1RGLA

Rnase t1 mutant glu46gln binds the inhibitors 2'gmp and 2'amp at the 3' subsite
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYQGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title RNase T1 mutant Glu46Gln binds the inhibitors 2'GMP and 2'AMP at the 3' subsite.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rglA00
1RGCA 1BRJA 2BIRA 1JBRA 1X1UA 1YVSA 3KCHA 1B2UA 1T2IA 3Q3FA 3URPA 5BIRA 1BNJA 1RGGA 1BSBA 2HOHA 1UCIA 3BU4A 4J5KA 1I2GA 1MGWA 1B2XA 1GSPA 1BRGA 1B21A 1YGWA 2RNTA 1RNBA 1FUSA 2KAAA 1I2FA 1LNIA 1I8VA 6RNTA 1BU4A 1BSCA 1RGAA 1I70A 1AQZA 2F56A 2RBIA 1FW7A 1B2ZA 1LOWA 1RGHA 3D5GA 1IYYA 1SARA 1MGRA 1PY3A 6GSPA 1GOVA 1BOXA 4RNTA 7GSPA 1X1WA 1GOUA 1TTOA 3AGNA 1RSNA 1X1YA 3D4AA 1LRAA 2SARA 1RMSA 1BVIA 1I0VA 2AADA 1BNRA 3A5EA 1RCLA 1I0XA 1RCKA 3GSPA 1BUJA 1BSDA 1RLSA 1DETA 5BU4A 1BSEA 1BRIA 1RN4A 1B3SA 1GMRA 1RNTA 1GMQA 1Q9EA 4GSPA 7RNTA 1T2HA 1R4YA 1BNSA 4BU4A 4GHOA 1ZGXA 2BU4A 1RN1A 1CH0A 1FZUA 1RDSA 1GOYA 1BRNL 1I3FA 1YNVX 1I2EA 2KF6A 1B20A 1RTUA 1BNEA 1BGSA 1BANA 3AGOA 4HAAA 3WHOA 1JBSA 1BNFA 1GMPA 2F4YA 2KF3A 1FYSA 1TRPA 1G02A 1BRHA 1A2PA 5GSPA 5RNTA 1B2SA 4HOHA 1C54A 1TRQA 1B27A 1BRKA 2F5MA 1RGLA 3AHWA 1RHLA 1UCJA 1LOVA 2KF5A 1HYFA 1UCKA 1RGKA 3DH2A 3SYUA 3BIRA 2ZA4A 2GSPA 4J5GA 1BIRA 2F5WA 2AAEA 4BIRA 3AHSA 1RGFA 1BSAA 1FUTA 1AY7A 1BRSA 1BNGA 1LOYA 3RNTA 1BAOA 3WR2A 3D5IA 3HOHA 1PYLA 1BNIA 1HZ1A 3DGYA 9RNTA 1B2MA 5HOHA 1X1XA 2C4BA 8RNTA 2KF4A 1JBTA 1DE3A 1UCLA 1I3IA 1RGEA
chains in the Genus database with same CATH superfamily
1Q40B 1U5OA 2HMLB 2QGUA 4XB5A 2BIRA 4MJDA 2CC3A 1JBRA 1M904 1X1UA 1O7HB 3KCHA 1T2IA 3Q3FA 1E3VA 1BNJA 2D42A 1VQ63 1JB4A 1N5PA 2JDIH 1J2BA 4XBTA 3N9HA 1BSBA 3CC73 1NNVA 1GY5A 2E2TA 2GEXA 2HOHA 3OW22 4J5KA 1MGWA 1B2XA 1CEWI 4MMYB 1RJOA 1KC84 1O7MB 2XF3A 1TU5A 3CPW2 1W6GA 3L0RA 5CF1A 1UGHI 3EN1B 4I5QA 1K8A4 1SJWA 3S29A 4KVHA 1A90A 1SQWA 1YGEA 3GZBA 3CCM3 3Q1CA 4FCZA 6RNTA 4H61A 3SXXA 1LOXA 2BNGA 2W6JH 3BNCA 4HKVB 5DRVA 1RGAA 1ISKA 1YVBI 4KT3B 4N3VA 1B2ZA 2W03A 3AMOA 3NBBA 2P0XA 1O7PB 2W56A 2RCDA 2ML5A 2BHMA 3GAXA 4JF8A 1GOVA 1Z1SA 2GBXB 2CG0A 1ULIB 1GOUA 1IK3A 1X1YA 2OWPA 1LRAA 2SARA 3EE1A 4MMZB 1RMSA 1OGXA 2D1WA 1BVIA 1I0VA 1MWRA 1HKXA 1EQKA 2XSHB 3GSPA 3KZTA 2CG1A 4OVMA 5IEPA 1LQGC 5IG0A 1RLSA 1TIJA 4FR9A 3WOFB 3JUNA 3IPTA 5CK6A 2RFRA 3I553 1BSEA 3MYTA 4EV5A 3PCSA 1DYUA 1FGRA 1GMRA 3KKGA 5I97A 3G713 1AVLA 1C7HA 1JJ22 2BMRB 7RNTA 4RNZA 1T2HA 3GZRA 4JRFA 1R4YA 4BTXA 1GD4A 1KD14 1WMOA 1CH0A 2W0QA 3CCS3 1GOYA 1IT7A 1MWUA 4XDVA 1JB5A 1KQS2 1BRNL 1NJI4 1I3FA 1YNVX 1I2EA 2KF6A 1B20A 4WFOA 1RTUA 1BGSA 1JRQA 1O7NB 1BANA 1RN7A 3AGOA 5HGRA 2KCDA 4FMDA 4LZIA 3KSPA 3WHOA 1D6UA 2Z76A 5CF2A 4KZ1A 2OTL3 3CCR3 1BNFA 3STDA 1RRHA 3NV0B 1SIIA 3FG3A 1FYSA 2JQ5A 3A76A 1GD3A 3NM7A 2QA43 1QVF2 1QJGA 5M1AA 4ILFA 1B27A 3HIIA 1ROVA 3MPHA 1UUGB 3AHWA 2CFGA 3F9SA 2GXFA 1YJ93 3DGNA 1QAKA 3EX9A 4LGQA 2HMJB 2UUGC 3I563 3ER7A 3LTAA 3FLJA 1NB3I 2AAEA 1N5HA 1T5YA 1YHQ3 3AHSA 3I0YA 4HM1B 1FUTA 3G6E3 1W01A 4R80A 1BAOA 2HMOB 3RNTA 2RSXA 1TFKA 1AVKA 2O9UX 4XM4A 8CHOA 1BNIA 3UL5A 2J8XB 2HMMB 3DGOA 1HZ1A 4CDLA 4K90B 1NDOB 4FCJA 2WOHA 1IVWA 2O3OA 1B2MA 4IPBA 5HOHA 2CK3H 3CD63 3EJVA 2SBLA 2KF4A 2R4IA 3LOYA 5IF6A 2QIYA 2Q07A 3NV0A 3M8CA 1YIT3 1BRJA 5CXOA 5AIIA 1YVSA 1A2KA 1B2UA 1SIHA 3DXOA 3URPA 3X41A 1UW1A 1IQYA 3B8LA 3UL6A 1S723 2CFLA 3HIGA 5M18A 1IVUA 4EW5A 2CW9A 1K28A 1YI23 1I2GA 3NUVA 2L1SA 1YGWA 4EBGA 1W7CA 2OOVA 3U1WA 1K734 4HM6B 1TFOA 3NQYA 1FA3A 3JUPA 5KP3A 2LYXA 4NREA 1BU4A 2W9QA 3K0ZA 1G96A 3FG1A 4IIAA 3N8BA 4O2HA 4L8PA 2OTJ3 3OV4A 4FMBA 1A2VA 3BNEA 3EF8A 3GZXB 3DUKA 3D5GA 3IJEB 1RGHA 2PZVA 5LC7A 1IYYA 2WGQA 3RGAA 1PY3A 5STDA 3GWRA 3SX1A 5IENA 4K1UA 4RNTA 2STDA 5AEWB 4CCVA 5ELUA 3D4AA 1W6YA 2F86B 2XEPA 1OH0A 2ML6A 3DMCA 4KFFA 2AADA 1BNRA 1I0XA 2P05A 5AYRB 3J7Yd 2P09A 5DREA 1IDPA 3X42A 3S5CA 1V74A 1DETA 1W02A 2C11A 3EHCA 2CX1A 4AEQA 2XSOB 4KFDA 3T8UA 1M1K4 1IQXA 1OF5A 2OQEA 1OACA 1WNHA 2BT3A 2FXTA 3MG1A 3UNLA 1ZGXA 2BU4A 4CPKA 4TX4A 1RDSA 2KXGA 3CCE3 5D82A 3PGBA 4HM7B 2A15A 1VQK3 1MWSA 3OWYA 3V98A 2C10A 4OK0A 1IVXA 4HAAA 4EC6A 1MNLA 1WQLB 3F7XA 3ZFZA 3EQQB 3PXMA 4J8TA 3NX0A 1N8R4 1VQO3 1NU3A 2IY2A 4X2OA 3VSYA 4LEHA 2CWTA 1Q40A 2FNQA 2K0MA 2CWUA 4U13A 2UX0A 1G02A 1BRHA 5GSPA 1W2B2 3DY5A 4XBXA 4FMAA 3MHEA 1IU7A 4RNYA 1GS3A 2V1LA 3T8NA 1B2SA 3V92A 1OPYA 4WWUC 1EUIC 1W6CA 5KP4A 1WMNA 3EB8A 4BTWA 1K41A 5D81A 4HZ9B 3X3XA 2HMNB 3CPOA 4XDWA 4PEJA 3WA3A 3LTCA 4WHAA 1LOVA 3EBTA 4WP5A 2OCTA 4DKIA 3EBYA 4BTYA 3MSOA 4HM5B 7STDA 1JN5B 2GSPA 1BIRA 2W2CA 3GRDA 3F8XA 3K5TA 2MF7A 2H0HA 1DMNA 3NM2A 1D6ZA 3OXAA 1CYVA 5IW9A 4HBRA 4N6MA 2YX9A 1W00A 3GZYB 2IUJA 1RGFA 3LT8A 1VQ93 1BSAA 2P0MA 4O3VA 1BNGA 3CU3A 3NBJA 2IYJA 5AI1A 3SOYA 2Y73A 4MMXB 1L5GB 1Q42A 3FH1A 3DGYA 3CME3 4J9AA 9RNTA 2INXA 1QVG2 4EYCA 2GBWB 4R1KA 1VQN3 3UJMA 3X3YA 1JBTA 1DE3A 1E3RA 3NHXA 1JNQA 4OUQA 1RGCA 3BNDA 1JV2B 2CWVA 3K63A 1VQ83 3ZG5A 3DGMA 1VQP3 3LYGA 3FCSB 1RGGA 2UGIA 3PCRA 3ZG0A 4ZM8A 1TP6A 1UCIA 1JZOA 3D79A 5AIGA 1MWTA 4LYLB 3CC23 2RNTA 1RNBA 3S28A 1JKGB 4HZBB 1FUSA 4AKYA 5EQLA 3CCU3 1GY6A 1STFI 3H3HA 5AEUB 2KRTA 1O7WB 1DMMA 3BNBA 1I8VA 4HM0B 2F98A 2XGNA 4O02B 1Q7Y4 1BSCA 3FZWA 4G1MB 1N9JA 2W04A 5TGNA 1I70A 1Q864 3CCJ3 1UDII 4STDA 1FW7A 1LOWA 3FKAA 1OHPA 3B7CA 3PS8A 1Q7HA 4NHFA 6GSPA 7GSPA 1BUQA 2H0GA 1X1WA 5JBSA 3AGNA 1RSNA 1DMQA 4L8OA 5AYSC 1UI7A 1QMAA 1RCLA 2WOFA 1BUJA 1OHOA 1MOLA 4HM2B 5EEOA 3SLUA 3KSED 4Q53A 3CXC2 1AR0A 4QWTA 5BU4A 3SEDA 1K9M4 1BRIA 1RN4A 3LXUX 1B3SA 1Q9EA 2W9PA 3VF1A 4GSPA 1VQ73 3FF2A 4CJNA 5BVBA 4XBYA 1BNSA 4BU4A 1V57A 1NO3A 3PYJA 4LMIA 2RGQA 4N6V0 3X3ZA 1R4CA 1JKGA 4H3UA 2R41A 3JUMA 1W4NA 3RGRA 2M7OA 3FG4A 3JUOA 1JB2A 1QAFA 3LMLA 4WYKB 1OGZA 3OWSA 2BMOB 2CHCA 2B1XB 1S5AA 2YFLB 2K54A 5IG3A 1UGIA 1JBSA 3F8HA 5G1LA 3AMOB 2F4YA 3WOEB 2KF3A 5RNTA 3VGNA 4L7KA 3D3LA 3NXJA 2GU1A 4HOHA 1VQM3 1EKMA 3CC43 3E99A 2I9WA 3HX8A 3K9MC 1LNHA 1RGLA 3WA2X 4BL2A 1US1A 3CCV3 1NB5I 1UCJA 3Q90A 2KF5A 1HYFA 4N6TA 2Y74A 3RDEA 1RGKA 2XH9A 1WTHA 1JZDA 4O8SA 2F5WA 1VQ53 3DGLA 4BIRA 3HK4A 5G2GA 3WDGB 6STDA 2YFIB 1DVDA 1M1XB 3HI7A 4HM3B 1BRSA 1FGQA 1LOYA 2IUKA 2HMKB 3WR2A 3LZAA 1Y4KA 5FW5A 1Q814 1VQL3 3HOHA 4I4KA 1VQ43 2OOVC 3TDGA 2B24B 3F40A 4K61A 5BXQA 5IEOA 2ZL8A 4GL6A 4WYKA 1AV4A 2H0IA 5ELJA 5G1KA 3KE7A 3QK9A 4R9LA 1X1XA 5JPUA 1U8CB 1OHSA 2BO9B 3EN8A 5FGOA 8RNTA 1ZS7A 3S67A 4BL3A 1I3IA 4R4KA 1RGEA 1YIJ3 1YJW3 2GU3A 5EVHA 4EV2A 4N6UA 5BIRA 1UUVB 4EXRA 1GY7A 1A67A 1V58A 2Z6BA 4LSOA 1M9GA 2IA7A 3MWZA 3CMA3 4HVNA 3NQZA 3LT9A 4N6NB 3BU4A 3KN4A 1GSPA 1LXEA 1LVNA 1STDA 3JVCA 1BRGA 1B21A 5D83A 1YJN3 3V99A 3DM8A 2KAAA 1IV7A 3ECFA 1ASKA 2IMJA 1I2FA 3KFQC 1LNIA 1IVVA 1WMPA 3OWUA 5JPPA 3B4OA 4HM4B 3NBRA 3CCL3 2FGTA 1FUWA 2CFDA 1FGOA 2OQEC 1AQZA 1RRLA 2F56A 2L4VA 3G8ZA 1G0TA 2RBIA 1RKYA 1TUHA 3G0KA 1ZX2A 1SPUA 2CIUA 1SARA 1MGRA 2F99A 5KP1A 1OUNA 1IV9A 1BOXA 1ULJB 1PFPA 1TTOA 1VQQA 3DZLA 1KSIA 3H51A 5IG5A 4K1VA 4HJLB 1NWWA 3SVAA 1W2ZA 2Z7AA 4RBNA 1ROAA 3A5EA 3LH4A 1T3BA 1RCKA 3FSDA 3MG2A 4MEIA 1BSDA 2XGLA 2BMQB 3ALAA 5IERA 1UI8A 1IQ8A 1TJDA 3K7CA 1JN5A 1N9EA 5IG4A 1HU9A 1RNTA 1GMQA 3S27A 1IT8A 1VZZA 1FGTA 3G16A 2GEYA 4KFEA 5AIFA 2ZDJA 3EC9A 2MC8A 2WGOA 5LC6A 4HM8B 1D6YA 4GHOA 5CLKA 1RN1A 1FZUA 1EA2A 3KIIA 2QEX3 4NPBA 5M19A 3FF0A 4X2HA 3MG3A 2CH9A 1BNEA 3F14A 4RZMA 3N54B 3T0UA 2XRXB 3UB1A 3WMDA 5A0OB 1UUWB 3U97A 2ZHXB 1DVCA 2WO0A 2CFKA 3FGYA 4FCMA 3PZWA 1GMPA 4HYZA 3D9RA 3Q2PA 4GB5A 1TRPA 1A2PA 3OX9A 3CNMA 1FGMA 4FMCA 5AIHA 2E2VA 2PNCA 1F8NA 4AKZA 1C54A 1TRQA 1E97A 4IT7A 3JUQA 1BRKA 1W5ZA 2E2UA 2F5MA 3BLZA 1RHLA 3IMAB 2LQVA 2P38A 2Z77A 3SOAA 1UCKA 4N6OB 3DH2A 1OCVA 3SYUA 3BIRA 2ZA4A 4J5GA 4ORLA 3WODG 1PU4A 3CNXA 1LQMB 2YFJB 3HZPA 3MKIA 1OF5B 1CYUA 1AY7A 3LTDA 2CKFB 3BB9A 2XFTA 3G4S3 3D5IA 1ZO2A 1PYLA 2XFSA 3F7SA 1EEJA 3CCQ3 2W56B 1GYBA 1CQSA 1O7GB 1QALA 3B4PA 1KWIA 2CX0A 1Q824 1EG9B 2CFWA 3O8YA 3LTBA 3QRDA 3ROBA 1N8QA 2XR8B 4R9KA 3X40A 2K3DA 1UCLA 2C4BA 4N6LA
chains in the Genus database with same CATH topology
1RGCA 1BRJA 2BIRA 1JBRA 1X1UA 1YVSA 3KCHA 1B2UA 1T2IA 3Q3FA 3URPA 5BIRA 1BNJA 1RGGA 1BSBA 2HOHA 1UCIA 3BU4A 4J5KA 1I2GA 1MGWA 1B2XA 1GSPA 1BRGA 1B21A 1YGWA 2RNTA 1RNBA 1FUSA 2KAAA 1I2FA 1LNIA 1I8VA 6RNTA 1BU4A 1BSCA 1RGAA 1I70A 1AQZA 2F56A 2RBIA 1FW7A 1B2ZA 1LOWA 1RGHA 3D5GA 1IYYA 1SARA 1MGRA 1PY3A 6GSPA 1GOVA 1BOXA 4RNTA 7GSPA 1X1WA 1GOUA 1TTOA 3AGNA 1RSNA 1X1YA 3D4AA 1LRAA 2SARA 1RMSA 1BVIA 1I0VA 2AADA 1BNRA 3A5EA 1RCLA 1I0XA 1RCKA 3GSPA 1BUJA 1BSDA 1RLSA 1DETA 5BU4A 1BSEA 1BRIA 1RN4A 1B3SA 1GMRA 1RNTA 1GMQA 1Q9EA 4GSPA 7RNTA 1T2HA 1R4YA 1BNSA 4BU4A 4GHOA 1ZGXA 2BU4A 1RN1A 1CH0A 1FZUA 1RDSA 1GOYA 1BRNL 1I3FA 1YNVX 1I2EA 2KF6A 1B20A 1RTUA 1BNEA 1BGSA 1BANA 3AGOA 4HAAA 3WHOA 1JBSA 1BNFA 1GMPA 2F4YA 2KF3A 1FYSA 1TRPA 1G02A 1BRHA 1A2PA 5GSPA 5RNTA 1B2SA 4HOHA 1C54A 1TRQA 1B27A 1BRKA 2F5MA 1RGLA 3AHWA 1RHLA 1UCJA 1LOVA 2KF5A 1HYFA 1UCKA 1RGKA 3DH2A 3SYUA 3BIRA 2ZA4A 2GSPA 4J5GA 1BIRA 2F5WA 2AAEA 4BIRA 3AHSA 1RGFA 1BSAA 1FUTA 1AY7A 1BRSA 1BNGA 1LOYA 3RNTA 1BAOA 3WR2A 3D5IA 3HOHA 1PYLA 1BNIA 1HZ1A 3DGYA 9RNTA 1B2MA 5HOHA 1X1XA 2C4BA 8RNTA 2KF4A 1JBTA 1DE3A 1UCLA 1I3IA 1RGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGC A;  1BRJ A;  2BIR A;  1JBR A;  1X1U A;  1YVS A;  3KCH A;  1B2U A;  1T2I A;  3Q3F A;  3URP A;  5BIR A;  1BNJ A;  1RGG A;  1BSB A;  2HOH A;  1UCI A;  3BU4 A;  4J5K A;  1I2G A;  1MGW A;  1B2X A;  1GSP A;  1BRG A;  1B21 A;  1YGW A;  2RNT A;  1RNB A;  1FUS A;  2KAA A;  1I2F A;  1LNI A;  1I8V A;  6RNT A;  1BU4 A;  1BSC A;  1RGA A;  1I70 A;  1AQZ A;  2F56 A;  2RBI A;  1FW7 A;  1B2Z A;  1LOW A;  1RGH A;  3D5G A;  1IYY A;  1SAR A;  1MGR A;  1PY3 A;  6GSP A;  1GOV A;  1BOX A;  4RNT A;  7GSP A;  1X1W A;  1GOU A;  1TTO A;  3AGN A;  1RSN A;  1X1Y A;  3D4A A;  1LRA A;  2SAR A;  1RMS A;  1BVI A;  1I0V A;  2AAD A;  1BNR A;  3A5E A;  1RCL A;  1I0X A;  1RCK A;  3GSP A;  1BUJ A;  1BSD A;  1RLS A;  1DET A;  5BU4 A;  1BSE A;  1BRI A;  1RN4 A;  1B3S A;  1GMR A;  1RNT A;  1GMQ A;  1Q9E A;  4GSP A;  7RNT A;  1T2H A;  1R4Y A;  1BNS A;  4BU4 A;  4GHO A;  1ZGX A;  2BU4 A;  1RN1 A;  1CH0 A;  1FZU A;  1RDS A;  1GOY A;  1BRN L;  1I3F A;  1YNV X;  1I2E A;  2KF6 A;  1B20 A;  1RTU A;  1BNE A;  1BGS A;  1BAN A;  3AGO A;  4HAA A;  3WHO A;  1JBS A;  1BNF A;  1GMP A;  2F4Y A;  2KF3 A;  1FYS A;  1TRP A;  1G02 A;  1BRH A;  1A2P A;  5GSP A;  5RNT A;  1B2S A;  4HOH A;  1C54 A;  1TRQ A;  1B27 A;  1BRK A;  2F5M A;  1RGL A;  3AHW A;  1RHL A;  1UCJ A;  1LOV A;  2KF5 A;  1HYF A;  1UCK A;  1RGK A;  3DH2 A;  3SYU A;  3BIR A;  2ZA4 A;  2GSP A;  4J5G A;  1BIR A;  2F5W A;  2AAE A;  4BIR A;  3AHS A;  1RGF A;  1BSA A;  1FUT A;  1AY7 A;  1BRS A;  1BNG A;  1LOY A;  3RNT A;  1BAO A;  3WR2 A;  3D5I A;  3HOH A;  1PYL A;  1BNI A;  1HZ1 A;  3DGY A;  9RNT A;  1B2M A;  5HOH A;  1X1X A;  2C4B A;  8RNT A;  2KF4 A;  1JBT A;  1DE3 A;  1UCL A;  1I3I A;  1RGE A; 
#chains in the Genus database with same CATH topology
 1Q40 B;  1U5O A;  2HML B;  2QGU A;  4XB5 A;  2BIR A;  4MJD A;  2CC3 A;  1JBR A;  1M90 4;  1X1U A;  1O7H B;  3KCH A;  1T2I A;  3Q3F A;  1E3V A;  1BNJ A;  2D42 A;  1VQ6 3;  1JB4 A;  1N5P A;  2JDI H;  1J2B A;  4XBT A;  3N9H A;  1BSB A;  3CC7 3;  1NNV A;  1GY5 A;  2E2T A;  2GEX A;  2HOH A;  3OW2 2;  4J5K A;  1MGW A;  1B2X A;  1CEW I;  4MMY B;  1RJO A;  1KC8 4;  1O7M B;  2XF3 A;  1TU5 A;  3CPW 2;  1W6G A;  3L0R A;  5CF1 A;  1UGH I;  3EN1 B;  4I5Q A;  1K8A 4;  1SJW A;  3S29 A;  4KVH A;  1A90 A;  1SQW A;  1YGE A;  3GZB A;  3CCM 3;  3Q1C A;  4FCZ A;  6RNT A;  4H61 A;  3SXX A;  1LOX A;  2BNG A;  2W6J H;  3BNC A;  4HKV B;  5DRV A;  1RGA A;  1ISK A;  1YVB I;  4KT3 B;  4N3V A;  1B2Z A;  2W03 A;  3AMO A;  3NBB A;  2P0X A;  1O7P B;  2W56 A;  2RCD A;  2ML5 A;  2BHM A;  3GAX A;  4JF8 A;  1GOV A;  1Z1S A;  2GBX B;  2CG0 A;  1ULI B;  1GOU A;  1IK3 A;  1X1Y A;  2OWP A;  1LRA A;  2SAR A;  3EE1 A;  4MMZ B;  1RMS A;  1OGX A;  2D1W A;  1BVI A;  1I0V A;  1MWR A;  1HKX A;  1EQK A;  2XSH B;  3GSP A;  3KZT A;  2CG1 A;  4OVM A;  5IEP A;  1LQG C;  5IG0 A;  1RLS A;  1TIJ A;  4FR9 A;  3WOF B;  3JUN A;  3IPT A;  5CK6 A;  2RFR A;  3I55 3;  1BSE A;  3MYT A;  4EV5 A;  3PCS A;  1DYU A;  1FGR A;  1GMR A;  3KKG A;  5I97 A;  3G71 3;  1AVL A;  1C7H A;  1JJ2 2;  2BMR B;  7RNT A;  4RNZ A;  1T2H A;  3GZR A;  4JRF A;  1R4Y A;  4BTX A;  1GD4 A;  1KD1 4;  1WMO A;  1CH0 A;  2W0Q A;  3CCS 3;  1GOY A;  1IT7 A;  1MWU A;  4XDV A;  1JB5 A;  1KQS 2;  1BRN L;  1NJI 4;  1I3F A;  1YNV X;  1I2E A;  2KF6 A;  1B20 A;  4WFO A;  1RTU A;  1BGS A;  1JRQ A;  1O7N B;  1BAN A;  1RN7 A;  3AGO A;  5HGR A;  2KCD A;  4FMD A;  4LZI A;  3KSP A;  3WHO A;  1D6U A;  2Z76 A;  5CF2 A;  4KZ1 A;  2OTL 3;  3CCR 3;  1BNF A;  3STD A;  1RRH A;  3NV0 B;  1SII A;  3FG3 A;  1FYS A;  2JQ5 A;  3A76 A;  1GD3 A;  3NM7 A;  2QA4 3;  1QVF 2;  1QJG A;  5M1A A;  4ILF A;  1B27 A;  3HII A;  1ROV A;  3MPH A;  1UUG B;  3AHW A;  2CFG A;  3F9S A;  2GXF A;  1YJ9 3;  3DGN A;  1QAK A;  3EX9 A;  4LGQ A;  2HMJ B;  2UUG C;  3I56 3;  3ER7 A;  3LTA A;  3FLJ A;  1NB3 I;  2AAE A;  1N5H A;  1T5Y A;  1YHQ 3;  3AHS A;  3I0Y A;  4HM1 B;  1FUT A;  3G6E 3;  1W01 A;  4R80 A;  1BAO A;  2HMO B;  3RNT A;  2RSX A;  1TFK A;  1AVK A;  2O9U X;  4XM4 A;  8CHO A;  1BNI A;  3UL5 A;  2J8X B;  2HMM B;  3DGO A;  1HZ1 A;  4CDL A;  4K90 B;  1NDO B;  4FCJ A;  2WOH A;  1IVW A;  2O3O A;  1B2M A;  4IPB A;  5HOH A;  2CK3 H;  3CD6 3;  3EJV A;  2SBL A;  2KF4 A;  2R4I A;  3LOY A;  5IF6 A;  2QIY A;  2Q07 A;  3NV0 A;  3M8C A;  1YIT 3;  1BRJ A;  5CXO A;  5AII A;  1YVS A;  1A2K A;  1B2U A;  1SIH A;  3DXO A;  3URP A;  3X41 A;  1UW1 A;  1IQY A;  3B8L A;  3UL6 A;  1S72 3;  2CFL A;  3HIG A;  5M18 A;  1IVU A;  4EW5 A;  2CW9 A;  1K28 A;  1YI2 3;  1I2G A;  3NUV A;  2L1S A;  1YGW A;  4EBG A;  1W7C A;  2OOV A;  3U1W A;  1K73 4;  4HM6 B;  1TFO A;  3NQY A;  1FA3 A;  3JUP A;  5KP3 A;  2LYX A;  4NRE A;  1BU4 A;  2W9Q A;  3K0Z A;  1G96 A;  3FG1 A;  4IIA A;  3N8B A;  4O2H A;  4L8P A;  2OTJ 3;  3OV4 A;  4FMB A;  1A2V A;  3BNE A;  3EF8 A;  3GZX B;  3DUK A;  3D5G A;  3IJE B;  1RGH A;  2PZV A;  5LC7 A;  1IYY A;  2WGQ A;  3RGA A;  1PY3 A;  5STD A;  3GWR A;  3SX1 A;  5IEN A;  4K1U A;  4RNT A;  2STD A;  5AEW B;  4CCV A;  5ELU A;  3D4A A;  1W6Y A;  2F86 B;  2XEP A;  1OH0 A;  2ML6 A;  3DMC A;  4KFF A;  2AAD A;  1BNR A;  1I0X A;  2P05 A;  5AYR B;  3J7Y d;  2P09 A;  5DRE A;  1IDP A;  3X42 A;  3S5C A;  1V74 A;  1DET A;  1W02 A;  2C11 A;  3EHC A;  2CX1 A;  4AEQ A;  2XSO B;  4KFD A;  3T8U A;  1M1K 4;  1IQX A;  1OF5 A;  2OQE A;  1OAC A;  1WNH A;  2BT3 A;  2FXT A;  3MG1 A;  3UNL A;  1ZGX A;  2BU4 A;  4CPK A;  4TX4 A;  1RDS A;  2KXG A;  3CCE 3;  5D82 A;  3PGB A;  4HM7 B;  2A15 A;  1VQK 3;  1MWS A;  3OWY A;  3V98 A;  2C10 A;  4OK0 A;  1IVX A;  4HAA A;  4EC6 A;  1MNL A;  1WQL B;  3F7X A;  3ZFZ A;  3EQQ B;  3PXM A;  4J8T A;  3NX0 A;  1N8R 4;  1VQO 3;  1NU3 A;  2IY2 A;  4X2O A;  3VSY A;  4LEH A;  2CWT A;  1Q40 A;  2FNQ A;  2K0M A;  2CWU A;  4U13 A;  2UX0 A;  1G02 A;  1BRH A;  5GSP A;  1W2B 2;  3DY5 A;  4XBX A;  4FMA A;  3MHE A;  1IU7 A;  4RNY A;  1GS3 A;  2V1L A;  3T8N A;  1B2S A;  3V92 A;  1OPY A;  4WWU C;  1EUI C;  1W6C A;  5KP4 A;  1WMN A;  3EB8 A;  4BTW A;  1K41 A;  5D81 A;  4HZ9 B;  3X3X A;  2HMN B;  3CPO A;  4XDW A;  4PEJ A;  3WA3 A;  3LTC A;  4WHA A;  1LOV A;  3EBT A;  4WP5 A;  2OCT A;  4DKI A;  3EBY A;  4BTY A;  3MSO A;  4HM5 B;  7STD A;  1JN5 B;  2GSP A;  1BIR A;  2W2C A;  3GRD A;  3F8X A;  3K5T A;  2MF7 A;  2H0H A;  1DMN A;  3NM2 A;  1D6Z A;  3OXA A;  1CYV A;  5IW9 A;  4HBR A;  4N6M A;  2YX9 A;  1W00 A;  3GZY B;  2IUJ A;  1RGF A;  3LT8 A;  1VQ9 3;  1BSA A;  2P0M A;  4O3V A;  1BNG A;  3CU3 A;  3NBJ A;  2IYJ A;  5AI1 A;  3SOY A;  2Y73 A;  4MMX B;  1L5G B;  1Q42 A;  3FH1 A;  3DGY A;  3CME 3;  4J9A A;  9RNT A;  2INX A;  1QVG 2;  4EYC A;  2GBW B;  4R1K A;  1VQN 3;  3UJM A;  3X3Y A;  1JBT A;  1DE3 A;  1E3R A;  3NHX A;  1JNQ A;  4OUQ A;  1RGC A;  3BND A;  1JV2 B;  2CWV A;  3K63 A;  1VQ8 3;  3ZG5 A;  3DGM A;  1VQP 3;  3LYG A;  3FCS B;  1RGG A;  2UGI A;  3PCR A;  3ZG0 A;  4ZM8 A;  1TP6 A;  1UCI A;  1JZO A;  3D79 A;  5AIG A;  1MWT A;  4LYL B;  3CC2 3;  2RNT A;  1RNB A;  3S28 A;  1JKG B;  4HZB B;  1FUS A;  4AKY A;  5EQL A;  3CCU 3;  1GY6 A;  1STF I;  3H3H A;  5AEU B;  2KRT A;  1O7W B;  1DMM A;  3BNB A;  1I8V A;  4HM0 B;  2F98 A;  2XGN A;  4O02 B;  1Q7Y 4;  1BSC A;  3FZW A;  4G1M B;  1N9J A;  2W04 A;  5TGN A;  1I70 A;  1Q86 4;  3CCJ 3;  1UDI I;  4STD A;  1FW7 A;  1LOW A;  3FKA A;  1OHP A;  3B7C A;  3PS8 A;  1Q7H A;  4NHF A;  6GSP A;  7GSP A;  1BUQ A;  2H0G A;  1X1W A;  5JBS A;  3AGN A;  1RSN A;  1DMQ A;  4L8O A;  5AYS C;  1UI7 A;  1QMA A;  1RCL A;  2WOF A;  1BUJ A;  1OHO A;  1MOL A;  4HM2 B;  5EEO A;  3SLU A;  3KSE D;  4Q53 A;  3CXC 2;  1AR0 A;  4QWT A;  5BU4 A;  3SED A;  1K9M 4;  1BRI A;  1RN4 A;  3LXU X;  1B3S A;  1Q9E A;  2W9P A;  3VF1 A;  4GSP A;  1VQ7 3;  3FF2 A;  4CJN A;  5BVB A;  4XBY A;  1BNS A;  4BU4 A;  1V57 A;  1NO3 A;  3PYJ A;  4LMI A;  2RGQ A;  4N6V 0;  3X3Z A;  1R4C A;  1JKG A;  4H3U A;  2R41 A;  3JUM A;  1W4N A;  3RGR A;  2M7O A;  3FG4 A;  3JUO A;  1JB2 A;  1QAF A;  3LML A;  4WYK B;  1OGZ A;  3OWS A;  2BMO B;  2CHC A;  2B1X B;  1S5A A;  2YFL B;  2K54 A;  5IG3 A;  1UGI A;  1JBS A;  3F8H A;  5G1L A;  3AMO B;  2F4Y A;  3WOE B;  2KF3 A;  5RNT A;  3VGN A;  4L7K A;  3D3L A;  3NXJ A;  2GU1 A;  4HOH A;  1VQM 3;  1EKM A;  3CC4 3;  3E99 A;  2I9W A;  3HX8 A;  3K9M C;  1LNH A;  1RGL A;  3WA2 X;  4BL2 A;  1US1 A;  3CCV 3;  1NB5 I;  1UCJ A;  3Q90 A;  2KF5 A;  1HYF A;  4N6T A;  2Y74 A;  3RDE A;  1RGK A;  2XH9 A;  1WTH A;  1JZD A;  4O8S A;  2F5W A;  1VQ5 3;  3DGL A;  4BIR A;  3HK4 A;  5G2G A;  3WDG B;  6STD A;  2YFI B;  1DVD A;  1M1X B;  3HI7 A;  4HM3 B;  1BRS A;  1FGQ A;  1LOY A;  2IUK A;  2HMK B;  3WR2 A;  3LZA A;  1Y4K A;  5FW5 A;  1Q81 4;  1VQL 3;  3HOH A;  4I4K A;  1VQ4 3;  2OOV C;  3TDG A;  2B24 B;  3F40 A;  4K61 A;  5BXQ A;  5IEO A;  2ZL8 A;  4GL6 A;  4WYK A;  1AV4 A;  2H0I A;  5ELJ A;  5G1K A;  3KE7 A;  3QK9 A;  4R9L A;  1X1X A;  5JPU A;  1U8C B;  1OHS A;  2BO9 B;  3EN8 A;  5FGO A;  8RNT A;  1ZS7 A;  3S67 A;  4BL3 A;  1I3I A;  4R4K A;  1RGE A;  1YIJ 3;  1YJW 3;  2GU3 A;  5EVH A;  4EV2 A;  4N6U A;  5BIR A;  1UUV B;  4EXR A;  1GY7 A;  1A67 A;  1V58 A;  2Z6B A;  4LSO A;  1M9G A;  2IA7 A;  3MWZ A;  3CMA 3;  4HVN A;  3NQZ A;  3LT9 A;  4N6N B;  3BU4 A;  3KN4 A;  1GSP A;  1LXE A;  1LVN A;  1STD A;  3JVC A;  1BRG A;  1B21 A;  5D83 A;  1YJN 3;  3V99 A;  3DM8 A;  2KAA A;  1IV7 A;  3ECF A;  1ASK A;  2IMJ A;  1I2F A;  3KFQ C;  1LNI A;  1IVV A;  1WMP A;  3OWU A;  5JPP A;  3B4O A;  4HM4 B;  3NBR A;  3CCL 3;  2FGT A;  1FUW A;  2CFD A;  1FGO A;  2OQE C;  1AQZ A;  1RRL A;  2F56 A;  2L4V A;  3G8Z A;  1G0T A;  2RBI A;  1RKY A;  1TUH A;  3G0K A;  1ZX2 A;  1SPU A;  2CIU A;  1SAR A;  1MGR A;  2F99 A;  5KP1 A;  1OUN A;  1IV9 A;  1BOX A;  1ULJ B;  1PFP A;  1TTO A;  1VQQ A;  3DZL A;  1KSI A;  3H51 A;  5IG5 A;  4K1V A;  4HJL B;  1NWW A;  3SVA A;  1W2Z A;  2Z7A A;  4RBN A;  1ROA A;  3A5E A;  3LH4 A;  1T3B A;  1RCK A;  3FSD A;  3MG2 A;  4MEI A;  1BSD A;  2XGL A;  2BMQ B;  3ALA A;  5IER A;  1UI8 A;  1IQ8 A;  1TJD A;  3K7C A;  1JN5 A;  1N9E A;  5IG4 A;  1HU9 A;  1RNT A;  1GMQ A;  3S27 A;  1IT8 A;  1VZZ A;  1FGT A;  3G16 A;  2GEY A;  4KFE A;  5AIF A;  2ZDJ A;  3EC9 A;  2MC8 A;  2WGO A;  5LC6 A;  4HM8 B;  1D6Y A;  4GHO A;  5CLK A;  1RN1 A;  1FZU A;  1EA2 A;  3KII A;  2QEX 3;  4NPB A;  5M19 A;  3FF0 A;  4X2H A;  3MG3 A;  2CH9 A;  1BNE A;  3F14 A;  4RZM A;  3N54 B;  3T0U A;  2XRX B;  3UB1 A;  3WMD A;  5A0O B;  1UUW B;  3U97 A;  2ZHX B;  1DVC A;  2WO0 A;  2CFK A;  3FGY A;  4FCM A;  3PZW A;  1GMP A;  4HYZ A;  3D9R A;  3Q2P A;  4GB5 A;  1TRP A;  1A2P A;  3OX9 A;  3CNM A;  1FGM A;  4FMC A;  5AIH A;  2E2V A;  2PNC A;  1F8N A;  4AKZ A;  1C54 A;  1TRQ A;  1E97 A;  4IT7 A;  3JUQ A;  1BRK A;  1W5Z A;  2E2U A;  2F5M A;  3BLZ A;  1RHL A;  3IMA B;  2LQV A;  2P38 A;  2Z77 A;  3SOA A;  1UCK A;  4N6O B;  3DH2 A;  1OCV A;  3SYU A;  3BIR A;  2ZA4 A;  4J5G A;  4ORL A;  3WOD G;  1PU4 A;  3CNX A;  1LQM B;  2YFJ B;  3HZP A;  3MKI A;  1OF5 B;  1CYU A;  1AY7 A;  3LTD A;  2CKF B;  3BB9 A;  2XFT A;  3G4S 3;  3D5I A;  1ZO2 A;  1PYL A;  2XFS A;  3F7S A;  1EEJ A;  3CCQ 3;  2W56 B;  1GYB A;  1CQS A;  1O7G B;  1QAL A;  3B4P A;  1KWI A;  2CX0 A;  1Q82 4;  1EG9 B;  2CFW A;  3O8Y A;  3LTB A;  3QRD A;  3ROB A;  1N8Q A;  2XR8 B;  4R9K A;  3X40 A;  2K3D A;  1UCL A;  2C4B A;  4N6L A; 
#chains in the Genus database with same CATH homology
 1RGC A;  1BRJ A;  2BIR A;  1JBR A;  1X1U A;  1YVS A;  3KCH A;  1B2U A;  1T2I A;  3Q3F A;  3URP A;  5BIR A;  1BNJ A;  1RGG A;  1BSB A;  2HOH A;  1UCI A;  3BU4 A;  4J5K A;  1I2G A;  1MGW A;  1B2X A;  1GSP A;  1BRG A;  1B21 A;  1YGW A;  2RNT A;  1RNB A;  1FUS A;  2KAA A;  1I2F A;  1LNI A;  1I8V A;  6RNT A;  1BU4 A;  1BSC A;  1RGA A;  1I70 A;  1AQZ A;  2F56 A;  2RBI A;  1FW7 A;  1B2Z A;  1LOW A;  1RGH A;  3D5G A;  1IYY A;  1SAR A;  1MGR A;  1PY3 A;  6GSP A;  1GOV A;  1BOX A;  4RNT A;  7GSP A;  1X1W A;  1GOU A;  1TTO A;  3AGN A;  1RSN A;  1X1Y A;  3D4A A;  1LRA A;  2SAR A;  1RMS A;  1BVI A;  1I0V A;  2AAD A;  1BNR A;  3A5E A;  1RCL A;  1I0X A;  1RCK A;  3GSP A;  1BUJ A;  1BSD A;  1RLS A;  1DET A;  5BU4 A;  1BSE A;  1BRI A;  1RN4 A;  1B3S A;  1GMR A;  1RNT A;  1GMQ A;  1Q9E A;  4GSP A;  7RNT A;  1T2H A;  1R4Y A;  1BNS A;  4BU4 A;  4GHO A;  1ZGX A;  2BU4 A;  1RN1 A;  1CH0 A;  1FZU A;  1RDS A;  1GOY A;  1BRN L;  1I3F A;  1YNV X;  1I2E A;  2KF6 A;  1B20 A;  1RTU A;  1BNE A;  1BGS A;  1BAN A;  3AGO A;  4HAA A;  3WHO A;  1JBS A;  1BNF A;  1GMP A;  2F4Y A;  2KF3 A;  1FYS A;  1TRP A;  1G02 A;  1BRH A;  1A2P A;  5GSP A;  5RNT A;  1B2S A;  4HOH A;  1C54 A;  1TRQ A;  1B27 A;  1BRK A;  2F5M A;  1RGL A;  3AHW A;  1RHL A;  1UCJ A;  1LOV A;  2KF5 A;  1HYF A;  1UCK A;  1RGK A;  3DH2 A;  3SYU A;  3BIR A;  2ZA4 A;  2GSP A;  4J5G A;  1BIR A;  2F5W A;  2AAE A;  4BIR A;  3AHS A;  1RGF A;  1BSA A;  1FUT A;  1AY7 A;  1BRS A;  1BNG A;  1LOY A;  3RNT A;  1BAO A;  3WR2 A;  3D5I A;  3HOH A;  1PYL A;  1BNI A;  1HZ1 A;  3DGY A;  9RNT A;  1B2M A;  5HOH A;  1X1X A;  2C4B A;  8RNT A;  2KF4 A;  1JBT A;  1DE3 A;  1UCL A;  1I3I A;  1RGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...