1RGLA

Rnase t1 mutant glu46gln binds the inhibitors 2'gmp and 2'amp at the 3' subsite
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYQGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title RNase T1 mutant Glu46Gln binds the inhibitors 2'GMP and 2'AMP at the 3' subsite.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rglA00
1BRIA 1GMRA 1I0XA 1LRAA 1RGGA 2F56A 1B27A 1GMQA 1RGFA 1BGSA 3HOHA 1B2UA 1SARA 1GOVA 5HOHA 1B2XA 1PY3A 1YGWA 2RBIA 1YNVX 1BAOA 1I3IA 3A5EA 7GSPA 2GSPA 1HZ1A 2KF3A 1GMPA 1UCIA 2BU4A 1BNSA 1RGKA 3AGNA 1RLSA 9RNTA 3DGYA 1FW7A 2KAAA 1I2FA 1B2SA 1B3SA 2F5MA 1BSBA 1BSCA 1Q9EA 5BIRA 1RNBA 1ZGXA 6RNTA 8RNTA 3BIRA 2KF5A 1A2PA 2KF4A 1GOYA 3D4AA 1X1WA 3AHSA 4RNTA 3Q3FA 1BIRA 1DE3A 1RGAA 4HAAA 4J5KA 1BRGA 1UCJA 1X1YA 1BSAA 1I8VA 1MGWA 1BOXA 1RGHA 1BRKA 1BNJA 1BNIA 1R4YA 1FYSA 1RTUA 1RMSA 2HOHA 3SYUA 1B20A 1I3FA 4J5GA 6GSPA 1GSPA 7RNTA 3RNTA 1AY7A 3WR2A 1T2IA 2BIRA 3DH2A 1MGRA 1RGCA 1BNGA 1HYFA 1IYYA 1AQZA 1TRQA 1B2MA 1RGEA 4GSPA 3AHWA 3WHOA 1FUSA 1JBTA 1BRNL 2F5WA 5RNTA 2SARA 2KF6A 1RCLA 1RN1A 3KCHA 3D5GA 1BSDA 2C4BA 3D5IA 1UCKA 2AADA 1G02A 1FZUA 1RN4A 1TTOA 1DETA 4HOHA 1PYLA 2RNTA 3GSPA 1C54A 2F4YA 1RSNA 1BSEA 1LNIA 1BRHA 1CH0A 1BUJA 1BRJA 1RGLA 1BNEA 3AGOA 1LOWA 1T2HA 1I70A 5BU4A 3URPA 1RCKA 5GSPA 1B2ZA 1I0VA 1YVSA 4BIRA 1BNFA 1UCLA 4GHOA 1JBSA 1RHLA 1LOYA 2ZA4A 1I2EA 1GOUA 1BRSA 1X1UA 1RDSA 1X1XA 1JBRA 1TRPA 3BU4A 4BU4A 1FUTA 1BNRA 1BANA 1BU4A 1I2GA 1BVIA 1LOVA 2AAEA 1RNTA 1B21A
chains in the Genus database with same CATH superfamily
3KSED 2FGTA 1BUQA 4ORLA 1JB2A 4XBXA 1Q40B 4HZBB 1LOXA 2QGUA 3RGRA 1J2BA 3MG3A 2BMRB 1BGSA 3HOHA 8CHOA 1B2UA 5FW5A 5IW9A 1YI23 1B2XA 4STDA 2RBIA 3KN4A 4O3VA 2ZDJA 1IVXA 2GSPA 4OK0A 1JZOA 4R80A 2BU4A 2GU3A 3DGYA 5BXQA 3EE1A 2W6JH 1RGKA 3EX9A 4J9AA 3B4PA 4WYKB 2KAAA 1TUHA 1UDII 1W6GA 3CPOA 1WNHA 3OWYA 1TJDA 1NDOB 4FMDA 4EXRA 3B4OA 3V92A 3NHXA 5EVHA 1M1K4 5A0OB 3LT9A 1G96A 3OWSA 1RNBA 1SJWA 1ZGXA 6RNTA 4EV5A 3BIRA 3NXJA 2E2TA 3GZRA 2RCDA 2KF4A 4NPBA 3D4AA 3TDGA 1US1A 2I9WA 2XF3A 3AHSA 3CMA3 1BIRA 3KSPA 3MPHA 1N5HA 1QVG2 1CYUA 2IYJA 1BRGA 4GL6A 3GZXB 4EC6A 5KP4A 3LYGA 1AV4A 1BRKA 2GXFA 3A76A 4MMZB 1UUVB 2XFTA 1FYSA 4LMIA 4AKZA 5AEWB 3BNEA 6GSPA 3KFQC 7RNTA 3SEDA 1MWUA 4N6OB 2HMMB 3FG1A 3OV4A 3J7Yd 2W56B 1UUGB 4QWTA 1T2IA 4XBTA 1MGRA 3LXUX 3CPW2 1VQ63 3EQQB 1BNGA 1GS3A 1N5PA 1LQMB 2QIYA 1IYYA 3WODG 1TRQA 3DGMA 4HZ9B 4J8TA 1B2MA 5ELUA 4GSPA 1WMOA 3HI7A 3RDEA 3WHOA 1K28A 1EA2A 1FGMA 1FUSA 3FF0A 3QK9A 5AYRB 4XB5A 2D42A 1RN7A 3JUQA 4O2HA 1QAFA 1ULIB 2IUKA 4HM8B 3NUVA 1OHOA 3DGNA 4X2HA 1FGRA 5D81A 3S28A 2CFLA 6STDA 3KCHA 3N8BA 3WMDA 3GZBA 1Q814 1IK3A 3G713 3NBRA 3GRDA 2OTL3 4FR9A 1ROAA 2BHMA 1V58A 2ML5A 1G02A 1FZUA 1VQK3 1DETA 1PYLA 2RNTA 2LQVA 3PCRA 4O8SA 4DKIA 1E3RA 4RBNA 3BNCA 1O7HB 1OPYA 1ASKA 1IDPA 3LTCA 1IVVA 1FGTA 3AGOA 1T2HA 1KD14 5BU4A 1W6CA 1ROVA 2WGOA 4PEJA 1I0VA 4EW5A 2J8XB 4HM2B 3U97A 4GHOA 3U1WA 1Q864 1LOYA 1GOUA 1BRSA 1LXEA 1OF5B 4RNYA 1K734 1EG9B 1X1UA 1MWRA 3M8CA 2GEYA 3EBYA 3H3HA 2F98A 1X1XA 2XH9A 2XGLA 3OX9A 4WFOA 1CEWI 1FUTA 5JBSA 1BNRA 1BANA 1BVIA 3V98A 5LC7A 1NJI4 4O02B 1TU5A 3MG2A 3PXMA 5M19A 1VQ73 1B21A 1A90A 2KRTA 3CCL3 1BRIA 1RGGA 1I0XA 1LRAA 4N6MA 1YJW3 1KQS2 1K9M4 1SIHA 4WHAA 5CF1A 5IG4A 1RGFA 3KE7A 1RRLA 1W6YA 1HU9A 3ZG0A 1WMNA 2YFJB 1CYVA 3L0RA 4K61A 4R9KA 2C10A 1ZO2A 3S5CA 3MYTA 2W0QA 4K90B 3WOEB 1LVNA 1RJOA 7GSPA 1S5AA 1UCIA 4MJDA 3O8YA 5AEUB 2P05A 2W9QA 5CXOA 3NBBA 3AGNA 1RLSA 3NX0A 1FW7A 2Q07A 3DGOA 5LC6A 2OOVA 2CFWA 1B3SA 3KZTA 3DM8A 3CD63 4CPKA 1BSBA 2SBLA 1Q9EA 5BIRA 1DYUA 2KF5A 2IUJA 1HKXA 1L5GB 1GOYA 2B1XB 1AR0A 1W2ZA 1X1WA 3UL5A 2ZHXB 3SLUA 1Q7Y4 1IV9A 4HAAA 1UUWB 4J5KA 4LZIA 2CWVA 2W04A 3S29A 2H0HA 1N8QA 1BSAA 1IQXA 3FGYA 1U8CB 4G1MB 3ZFZA 2OCTA 1IT7A 1BOXA 3OWUA 4HBRA 2OQEA 3G6E3 1NB3I 4BTWA 4BTXA 3SYUA 1TFKA 3NV0A 1B20A 1WTHA 3CNMA 1O7NB 1YJ93 3B7CA 4K1VA 1VQN3 3ALAA 1MWSA 4WWUC 1HYFA 5IEOA 1CQSA 2BNGA 2L4VA 5AIFA 2XSOB 4KFFA 1QALA 3K9MC 3WDGB 3V99A 3AHWA 2R41A 3EJVA 4OVMA 1LNHA 3X40A 4R1KA 1JB5A 1OF5A 4N6V0 4R4KA 1BRNL 2CG0A 2E2UA 1N9JA 1O7PB 1PFPA 2CH9A 2HMJB 3EB8A 1RCLA 3X3XA 3B8LA 3K7CA 5CK6A 3T0UA 1ZS7A 1JKGB 1BSDA 3EBTA 3F7SA 1GY6A 1D6ZA 1VQQA 1W4NA 4FCMA 1W01A 3PZWA 2AADA 4LYLB 4N6NB 4BL3A 1YIJ3 2UX0A 1RN4A 4HOHA 2F4YA 1BSEA 3AMOB 5IENA 5IF6A 1K41A 4KFDA 4FCJA 2PNCA 3F9SA 4X2OA 1BRJA 1RGLA 1STDA 3CNXA 3D79A 4ILFA 2QA43 4CCVA 2C11A 1LOWA 3GWRA 3IPTA 1O7GB 3URPA 2CHCA 2ML6A 3QRDA 2WOFA 4EBGA 2CX1A 3LZAA 1S723 1IVUA 4BIRA 1BNFA 1Q42A 1YGEA 2BO9B 1I2EA 2INXA 2RSXA 2MF7A 3VGNA 2QEX3 3FKAA 4JF8A 4AEQA 1TRPA 4BU4A 4N6LA 3PGBA 4FMBA 2H0GA 3F7XA 1OCVA 1LOVA 5IERA 1Q40A 1IQYA 5D83A 4L7KA 5I97A 1GMRA 5M1AA 5IG0A 4LEHA 1B27A 3DUKA 2STDA 1YJN3 1T5YA 1ZX2A 2D1WA 1GMQA 4HM4B 1G0TA 1OUNA 3WOFB 1FGQA 2V1LA 1FUWA 1SARA 3I0YA 5HOHA 1NU3A 2F86B 2FXTA 4HM0B 3CCR3 2O3OA 1VZZA 2W2CA 5TGNA 1BAOA 1I3IA 2A15A 3A5EA 3ER7A 4N3VA 4XBYA 4WYKA 1HZ1A 2Z77A 3HK4A 5DRVA 4XM4A 4LSOA 2WGQA 3LH4A 2JQ5A 5BVBA 2XRXB 4WP5A 3K63A 2OWPA 3EN8A 1GYBA 1O7MB 1O7WB 2H0IA 1QMAA 2K0MA 1JNQA 1E97A 1I2FA 2XFSA 1B2SA 1M9GA 4HJLB 1DMQA 2JDIH 2CK3H 1UW1A 2F5MA 3X41A 1BSCA 5ELJA 3F8XA 1JN5B 1YHQ3 1IT8A 3D3LA 2HMKB 4HM5B 1KWIA 5IG3A 3MKIA 1OHPA 4N6TA 3Q3FA 1VQ93 5G1LA 1NB5I 3LTAA 2HMNB 4R9LA 1UCJA 1X1YA 1IVWA 1SQWA 3KKGA 5IG5A 1MGWA 2KXGA 1VQ43 1BNJA 1BNIA 1NO3A 1R4YA 1RTUA 2BT3A 1RMSA 2W56A 3AMOA 3JUMA 4XDVA 5AI1A 5IEPA 1GSPA 3RNTA 3F14A 4HM3B 3CCQ3 4TX4A 2XR8B 1D6UA 1GY5A 1KSIA 2XEPA 2HMOB 1STFI 1WQLB 3BNDA 3MG1A 3NM7A 5HGRA 4CDLA 2OOVC 3EHCA 1AQZA 2BMQB 1RGEA 1TIJA 5G1KA 2P0XA 2FNQA 1A2KA 1JBTA 1DMNA 3UJMA 2R4IA 1D6YA 2SARA 3KIIA 2KF6A 1RRHA 5STDA 3CCE3 2GEXA 3UL6A 1C7HA 1AVLA 1Y4KA 1W7CA 2C4BA 3F40A 3FF2A 1NNVA 3GZYB 3JUOA 4HKVB 4LGQA 1LQGC 5AIIA 4FMAA 4ZM8A 2OQEC 2UUGC 1TTOA 3CCS3 2YFIB 2O9UX 3GSPA 3PCSA 1C54A 3JVCA 1UGHI 2RGQA 4JRFA 1CH0A 1JRQA 1UI8A 5CF2A 1BUJA 3CCJ3 3EN1B 5CLKA 1SIIA 1BNEA 1T3BA 3FZWA 3G0KA 2GBWB 3MSOA 1QVF2 1UI7A 3EF8A 1EEJA 1Q824 1GD3A 2CFGA 3UB1A 4MMXB 2UGIA 1N8R4 3G4S3 2W9PA 1YVSA 3Q90A 3T8NA 3FLJA 1V57A 4AKYA 1JBSA 4MMYB 3E99A 1RHLA 3PYJA 2CIUA 4GB5A 5AIGA 1GD4A 4HM1B 3WA3A 3S27A 1KC84 3CCV3 1EUIC 3CU3A 1OGXA 1JBRA 2CFKA 2CG1A 4RNZA 1JN5A 3DGLA 2P0MA 1I2GA 4IT7A 2AAEA 2M7OA 3FG4A 4L8OA 3RGAA 3ECFA 3IMAB 2F56A 1VQ53 3OXAA 3MWZA 2MC8A 3FSDA 3G8ZA 5JPUA 3DMCA 3WA2X 3DZLA 1EQKA 2HMLB 2XSHB 1VQO3 4RZMA 5JPPA 3FH1A 1JB4A 1GOVA 2OTJ3 3NQYA 3LOYA 1PY3A 1YGWA 1A2VA 2P09A 3LMLA 3X42A 1YNVX 2PZVA 3VF1A 4XDWA 1VQP3 1R4CA 1U5OA 2GBXB 4NHFA 2KF3A 1VQM3 3BB9A 1GMPA 3SXXA 3HX8A 3MHEA 1BNSA 3FCSB 1DMMA 9RNTA 1ULJB 2Y73A 2Z7AA 3X3YA 3D9RA 2B24B 4H3UA 4N6UA 1FGOA 1A67A 1OGZA 1TFOA 2K3DA 3GAXA 5EEOA 1Q7HA 3S67A 3CCU3 2XGNA 2LYXA 2W03A 1MNLA 4KVHA 8RNTA 5KP1A 1W2B2 1A2PA 3SOAA 3I563 3F8HA 1SPUA 1IV7A 1W5ZA 5KP3A 3SVAA 4RNTA 1DE3A 1DVDA 2KCDA 7STDA 2IY2A 2ZL8A 4HYZA 4I5QA 3CC73 1RGAA 4EYCA 1N9EA 4KT3B 3JUNA 4FMCA 3UNLA 4FCZA 1I8VA 1MOLA 1RGHA 2RFRA 3SOYA 1M904 1DVCA 1QJGA 1V74A 2HOHA 1MWTA 2P38A 2Y74A 3HZPA 3NBJA 1I3FA 4J5GA 1VQL3 4IPBA 2CKFB 1AY7A 3HIGA 1EKMA 3WR2A 4IIAA 5EQLA 3CC43 1ISKA 2BIRA 3DH2A 3NV0B 4NREA 3NQZA 1RGCA 4KFEA 4HVNA 1W02A 3EC9A 1K8A4 3T8UA 3PS8A 2CWTA 5FGOA 2WOHA 3OW22 2L1SA 3ZG5A 5AIHA 2F99A 1RKYA 1QAKA 4BTYA 1FA3A 1OACA 1OH0A 2F5WA 1JKGA 2IA7A 2E2VA 5D82A 5RNTA 3VSYA 1IQ8A 1RN1A 1IU7A 3D5GA 1VQ83 3LTDA 3D5IA 3CCM3 1UCKA 2K54A 3ROBA 2BMOB 1Z1SA 2IMJA 1WMPA 3BLZA 1RSNA 1LNIA 1BRHA 3I553 2CFDA 4OUQA 3NM2A 3SX1A 5M18A 1JV2B 1GY7A 5DREA 4L8PA 3IJEB 2GU1A 3K5TA 3K0ZA 4CJNA 2YFLB 4Q53A 3CME3 2CW9A 3X3ZA 1I70A 4EV2A 1TP6A 1JJ22 3FG3A 1JZDA 1RCKA 1UGIA 5AYSC 5GSPA 4BL2A 3STDA 4MEIA 3Q1CA 4H61A 3LTBA 1B2ZA 3CC23 4HM7B 4KZ1A 1UCLA 2CX0A 1YIT3 3N54B 2ZA4A 3G16A 3H51A 1E3VA 1AVKA 3N9HA 2CWUA 3LT8A 1F8NA 4K1UA 1RDSA 3HIIA 4HM6B 3BU4A 1W00A 1M1XB 1BU4A 2Z76A 3DY5A 3JUPA 1YVBI 3CXC2 3BNBA 4I4KA 1PU4A 4U13A 1NWWA 1OHSA 2CC3A 1RNTA 2YX9A 2Z6BA 3DXOA 3Q2PA 5G2GA 2WO0A
chains in the Genus database with same CATH topology
1BRIA 1GMRA 1I0XA 1LRAA 1RGGA 2F56A 1B27A 1GMQA 1RGFA 1BGSA 3HOHA 1B2UA 1SARA 1GOVA 5HOHA 1B2XA 1PY3A 1YGWA 2RBIA 1YNVX 1BAOA 1I3IA 3A5EA 7GSPA 2GSPA 1HZ1A 2KF3A 1GMPA 1UCIA 2BU4A 1BNSA 1RGKA 3AGNA 1RLSA 9RNTA 3DGYA 1FW7A 2KAAA 1I2FA 1B2SA 1B3SA 2F5MA 1BSBA 1BSCA 1Q9EA 5BIRA 1RNBA 1ZGXA 6RNTA 8RNTA 3BIRA 2KF5A 1A2PA 2KF4A 1GOYA 3D4AA 1X1WA 3AHSA 4RNTA 3Q3FA 1BIRA 1DE3A 1RGAA 4HAAA 4J5KA 1BRGA 1UCJA 1X1YA 1BSAA 1I8VA 1MGWA 1BOXA 1RGHA 1BRKA 1BNJA 1BNIA 1R4YA 1FYSA 1RTUA 1RMSA 2HOHA 3SYUA 1B20A 1I3FA 4J5GA 6GSPA 1GSPA 7RNTA 3RNTA 1AY7A 3WR2A 1T2IA 2BIRA 3DH2A 1MGRA 1RGCA 1BNGA 1HYFA 1IYYA 1AQZA 1TRQA 1B2MA 1RGEA 4GSPA 3AHWA 3WHOA 1FUSA 1JBTA 1BRNL 2F5WA 5RNTA 2SARA 2KF6A 1RCLA 1RN1A 3KCHA 3D5GA 1BSDA 2C4BA 3D5IA 1UCKA 2AADA 1G02A 1FZUA 1RN4A 1TTOA 1DETA 4HOHA 1PYLA 2RNTA 3GSPA 1C54A 2F4YA 1RSNA 1BSEA 1LNIA 1BRHA 1CH0A 1BUJA 1BRJA 1RGLA 1BNEA 3AGOA 1LOWA 1T2HA 1I70A 5BU4A 3URPA 1RCKA 5GSPA 1B2ZA 1I0VA 1YVSA 4BIRA 1BNFA 1UCLA 4GHOA 1JBSA 1RHLA 1LOYA 2ZA4A 1I2EA 1GOUA 1BRSA 1X1UA 1RDSA 1X1XA 1JBRA 1TRPA 3BU4A 4BU4A 1FUTA 1BNRA 1BANA 1BU4A 1I2GA 1BVIA 1LOVA 2AAEA 1RNTA 1B21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRI A;  1GMR A;  1I0X A;  1LRA A;  1RGG A;  2F56 A;  1B27 A;  1GMQ A;  1RGF A;  1BGS A;  3HOH A;  1B2U A;  1SAR A;  1GOV A;  5HOH A;  1B2X A;  1PY3 A;  1YGW A;  2RBI A;  1YNV X;  1BAO A;  1I3I A;  3A5E A;  7GSP A;  2GSP A;  1HZ1 A;  2KF3 A;  1GMP A;  1UCI A;  2BU4 A;  1BNS A;  1RGK A;  3AGN A;  1RLS A;  9RNT A;  3DGY A;  1FW7 A;  2KAA A;  1I2F A;  1B2S A;  1B3S A;  2F5M A;  1BSB A;  1BSC A;  1Q9E A;  5BIR A;  1RNB A;  1ZGX A;  6RNT A;  8RNT A;  3BIR A;  2KF5 A;  1A2P A;  2KF4 A;  1GOY A;  3D4A A;  1X1W A;  3AHS A;  4RNT A;  3Q3F A;  1BIR A;  1DE3 A;  1RGA A;  4HAA A;  4J5K A;  1BRG A;  1UCJ A;  1X1Y A;  1BSA A;  1I8V A;  1MGW A;  1BOX A;  1RGH A;  1BRK A;  1BNJ A;  1BNI A;  1R4Y A;  1FYS A;  1RTU A;  1RMS A;  2HOH A;  3SYU A;  1B20 A;  1I3F A;  4J5G A;  6GSP A;  1GSP A;  7RNT A;  3RNT A;  1AY7 A;  3WR2 A;  1T2I A;  2BIR A;  3DH2 A;  1MGR A;  1RGC A;  1BNG A;  1HYF A;  1IYY A;  1AQZ A;  1TRQ A;  1B2M A;  1RGE A;  4GSP A;  3AHW A;  3WHO A;  1FUS A;  1JBT A;  1BRN L;  2F5W A;  5RNT A;  2SAR A;  2KF6 A;  1RCL A;  1RN1 A;  3KCH A;  3D5G A;  1BSD A;  2C4B A;  3D5I A;  1UCK A;  2AAD A;  1G02 A;  1FZU A;  1RN4 A;  1TTO A;  1DET A;  4HOH A;  1PYL A;  2RNT A;  3GSP A;  1C54 A;  2F4Y A;  1RSN A;  1BSE A;  1LNI A;  1BRH A;  1CH0 A;  1BUJ A;  1BRJ A;  1RGL A;  1BNE A;  3AGO A;  1LOW A;  1T2H A;  1I70 A;  5BU4 A;  3URP A;  1RCK A;  5GSP A;  1B2Z A;  1I0V A;  1YVS A;  4BIR A;  1BNF A;  1UCL A;  4GHO A;  1JBS A;  1RHL A;  1LOY A;  2ZA4 A;  1I2E A;  1GOU A;  1BRS A;  1X1U A;  1RDS A;  1X1X A;  1JBR A;  1TRP A;  3BU4 A;  4BU4 A;  1FUT A;  1BNR A;  1BAN A;  1BU4 A;  1I2G A;  1BVI A;  1LOV A;  2AAE A;  1RNT A;  1B21 A; 
#chains in the Genus database with same CATH topology
 3KSE D;  2FGT A;  1BUQ A;  4ORL A;  1JB2 A;  4XBX A;  1Q40 B;  4HZB B;  1LOX A;  2QGU A;  3RGR A;  1J2B A;  3MG3 A;  2BMR B;  1BGS A;  3HOH A;  8CHO A;  1B2U A;  5FW5 A;  5IW9 A;  1YI2 3;  1B2X A;  4STD A;  2RBI A;  3KN4 A;  4O3V A;  2ZDJ A;  1IVX A;  2GSP A;  4OK0 A;  1JZO A;  4R80 A;  2BU4 A;  2GU3 A;  3DGY A;  5BXQ A;  3EE1 A;  2W6J H;  1RGK A;  3EX9 A;  4J9A A;  3B4P A;  4WYK B;  2KAA A;  1TUH A;  1UDI I;  1W6G A;  3CPO A;  1WNH A;  3OWY A;  1TJD A;  1NDO B;  4FMD A;  4EXR A;  3B4O A;  3V92 A;  3NHX A;  5EVH A;  1M1K 4;  5A0O B;  3LT9 A;  1G96 A;  3OWS A;  1RNB A;  1SJW A;  1ZGX A;  6RNT A;  4EV5 A;  3BIR A;  3NXJ A;  2E2T A;  3GZR A;  2RCD A;  2KF4 A;  4NPB A;  3D4A A;  3TDG A;  1US1 A;  2I9W A;  2XF3 A;  3AHS A;  3CMA 3;  1BIR A;  3KSP A;  3MPH A;  1N5H A;  1QVG 2;  1CYU A;  2IYJ A;  1BRG A;  4GL6 A;  3GZX B;  4EC6 A;  5KP4 A;  3LYG A;  1AV4 A;  1BRK A;  2GXF A;  3A76 A;  4MMZ B;  1UUV B;  2XFT A;  1FYS A;  4LMI A;  4AKZ A;  5AEW B;  3BNE A;  6GSP A;  3KFQ C;  7RNT A;  3SED A;  1MWU A;  4N6O B;  2HMM B;  3FG1 A;  3OV4 A;  3J7Y d;  2W56 B;  1UUG B;  4QWT A;  1T2I A;  4XBT A;  1MGR A;  3LXU X;  3CPW 2;  1VQ6 3;  3EQQ B;  1BNG A;  1GS3 A;  1N5P A;  1LQM B;  2QIY A;  1IYY A;  3WOD G;  1TRQ A;  3DGM A;  4HZ9 B;  4J8T A;  1B2M A;  5ELU A;  4GSP A;  1WMO A;  3HI7 A;  3RDE A;  3WHO A;  1K28 A;  1EA2 A;  1FGM A;  1FUS A;  3FF0 A;  3QK9 A;  5AYR B;  4XB5 A;  2D42 A;  1RN7 A;  3JUQ A;  4O2H A;  1QAF A;  1ULI B;  2IUK A;  4HM8 B;  3NUV A;  1OHO A;  3DGN A;  4X2H A;  1FGR A;  5D81 A;  3S28 A;  2CFL A;  6STD A;  3KCH A;  3N8B A;  3WMD A;  3GZB A;  1Q81 4;  1IK3 A;  3G71 3;  3NBR A;  3GRD A;  2OTL 3;  4FR9 A;  1ROA A;  2BHM A;  1V58 A;  2ML5 A;  1G02 A;  1FZU A;  1VQK 3;  1DET A;  1PYL A;  2RNT A;  2LQV A;  3PCR A;  4O8S A;  4DKI A;  1E3R A;  4RBN A;  3BNC A;  1O7H B;  1OPY A;  1ASK A;  1IDP A;  3LTC A;  1IVV A;  1FGT A;  3AGO A;  1T2H A;  1KD1 4;  5BU4 A;  1W6C A;  1ROV A;  2WGO A;  4PEJ A;  1I0V A;  4EW5 A;  2J8X B;  4HM2 B;  3U97 A;  4GHO A;  3U1W A;  1Q86 4;  1LOY A;  1GOU A;  1BRS A;  1LXE A;  1OF5 B;  4RNY A;  1K73 4;  1EG9 B;  1X1U A;  1MWR A;  3M8C A;  2GEY A;  3EBY A;  3H3H A;  2F98 A;  1X1X A;  2XH9 A;  2XGL A;  3OX9 A;  4WFO A;  1CEW I;  1FUT A;  5JBS A;  1BNR A;  1BAN A;  1BVI A;  3V98 A;  5LC7 A;  1NJI 4;  4O02 B;  1TU5 A;  3MG2 A;  3PXM A;  5M19 A;  1VQ7 3;  1B21 A;  1A90 A;  2KRT A;  3CCL 3;  1BRI A;  1RGG A;  1I0X A;  1LRA A;  4N6M A;  1YJW 3;  1KQS 2;  1K9M 4;  1SIH A;  4WHA A;  5CF1 A;  5IG4 A;  1RGF A;  3KE7 A;  1RRL A;  1W6Y A;  1HU9 A;  3ZG0 A;  1WMN A;  2YFJ B;  1CYV A;  3L0R A;  4K61 A;  4R9K A;  2C10 A;  1ZO2 A;  3S5C A;  3MYT A;  2W0Q A;  4K90 B;  3WOE B;  1LVN A;  1RJO A;  7GSP A;  1S5A A;  1UCI A;  4MJD A;  3O8Y A;  5AEU B;  2P05 A;  2W9Q A;  5CXO A;  3NBB A;  3AGN A;  1RLS A;  3NX0 A;  1FW7 A;  2Q07 A;  3DGO A;  5LC6 A;  2OOV A;  2CFW A;  1B3S A;  3KZT A;  3DM8 A;  3CD6 3;  4CPK A;  1BSB A;  2SBL A;  1Q9E A;  5BIR A;  1DYU A;  2KF5 A;  2IUJ A;  1HKX A;  1L5G B;  1GOY A;  2B1X B;  1AR0 A;  1W2Z A;  1X1W A;  3UL5 A;  2ZHX B;  3SLU A;  1Q7Y 4;  1IV9 A;  4HAA A;  1UUW B;  4J5K A;  4LZI A;  2CWV A;  2W04 A;  3S29 A;  2H0H A;  1N8Q A;  1BSA A;  1IQX A;  3FGY A;  1U8C B;  4G1M B;  3ZFZ A;  2OCT A;  1IT7 A;  1BOX A;  3OWU A;  4HBR A;  2OQE A;  3G6E 3;  1NB3 I;  4BTW A;  4BTX A;  3SYU A;  1TFK A;  3NV0 A;  1B20 A;  1WTH A;  3CNM A;  1O7N B;  1YJ9 3;  3B7C A;  4K1V A;  1VQN 3;  3ALA A;  1MWS A;  4WWU C;  1HYF A;  5IEO A;  1CQS A;  2BNG A;  2L4V A;  5AIF A;  2XSO B;  4KFF A;  1QAL A;  3K9M C;  3WDG B;  3V99 A;  3AHW A;  2R41 A;  3EJV A;  4OVM A;  1LNH A;  3X40 A;  4R1K A;  1JB5 A;  1OF5 A;  4N6V 0;  4R4K A;  1BRN L;  2CG0 A;  2E2U A;  1N9J A;  1O7P B;  1PFP A;  2CH9 A;  2HMJ B;  3EB8 A;  1RCL A;  3X3X A;  3B8L A;  3K7C A;  5CK6 A;  3T0U A;  1ZS7 A;  1JKG B;  1BSD A;  3EBT A;  3F7S A;  1GY6 A;  1D6Z A;  1VQQ A;  1W4N A;  4FCM A;  1W01 A;  3PZW A;  2AAD A;  4LYL B;  4N6N B;  4BL3 A;  1YIJ 3;  2UX0 A;  1RN4 A;  4HOH A;  2F4Y A;  1BSE A;  3AMO B;  5IEN A;  5IF6 A;  1K41 A;  4KFD A;  4FCJ A;  2PNC A;  3F9S A;  4X2O A;  1BRJ A;  1RGL A;  1STD A;  3CNX A;  3D79 A;  4ILF A;  2QA4 3;  4CCV A;  2C11 A;  1LOW A;  3GWR A;  3IPT A;  1O7G B;  3URP A;  2CHC A;  2ML6 A;  3QRD A;  2WOF A;  4EBG A;  2CX1 A;  3LZA A;  1S72 3;  1IVU A;  4BIR A;  1BNF A;  1Q42 A;  1YGE A;  2BO9 B;  1I2E A;  2INX A;  2RSX A;  2MF7 A;  3VGN A;  2QEX 3;  3FKA A;  4JF8 A;  4AEQ A;  1TRP A;  4BU4 A;  4N6L A;  3PGB A;  4FMB A;  2H0G A;  3F7X A;  1OCV A;  1LOV A;  5IER A;  1Q40 A;  1IQY A;  5D83 A;  4L7K A;  5I97 A;  1GMR A;  5M1A A;  5IG0 A;  4LEH A;  1B27 A;  3DUK A;  2STD A;  1YJN 3;  1T5Y A;  1ZX2 A;  2D1W A;  1GMQ A;  4HM4 B;  1G0T A;  1OUN A;  3WOF B;  1FGQ A;  2V1L A;  1FUW A;  1SAR A;  3I0Y A;  5HOH A;  1NU3 A;  2F86 B;  2FXT A;  4HM0 B;  3CCR 3;  2O3O A;  1VZZ A;  2W2C A;  5TGN A;  1BAO A;  1I3I A;  2A15 A;  3A5E A;  3ER7 A;  4N3V A;  4XBY A;  4WYK A;  1HZ1 A;  2Z77 A;  3HK4 A;  5DRV A;  4XM4 A;  4LSO A;  2WGQ A;  3LH4 A;  2JQ5 A;  5BVB A;  2XRX B;  4WP5 A;  3K63 A;  2OWP A;  3EN8 A;  1GYB A;  1O7M B;  1O7W B;  2H0I A;  1QMA A;  2K0M A;  1JNQ A;  1E97 A;  1I2F A;  2XFS A;  1B2S A;  1M9G A;  4HJL B;  1DMQ A;  2JDI H;  2CK3 H;  1UW1 A;  2F5M A;  3X41 A;  1BSC A;  5ELJ A;  3F8X A;  1JN5 B;  1YHQ 3;  1IT8 A;  3D3L A;  2HMK B;  4HM5 B;  1KWI A;  5IG3 A;  3MKI A;  1OHP A;  4N6T A;  3Q3F A;  1VQ9 3;  5G1L A;  1NB5 I;  3LTA A;  2HMN B;  4R9L A;  1UCJ A;  1X1Y A;  1IVW A;  1SQW A;  3KKG A;  5IG5 A;  1MGW A;  2KXG A;  1VQ4 3;  1BNJ A;  1BNI A;  1NO3 A;  1R4Y A;  1RTU A;  2BT3 A;  1RMS A;  2W56 A;  3AMO A;  3JUM A;  4XDV A;  5AI1 A;  5IEP A;  1GSP A;  3RNT A;  3F14 A;  4HM3 B;  3CCQ 3;  4TX4 A;  2XR8 B;  1D6U A;  1GY5 A;  1KSI A;  2XEP A;  2HMO B;  1STF I;  1WQL B;  3BND A;  3MG1 A;  3NM7 A;  5HGR A;  4CDL A;  2OOV C;  3EHC A;  1AQZ A;  2BMQ B;  1RGE A;  1TIJ A;  5G1K A;  2P0X A;  2FNQ A;  1A2K A;  1JBT A;  1DMN A;  3UJM A;  2R4I A;  1D6Y A;  2SAR A;  3KII A;  2KF6 A;  1RRH A;  5STD A;  3CCE 3;  2GEX A;  3UL6 A;  1C7H A;  1AVL A;  1Y4K A;  1W7C A;  2C4B A;  3F40 A;  3FF2 A;  1NNV A;  3GZY B;  3JUO A;  4HKV B;  4LGQ A;  1LQG C;  5AII A;  4FMA A;  4ZM8 A;  2OQE C;  2UUG C;  1TTO A;  3CCS 3;  2YFI B;  2O9U X;  3GSP A;  3PCS A;  1C54 A;  3JVC A;  1UGH I;  2RGQ A;  4JRF A;  1CH0 A;  1JRQ A;  1UI8 A;  5CF2 A;  1BUJ A;  3CCJ 3;  3EN1 B;  5CLK A;  1SII A;  1BNE A;  1T3B A;  3FZW A;  3G0K A;  2GBW B;  3MSO A;  1QVF 2;  1UI7 A;  3EF8 A;  1EEJ A;  1Q82 4;  1GD3 A;  2CFG A;  3UB1 A;  4MMX B;  2UGI A;  1N8R 4;  3G4S 3;  2W9P A;  1YVS A;  3Q90 A;  3T8N A;  3FLJ A;  1V57 A;  4AKY A;  1JBS A;  4MMY B;  3E99 A;  1RHL A;  3PYJ A;  2CIU A;  4GB5 A;  5AIG A;  1GD4 A;  4HM1 B;  3WA3 A;  3S27 A;  1KC8 4;  3CCV 3;  1EUI C;  3CU3 A;  1OGX A;  1JBR A;  2CFK A;  2CG1 A;  4RNZ A;  1JN5 A;  3DGL A;  2P0M A;  1I2G A;  4IT7 A;  2AAE A;  2M7O A;  3FG4 A;  4L8O A;  3RGA A;  3ECF A;  3IMA B;  2F56 A;  1VQ5 3;  3OXA A;  3MWZ A;  2MC8 A;  3FSD A;  3G8Z A;  5JPU A;  3DMC A;  3WA2 X;  3DZL A;  1EQK A;  2HML B;  2XSH B;  1VQO 3;  4RZM A;  5JPP A;  3FH1 A;  1JB4 A;  1GOV A;  2OTJ 3;  3NQY A;  3LOY A;  1PY3 A;  1YGW A;  1A2V A;  2P09 A;  3LML A;  3X42 A;  1YNV X;  2PZV A;  3VF1 A;  4XDW A;  1VQP 3;  1R4C A;  1U5O A;  2GBX B;  4NHF A;  2KF3 A;  1VQM 3;  3BB9 A;  1GMP A;  3SXX A;  3HX8 A;  3MHE A;  1BNS A;  3FCS B;  1DMM A;  9RNT A;  1ULJ B;  2Y73 A;  2Z7A A;  3X3Y A;  3D9R A;  2B24 B;  4H3U A;  4N6U A;  1FGO A;  1A67 A;  1OGZ A;  1TFO A;  2K3D A;  3GAX A;  5EEO A;  1Q7H A;  3S67 A;  3CCU 3;  2XGN A;  2LYX A;  2W03 A;  1MNL A;  4KVH A;  8RNT A;  5KP1 A;  1W2B 2;  1A2P A;  3SOA A;  3I56 3;  3F8H A;  1SPU A;  1IV7 A;  1W5Z A;  5KP3 A;  3SVA A;  4RNT A;  1DE3 A;  1DVD A;  2KCD A;  7STD A;  2IY2 A;  2ZL8 A;  4HYZ A;  4I5Q A;  3CC7 3;  1RGA A;  4EYC A;  1N9E A;  4KT3 B;  3JUN A;  4FMC A;  3UNL A;  4FCZ A;  1I8V A;  1MOL A;  1RGH A;  2RFR A;  3SOY A;  1M90 4;  1DVC A;  1QJG A;  1V74 A;  2HOH A;  1MWT A;  2P38 A;  2Y74 A;  3HZP A;  3NBJ A;  1I3F A;  4J5G A;  1VQL 3;  4IPB A;  2CKF B;  1AY7 A;  3HIG A;  1EKM A;  3WR2 A;  4IIA A;  5EQL A;  3CC4 3;  1ISK A;  2BIR A;  3DH2 A;  3NV0 B;  4NRE A;  3NQZ A;  1RGC A;  4KFE A;  4HVN A;  1W02 A;  3EC9 A;  1K8A 4;  3T8U A;  3PS8 A;  2CWT A;  5FGO A;  2WOH A;  3OW2 2;  2L1S A;  3ZG5 A;  5AIH A;  2F99 A;  1RKY A;  1QAK A;  4BTY A;  1FA3 A;  1OAC A;  1OH0 A;  2F5W A;  1JKG A;  2IA7 A;  2E2V A;  5D82 A;  5RNT A;  3VSY A;  1IQ8 A;  1RN1 A;  1IU7 A;  3D5G A;  1VQ8 3;  3LTD A;  3D5I A;  3CCM 3;  1UCK A;  2K54 A;  3ROB A;  2BMO B;  1Z1S A;  2IMJ A;  1WMP A;  3BLZ A;  1RSN A;  1LNI A;  1BRH A;  3I55 3;  2CFD A;  4OUQ A;  3NM2 A;  3SX1 A;  5M18 A;  1JV2 B;  1GY7 A;  5DRE A;  4L8P A;  3IJE B;  2GU1 A;  3K5T A;  3K0Z A;  4CJN A;  2YFL B;  4Q53 A;  3CME 3;  2CW9 A;  3X3Z A;  1I70 A;  4EV2 A;  1TP6 A;  1JJ2 2;  3FG3 A;  1JZD A;  1RCK A;  1UGI A;  5AYS C;  5GSP A;  4BL2 A;  3STD A;  4MEI A;  3Q1C A;  4H61 A;  3LTB A;  1B2Z A;  3CC2 3;  4HM7 B;  4KZ1 A;  1UCL A;  2CX0 A;  1YIT 3;  3N54 B;  2ZA4 A;  3G16 A;  3H51 A;  1E3V A;  1AVK A;  3N9H A;  2CWU A;  3LT8 A;  1F8N A;  4K1U A;  1RDS A;  3HII A;  4HM6 B;  3BU4 A;  1W00 A;  1M1X B;  1BU4 A;  2Z76 A;  3DY5 A;  3JUP A;  1YVB I;  3CXC 2;  3BNB A;  4I4K A;  1PU4 A;  4U13 A;  1NWW A;  1OHS A;  2CC3 A;  1RNT A;  2YX9 A;  2Z6B A;  3DXO A;  3Q2P A;  5G2G A;  2WO0 A; 
#chains in the Genus database with same CATH homology
 1BRI A;  1GMR A;  1I0X A;  1LRA A;  1RGG A;  2F56 A;  1B27 A;  1GMQ A;  1RGF A;  1BGS A;  3HOH A;  1B2U A;  1SAR A;  1GOV A;  5HOH A;  1B2X A;  1PY3 A;  1YGW A;  2RBI A;  1YNV X;  1BAO A;  1I3I A;  3A5E A;  7GSP A;  2GSP A;  1HZ1 A;  2KF3 A;  1GMP A;  1UCI A;  2BU4 A;  1BNS A;  1RGK A;  3AGN A;  1RLS A;  9RNT A;  3DGY A;  1FW7 A;  2KAA A;  1I2F A;  1B2S A;  1B3S A;  2F5M A;  1BSB A;  1BSC A;  1Q9E A;  5BIR A;  1RNB A;  1ZGX A;  6RNT A;  8RNT A;  3BIR A;  2KF5 A;  1A2P A;  2KF4 A;  1GOY A;  3D4A A;  1X1W A;  3AHS A;  4RNT A;  3Q3F A;  1BIR A;  1DE3 A;  1RGA A;  4HAA A;  4J5K A;  1BRG A;  1UCJ A;  1X1Y A;  1BSA A;  1I8V A;  1MGW A;  1BOX A;  1RGH A;  1BRK A;  1BNJ A;  1BNI A;  1R4Y A;  1FYS A;  1RTU A;  1RMS A;  2HOH A;  3SYU A;  1B20 A;  1I3F A;  4J5G A;  6GSP A;  1GSP A;  7RNT A;  3RNT A;  1AY7 A;  3WR2 A;  1T2I A;  2BIR A;  3DH2 A;  1MGR A;  1RGC A;  1BNG A;  1HYF A;  1IYY A;  1AQZ A;  1TRQ A;  1B2M A;  1RGE A;  4GSP A;  3AHW A;  3WHO A;  1FUS A;  1JBT A;  1BRN L;  2F5W A;  5RNT A;  2SAR A;  2KF6 A;  1RCL A;  1RN1 A;  3KCH A;  3D5G A;  1BSD A;  2C4B A;  3D5I A;  1UCK A;  2AAD A;  1G02 A;  1FZU A;  1RN4 A;  1TTO A;  1DET A;  4HOH A;  1PYL A;  2RNT A;  3GSP A;  1C54 A;  2F4Y A;  1RSN A;  1BSE A;  1LNI A;  1BRH A;  1CH0 A;  1BUJ A;  1BRJ A;  1RGL A;  1BNE A;  3AGO A;  1LOW A;  1T2H A;  1I70 A;  5BU4 A;  3URP A;  1RCK A;  5GSP A;  1B2Z A;  1I0V A;  1YVS A;  4BIR A;  1BNF A;  1UCL A;  4GHO A;  1JBS A;  1RHL A;  1LOY A;  2ZA4 A;  1I2E A;  1GOU A;  1BRS A;  1X1U A;  1RDS A;  1X1X A;  1JBR A;  1TRP A;  3BU4 A;  4BU4 A;  1FUT A;  1BNR A;  1BAN A;  1BU4 A;  1I2G A;  1BVI A;  1LOV A;  2AAE A;  1RNT A;  1B21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...