1RGLA

Rnase t1 mutant glu46gln binds the inhibitors 2'gmp and 2'amp at the 3' subsite
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYQGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase T1 mutant Glu46Gln binds the inhibitors 2'GMP and 2'AMP at the 3' subsite.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rglA00
1AY7A 1JBSA 1BSEA 1FW7A 1BU4A 1RTUA 2F5MA 2ZA4A 2KAAA 3AHWA 3D4AA 1BNJA 1BRIA 1I3FA 2KF6A 1BNIA 1RCKA 5HOHA 1MGRA 5GSPA 1RNTA 1TRPA 2RBIA 3AHSA 1RGAA 1BGSA 1FZUA 1C54A 1MGWA 1B3SA 1B20A 1B2MA 1Q9EA 1CH0A 3BIRA 1TTOA 2HOHA 4HOHA 8RNTA 2F4YA 1RGFA 2AAEA 1I2FA 2BIRA 1BOXA 1BRKA 3D5GA 2GSPA 3KCHA 1RN1A 3D5IA 1BANA 4J5KA 1A2PA 4BIRA 4BU4A 7RNTA 1RGEA 1I2GA 2BU4A 1RHLA 1BAOA 1BNGA 7GSPA 1BNRA 1BVIA 1I0XA 1RSNA 1UCKA 1BRSA 2F5WA 1GMPA 3A5EA 5RNTA 1BRJA 2RNTA 1BSAA 1I3IA 1RCLA 3AGOA 2KF4A 1I0VA 3RNTA 1UCJA 1I2EA 1G02A 1UCLA 1DETA 1GOYA 1RGGA 1RN4A 1UCIA 1GMRA 1RLSA 4J5GA 2KF3A 3WR2A 1GMQA 1FUSA 1IYYA 1GSPA 1BIRA 1T2IA 2KF5A 6RNTA 1YNVX 3AGNA 1B21A 1SARA 1BSDA 9RNTA 1BSCA 1R4YA 1PYLA 1I8VA 1RDSA 1B2SA 1BRNL 1FUTA 1RGLA 2C4BA 1BNEA 1HZ1A 1LOWA 1B2XA 1BUJA 2AADA 1JBRA 5BIRA 1RNBA 4RNTA 6GSPA 1AQZA 1RGCA 1BRGA 1PY3A 3URPA 1X1UA 1BRHA 3SYUA 4GHOA 1RMSA 1TRQA 4HAAA 1DE3A 1JBTA 1X1YA 1YVSA 5BU4A 1ZGXA 1RGKA 1T2HA 3GSPA 1GOUA 1RGHA 3DH2A 1GOVA 3BU4A 3WHOA 4GSPA 1HYFA 1FYSA 1BSBA 1X1WA 2F56A 1BNSA 1BNFA 1B27A 2SARA 1LRAA 3HOHA 1YGWA 1LNIA 1I70A 1LOVA 1B2ZA 1B2UA 3Q3FA 1LOYA 3DGYA 1X1XA
chains in the Genus database with same CATH superfamily
1QAKA 2SBLA 4OUQA 1MWSA 1IVXA 4HM3B 3PXMA 4XDWA 1PU4A 2CWTA 2KAAA 1BRIA 1MGRA 1WMOA 3CNMA 4FCJA 4BTYA 4EC6A 3BLZA 3NM2A 4LYLB 1D6UA 1BGSA 1QJGA 1VZZA 1FZUA 1A2KA 1MGWA 1B3SA 2M7OA 1FUWA 4HKVB 3CCE3 3HI7A 1TP6A 2F4YA 1RGFA 1I2FA 3FF2A 1TU5A 5AYRB 2W2CA 4O02B 1BANA 3CC43 4J5KA 7RNTA 3CNXA 3DUKA 4BIRA 1SIHA 3WOFB 1I2GA 5EEOA 1RHLA 3LXUX 2RCDA 1VQN3 1BNRA 4GB5A 1I0XA 2P0MA 1O7HB 2W0QA 3WMDA 1OHPA 4I4KA 1YHQ3 1K734 5RNTA 1SJWA 3K9MC 1BRJA 4HM0B 2RNTA 1BSAA 1IU7A 3M8CA 1RCLA 1W01A 2YFIB 3EB8A 1IQYA 2KF4A 1YVBI 1I0VA 1TFKA 2XGNA 2Z7AA 3FG1A 3RNTA 1G02A 5IG4A 1JB5A 1ULJB 1LOXA 1RGGA 3JVCA 2OTL3 2QGUA 2QEX3 2OOVA 3JUMA 1YIJ3 1S723 2CHCA 4WWUC 2LQVA 2CFDA 4EXRA 2L1SA 1GMQA 1FUSA 2ML5A 1CYVA 2OOVC 2LYXA 1BIRA 3UL5A 2CK3H 3UJMA 3VSYA 3KKGA 4NREA 3CCJ3 3OW22 4L8OA 3GZYB 4ZM8A 2BHMA 2GBXB 2INXA 5KP3A 4MJDA 3G713 1A2VA 1YJ93 1CYUA 5IG0A 1PYLA 2PNCA 1GY6A 2CG1A 1STDA 3SXXA 3N9HA 4WFOA 1B2SA 1MOLA 1RGLA 3PGBA 4HM1B 3SOYA 2KCDA 4EW5A 3OXAA 3CCQ3 3VF1A 2C4BA 1FGQA 1RN7A 1BNEA 3NX0A 3GRDA 3NV0A 4R1KA 4XB5A 3CPW2 1B2XA 1AVKA 1C7HA 2AADA 2IUKA 5DRVA 1JRQA 4WHAA 5BIRA 3F9SA 2ZL8A 1RNBA 1M1XB 2F86B 1PY3A 1W6GA 3URPA 1BRHA 3RDEA 3ZG5A 3DGNA 3LTDA 1D6YA 1IV7A 1X1YA 5BU4A 1N5HA 3CME3 2RGQA 3BNBA 3DY5A 3GSPA 3SX1A 1RRLA 4MMYB 3GWRA 3NV0B 3TDGA 1FGOA 2W04A 1JKGB 2WOHA 2XSOB 3D9RA 3F7XA 3T8NA 1W2B2 4K61A 1G0TA 4JRFA 1VQK3 4N6LA 1B27A 3AMOA 3HOHA 4Q53A 4KVHA 2BNGA 1KWIA 6STDA 5G1KA 1B2ZA 1RKYA 2P38A 3LH4A 2XFSA 4EV5A 1W6CA 1AY7A 1MNLA 3DGLA 3WA2X 1JZOA 1BSEA 2BMQB 1OH0A 1BU4A 1M9GA 3LTBA 4N6NB 1Q864 2F5MA 3DZLA 2XEPA 1BNJA 1Z1SA 3ZFZA 3PS8A 1NO3A 2KRTA 1FA3A 5TGNA 1TRPA 3T8UA 3DMCA 5IF6A 1JN5A 3F8XA 4X2HA 5IEOA 4WP5A 3CC73 3RGAA 1C54A 1KD14 2STDA 4KZ1A 1B2MA 1Q9EA 1CH0A 4N6MA 4HOHA 2V1LA 3JUOA 2K0MA 8RNTA 1WMNA 5AEWB 1BOXA 3CMA3 5BVBA 1O7GB 3D5IA 4KFEA 4BU4A 1V74A 3WA3A 4N6OB 2BU4A 1UI7A 1BAOA 1BNGA 2OTJ3 3EN8A 1LQGC 1W4NA 1AV4A 5DREA 2BT3A 3F8HA 1BVIA 3V99A 1JZDA 1UCKA 2Z76A 1L5GB 3NHXA 2XR8B 4HBRA 2CC3A 1I3IA 3KSPA 1Q814 1Q42A 3AGOA 4IPBA 5D81A 4AKZA 3U1WA 1UCJA 4HYZA 1DYUA 2OQEC 3QRDA 1UCLA 4FMBA 5D83A 1UCIA 3Q1CA 2GEYA 3UL6A 1UGHI 4J5GA 3WOEB 4HM8B 5G1LA 3Q2PA 3CC23 1UW1A 1UGIA 1GSPA 2O3OA 2KF5A 1FGRA 2OCTA 2CWUA 3AGNA 1OGZA 3EF8A 1RJOA 2CWVA 2OWPA 5ELJA 1ROAA 1R4YA 1N8QA 3A76A 3S27A 1IQ8A 2BO9B 4CDLA 3JUQA 2FGTA 4J9AA 1JN5B 3PCSA 1ULIB 1JB4A 3KFQC 2HMOB 3DGMA 4U13A 3CU3A 1GY5A 1G96A 2GU3A 5AIIA 1EQKA 1ZO2A 3LTAA 1VQ93 1VQP3 1VQQA 1HZ1A 4AKYA 5CF2A 1IV9A 3IPTA 1Q7HA 3NQYA 3S5CA 2F98A 2IMJA 1OACA 4O2HA 3CCV3 4RNTA 1VQM3 2QIYA 6GSPA 1NU3A 1RGCA 1BRGA 4RNZA 1JKGA 4GHOA 2W9PA 4NHFA 4EV2A 4IIAA 4HAAA 4XM4A 2W56A 5AIFA 3WODG 1DE3A 4DKIA 2CG0A 3JUNA 1T2HA 3B4OA 3J7Yd 1RGHA 2UGIA 1HU9A 2P05A 2UX0A 1TJDA 1VQO3 3WHOA 3CCL3 2CIUA 4GSPA 2BMRB 4J8TA 3Q90A 5BXQA 1SIIA 1BSBA 1X1WA 2CH9A 3EN1B 2F56A 1BNSA 1BNFA 3CCU3 1TUHA 7STDA 2C10A 4H3UA 3X40A 1JV2B 2GXFA 2W03A 3GZBA 1K8A4 1IVWA 1LNIA 3FG3A 3N8BA 1A90A 1TFOA 1UUGB 3IJEB 1W5ZA 4FMDA 2Y74A 1VQ43 3Q3FA 4HM7B 3L0RA 1OHOA 1EKMA 3EHCA 3LTCA 1QAFA 3QK9A 5CK6A 1JBSA 1FW7A 2XFTA 3NM7A 1N9EA 4O8SA 3FG4A 1QVG2 1ROVA 2IYJA 3FF0A 3SOAA 3D4AA 1WMPA 2KF6A 1O7MB 3I553 1VQL3 1VQ63 4R9LA 1E97A 3S28A 1DMQA 2B24B 3MG3A 2CFGA 2FXTA 3FKAA 1GYBA 1YJN3 1KC84 4FR9A 3I0YA 1NNVA 5JPPA 3BB9A 5M18A 2A15A 2E2UA 1B20A 1E3VA 2R4IA 4K90B 3LT9A 3BIRA 1TTOA 1QALA 2HOHA 2I9WA 3MPHA 1QVF2 2AAEA 1K28A 2BIRA 2Z6BA 2W56B 1RN1A 2O9UX 3MKIA 1NWWA 1Q40A 1RGEA 3F7SA 2GU1A 5LC7A 2B1XB 2WGQA 4O3VA 1STFI 3KN4A 1V58A 4MMZB 7GSPA 1WTHA 4G1MB 1NB3I 2E2VA 1BRSA 1JB2A 1GMPA 3A5EA 3G16A 3HX8A 3OX9A 2QA43 4KFFA 2IA7A 1BUQA 2CX1A 1KQS2 1I2EA 2W9QA 3F14A 3NQZA 1DETA 5IW9A 3GAXA 5LC6A 5IG5A 4LMIA 5AYSC 1RN4A 5EQLA 1MWUA 3NBJA 3B8LA 3KZTA 4HM5B 3WR2A 1YJW3 3B7CA 4HZ9B 4LSOA 5EVHA 4LZIA 3U97A 6RNTA 5HGRA 3OV4A 2CW9A 4QWTA 5A0OB 3CCR3 1OF5A 4XBXA 5D82A 1ISKA 4H61A 2HMKB 2ZDJA 3EBYA 4WYKA 1WQLB 2BMOB 1NB5I 1I8VA 2CFKA 2D42A 1RDSA 4KT3B 3SLUA 3ROBA 1W2ZA 3BNDA 5ELUA 1RRHA 1UDII 2R41A 3IMAB 4EBGA 1M1K4 3MG2A 5I97A 1OCVA 5AI1A 1BRNL 3FGYA 2HMLB 1W02A 2HMMB 1YI23 2IY2A 4GL6A 1EA2A 3LOYA 1VQ83 1ASKA 1JBRA 1N9JA 4N3VA 2CX0A 3EC9A 4PEJA 3HK4A 4XDVA 3G6E3 1NJI4 4ILFA 3G8ZA 2MC8A 4CPKA 1X1UA 1DVDA 3SYUA 4CCVA 1O7WB 2H0HA 3LYGA 1JJ22 1SQWA 5FW5A 1IQXA 5JBSA 1ZGXA 3X42A 1RGKA 2KXGA 1T5YA 1US1A 3DH2A 1GOVA 3BU4A 2W6JH 3X41A 3CXC2 1W6YA 3K5TA 2JQ5A 4L7KA 1OGXA 3SVAA 3NUVA 2YX9A 2YFLB 3EBTA 3BNEA 3DXOA 2RFRA 4HM4B 2JDIH 1EEJA 4LEHA 1MWRA 3V92A 4HJLB 4XBYA 1Y4KA 3D79A 4HM6B 1QMAA 4BL2A 2P09A 1EG9B 3LT8A 2Z77A 4OK0A 3OWYA 3X3YA 4R4KA 1I70A 1LOVA 8CHOA 1M904 5KP4A 1OF5B 1GS3A 1OUNA 5AEUB 1B2UA 3DM8A 1LXEA 3EX9A 4AEQA 3VGNA 1X1XA 3D5GA 2CKFB 3ALAA 5CF1A 3MHEA 1IVUA 4K1VA 1RTUA 4BTWA 1D6ZA 2ZA4A 3JUPA 3NBRA 3NBBA 3HZPA 3K63A 3UNLA 3AHWA 2K54A 1I3FA 4OVMA 5HOHA 2WO0A 1BNIA 1RCKA 1IT7A 3GZXB 3KIIA 1LVNA 5GSPA 1RNTA 1E3RA 1EUIC 3H3HA 2RBIA 3OWUA 3STDA 1MWTA 3AHSA 4RZMA 3FLJA 5IG3A 1GD3A 1RGAA 3CCM3 2XF3A 3F40A 4IT7A 1YGEA 1Q824 1VQ53 3S29A 2YFJB 2E2TA 2P0XA 1BRKA 2GSPA 2J8XB 3K7CA 3KCHA 2MF7A 1KSIA 1K41A 1A2PA 1OPYA 2XSHB 3FCSB 3KSED 4XBTA 5STDA 4RBNA 3B4PA 1W7CA 4FCMA 2OQEA 3DGOA 3FZWA 4BTXA 1GY7A 2HMJB 5AIGA 3X3ZA 4ORLA 4RNYA 4BL3A 2GEXA 1V57A 1RSNA 1TIJA 4CJNA 2F5WA 2H0GA 1F8NA 1Q40B 1VQ73 1IDPA 1JNQA 1SPUA 3CPOA 3EJVA 5G2GA 2Y73A 1IK3A 2D1WA 4NPBA 4K1UA 2Q07A 1GOYA 4MMXB 4N6TA 2ML6A 1AVLA 1GMRA 1RLSA 5IENA 3V98A 2KF3A 1W00A 2CFLA 4I5QA 1IYYA 3EE1A 3X3XA 1T2IA 1UUVB 4FMCA 1YNVX 3ZG0A 1B21A 1SARA 1T3BA 3LMLA 1FGMA 1BSDA 3PCRA 2XRXB 4EYCA 1DMNA 9RNTA 1CEWI 1BSCA 3ECFA 3GZRA 5AIHA 3WDGB 1HKXA 4FMAA 3G0KA 3I563 1AR0A 3KE7A 5M19A 1R4CA 5FGOA 1FUTA 4JF8A 3N54B 3OWSA 1NDOB 4WYKB 5IEPA 1LQMB 5M1AA 1O7NB 1LOWA 2C11A 1BUJA 1N8R4 2L4VA 4X2OA 3MSOA 5CXOA 3RGRA 2CFWA 2GBWB 1UUWB 2UUGC 2K3DA 4R80A 1AQZA 4STDA 4R9KA 3FH1A 3ER7A 5JPUA 3PYJA 1RMSA 5CLKA 1TRQA 2FNQA 4N6V0 1U5OA 4HVNA 1JBTA 1YVSA 3LZAA 2RSXA 3CD63 3D3LA 1N5PA 1DMMA 1Q7Y4 1U8CB 1GOUA 1GD4A 4L8PA 3PZWA 3O8YA 4HZBB 4FCZA 3S67A 3SEDA 3UB1A 3T0UA 3G4S3 3BNCA 2IUJA 5IERA 3MYTA 4TX4A 2H0IA 2XGLA 1HYFA 1WNHA 3HIGA 1FYSA 2PZVA 2HMNB 4MEIA 1K9M4 4LGQA 1DVCA 2WGOA 3H51A 3NXJA 1CQSA 2SARA 2XH9A 1LRAA 1O7PB 1ZS7A 3CCS3 1FGTA 3EQQB 5KP1A 3K0ZA 1IVVA 1YIT3 1UI8A 1J2BA 1YGWA 4N6UA 1ZX2A 2WOFA 1IT8A 3FSDA 4KFDA 2F99A 1LNHA 1PFPA 1S5AA 1OHSA 3E99A 3HIIA 3MWZA 4HM2B 1A67A 1LOYA 3MG1A 2ZHXB 3AMOB 3DGYA
chains in the Genus database with same CATH topology
1AY7A 1JBSA 1BSEA 1FW7A 1BU4A 1RTUA 2F5MA 2ZA4A 2KAAA 3AHWA 3D4AA 1BNJA 1BRIA 1I3FA 2KF6A 1BNIA 1RCKA 5HOHA 1MGRA 5GSPA 1RNTA 1TRPA 2RBIA 3AHSA 1RGAA 1BGSA 1FZUA 1C54A 1MGWA 1B3SA 1B20A 1B2MA 1Q9EA 1CH0A 3BIRA 1TTOA 2HOHA 4HOHA 8RNTA 2F4YA 1RGFA 2AAEA 1I2FA 2BIRA 1BOXA 1BRKA 3D5GA 2GSPA 3KCHA 1RN1A 3D5IA 1BANA 4J5KA 1A2PA 4BIRA 4BU4A 7RNTA 1RGEA 1I2GA 2BU4A 1RHLA 1BAOA 1BNGA 7GSPA 1BNRA 1BVIA 1I0XA 1RSNA 1UCKA 1BRSA 2F5WA 1GMPA 3A5EA 5RNTA 1BRJA 2RNTA 1BSAA 1I3IA 1RCLA 3AGOA 2KF4A 1I0VA 3RNTA 1UCJA 1I2EA 1G02A 1UCLA 1DETA 1GOYA 1RGGA 1RN4A 1UCIA 1GMRA 1RLSA 4J5GA 2KF3A 3WR2A 1GMQA 1FUSA 1IYYA 1GSPA 1BIRA 1T2IA 2KF5A 6RNTA 1YNVX 3AGNA 1B21A 1SARA 1BSDA 9RNTA 1BSCA 1R4YA 1PYLA 1I8VA 1RDSA 1B2SA 1BRNL 1FUTA 1RGLA 2C4BA 1BNEA 1HZ1A 1LOWA 1B2XA 1BUJA 2AADA 1JBRA 5BIRA 1RNBA 4RNTA 6GSPA 1AQZA 1RGCA 1BRGA 1PY3A 3URPA 1X1UA 1BRHA 3SYUA 4GHOA 1RMSA 1TRQA 4HAAA 1DE3A 1JBTA 1X1YA 1YVSA 5BU4A 1ZGXA 1RGKA 1T2HA 3GSPA 1GOUA 1RGHA 3DH2A 1GOVA 3BU4A 3WHOA 4GSPA 1HYFA 1FYSA 1BSBA 1X1WA 2F56A 1BNSA 1BNFA 1B27A 2SARA 1LRAA 3HOHA 1YGWA 1LNIA 1I70A 1LOVA 1B2ZA 1B2UA 3Q3FA 1LOYA 3DGYA 1X1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AY7 A;  1JBS A;  1BSE A;  1FW7 A;  1BU4 A;  1RTU A;  2F5M A;  2ZA4 A;  2KAA A;  3AHW A;  3D4A A;  1BNJ A;  1BRI A;  1I3F A;  2KF6 A;  1BNI A;  1RCK A;  5HOH A;  1MGR A;  5GSP A;  1RNT A;  1TRP A;  2RBI A;  3AHS A;  1RGA A;  1BGS A;  1FZU A;  1C54 A;  1MGW A;  1B3S A;  1B20 A;  1B2M A;  1Q9E A;  1CH0 A;  3BIR A;  1TTO A;  2HOH A;  4HOH A;  8RNT A;  2F4Y A;  1RGF A;  2AAE A;  1I2F A;  2BIR A;  1BOX A;  1BRK A;  3D5G A;  2GSP A;  3KCH A;  1RN1 A;  3D5I A;  1BAN A;  4J5K A;  1A2P A;  4BIR A;  4BU4 A;  7RNT A;  1RGE A;  1I2G A;  2BU4 A;  1RHL A;  1BAO A;  1BNG A;  7GSP A;  1BNR A;  1BVI A;  1I0X A;  1RSN A;  1UCK A;  1BRS A;  2F5W A;  1GMP A;  3A5E A;  5RNT A;  1BRJ A;  2RNT A;  1BSA A;  1I3I A;  1RCL A;  3AGO A;  2KF4 A;  1I0V A;  3RNT A;  1UCJ A;  1I2E A;  1G02 A;  1UCL A;  1DET A;  1GOY A;  1RGG A;  1RN4 A;  1UCI A;  1GMR A;  1RLS A;  4J5G A;  2KF3 A;  3WR2 A;  1GMQ A;  1FUS A;  1IYY A;  1GSP A;  1BIR A;  1T2I A;  2KF5 A;  6RNT A;  1YNV X;  3AGN A;  1B21 A;  1SAR A;  1BSD A;  9RNT A;  1BSC A;  1R4Y A;  1PYL A;  1I8V A;  1RDS A;  1B2S A;  1BRN L;  1FUT A;  1RGL A;  2C4B A;  1BNE A;  1HZ1 A;  1LOW A;  1B2X A;  1BUJ A;  2AAD A;  1JBR A;  5BIR A;  1RNB A;  4RNT A;  6GSP A;  1AQZ A;  1RGC A;  1BRG A;  1PY3 A;  3URP A;  1X1U A;  1BRH A;  3SYU A;  4GHO A;  1RMS A;  1TRQ A;  4HAA A;  1DE3 A;  1JBT A;  1X1Y A;  1YVS A;  5BU4 A;  1ZGX A;  1RGK A;  1T2H A;  3GSP A;  1GOU A;  1RGH A;  3DH2 A;  1GOV A;  3BU4 A;  3WHO A;  4GSP A;  1HYF A;  1FYS A;  1BSB A;  1X1W A;  2F56 A;  1BNS A;  1BNF A;  1B27 A;  2SAR A;  1LRA A;  3HOH A;  1YGW A;  1LNI A;  1I70 A;  1LOV A;  1B2Z A;  1B2U A;  3Q3F A;  1LOY A;  3DGY A;  1X1X A; 
#chains in the Genus database with same CATH topology
 1QAK A;  2SBL A;  4OUQ A;  1MWS A;  1IVX A;  4HM3 B;  3PXM A;  4XDW A;  1PU4 A;  2CWT A;  2KAA A;  1BRI A;  1MGR A;  1WMO A;  3CNM A;  4FCJ A;  4BTY A;  4EC6 A;  3BLZ A;  3NM2 A;  4LYL B;  1D6U A;  1BGS A;  1QJG A;  1VZZ A;  1FZU A;  1A2K A;  1MGW A;  1B3S A;  2M7O A;  1FUW A;  4HKV B;  3CCE 3;  3HI7 A;  1TP6 A;  2F4Y A;  1RGF A;  1I2F A;  3FF2 A;  1TU5 A;  5AYR B;  2W2C A;  4O02 B;  1BAN A;  3CC4 3;  4J5K A;  7RNT A;  3CNX A;  3DUK A;  4BIR A;  1SIH A;  3WOF B;  1I2G A;  5EEO A;  1RHL A;  3LXU X;  2RCD A;  1VQN 3;  1BNR A;  4GB5 A;  1I0X A;  2P0M A;  1O7H B;  2W0Q A;  3WMD A;  1OHP A;  4I4K A;  1YHQ 3;  1K73 4;  5RNT A;  1SJW A;  3K9M C;  1BRJ A;  4HM0 B;  2RNT A;  1BSA A;  1IU7 A;  3M8C A;  1RCL A;  1W01 A;  2YFI B;  3EB8 A;  1IQY A;  2KF4 A;  1YVB I;  1I0V A;  1TFK A;  2XGN A;  2Z7A A;  3FG1 A;  3RNT A;  1G02 A;  5IG4 A;  1JB5 A;  1ULJ B;  1LOX A;  1RGG A;  3JVC A;  2OTL 3;  2QGU A;  2QEX 3;  2OOV A;  3JUM A;  1YIJ 3;  1S72 3;  2CHC A;  4WWU C;  2LQV A;  2CFD A;  4EXR A;  2L1S A;  1GMQ A;  1FUS A;  2ML5 A;  1CYV A;  2OOV C;  2LYX A;  1BIR A;  3UL5 A;  2CK3 H;  3UJM A;  3VSY A;  3KKG A;  4NRE A;  3CCJ 3;  3OW2 2;  4L8O A;  3GZY B;  4ZM8 A;  2BHM A;  2GBX B;  2INX A;  5KP3 A;  4MJD A;  3G71 3;  1A2V A;  1YJ9 3;  1CYU A;  5IG0 A;  1PYL A;  2PNC A;  1GY6 A;  2CG1 A;  1STD A;  3SXX A;  3N9H A;  4WFO A;  1B2S A;  1MOL A;  1RGL A;  3PGB A;  4HM1 B;  3SOY A;  2KCD A;  4EW5 A;  3OXA A;  3CCQ 3;  3VF1 A;  2C4B A;  1FGQ A;  1RN7 A;  1BNE A;  3NX0 A;  3GRD A;  3NV0 A;  4R1K A;  4XB5 A;  3CPW 2;  1B2X A;  1AVK A;  1C7H A;  2AAD A;  2IUK A;  5DRV A;  1JRQ A;  4WHA A;  5BIR A;  3F9S A;  2ZL8 A;  1RNB A;  1M1X B;  2F86 B;  1PY3 A;  1W6G A;  3URP A;  1BRH A;  3RDE A;  3ZG5 A;  3DGN A;  3LTD A;  1D6Y A;  1IV7 A;  1X1Y A;  5BU4 A;  1N5H A;  3CME 3;  2RGQ A;  3BNB A;  3DY5 A;  3GSP A;  3SX1 A;  1RRL A;  4MMY B;  3GWR A;  3NV0 B;  3TDG A;  1FGO A;  2W04 A;  1JKG B;  2WOH A;  2XSO B;  3D9R A;  3F7X A;  3T8N A;  1W2B 2;  4K61 A;  1G0T A;  4JRF A;  1VQK 3;  4N6L A;  1B27 A;  3AMO A;  3HOH A;  4Q53 A;  4KVH A;  2BNG A;  1KWI A;  6STD A;  5G1K A;  1B2Z A;  1RKY A;  2P38 A;  3LH4 A;  2XFS A;  4EV5 A;  1W6C A;  1AY7 A;  1MNL A;  3DGL A;  3WA2 X;  1JZO A;  1BSE A;  2BMQ B;  1OH0 A;  1BU4 A;  1M9G A;  3LTB A;  4N6N B;  1Q86 4;  2F5M A;  3DZL A;  2XEP A;  1BNJ A;  1Z1S A;  3ZFZ A;  3PS8 A;  1NO3 A;  2KRT A;  1FA3 A;  5TGN A;  1TRP A;  3T8U A;  3DMC A;  5IF6 A;  1JN5 A;  3F8X A;  4X2H A;  5IEO A;  4WP5 A;  3CC7 3;  3RGA A;  1C54 A;  1KD1 4;  2STD A;  4KZ1 A;  1B2M A;  1Q9E A;  1CH0 A;  4N6M A;  4HOH A;  2V1L A;  3JUO A;  2K0M A;  8RNT A;  1WMN A;  5AEW B;  1BOX A;  3CMA 3;  5BVB A;  1O7G B;  3D5I A;  4KFE A;  4BU4 A;  1V74 A;  3WA3 A;  4N6O B;  2BU4 A;  1UI7 A;  1BAO A;  1BNG A;  2OTJ 3;  3EN8 A;  1LQG C;  1W4N A;  1AV4 A;  5DRE A;  2BT3 A;  3F8H A;  1BVI A;  3V99 A;  1JZD A;  1UCK A;  2Z76 A;  1L5G B;  3NHX A;  2XR8 B;  4HBR A;  2CC3 A;  1I3I A;  3KSP A;  1Q81 4;  1Q42 A;  3AGO A;  4IPB A;  5D81 A;  4AKZ A;  3U1W A;  1UCJ A;  4HYZ A;  1DYU A;  2OQE C;  3QRD A;  1UCL A;  4FMB A;  5D83 A;  1UCI A;  3Q1C A;  2GEY A;  3UL6 A;  1UGH I;  4J5G A;  3WOE B;  4HM8 B;  5G1L A;  3Q2P A;  3CC2 3;  1UW1 A;  1UGI A;  1GSP A;  2O3O A;  2KF5 A;  1FGR A;  2OCT A;  2CWU A;  3AGN A;  1OGZ A;  3EF8 A;  1RJO A;  2CWV A;  2OWP A;  5ELJ A;  1ROA A;  1R4Y A;  1N8Q A;  3A76 A;  3S27 A;  1IQ8 A;  2BO9 B;  4CDL A;  3JUQ A;  2FGT A;  4J9A A;  1JN5 B;  3PCS A;  1ULI B;  1JB4 A;  3KFQ C;  2HMO B;  3DGM A;  4U13 A;  3CU3 A;  1GY5 A;  1G96 A;  2GU3 A;  5AII A;  1EQK A;  1ZO2 A;  3LTA A;  1VQ9 3;  1VQP 3;  1VQQ A;  1HZ1 A;  4AKY A;  5CF2 A;  1IV9 A;  3IPT A;  1Q7H A;  3NQY A;  3S5C A;  2F98 A;  2IMJ A;  1OAC A;  4O2H A;  3CCV 3;  4RNT A;  1VQM 3;  2QIY A;  6GSP A;  1NU3 A;  1RGC A;  1BRG A;  4RNZ A;  1JKG A;  4GHO A;  2W9P A;  4NHF A;  4EV2 A;  4IIA A;  4HAA A;  4XM4 A;  2W56 A;  5AIF A;  3WOD G;  1DE3 A;  4DKI A;  2CG0 A;  3JUN A;  1T2H A;  3B4O A;  3J7Y d;  1RGH A;  2UGI A;  1HU9 A;  2P05 A;  2UX0 A;  1TJD A;  1VQO 3;  3WHO A;  3CCL 3;  2CIU A;  4GSP A;  2BMR B;  4J8T A;  3Q90 A;  5BXQ A;  1SII A;  1BSB A;  1X1W A;  2CH9 A;  3EN1 B;  2F56 A;  1BNS A;  1BNF A;  3CCU 3;  1TUH A;  7STD A;  2C10 A;  4H3U A;  3X40 A;  1JV2 B;  2GXF A;  2W03 A;  3GZB A;  1K8A 4;  1IVW A;  1LNI A;  3FG3 A;  3N8B A;  1A90 A;  1TFO A;  1UUG B;  3IJE B;  1W5Z A;  4FMD A;  2Y74 A;  1VQ4 3;  3Q3F A;  4HM7 B;  3L0R A;  1OHO A;  1EKM A;  3EHC A;  3LTC A;  1QAF A;  3QK9 A;  5CK6 A;  1JBS A;  1FW7 A;  2XFT A;  3NM7 A;  1N9E A;  4O8S A;  3FG4 A;  1QVG 2;  1ROV A;  2IYJ A;  3FF0 A;  3SOA A;  3D4A A;  1WMP A;  2KF6 A;  1O7M B;  3I55 3;  1VQL 3;  1VQ6 3;  4R9L A;  1E97 A;  3S28 A;  1DMQ A;  2B24 B;  3MG3 A;  2CFG A;  2FXT A;  3FKA A;  1GYB A;  1YJN 3;  1KC8 4;  4FR9 A;  3I0Y A;  1NNV A;  5JPP A;  3BB9 A;  5M18 A;  2A15 A;  2E2U A;  1B20 A;  1E3V A;  2R4I A;  4K90 B;  3LT9 A;  3BIR A;  1TTO A;  1QAL A;  2HOH A;  2I9W A;  3MPH A;  1QVF 2;  2AAE A;  1K28 A;  2BIR A;  2Z6B A;  2W56 B;  1RN1 A;  2O9U X;  3MKI A;  1NWW A;  1Q40 A;  1RGE A;  3F7S A;  2GU1 A;  5LC7 A;  2B1X B;  2WGQ A;  4O3V A;  1STF I;  3KN4 A;  1V58 A;  4MMZ B;  7GSP A;  1WTH A;  4G1M B;  1NB3 I;  2E2V A;  1BRS A;  1JB2 A;  1GMP A;  3A5E A;  3G16 A;  3HX8 A;  3OX9 A;  2QA4 3;  4KFF A;  2IA7 A;  1BUQ A;  2CX1 A;  1KQS 2;  1I2E A;  2W9Q A;  3F14 A;  3NQZ A;  1DET A;  5IW9 A;  3GAX A;  5LC6 A;  5IG5 A;  4LMI A;  5AYS C;  1RN4 A;  5EQL A;  1MWU A;  3NBJ A;  3B8L A;  3KZT A;  4HM5 B;  3WR2 A;  1YJW 3;  3B7C A;  4HZ9 B;  4LSO A;  5EVH A;  4LZI A;  3U97 A;  6RNT A;  5HGR A;  3OV4 A;  2CW9 A;  4QWT A;  5A0O B;  3CCR 3;  1OF5 A;  4XBX A;  5D82 A;  1ISK A;  4H61 A;  2HMK B;  2ZDJ A;  3EBY A;  4WYK A;  1WQL B;  2BMO B;  1NB5 I;  1I8V A;  2CFK A;  2D42 A;  1RDS A;  4KT3 B;  3SLU A;  3ROB A;  1W2Z A;  3BND A;  5ELU A;  1RRH A;  1UDI I;  2R41 A;  3IMA B;  4EBG A;  1M1K 4;  3MG2 A;  5I97 A;  1OCV A;  5AI1 A;  1BRN L;  3FGY A;  2HML B;  1W02 A;  2HMM B;  1YI2 3;  2IY2 A;  4GL6 A;  1EA2 A;  3LOY A;  1VQ8 3;  1ASK A;  1JBR A;  1N9J A;  4N3V A;  2CX0 A;  3EC9 A;  4PEJ A;  3HK4 A;  4XDV A;  3G6E 3;  1NJI 4;  4ILF A;  3G8Z A;  2MC8 A;  4CPK A;  1X1U A;  1DVD A;  3SYU A;  4CCV A;  1O7W B;  2H0H A;  3LYG A;  1JJ2 2;  1SQW A;  5FW5 A;  1IQX A;  5JBS A;  1ZGX A;  3X42 A;  1RGK A;  2KXG A;  1T5Y A;  1US1 A;  3DH2 A;  1GOV A;  3BU4 A;  2W6J H;  3X41 A;  3CXC 2;  1W6Y A;  3K5T A;  2JQ5 A;  4L7K A;  1OGX A;  3SVA A;  3NUV A;  2YX9 A;  2YFL B;  3EBT A;  3BNE A;  3DXO A;  2RFR A;  4HM4 B;  2JDI H;  1EEJ A;  4LEH A;  1MWR A;  3V92 A;  4HJL B;  4XBY A;  1Y4K A;  3D79 A;  4HM6 B;  1QMA A;  4BL2 A;  2P09 A;  1EG9 B;  3LT8 A;  2Z77 A;  4OK0 A;  3OWY A;  3X3Y A;  4R4K A;  1I70 A;  1LOV A;  8CHO A;  1M90 4;  5KP4 A;  1OF5 B;  1GS3 A;  1OUN A;  5AEU B;  1B2U A;  3DM8 A;  1LXE A;  3EX9 A;  4AEQ A;  3VGN A;  1X1X A;  3D5G A;  2CKF B;  3ALA A;  5CF1 A;  3MHE A;  1IVU A;  4K1V A;  1RTU A;  4BTW A;  1D6Z A;  2ZA4 A;  3JUP A;  3NBR A;  3NBB A;  3HZP A;  3K63 A;  3UNL A;  3AHW A;  2K54 A;  1I3F A;  4OVM A;  5HOH A;  2WO0 A;  1BNI A;  1RCK A;  1IT7 A;  3GZX B;  3KII A;  1LVN A;  5GSP A;  1RNT A;  1E3R A;  1EUI C;  3H3H A;  2RBI A;  3OWU A;  3STD A;  1MWT A;  3AHS A;  4RZM A;  3FLJ A;  5IG3 A;  1GD3 A;  1RGA A;  3CCM 3;  2XF3 A;  3F40 A;  4IT7 A;  1YGE A;  1Q82 4;  1VQ5 3;  3S29 A;  2YFJ B;  2E2T A;  2P0X A;  1BRK A;  2GSP A;  2J8X B;  3K7C A;  3KCH A;  2MF7 A;  1KSI A;  1K41 A;  1A2P A;  1OPY A;  2XSH B;  3FCS B;  3KSE D;  4XBT A;  5STD A;  4RBN A;  3B4P A;  1W7C A;  4FCM A;  2OQE A;  3DGO A;  3FZW A;  4BTX A;  1GY7 A;  2HMJ B;  5AIG A;  3X3Z A;  4ORL A;  4RNY A;  4BL3 A;  2GEX A;  1V57 A;  1RSN A;  1TIJ A;  4CJN A;  2F5W A;  2H0G A;  1F8N A;  1Q40 B;  1VQ7 3;  1IDP A;  1JNQ A;  1SPU A;  3CPO A;  3EJV A;  5G2G A;  2Y73 A;  1IK3 A;  2D1W A;  4NPB A;  4K1U A;  2Q07 A;  1GOY A;  4MMX B;  4N6T A;  2ML6 A;  1AVL A;  1GMR A;  1RLS A;  5IEN A;  3V98 A;  2KF3 A;  1W00 A;  2CFL A;  4I5Q A;  1IYY A;  3EE1 A;  3X3X A;  1T2I A;  1UUV B;  4FMC A;  1YNV X;  3ZG0 A;  1B21 A;  1SAR A;  1T3B A;  3LML A;  1FGM A;  1BSD A;  3PCR A;  2XRX B;  4EYC A;  1DMN A;  9RNT A;  1CEW I;  1BSC A;  3ECF A;  3GZR A;  5AIH A;  3WDG B;  1HKX A;  4FMA A;  3G0K A;  3I56 3;  1AR0 A;  3KE7 A;  5M19 A;  1R4C A;  5FGO A;  1FUT A;  4JF8 A;  3N54 B;  3OWS A;  1NDO B;  4WYK B;  5IEP A;  1LQM B;  5M1A A;  1O7N B;  1LOW A;  2C11 A;  1BUJ A;  1N8R 4;  2L4V A;  4X2O A;  3MSO A;  5CXO A;  3RGR A;  2CFW A;  2GBW B;  1UUW B;  2UUG C;  2K3D A;  4R80 A;  1AQZ A;  4STD A;  4R9K A;  3FH1 A;  3ER7 A;  5JPU A;  3PYJ A;  1RMS A;  5CLK A;  1TRQ A;  2FNQ A;  4N6V 0;  1U5O A;  4HVN A;  1JBT A;  1YVS A;  3LZA A;  2RSX A;  3CD6 3;  3D3L A;  1N5P A;  1DMM A;  1Q7Y 4;  1U8C B;  1GOU A;  1GD4 A;  4L8P A;  3PZW A;  3O8Y A;  4HZB B;  4FCZ A;  3S67 A;  3SED A;  3UB1 A;  3T0U A;  3G4S 3;  3BNC A;  2IUJ A;  5IER A;  3MYT A;  4TX4 A;  2H0I A;  2XGL A;  1HYF A;  1WNH A;  3HIG A;  1FYS A;  2PZV A;  2HMN B;  4MEI A;  1K9M 4;  4LGQ A;  1DVC A;  2WGO A;  3H51 A;  3NXJ A;  1CQS A;  2SAR A;  2XH9 A;  1LRA A;  1O7P B;  1ZS7 A;  3CCS 3;  1FGT A;  3EQQ B;  5KP1 A;  3K0Z A;  1IVV A;  1YIT 3;  1UI8 A;  1J2B A;  1YGW A;  4N6U A;  1ZX2 A;  2WOF A;  1IT8 A;  3FSD A;  4KFD A;  2F99 A;  1LNH A;  1PFP A;  1S5A A;  1OHS A;  3E99 A;  3HII A;  3MWZ A;  4HM2 B;  1A67 A;  1LOY A;  3MG1 A;  2ZHX B;  3AMO B;  3DGY A; 
#chains in the Genus database with same CATH homology
 1AY7 A;  1JBS A;  1BSE A;  1FW7 A;  1BU4 A;  1RTU A;  2F5M A;  2ZA4 A;  2KAA A;  3AHW A;  3D4A A;  1BNJ A;  1BRI A;  1I3F A;  2KF6 A;  1BNI A;  1RCK A;  5HOH A;  1MGR A;  5GSP A;  1RNT A;  1TRP A;  2RBI A;  3AHS A;  1RGA A;  1BGS A;  1FZU A;  1C54 A;  1MGW A;  1B3S A;  1B20 A;  1B2M A;  1Q9E A;  1CH0 A;  3BIR A;  1TTO A;  2HOH A;  4HOH A;  8RNT A;  2F4Y A;  1RGF A;  2AAE A;  1I2F A;  2BIR A;  1BOX A;  1BRK A;  3D5G A;  2GSP A;  3KCH A;  1RN1 A;  3D5I A;  1BAN A;  4J5K A;  1A2P A;  4BIR A;  4BU4 A;  7RNT A;  1RGE A;  1I2G A;  2BU4 A;  1RHL A;  1BAO A;  1BNG A;  7GSP A;  1BNR A;  1BVI A;  1I0X A;  1RSN A;  1UCK A;  1BRS A;  2F5W A;  1GMP A;  3A5E A;  5RNT A;  1BRJ A;  2RNT A;  1BSA A;  1I3I A;  1RCL A;  3AGO A;  2KF4 A;  1I0V A;  3RNT A;  1UCJ A;  1I2E A;  1G02 A;  1UCL A;  1DET A;  1GOY A;  1RGG A;  1RN4 A;  1UCI A;  1GMR A;  1RLS A;  4J5G A;  2KF3 A;  3WR2 A;  1GMQ A;  1FUS A;  1IYY A;  1GSP A;  1BIR A;  1T2I A;  2KF5 A;  6RNT A;  1YNV X;  3AGN A;  1B21 A;  1SAR A;  1BSD A;  9RNT A;  1BSC A;  1R4Y A;  1PYL A;  1I8V A;  1RDS A;  1B2S A;  1BRN L;  1FUT A;  1RGL A;  2C4B A;  1BNE A;  1HZ1 A;  1LOW A;  1B2X A;  1BUJ A;  2AAD A;  1JBR A;  5BIR A;  1RNB A;  4RNT A;  6GSP A;  1AQZ A;  1RGC A;  1BRG A;  1PY3 A;  3URP A;  1X1U A;  1BRH A;  3SYU A;  4GHO A;  1RMS A;  1TRQ A;  4HAA A;  1DE3 A;  1JBT A;  1X1Y A;  1YVS A;  5BU4 A;  1ZGX A;  1RGK A;  1T2H A;  3GSP A;  1GOU A;  1RGH A;  3DH2 A;  1GOV A;  3BU4 A;  3WHO A;  4GSP A;  1HYF A;  1FYS A;  1BSB A;  1X1W A;  2F56 A;  1BNS A;  1BNF A;  1B27 A;  2SAR A;  1LRA A;  3HOH A;  1YGW A;  1LNI A;  1I70 A;  1LOV A;  1B2Z A;  1B2U A;  3Q3F A;  1LOY A;  3DGY A;  1X1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...