1N5HA

Solution structure of the cathelin-like domain of protegrins (the r87-p88 and d118-p119 amide bonds are in the cis conformation)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
105
structure length
105
Chain Sequence
GSHMQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords protegrins
publication title NMR Structure of the Cathelin-like domain of the protegrin-3 Precursor
pubmed doi rcsb
source organism Sus scrofa
total genus 21
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1n5hA00
1CEWI 4N6TA 4CCVA 3S67A 1A90A 5EQLA 1DVCA 1CYVA 1GD3A 3SVAA 1CYUA 4N6NB 1N5PA 1WNHA 2KXGA 4IT7A 2W9PA 3MWZA 1YVBI 3QRDA 1TIJA 2BO9B 1EQKA 1A67A 1NB3I 5A0OB 1N9JA 1FA3A 4EYCA 3PYJA 1G96A 1M9GA 1NB5I 1KWIA 1RN7A 4N6UA 1FUWA 3UL6A 3KSED 1MNLA 1MOLA 1LXEA 3K9MC 4ZM8A 1GD4A 3PXMA 1PFPA 4N6MA 2O9UX 2OCTA 5LC7A 4TX4A 5ELJA 1STFI 3Q2PA 2CH9A 4N6V0 1DVDA 5ELUA 3L0RA 3GAXA 5LC6A 3PS8A 1N5HA 3KFQC 1ROAA 3LH4A 4N6OB 4N6LA 3UL5A 2W9QA 1IV9A 3IMAB 3NX0A 1IV7A 1R4CA 4LZIA
chains in the Genus database with same CATH superfamily
1BNGA 1BRKA 1TRQA 1LRAA 2GEYA 4WYKA 1BUJA 4R9KA 3DMCA 1AVKA 2GU3A 3Q3FA 4HM1B 2MC8A 3H3HA 1JBTA 1JZOA 1A90A 1CQSA 3DGNA 1UUGB 1K41A 1B3SA 5EVHA 2RNTA 2V1LA 4MMXB 1QVG2 5IG5A 1US1A 4CDLA 3NUVA 4HJLB 1YJN3 3X42A 1W00A 2MF7A 3G16A 3OXAA 6GSPA 5G2GA 2CFDA 2WGOA 2BMOB 3WR2A 2KXGA 2PZVA 3MG1A 1Q864 1OF5A 1OGZA 3AMOB 1VQQA 1I3FA 3AMOA 3QRDA 1JBSA 3BLZA 2ZA4A 1EQKA 3LTDA 4O3VA 3KN4A 1IDPA 5AI1A 4EC6A 3V99A 1U5OA 1FYSA 1Z1SA 4GHOA 4EXRA 3BIRA 4HM2B 4NPBA 1HU9A 1F8NA 4QWTA 3B8LA 1HYFA 1VQ73 3PYJA 2XSOB 4RNTA 4EW5A 4KT3B 3I563 3DY5A 3EC9A 3ALAA 2OQEC 2XSHB 3DGLA 2L1SA 1LNHA 1O7MB 3GZRA 2F4YA 3D5GA 1W02A 1TFKA 1GSPA 2GXFA 1RGHA 5BIRA 4RZMA 2J8XB 4HZ9B 4LEHA 1GMPA 5IEPA 1Q40B 2C4BA 1Q40A 3BNEA 2CFLA 4DKIA 1UUVB 4AKZA 3HZPA 1O7NB 4BTXA 3V92A 4AEQA 3EN1B 3X41A 4FR9A 2OCTA 2OWPA 3WA3A 4HZBB 1BNRA 3BNCA 3FF0A 2KF5A 4FCZA 1ULJB 2I9WA 1YVSA 1VZZA 1N8R4 3F7XA 2XGNA 2YFIB 3CME3 4BU4A 3CCQ3 3Q2PA 4N3VA 4L7KA 4O8SA 3SYUA 1T2HA 1VQM3 1BGSA 2LYXA 1EG9B 1G02A 2YFLB 4I5QA 3T8NA 3X40A 1QAKA 1IVWA 3CPW2 1ASKA 4BL2A 1BNSA 3L0RA 1JN5B 3B7CA 1BRHA 1RKYA 5IENA 3K5TA 2IUKA 3K7CA 1YNVX 5AIIA 4IIAA 3FF2A 1W6GA 4KFDA 3EN8A 1Q7Y4 3CCM3 1O7WB 1SQWA 3F7SA 2ZL8A 4RBNA 4WHAA 1YHQ3 3SLUA 1FUTA 3NM2A 1N5HA 3AHSA 2W6JH 4X2OA 3NV0B 1NJI4 1GY5A 3NV0A 1W2B2 2HMJB 3LH4A 2CWVA 3KE7A 4FMDA 4N6OB 2E2UA 4O2HA 1JB5A 1BRSA 4N6LA 3S29A 1SARA 3MSOA 3M8CA 4OK0A 6RNTA 2RFRA 3NHXA 1IV9A 3EBYA 1DMNA 2XFTA 3NX0A 1DE3A 2QIYA 3LYGA 3FLJA 2HOHA 1B2SA 1NO3A 2IMJA 2K54A 1R4CA 3GSPA 1V74A 1EUIC 2XGLA 4N6TA 3LXUX 1B2UA 1NU3A 4CCVA 2IA7A 1UGHI 3HIIA 4EBGA 1VQO3 4H3UA 1BSAA 1BSEA 4H61A 3KZTA 3DUKA 1WMOA 4K1UA 4R9LA 4BTWA 3CC43 2E2VA 1QVF2 2Y74A 1BIRA 1YIJ3 1UGIA 3SVAA 2XEPA 5AEWB 4XDWA 3CCE3 2INXA 3BB9A 7GSPA 1VQ53 4N6NB 3BNDA 1BNEA 2WOFA 1GOVA 3JUOA 1RRLA 3BNBA 1TTOA 2CX1A 2D42A 3I553 2BO9B 3DXOA 4HM5B 1JJ22 3G6E3 4HKVB 1A67A 1OH0A 2SBLA 1TUHA 1N8QA 1NB3I 1GOYA 2HMOB 2IYJA 1N9JA 3JUNA 3NBRA 2RGQA 3NXJA 2R4IA 5A0OB 1KD14 2CWTA 5AIFA 3EB8A 1UI7A 5KP4A 1T5YA 1W7CA 1GYBA 2H0GA 2OOVA 3CCR3 2BMQB 2F5MA 1RMSA 3WOFB 3HOHA 1FGRA 2CFGA 2F5WA 1RGKA 2ML6A 3SOYA 2CG0A 3EQQB 1MWTA 2W04A 1BANA 3UNLA 1RJOA 2P09A 1BRJA 1OACA 5DREA 3VSYA 8RNTA 3CCS3 1B2ZA 1JRQA 5D82A 1VQL3 2OTJ3 1M1K4 2GBWB 4IPBA 2ZHXB 5IG4A 1WQLB 1IVXA 4MJDA 1AY7A 3ZG5A 1BVIA 3DGOA 2WOHA 4J5KA 3O8YA 1LXEA 3K9MC 2C11A 1L5GB 3CCV3 2RBIA 2GU1A 2KF6A 2CC3A 3S28A 1PFPA 1DETA 3B4OA 2O9UX 3FGYA 1PY3A 4J9AA 5IG3A 1EA2A 3D5IA 4HM7B 4TX4A 5AIHA 5CF1A 1AVLA 3HK4A 3JUQA 3DGMA 3KKGA 4XM4A 3FH1A 1RTUA 2SARA 3LTCA 1GY7A 2JDIH 1ZO2A 1BNIA 2CH9A 3LTBA 4STDA 1OGXA 4N6V0 4ILFA 1OCVA 4LGQA 1DVDA 2A15A 2L4VA 5I97A 1ISKA 3OWYA 1IQ8A 2ML5A 3G0KA 5ELUA 4AKYA 1OHPA 2UGIA 1Q9EA 1BAOA 5AYSC 4R80A 1X1WA 1HKXA 1W4NA 1W5ZA 4FMBA 2LQVA 1YGWA 4BL3A 5GSPA 5KP1A 3PCRA 1RNTA 1DYUA 1JB4A 5M19A 1VQ63 3ROBA 3SXXA 4RNZA 5M1AA 1G0TA 3K0ZA 3KFQC 4FMAA 4HYZA 1DMQA 1ROAA 1BOXA 1NWWA 1O7GB 2KCDA 1JB2A 1QAFA 1UCKA 2P0MA 3MG3A 3D4AA 1JBRA 3UL5A 3K63A 4HM6B 3JVCA 5EEOA 3CMA3 2W9QA 3IMAB 5JBSA 1QALA 4J5GA 3UJMA 3T0UA 3KSPA 3FG4A 1SPUA 2WGQA 4HM3B 1W01A 1IV7A 2F86B 2RSXA 4JRFA 2ZDJA 1IVUA 5TGNA 1JN5A 4LYLB 1PYLA 1MWSA 3FG3A 5JPUA 1K734 1VQ83 2GEXA 2QEX3 3RDEA 1C7HA 4HM4B 3T8UA 3ZFZA 4NHFA 2Y73A 3EBTA 1O7HB 1BSDA 1RSNA 3NQYA 1BU4A 1RGEA 2OTL3 3AHWA 1DVCA 3RNTA 1M1XB 2H0HA 3LOYA 4XBTA 1B21A 1X1XA 1CYVA 1RGGA 2HMKB 3GRDA 1BRIA 1CYUA 1TJDA 3ER7A 2IY2A 4HVNA 5CXOA 1ZS7A 1N5PA 1WNHA 4XBYA 5IEOA 2P05A 3MG2A 3D3LA 5M18A 1S5AA 2W9PA 5D83A 3S27A 1TIJA 1KSIA 1W6CA 2QA43 1IYYA 1TFOA 2XF3A 3CU3A 1FZUA 1X1UA 4J8TA 5FGOA 3S5CA 3TDGA 1FGQA 3LT8A 3H51A 4KFFA 1IT7A 2F56A 2KF3A 3Q1CA 1FA3A 1TP6A 1E97A 1LOVA 2F99A 1RGCA 5DRVA 1UCLA 1JKGB 1JKGA 3MKIA 1I0VA 5D81A 1YGEA 1RLSA 5AIGA 1AR0A 3EX9A 1M9GA 1TRPA 1GS3A 4KVHA 1ZX2A 1AQZA 7STDA 1NB5I 3GZXB 1RN7A 1VQN3 3ZG0A 1ULIB 2O3OA 3D9RA 5HOHA 1ROVA 1FUWA 3UL6A 3EE1A 3LTAA 3AGNA 1LOXA 3N9HA 3MHEA 1Q7HA 1MNLA 3CCJ3 5CK6A 4WFOA 3WDGB 1BRNL 1E3RA 3CD63 1QMAA 1UCIA 3FSDA 2W0QA 1FUSA 3PXMA 4N6MA 1W2ZA 3NBBA 3QK9A 3PZWA 1RCLA 1RN4A 1TU5A 2WO0A 3G8ZA 2W56B 1LOWA 2W56A 3SOAA 8CHOA 3LMLA 5ELJA 1IQXA 3UB1A 2UUGC 4RNYA 3DH2A 5BU4A 1I2GA 3NM7A 2AADA 2CWUA 2F98A 2HMNB 1YJW3 1VQ93 2BU4A 4KZ1A 2CX0A 1K9M4 2OQEA 4U13A 3LT9A 2CHCA 1I3IA 1FGMA 3A76A 3CCL3 4K90B 4L8OA 1DMMA 1WTHA 1NDOB 1RDSA 3F8XA 1PU4A 1WMPA 3WODG 2K3DA 1IQYA 3SEDA 4XBXA 1YIT3 4WYKB 1FGOA 2B1XB 4FCJA 3CPOA 2K0MA 1A2KA 4I4KA 4WWUC 2CW9A 3OV4A 2HMLB 3G713 1Y4KA 3F14A 1JV2B 1A2VA 1LOYA 3F40A 1BNJA 4O02B 1S723 1U8CB 1BRGA 7RNTA 4FCMA 3PCSA 4LZIA 1LQGC 1V58A 2M7OA 5IW9A 1D6ZA 1BSCA 3MYTA 2BIRA 3WOEB 1I8VA 3OX9A 4LMIA 1LNIA 3JUPA 5BVBA 4GB5A 1OF5B 3SX1A 2KRTA 1IU7A 2RCDA 2JQ5A 1SIIA 3HI7A 1OPYA 3OWSA 3LZAA 2OOVC 4MEIA 4PEJA 4HAAA 2FXTA 3FCSB 3IJEB 4MMYB 4ORLA 3STDA 3WMDA 1K8A4 3WHOA 5G1KA 1CEWI 1CH0A 1JZDA 1EEJA 2XFSA 2Z7AA 1GMRA 1RGAA 3NBJA 4NREA 3S67A 5JPPA 3X3ZA 1OUNA 1D6UA 1Q814 4XB5A 1IT8A 1EKMA 3ECFA 5EQLA 1VQK3 3MPHA 1KQS2 3GWRA 1MWUA 1GD3A 3N8BA 3B4PA 3G4S3 3U1WA 4JF8A 1R4YA 2R41A 3BU4A 1T3BA 3CNXA 3U97A 4CJNA 1VQ43 2XH9A 2CFWA 3HX8A 1B2XA 4R1KA 3F9SA 4IT7A 1I2EA 2CIUA 2KF4A 3MWZA 1BNFA 1YVBI 1O7PB 2CKFB 4R4KA 3GZYB 1BUQA 1V57A 1E3VA 1I70A 2Z76A 3RGRA 4EV2A 1UCJA 5IG0A 1Q824 2E2TA 3V98A 4X2HA 1C54A 3E99A 4EYCA 4Q53A 1GY6A 5AYRB 3CCU3 1WMNA 3CC23 1W6YA 1FGTA 1OHSA 1B20A 1G96A 1YI23 2GBXB 1RCKA 3CNMA 1SIHA 1KWIA 4N6UA 4CPKA 1JNQA 1B27A 5HGRA 5IERA 3NQZA 1BSBA 4BTYA 2YX9A 3KSED 4L8PA 1UDII 2STDA 1AV4A 2QGUA 1STDA 3FKAA 5IF6A 3X3XA 1M904 1MOLA 1B2MA 5CF2A 2W2CA 3PGBA 2BNGA 3WA2X 1HZ1A 2XRXB 4ZM8A 2YFJB 1OHOA 1GD4A 3DZLA 3X3YA 1FW7A 3FZWA 3FG1A 4G1MB 1YJ93 1RNBA 1MWRA 1GOUA 5LC7A 1KC84 3A5EA 2Z6BA 1RHLA 3Q90A 4K61A 3DM8A 3VF1A 4KFEA 2IUJA 2Q07A 4OVMA 4FMCA 3J7Yd 1STFI 1K28A 4XDVA 5RNTA 5KP3A 1NNVA 3EF8A 5FW5A 1MGWA 2Z77A 2BT3A 4MMZB 2XR8B 3AGOA 3EJVA 2P0XA 1X1YA 2W03A 4GSPA 4HM0B 4OUQA 5CLKA 2B24B 3GAXA 1LVNA 3OW22 2PNCA 3EHCA 2P38A 2CK3H 4HBRA 2H0IA 4LSOA 3IPTA 5LC6A 4EV5A 1GMQA 1RN1A 2GSPA 5BXQA 1RRHA 3PS8A 2KAAA 4HM8B 1D6YA 3RGAA 1RGLA 1T2IA 4WP5A 1IVVA 2UX0A 2D1WA 3N54B 2BMRB 1SJWA 4GL6A 1Q42A 1ZGXA 1J2BA 3URPA 2FGTA 3I0YA 1IK3A 1I0XA 1UUWB 3F8HA 3GZBA 4HOHA 6STDA 3JUMA 3CXC2 1UW1A 3OWUA 2CG1A 1LQMB 3VGNA 1I2FA 1A2PA 1UI8A 2FNQA 3DGYA 5STDA 1RGFA 2AAEA 1N9EA 3KIIA 3KCHA 4K1VA 5AEUB 2BHMA 2HMMB 5G1LA 3CC73 1MGRA 2C10A 3D79A 9RNTA 4BIRA 1VQP3 3HIGA 1QJGA 2CFKA
chains in the Genus database with same CATH topology
4WYKA 2GEYA 4R9KA 3DMCA 1AVKA 2GU3A 4HM1B 2MC8A 3H3HA 1A90A 1CQSA 3DGNA 1K41A 5EVHA 1QVG2 2V1LA 4MMXB 5IG5A 1US1A 4CDLA 3NUVA 4HJLB 1YJN3 3X42A 1W00A 2MF7A 3G16A 3OXAA 5G2GA 2CFDA 2WGOA 2BMOB 1Q864 2KXGA 2PZVA 3MG1A 1OF5A 1OGZA 3AMOB 3AMOA 3QRDA 3BLZA 1EQKA 3LTDA 4O3VA 3KN4A 1IDPA 5AI1A 4EC6A 3V99A 1U5OA 1Z1SA 4EXRA 4HM2B 1HU9A 1F8NA 4QWTA 3B8LA 1VQ73 3PYJA 2XSOB 3I563 3DY5A 3EC9A 3ALAA 2OQEC 2XSHB 3DGLA 1LNHA 1O7MB 3GZRA 1W02A 1TFKA 2GXFA 4RZMA 4HZ9B 4LEHA 5IEPA 1Q40B 3BNEA 1Q40A 2CFLA 1UUVB 4AKZA 3HZPA 1O7NB 4BTXA 3V92A 4AEQA 3EN1B 3X41A 4FR9A 2OCTA 2OWPA 3WA3A 4HZBB 3BNCA 3FF0A 4FCZA 1ULJB 2I9WA 1VZZA 1N8R4 3F7XA 2XGNA 2YFIB 3CME3 3CCQ3 3Q2PA 4N3VA 4L7KA 4O8SA 1VQM3 2LYXA 1EG9B 2YFLB 3T8NA 3X40A 1QAKA 1IVWA 3CPW2 1ASKA 3L0RA 1JN5B 3B7CA 1RKYA 5IENA 3K5TA 2IUKA 3K7CA 5AIIA 4IIAA 3FF2A 1W6GA 4KFDA 3EN8A 1Q7Y4 3CCM3 1O7WB 1SQWA 3F7SA 2ZL8A 4RBNA 4WHAA 1YHQ3 3SLUA 3NM2A 1N5HA 2W6JH 4X2OA 3NV0B 1NJI4 1GY5A 3NV0A 1W2B2 2HMJB 3LH4A 2CWVA 3KE7A 4FMDA 4N6OB 2E2UA 4O2HA 1JB5A 4N6LA 3S29A 3MSOA 4OK0A 3M8CA 2RFRA 3NHXA 1IV9A 3EBYA 1DMNA 2XFTA 3NX0A 2QIYA 3LYGA 3FLJA 2IMJA 1NO3A 2K54A 1R4CA 1V74A 2XGLA 4N6TA 3LXUX 1NU3A 4CCVA 2IA7A 3HIIA 4EBGA 1VQO3 4H3UA 4H61A 3KZTA 3DUKA 1WMOA 4K1UA 4R9LA 4BTWA 3CC43 2E2VA 1QVF2 2Y74A 1YIJ3 5AEWB 3SVAA 2XEPA 4XDWA 3CCE3 2INXA 3BB9A 1VQ53 4N6NB 3BNDA 2WOFA 3JUOA 1RRLA 3BNBA 2D42A 3I553 2BO9B 3DXOA 4HM5B 1JJ22 3G6E3 4HKVB 1A67A 1OH0A 2SBLA 1TUHA 1N8QA 1NB3I 2HMOB 3NBRA 1N9JA 3JUNA 3NXJA 2RGQA 5A0OB 2R4IA 1KD14 2CWTA 5AIFA 3EB8A 1UI7A 5KP4A 1T5YA 1W7CA 1GYBA 2OOVA 3CCR3 2BMQB 3WOFB 1FGRA 2CFGA 3SOYA 2ML6A 2CG0A 3EQQB 2W04A 3UNLA 1RJOA 2P09A 1OACA 5DREA 3VSYA 3CCS3 1VQL3 1JRQA 1BUQA 5D82A 2OTJ3 1M1K4 2GBWB 4IPBA 5IG4A 1WQLB 1IVXA 4MJDA 3DGOA 2WOHA 3O8YA 1LXEA 3K9MC 2C11A 1L5GB 3CCV3 2GU1A 2CC3A 3S28A 1PFPA 3B4OA 2O9UX 3FGYA 4J9AA 5IG3A 1EA2A 4HM7B 4TX4A 5AIHA 5CF1A 1AVLA 3HK4A 3JUQA 3DGMA 3KKGA 4XM4A 3FH1A 3LTCA 1GY7A 2JDIH 1ZO2A 2CH9A 3LTBA 4STDA 1OGXA 4N6V0 1OCVA 4LGQA 1DVDA 2A15A 2L4VA 5I97A 1ISKA 3OWYA 1IQ8A 2ML5A 3G0KA 5ELUA 4AKYA 1OHPA 5AYSC 4R80A 1HKXA 1W4NA 1W5ZA 4FMBA 2LQVA 5KP1A 3PCRA 1DYUA 1JB4A 1VQ63 3ROBA 3SXXA 4RNZA 3CCU3 3K0ZA 3KFQC 4FMAA 4HYZA 1DMQA 1ROAA 1NWWA 1O7GB 2P0MA 2KCDA 1JB2A 1QAFA 3MG3A 3UL5A 3K63A 4HM6B 3JVCA 5EEOA 3CMA3 2W9QA 3IMAB 5JBSA 1QALA 3UJMA 3T0UA 3KSPA 3FG4A 1SPUA 2WGQA 4HM3B 1W01A 1IV7A 2F86B 2RSXA 4JRFA 2ZDJA 1IVUA 5TGNA 1JN5A 5JPUA 3FG3A 1K734 1VQ83 2GEXA 2QEX3 3RDEA 1C7HA 4HM4B 3T8UA 4NHFA 2Y73A 3EBTA 1O7HB 3NQYA 1DVCA 1M1XB 3LOYA 4XBTA 1CYVA 2HMKB 3GRDA 1CYUA 3ER7A 4HVNA 5CXOA 1N5PA 1WNHA 4XBYA 5IEOA 2P05A 3MG2A 3D3LA 1S5AA 2W9PA 5D83A 3S27A 1TIJA 1KSIA 1W6CA 2QA43 1TFOA 2XF3A 3CU3A 4J8TA 5FGOA 3TDGA 3S5CA 1FGQA 3LT8A 3H51A 4KFFA 1IT7A 3Q1CA 1FA3A 1TP6A 1E97A 2F99A 5DRVA 1JKGB 1JKGA 3MKIA 5D81A 1YGEA 5AIGA 1AR0A 3EX9A 1M9GA 4KVHA 1GS3A 7STDA 1ZX2A 1NB5I 1VQN3 3GZXB 1RN7A 1ULIB 2O3OA 3D9RA 1FUWA 1ROVA 3UL6A 3EE1A 3LTAA 1LOXA 3N9HA 3MHEA 1MNLA 3CCJ3 5CK6A 4WFOA 3WDGB 1E3RA 3CD63 1QMAA 3FSDA 2W0QA 3PXMA 4N6MA 1W2ZA 3NBBA 3QK9A 3PZWA 1TU5A 2WO0A 3G8ZA 2W56B 2W56A 3SOAA 8CHOA 3LMLA 5ELJA 1IQXA 3UB1A 4RNYA 3NM7A 2F98A 2CWUA 2HMNB 1YJW3 1VQ93 4KZ1A 1K9M4 2OQEA 4U13A 3LT9A 2CHCA 1FGMA 3A76A 3CCL3 4K90B 4L8OA 1DMMA 1WTHA 1NDOB 3F8XA 1PU4A 1WMPA 3WODG 1IQYA 3SEDA 4XBXA 1YIT3 4WYKB 1FGOA 2B1XB 4FCJA 3CPOA 2K0MA 1A2KA 4I4KA 4WWUC 2CW9A 3OV4A 2HMLB 3G713 1Y4KA 3F14A 1JV2B 1A2VA 3F40A 4O02B 1S723 1U8CB 4FCMA 3PCSA 4LZIA 2M7OA 5IW9A 1D6ZA 3MYTA 3WOEB 3OX9A 4LMIA 5BVBA 3JUPA 4GB5A 1OF5B 3SX1A 2KRTA 1IU7A 2RCDA 2JQ5A 1SIIA 3HI7A 1OPYA 3OWSA 3LZAA 2OOVC 4MEIA 4PEJA 2FXTA 3FCSB 3IJEB 4MMYB 4ORLA 3STDA 3WMDA 1K8A4 1CEWI 2Z7AA 2XFSA 4NREA 3NBJA 5JPPA 3S67A 3X3ZA 1OUNA 1D6UA 1Q814 4XB5A 1IT8A 1EKMA 3ECFA 5EQLA 1VQK3 3MPHA 1KQS2 3GWRA 1GD3A 3N8BA 3B4PA 3G4S3 3U1WA 4JF8A 3CNXA 3U97A 1VQ43 2XH9A 2CFWA 3HX8A 4R1KA 3F9SA 4IT7A 2CIUA 3MWZA 1YVBI 1O7PB 2CKFB 4R4KA 3GZYB 1E3VA 2Z76A 3RGRA 4EV2A 5IG0A 1Q824 2E2TA 3V98A 4X2HA 3E99A 4EYCA 4Q53A 1GY6A 5AYRB 1WMNA 3CC23 1W6YA 1FGTA 1OHSA 1G96A 1YI23 2GBXB 3CNMA 1SIHA 1KWIA 4N6UA 1JNQA 5HGRA 5IERA 3NQZA 4BTYA 2YX9A 3KSED 4L8PA 2STDA 1AV4A 2QGUA 1STDA 3FKAA 5IF6A 3X3XA 1M904 1MOLA 5CF2A 2W2CA 3PGBA 2BNGA 3WA2X 2XRXB 4ZM8A 2YFJB 1OHOA 1GD4A 3DZLA 3X3YA 3FZWA 3FG1A 4G1MB 1YJ93 5LC7A 1KC84 2Z6BA 3Q90A 4K61A 3DM8A 3VF1A 4KFEA 2IUJA 2Q07A 4OVMA 4FMCA 3J7Yd 1STFI 1K28A 4XDVA 5KP3A 3EF8A 5FW5A 2Z77A 2BT3A 4MMZB 2XR8B 3EJVA 2P0XA 2W03A 5CLKA 4HM0B 4OUQA 2B24B 3GAXA 1LVNA 3OW22 2PNCA 3EHCA 2P38A 2CK3H 4HBRA 4LSOA 3IPTA 5LC6A 4EV5A 5BXQA 1RRHA 3PS8A 4HM8B 1D6YA 3RGAA 4WP5A 1IVVA 2UX0A 2D1WA 3N54B 2BMRB 1SJWA 4GL6A 1Q42A 1J2BA 2FGTA 3I0YA 1IK3A 1UUWB 6STDA 3F8HA 3GZBA 3CXC2 3JUMA 1UW1A 3OWUA 2CG1A 3VGNA 1UI8A 2FNQA 5STDA 2OTL3 3KIIA 1N9EA 4K1VA 5AEUB 2BHMA 2HMMB 3CC73 2C10A 1VQP3 3HIGA 1QJGA 2CFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEW I;  4N6T A;  4CCV A;  3S67 A;  1A90 A;  5EQL A;  1DVC A;  1CYV A;  1GD3 A;  3SVA A;  1CYU A;  4N6N B;  1N5P A;  1WNH A;  2KXG A;  4IT7 A;  2W9P A;  3MWZ A;  1YVB I;  3QRD A;  1TIJ A;  2BO9 B;  1EQK A;  1A67 A;  1NB3 I;  5A0O B;  1N9J A;  1FA3 A;  4EYC A;  3PYJ A;  1G96 A;  1M9G A;  1NB5 I;  1KWI A;  1RN7 A;  4N6U A;  1FUW A;  3UL6 A;  3KSE D;  1MNL A;  1MOL A;  1LXE A;  3K9M C;  4ZM8 A;  1GD4 A;  3PXM A;  1PFP A;  4N6M A;  2O9U X;  2OCT A;  5LC7 A;  4TX4 A;  5ELJ A;  1STF I;  3Q2P A;  2CH9 A;  4N6V 0;  1DVD A;  5ELU A;  3L0R A;  3GAX A;  5LC6 A;  3PS8 A;  1N5H A;  3KFQ C;  1ROA A;  3LH4 A;  4N6O B;  4N6L A;  3UL5 A;  2W9Q A;  1IV9 A;  3IMA B;  3NX0 A;  1IV7 A;  1R4C A;  4LZI A; 
#chains in the Genus database with same CATH topology
 1BNG A;  1BRK A;  1TRQ A;  1LRA A;  2GEY A;  4WYK A;  1BUJ A;  4R9K A;  3DMC A;  1AVK A;  2GU3 A;  3Q3F A;  4HM1 B;  2MC8 A;  3H3H A;  1JBT A;  1JZO A;  1A90 A;  1CQS A;  3DGN A;  1UUG B;  1K41 A;  1B3S A;  5EVH A;  2RNT A;  2V1L A;  4MMX B;  1QVG 2;  5IG5 A;  1US1 A;  4CDL A;  3NUV A;  4HJL B;  1YJN 3;  3X42 A;  1W00 A;  2MF7 A;  3G16 A;  3OXA A;  6GSP A;  5G2G A;  2CFD A;  2WGO A;  2BMO B;  3WR2 A;  2KXG A;  2PZV A;  3MG1 A;  1Q86 4;  1OF5 A;  1OGZ A;  3AMO B;  1VQQ A;  1I3F A;  3AMO A;  3QRD A;  1JBS A;  3BLZ A;  2ZA4 A;  1EQK A;  3LTD A;  4O3V A;  3KN4 A;  1IDP A;  5AI1 A;  4EC6 A;  3V99 A;  1U5O A;  1FYS A;  1Z1S A;  4GHO A;  4EXR A;  3BIR A;  4HM2 B;  4NPB A;  1HU9 A;  1F8N A;  4QWT A;  3B8L A;  1HYF A;  1VQ7 3;  3PYJ A;  2XSO B;  4RNT A;  4EW5 A;  4KT3 B;  3I56 3;  3DY5 A;  3EC9 A;  3ALA A;  2OQE C;  2XSH B;  3DGL A;  2L1S A;  1LNH A;  1O7M B;  3GZR A;  2F4Y A;  3D5G A;  1W02 A;  1TFK A;  1GSP A;  2GXF A;  1RGH A;  5BIR A;  4RZM A;  2J8X B;  4HZ9 B;  4LEH A;  1GMP A;  5IEP A;  1Q40 B;  2C4B A;  1Q40 A;  3BNE A;  2CFL A;  4DKI A;  1UUV B;  4AKZ A;  3HZP A;  1O7N B;  4BTX A;  3V92 A;  4AEQ A;  3EN1 B;  3X41 A;  4FR9 A;  2OCT A;  2OWP A;  3WA3 A;  4HZB B;  1BNR A;  3BNC A;  3FF0 A;  2KF5 A;  4FCZ A;  1ULJ B;  2I9W A;  1YVS A;  1VZZ A;  1N8R 4;  3F7X A;  2XGN A;  2YFI B;  3CME 3;  4BU4 A;  3CCQ 3;  3Q2P A;  4N3V A;  4L7K A;  4O8S A;  3SYU A;  1T2H A;  1VQM 3;  1BGS A;  2LYX A;  1EG9 B;  1G02 A;  2YFL B;  4I5Q A;  3T8N A;  3X40 A;  1QAK A;  1IVW A;  3CPW 2;  1ASK A;  4BL2 A;  1BNS A;  3L0R A;  1JN5 B;  3B7C A;  1BRH A;  1RKY A;  5IEN A;  3K5T A;  2IUK A;  3K7C A;  1YNV X;  5AII A;  4IIA A;  3FF2 A;  1W6G A;  4KFD A;  3EN8 A;  1Q7Y 4;  3CCM 3;  1O7W B;  1SQW A;  3F7S A;  2ZL8 A;  4RBN A;  4WHA A;  1YHQ 3;  3SLU A;  1FUT A;  3NM2 A;  1N5H A;  3AHS A;  2W6J H;  4X2O A;  3NV0 B;  1NJI 4;  1GY5 A;  3NV0 A;  1W2B 2;  2HMJ B;  3LH4 A;  2CWV A;  3KE7 A;  4FMD A;  4N6O B;  2E2U A;  4O2H A;  1JB5 A;  1BRS A;  4N6L A;  3S29 A;  1SAR A;  3MSO A;  3M8C A;  4OK0 A;  6RNT A;  2RFR A;  3NHX A;  1IV9 A;  3EBY A;  1DMN A;  2XFT A;  3NX0 A;  1DE3 A;  2QIY A;  3LYG A;  3FLJ A;  2HOH A;  1B2S A;  1NO3 A;  2IMJ A;  2K54 A;  1R4C A;  3GSP A;  1V74 A;  1EUI C;  2XGL A;  4N6T A;  3LXU X;  1B2U A;  1NU3 A;  4CCV A;  2IA7 A;  1UGH I;  3HII A;  4EBG A;  1VQO 3;  4H3U A;  1BSA A;  1BSE A;  4H61 A;  3KZT A;  3DUK A;  1WMO A;  4K1U A;  4R9L A;  4BTW A;  3CC4 3;  2E2V A;  1QVF 2;  2Y74 A;  1BIR A;  1YIJ 3;  1UGI A;  3SVA A;  2XEP A;  5AEW B;  4XDW A;  3CCE 3;  2INX A;  3BB9 A;  7GSP A;  1VQ5 3;  4N6N B;  3BND A;  1BNE A;  2WOF A;  1GOV A;  3JUO A;  1RRL A;  3BNB A;  1TTO A;  2CX1 A;  2D42 A;  3I55 3;  2BO9 B;  3DXO A;  4HM5 B;  1JJ2 2;  3G6E 3;  4HKV B;  1A67 A;  1OH0 A;  2SBL A;  1TUH A;  1N8Q A;  1NB3 I;  1GOY A;  2HMO B;  2IYJ A;  1N9J A;  3JUN A;  3NBR A;  2RGQ A;  3NXJ A;  2R4I A;  5A0O B;  1KD1 4;  2CWT A;  5AIF A;  3EB8 A;  1UI7 A;  5KP4 A;  1T5Y A;  1W7C A;  1GYB A;  2H0G A;  2OOV A;  3CCR 3;  2BMQ B;  2F5M A;  1RMS A;  3WOF B;  3HOH A;  1FGR A;  2CFG A;  2F5W A;  1RGK A;  2ML6 A;  3SOY A;  2CG0 A;  3EQQ B;  1MWT A;  2W04 A;  1BAN A;  3UNL A;  1RJO A;  2P09 A;  1BRJ A;  1OAC A;  5DRE A;  3VSY A;  8RNT A;  3CCS 3;  1B2Z A;  1JRQ A;  5D82 A;  1VQL 3;  2OTJ 3;  1M1K 4;  2GBW B;  4IPB A;  2ZHX B;  5IG4 A;  1WQL B;  1IVX A;  4MJD A;  1AY7 A;  3ZG5 A;  1BVI A;  3DGO A;  2WOH A;  4J5K A;  3O8Y A;  1LXE A;  3K9M C;  2C11 A;  1L5G B;  3CCV 3;  2RBI A;  2GU1 A;  2KF6 A;  2CC3 A;  3S28 A;  1PFP A;  1DET A;  3B4O A;  2O9U X;  3FGY A;  1PY3 A;  4J9A A;  5IG3 A;  1EA2 A;  3D5I A;  4HM7 B;  4TX4 A;  5AIH A;  5CF1 A;  1AVL A;  3HK4 A;  3JUQ A;  3DGM A;  3KKG A;  4XM4 A;  3FH1 A;  1RTU A;  2SAR A;  3LTC A;  1GY7 A;  2JDI H;  1ZO2 A;  1BNI A;  2CH9 A;  3LTB A;  4STD A;  1OGX A;  4N6V 0;  4ILF A;  1OCV A;  4LGQ A;  1DVD A;  2A15 A;  2L4V A;  5I97 A;  1ISK A;  3OWY A;  1IQ8 A;  2ML5 A;  3G0K A;  5ELU A;  4AKY A;  1OHP A;  2UGI A;  1Q9E A;  1BAO A;  5AYS C;  4R80 A;  1X1W A;  1HKX A;  1W4N A;  1W5Z A;  4FMB A;  2LQV A;  1YGW A;  4BL3 A;  5GSP A;  5KP1 A;  3PCR A;  1RNT A;  1DYU A;  1JB4 A;  5M19 A;  1VQ6 3;  3ROB A;  3SXX A;  4RNZ A;  5M1A A;  1G0T A;  3K0Z A;  3KFQ C;  4FMA A;  4HYZ A;  1DMQ A;  1ROA A;  1BOX A;  1NWW A;  1O7G B;  2KCD A;  1JB2 A;  1QAF A;  1UCK A;  2P0M A;  3MG3 A;  3D4A A;  1JBR A;  3UL5 A;  3K63 A;  4HM6 B;  3JVC A;  5EEO A;  3CMA 3;  2W9Q A;  3IMA B;  5JBS A;  1QAL A;  4J5G A;  3UJM A;  3T0U A;  3KSP A;  3FG4 A;  1SPU A;  2WGQ A;  4HM3 B;  1W01 A;  1IV7 A;  2F86 B;  2RSX A;  4JRF A;  2ZDJ A;  1IVU A;  5TGN A;  1JN5 A;  4LYL B;  1PYL A;  1MWS A;  3FG3 A;  5JPU A;  1K73 4;  1VQ8 3;  2GEX A;  2QEX 3;  3RDE A;  1C7H A;  4HM4 B;  3T8U A;  3ZFZ A;  4NHF A;  2Y73 A;  3EBT A;  1O7H B;  1BSD A;  1RSN A;  3NQY A;  1BU4 A;  1RGE A;  2OTL 3;  3AHW A;  1DVC A;  3RNT A;  1M1X B;  2H0H A;  3LOY A;  4XBT A;  1B21 A;  1X1X A;  1CYV A;  1RGG A;  2HMK B;  3GRD A;  1BRI A;  1CYU A;  1TJD A;  3ER7 A;  2IY2 A;  4HVN A;  5CXO A;  1ZS7 A;  1N5P A;  1WNH A;  4XBY A;  5IEO A;  2P05 A;  3MG2 A;  3D3L A;  5M18 A;  1S5A A;  2W9P A;  5D83 A;  3S27 A;  1TIJ A;  1KSI A;  1W6C A;  2QA4 3;  1IYY A;  1TFO A;  2XF3 A;  3CU3 A;  1FZU A;  1X1U A;  4J8T A;  5FGO A;  3S5C A;  3TDG A;  1FGQ A;  3LT8 A;  3H51 A;  4KFF A;  1IT7 A;  2F56 A;  2KF3 A;  3Q1C A;  1FA3 A;  1TP6 A;  1E97 A;  1LOV A;  2F99 A;  1RGC A;  5DRV A;  1UCL A;  1JKG B;  1JKG A;  3MKI A;  1I0V A;  5D81 A;  1YGE A;  1RLS A;  5AIG A;  1AR0 A;  3EX9 A;  1M9G A;  1TRP A;  1GS3 A;  4KVH A;  1ZX2 A;  1AQZ A;  7STD A;  1NB5 I;  3GZX B;  1RN7 A;  1VQN 3;  3ZG0 A;  1ULI B;  2O3O A;  3D9R A;  5HOH A;  1ROV A;  1FUW A;  3UL6 A;  3EE1 A;  3LTA A;  3AGN A;  1LOX A;  3N9H A;  3MHE A;  1Q7H A;  1MNL A;  3CCJ 3;  5CK6 A;  4WFO A;  3WDG B;  1BRN L;  1E3R A;  3CD6 3;  1QMA A;  1UCI A;  3FSD A;  2W0Q A;  1FUS A;  3PXM A;  4N6M A;  1W2Z A;  3NBB A;  3QK9 A;  3PZW A;  1RCL A;  1RN4 A;  1TU5 A;  2WO0 A;  3G8Z A;  2W56 B;  1LOW A;  2W56 A;  3SOA A;  8CHO A;  3LML A;  5ELJ A;  1IQX A;  3UB1 A;  2UUG C;  4RNY A;  3DH2 A;  5BU4 A;  1I2G A;  3NM7 A;  2AAD A;  2CWU A;  2F98 A;  2HMN B;  1YJW 3;  1VQ9 3;  2BU4 A;  4KZ1 A;  2CX0 A;  1K9M 4;  2OQE A;  4U13 A;  3LT9 A;  2CHC A;  1I3I A;  1FGM A;  3A76 A;  3CCL 3;  4K90 B;  4L8O A;  1DMM A;  1WTH A;  1NDO B;  1RDS A;  3F8X A;  1PU4 A;  1WMP A;  3WOD G;  2K3D A;  1IQY A;  3SED A;  4XBX A;  1YIT 3;  4WYK B;  1FGO A;  2B1X B;  4FCJ A;  3CPO A;  2K0M A;  1A2K A;  4I4K A;  4WWU C;  2CW9 A;  3OV4 A;  2HML B;  3G71 3;  1Y4K A;  3F14 A;  1JV2 B;  1A2V A;  1LOY A;  3F40 A;  1BNJ A;  4O02 B;  1S72 3;  1U8C B;  1BRG A;  7RNT A;  4FCM A;  3PCS A;  4LZI A;  1LQG C;  1V58 A;  2M7O A;  5IW9 A;  1D6Z A;  1BSC A;  3MYT A;  2BIR A;  3WOE B;  1I8V A;  3OX9 A;  4LMI A;  1LNI A;  3JUP A;  5BVB A;  4GB5 A;  1OF5 B;  3SX1 A;  2KRT A;  1IU7 A;  2RCD A;  2JQ5 A;  1SII A;  3HI7 A;  1OPY A;  3OWS A;  3LZA A;  2OOV C;  4MEI A;  4PEJ A;  4HAA A;  2FXT A;  3FCS B;  3IJE B;  4MMY B;  4ORL A;  3STD A;  3WMD A;  1K8A 4;  3WHO A;  5G1K A;  1CEW I;  1CH0 A;  1JZD A;  1EEJ A;  2XFS A;  2Z7A A;  1GMR A;  1RGA A;  3NBJ A;  4NRE A;  3S67 A;  5JPP A;  3X3Z A;  1OUN A;  1D6U A;  1Q81 4;  4XB5 A;  1IT8 A;  1EKM A;  3ECF A;  5EQL A;  1VQK 3;  3MPH A;  1KQS 2;  3GWR A;  1MWU A;  1GD3 A;  3N8B A;  3B4P A;  3G4S 3;  3U1W A;  4JF8 A;  1R4Y A;  2R41 A;  3BU4 A;  1T3B A;  3CNX A;  3U97 A;  4CJN A;  1VQ4 3;  2XH9 A;  2CFW A;  3HX8 A;  1B2X A;  4R1K A;  3F9S A;  4IT7 A;  1I2E A;  2CIU A;  2KF4 A;  3MWZ A;  1BNF A;  1YVB I;  1O7P B;  2CKF B;  4R4K A;  3GZY B;  1BUQ A;  1V57 A;  1E3V A;  1I70 A;  2Z76 A;  3RGR A;  4EV2 A;  1UCJ A;  5IG0 A;  1Q82 4;  2E2T A;  3V98 A;  4X2H A;  1C54 A;  3E99 A;  4EYC A;  4Q53 A;  1GY6 A;  5AYR B;  3CCU 3;  1WMN A;  3CC2 3;  1W6Y A;  1FGT A;  1OHS A;  1B20 A;  1G96 A;  1YI2 3;  2GBX B;  1RCK A;  3CNM A;  1SIH A;  1KWI A;  4N6U A;  4CPK A;  1JNQ A;  1B27 A;  5HGR A;  5IER A;  3NQZ A;  1BSB A;  4BTY A;  2YX9 A;  3KSE D;  4L8P A;  1UDI I;  2STD A;  1AV4 A;  2QGU A;  1STD A;  3FKA A;  5IF6 A;  3X3X A;  1M90 4;  1MOL A;  1B2M A;  5CF2 A;  2W2C A;  3PGB A;  2BNG A;  3WA2 X;  1HZ1 A;  2XRX B;  4ZM8 A;  2YFJ B;  1OHO A;  1GD4 A;  3DZL A;  3X3Y A;  1FW7 A;  3FZW A;  3FG1 A;  4G1M B;  1YJ9 3;  1RNB A;  1MWR A;  1GOU A;  5LC7 A;  1KC8 4;  3A5E A;  2Z6B A;  1RHL A;  3Q90 A;  4K61 A;  3DM8 A;  3VF1 A;  4KFE A;  2IUJ A;  2Q07 A;  4OVM A;  4FMC A;  3J7Y d;  1STF I;  1K28 A;  4XDV A;  5RNT A;  5KP3 A;  1NNV A;  3EF8 A;  5FW5 A;  1MGW A;  2Z77 A;  2BT3 A;  4MMZ B;  2XR8 B;  3AGO A;  3EJV A;  2P0X A;  1X1Y A;  2W03 A;  4GSP A;  4HM0 B;  4OUQ A;  5CLK A;  2B24 B;  3GAX A;  1LVN A;  3OW2 2;  2PNC A;  3EHC A;  2P38 A;  2CK3 H;  4HBR A;  2H0I A;  4LSO A;  3IPT A;  5LC6 A;  4EV5 A;  1GMQ A;  1RN1 A;  2GSP A;  5BXQ A;  1RRH A;  3PS8 A;  2KAA A;  4HM8 B;  1D6Y A;  3RGA A;  1RGL A;  1T2I A;  4WP5 A;  1IVV A;  2UX0 A;  2D1W A;  3N54 B;  2BMR B;  1SJW A;  4GL6 A;  1Q42 A;  1ZGX A;  1J2B A;  3URP A;  2FGT A;  3I0Y A;  1IK3 A;  1I0X A;  1UUW B;  3F8H A;  3GZB A;  4HOH A;  6STD A;  3JUM A;  3CXC 2;  1UW1 A;  3OWU A;  2CG1 A;  1LQM B;  3VGN A;  1I2F A;  1A2P A;  1UI8 A;  2FNQ A;  3DGY A;  5STD A;  1RGF A;  2AAE A;  1N9E A;  3KII A;  3KCH A;  4K1V A;  5AEU B;  2BHM A;  2HMM B;  5G1L A;  3CC7 3;  1MGR A;  2C10 A;  3D79 A;  9RNT A;  4BIR A;  1VQP 3;  3HIG A;  1QJG A;  2CFK A; 
#chains in the Genus database with same CATH homology
 4WYK A;  2GEY A;  4R9K A;  3DMC A;  1AVK A;  2GU3 A;  4HM1 B;  2MC8 A;  3H3H A;  1A90 A;  1CQS A;  3DGN A;  1K41 A;  5EVH A;  1QVG 2;  2V1L A;  4MMX B;  5IG5 A;  1US1 A;  4CDL A;  3NUV A;  4HJL B;  1YJN 3;  3X42 A;  1W00 A;  2MF7 A;  3G16 A;  3OXA A;  5G2G A;  2CFD A;  2WGO A;  2BMO B;  1Q86 4;  2KXG A;  2PZV A;  3MG1 A;  1OF5 A;  1OGZ A;  3AMO B;  3AMO A;  3QRD A;  3BLZ A;  1EQK A;  3LTD A;  4O3V A;  3KN4 A;  1IDP A;  5AI1 A;  4EC6 A;  3V99 A;  1U5O A;  1Z1S A;  4EXR A;  4HM2 B;  1HU9 A;  1F8N A;  4QWT A;  3B8L A;  1VQ7 3;  3PYJ A;  2XSO B;  3I56 3;  3DY5 A;  3EC9 A;  3ALA A;  2OQE C;  2XSH B;  3DGL A;  1LNH A;  1O7M B;  3GZR A;  1W02 A;  1TFK A;  2GXF A;  4RZM A;  4HZ9 B;  4LEH A;  5IEP A;  1Q40 B;  3BNE A;  1Q40 A;  2CFL A;  1UUV B;  4AKZ A;  3HZP A;  1O7N B;  4BTX A;  3V92 A;  4AEQ A;  3EN1 B;  3X41 A;  4FR9 A;  2OCT A;  2OWP A;  3WA3 A;  4HZB B;  3BNC A;  3FF0 A;  4FCZ A;  1ULJ B;  2I9W A;  1VZZ A;  1N8R 4;  3F7X A;  2XGN A;  2YFI B;  3CME 3;  3CCQ 3;  3Q2P A;  4N3V A;  4L7K A;  4O8S A;  1VQM 3;  2LYX A;  1EG9 B;  2YFL B;  3T8N A;  3X40 A;  1QAK A;  1IVW A;  3CPW 2;  1ASK A;  3L0R A;  1JN5 B;  3B7C A;  1RKY A;  5IEN A;  3K5T A;  2IUK A;  3K7C A;  5AII A;  4IIA A;  3FF2 A;  1W6G A;  4KFD A;  3EN8 A;  1Q7Y 4;  3CCM 3;  1O7W B;  1SQW A;  3F7S A;  2ZL8 A;  4RBN A;  4WHA A;  1YHQ 3;  3SLU A;  3NM2 A;  1N5H A;  2W6J H;  4X2O A;  3NV0 B;  1NJI 4;  1GY5 A;  3NV0 A;  1W2B 2;  2HMJ B;  3LH4 A;  2CWV A;  3KE7 A;  4FMD A;  4N6O B;  2E2U A;  4O2H A;  1JB5 A;  4N6L A;  3S29 A;  3MSO A;  4OK0 A;  3M8C A;  2RFR A;  3NHX A;  1IV9 A;  3EBY A;  1DMN A;  2XFT A;  3NX0 A;  2QIY A;  3LYG A;  3FLJ A;  2IMJ A;  1NO3 A;  2K54 A;  1R4C A;  1V74 A;  2XGL A;  4N6T A;  3LXU X;  1NU3 A;  4CCV A;  2IA7 A;  3HII A;  4EBG A;  1VQO 3;  4H3U A;  4H61 A;  3KZT A;  3DUK A;  1WMO A;  4K1U A;  4R9L A;  4BTW A;  3CC4 3;  2E2V A;  1QVF 2;  2Y74 A;  1YIJ 3;  5AEW B;  3SVA A;  2XEP A;  4XDW A;  3CCE 3;  2INX A;  3BB9 A;  1VQ5 3;  4N6N B;  3BND A;  2WOF A;  3JUO A;  1RRL A;  3BNB A;  2D42 A;  3I55 3;  2BO9 B;  3DXO A;  4HM5 B;  1JJ2 2;  3G6E 3;  4HKV B;  1A67 A;  1OH0 A;  2SBL A;  1TUH A;  1N8Q A;  1NB3 I;  2HMO B;  3NBR A;  1N9J A;  3JUN A;  3NXJ A;  2RGQ A;  5A0O B;  2R4I A;  1KD1 4;  2CWT A;  5AIF A;  3EB8 A;  1UI7 A;  5KP4 A;  1T5Y A;  1W7C A;  1GYB A;  2OOV A;  3CCR 3;  2BMQ B;  3WOF B;  1FGR A;  2CFG A;  3SOY A;  2ML6 A;  2CG0 A;  3EQQ B;  2W04 A;  3UNL A;  1RJO A;  2P09 A;  1OAC A;  5DRE A;  3VSY A;  3CCS 3;  1VQL 3;  1JRQ A;  1BUQ A;  5D82 A;  2OTJ 3;  1M1K 4;  2GBW B;  4IPB A;  5IG4 A;  1WQL B;  1IVX A;  4MJD A;  3DGO A;  2WOH A;  3O8Y A;  1LXE A;  3K9M C;  2C11 A;  1L5G B;  3CCV 3;  2GU1 A;  2CC3 A;  3S28 A;  1PFP A;  3B4O A;  2O9U X;  3FGY A;  4J9A A;  5IG3 A;  1EA2 A;  4HM7 B;  4TX4 A;  5AIH A;  5CF1 A;  1AVL A;  3HK4 A;  3JUQ A;  3DGM A;  3KKG A;  4XM4 A;  3FH1 A;  3LTC A;  1GY7 A;  2JDI H;  1ZO2 A;  2CH9 A;  3LTB A;  4STD A;  1OGX A;  4N6V 0;  1OCV A;  4LGQ A;  1DVD A;  2A15 A;  2L4V A;  5I97 A;  1ISK A;  3OWY A;  1IQ8 A;  2ML5 A;  3G0K A;  5ELU A;  4AKY A;  1OHP A;  5AYS C;  4R80 A;  1HKX A;  1W4N A;  1W5Z A;  4FMB A;  2LQV A;  5KP1 A;  3PCR A;  1DYU A;  1JB4 A;  1VQ6 3;  3ROB A;  3SXX A;  4RNZ A;  3CCU 3;  3K0Z A;  3KFQ C;  4FMA A;  4HYZ A;  1DMQ A;  1ROA A;  1NWW A;  1O7G B;  2P0M A;  2KCD A;  1JB2 A;  1QAF A;  3MG3 A;  3UL5 A;  3K63 A;  4HM6 B;  3JVC A;  5EEO A;  3CMA 3;  2W9Q A;  3IMA B;  5JBS A;  1QAL A;  3UJM A;  3T0U A;  3KSP A;  3FG4 A;  1SPU A;  2WGQ A;  4HM3 B;  1W01 A;  1IV7 A;  2F86 B;  2RSX A;  4JRF A;  2ZDJ A;  1IVU A;  5TGN A;  1JN5 A;  5JPU A;  3FG3 A;  1K73 4;  1VQ8 3;  2GEX A;  2QEX 3;  3RDE A;  1C7H A;  4HM4 B;  3T8U A;  4NHF A;  2Y73 A;  3EBT A;  1O7H B;  3NQY A;  1DVC A;  1M1X B;  3LOY A;  4XBT A;  1CYV A;  2HMK B;  3GRD A;  1CYU A;  3ER7 A;  4HVN A;  5CXO A;  1N5P A;  1WNH A;  4XBY A;  5IEO A;  2P05 A;  3MG2 A;  3D3L A;  1S5A A;  2W9P A;  5D83 A;  3S27 A;  1TIJ A;  1KSI A;  1W6C A;  2QA4 3;  1TFO A;  2XF3 A;  3CU3 A;  4J8T A;  5FGO A;  3TDG A;  3S5C A;  1FGQ A;  3LT8 A;  3H51 A;  4KFF A;  1IT7 A;  3Q1C A;  1FA3 A;  1TP6 A;  1E97 A;  2F99 A;  5DRV A;  1JKG B;  1JKG A;  3MKI A;  5D81 A;  1YGE A;  5AIG A;  1AR0 A;  3EX9 A;  1M9G A;  4KVH A;  1GS3 A;  7STD A;  1ZX2 A;  1NB5 I;  1VQN 3;  3GZX B;  1RN7 A;  1ULI B;  2O3O A;  3D9R A;  1FUW A;  1ROV A;  3UL6 A;  3EE1 A;  3LTA A;  1LOX A;  3N9H A;  3MHE A;  1MNL A;  3CCJ 3;  5CK6 A;  4WFO A;  3WDG B;  1E3R A;  3CD6 3;  1QMA A;  3FSD A;  2W0Q A;  3PXM A;  4N6M A;  1W2Z A;  3NBB A;  3QK9 A;  3PZW A;  1TU5 A;  2WO0 A;  3G8Z A;  2W56 B;  2W56 A;  3SOA A;  8CHO A;  3LML A;  5ELJ A;  1IQX A;  3UB1 A;  4RNY A;  3NM7 A;  2F98 A;  2CWU A;  2HMN B;  1YJW 3;  1VQ9 3;  4KZ1 A;  1K9M 4;  2OQE A;  4U13 A;  3LT9 A;  2CHC A;  1FGM A;  3A76 A;  3CCL 3;  4K90 B;  4L8O A;  1DMM A;  1WTH A;  1NDO B;  3F8X A;  1PU4 A;  1WMP A;  3WOD G;  1IQY A;  3SED A;  4XBX A;  1YIT 3;  4WYK B;  1FGO A;  2B1X B;  4FCJ A;  3CPO A;  2K0M A;  1A2K A;  4I4K A;  4WWU C;  2CW9 A;  3OV4 A;  2HML B;  3G71 3;  1Y4K A;  3F14 A;  1JV2 B;  1A2V A;  3F40 A;  4O02 B;  1S72 3;  1U8C B;  4FCM A;  3PCS A;  4LZI A;  2M7O A;  5IW9 A;  1D6Z A;  3MYT A;  3WOE B;  3OX9 A;  4LMI A;  5BVB A;  3JUP A;  4GB5 A;  1OF5 B;  3SX1 A;  2KRT A;  1IU7 A;  2RCD A;  2JQ5 A;  1SII A;  3HI7 A;  1OPY A;  3OWS A;  3LZA A;  2OOV C;  4MEI A;  4PEJ A;  2FXT A;  3FCS B;  3IJE B;  4MMY B;  4ORL A;  3STD A;  3WMD A;  1K8A 4;  1CEW I;  2Z7A A;  2XFS A;  4NRE A;  3NBJ A;  5JPP A;  3S67 A;  3X3Z A;  1OUN A;  1D6U A;  1Q81 4;  4XB5 A;  1IT8 A;  1EKM A;  3ECF A;  5EQL A;  1VQK 3;  3MPH A;  1KQS 2;  3GWR A;  1GD3 A;  3N8B A;  3B4P A;  3G4S 3;  3U1W A;  4JF8 A;  3CNX A;  3U97 A;  1VQ4 3;  2XH9 A;  2CFW A;  3HX8 A;  4R1K A;  3F9S A;  4IT7 A;  2CIU A;  3MWZ A;  1YVB I;  1O7P B;  2CKF B;  4R4K A;  3GZY B;  1E3V A;  2Z76 A;  3RGR A;  4EV2 A;  5IG0 A;  1Q82 4;  2E2T A;  3V98 A;  4X2H A;  3E99 A;  4EYC A;  4Q53 A;  1GY6 A;  5AYR B;  1WMN A;  3CC2 3;  1W6Y A;  1FGT A;  1OHS A;  1G96 A;  1YI2 3;  2GBX B;  3CNM A;  1SIH A;  1KWI A;  4N6U A;  1JNQ A;  5HGR A;  5IER A;  3NQZ A;  4BTY A;  2YX9 A;  3KSE D;  4L8P A;  2STD A;  1AV4 A;  2QGU A;  1STD A;  3FKA A;  5IF6 A;  3X3X A;  1M90 4;  1MOL A;  5CF2 A;  2W2C A;  3PGB A;  2BNG A;  3WA2 X;  2XRX B;  4ZM8 A;  2YFJ B;  1OHO A;  1GD4 A;  3DZL A;  3X3Y A;  3FZW A;  3FG1 A;  4G1M B;  1YJ9 3;  5LC7 A;  1KC8 4;  2Z6B A;  3Q90 A;  4K61 A;  3DM8 A;  3VF1 A;  4KFE A;  2IUJ A;  2Q07 A;  4OVM A;  4FMC A;  3J7Y d;  1STF I;  1K28 A;  4XDV A;  5KP3 A;  3EF8 A;  5FW5 A;  2Z77 A;  2BT3 A;  4MMZ B;  2XR8 B;  3EJV A;  2P0X A;  2W03 A;  5CLK A;  4HM0 B;  4OUQ A;  2B24 B;  3GAX A;  1LVN A;  3OW2 2;  2PNC A;  3EHC A;  2P38 A;  2CK3 H;  4HBR A;  4LSO A;  3IPT A;  5LC6 A;  4EV5 A;  5BXQ A;  1RRH A;  3PS8 A;  4HM8 B;  1D6Y A;  3RGA A;  4WP5 A;  1IVV A;  2UX0 A;  2D1W A;  3N54 B;  2BMR B;  1SJW A;  4GL6 A;  1Q42 A;  1J2B A;  2FGT A;  3I0Y A;  1IK3 A;  1UUW B;  6STD A;  3F8H A;  3GZB A;  3CXC 2;  3JUM A;  1UW1 A;  3OWU A;  2CG1 A;  3VGN A;  1UI8 A;  2FNQ A;  5STD A;  2OTL 3;  3KII A;  1N9E A;  4K1V A;  5AEU B;  2BHM A;  2HMM B;  3CC7 3;  2C10 A;  1VQP 3;  3HIG A;  1QJG A;  2CFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...