3DGMA

2.4 a structure of a non-biological atp binding protein with adp bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP Binding Protein-DX
publication title A Primordial ATP Binding Protein Generated from Random Sequence Origin
rcsb
source organism Unidentified
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dgmA00
3LT8A 2P09A 3LTAA 1UW1A 3LTCA 2P0XA 3LT9A 3LTDA 3DGLA 3LTBA 3DGNA 2P05A 3DGOA 3DGMA
chains in the Genus database with same CATH superfamily
3D5IA 4EYCA 2Z6BA 1K734 3Q1CA 3IJEB 3MG1A 3F40A 2CFLA 2KXGA 1RGEA 2HOHA 4X2OA 1B21A 3EF8A 2LQVA 4FCMA 1Q814 2BT3A 1W00A 5DRVA 3ECFA 3ER7A 3HX8A 2WO0A 4J9AA 5M19A 5TGNA 1CEWI 1W02A 4HZ9B 4N6LA 1N5PA 3F8HA 3AGOA 3FH1A 2HMNB 3CU3A 1G96A 3LOYA 3NX0A 2HMLB 3FG1A 1JKGA 1RGGA 4HM1B 3TDGA 1LOYA 9RNTA 1SPUA 1VQ63 1VQQA 1ZS7A 2CW9A 5BXQA 3K9MC 1RDSA 2RGQA 1TU5A 4K1VA 1GMPA 1W4NA 2V1LA 1IV7A 2YFJB 1NWWA 4HM4B 2Q07A 1IVXA 3JUPA 3DZLA 3S5CA 1BSCA 3HOHA 3KE7A 1X1UA 3MSOA 3DGMA 4K61A 4HBRA 3T8UA 3CC43 2MC8A 2SARA 1RRLA 3A76A 3B4OA 2BHMA 4TX4A 5AYSC 4MJDA 1D6YA 1Q42A 4U13A 1RGCA 4HM5B 5IW9A 1VQK3 1N8R4 1VQ53 4OK0A 1BSAA 2F86B 1UW1A 1YGEA 4KZ1A 1N5HA 3MKIA 4KFFA 3G0KA 2BMQB 3JUOA 1JKGB 1Q40A 3V98A 5IEOA 4HM3B 1OF5A 2INXA 3MG2A 3MG3A 4LEHA 1SQWA 2P09A 3Q90A 2K0MA 1US1A 4N3VA 1ZO2A 1C7HA 1YGWA 8RNTA 2QGUA 3F7SA 3H51A 4Q53A 1MWUA 3NQYA 4K90B 1IU7A 1GYBA 4GHOA 5LC7A 1Q824 1BRJA 1YI23 5CK6A 3FF2A 3H3HA 3NQZA 2CWUA 1I0XA 2JQ5A 2ZHXB 3AMOA 1LOWA 3WODG 1S5AA 3MYTA 5M1AA 1W7CA 1IV9A 2GU1A 1U5OA 2BMOB 4R4KA 3DGYA 2PNCA 3DUKA 3MWZA 4O02B 1Q40B 2YFLB 5AI1A 3CPW2 2GEXA 3NBBA 1K41A 1OF5B 3KSPA 1FW7A 1WMOA 4J5KA 3G713 2KF5A 2UGIA 5HGRA 2Y74A 1BNFA 1E3VA 1FGRA 1WTHA 2D42A 3GZYB 3LXUX 3NUVA 1KC84 5IENA 3HI7A 1WMPA 1MWSA 4JRFA 1CYVA 2J8XB 2RBIA 3S27A 1RGHA 1FA3A 4OUQA 5AEUB 2O3OA 1JB4A 3KZTA 1OHOA 1NB5I 3EC9A 1B2ZA 2KAAA 3EBYA 1RN7A 4LZIA 1W2B2 3AMOB 3X42A 1BANA 3BB9A 4N6OB 4HM6B 2CWTA 5G2GA 4KFEA 1I2EA 4DKIA 1YNVX 4K1UA 3PGBA 1FGOA 4WP5A 1BRSA 2K3DA 3CCM3 1VQ93 3G16A 2OTL3 3DMCA 3CXC2 1BRKA 4L7KA 4RBNA 4NREA 5IG4A 2XGNA 1JB2A 1BSBA 3SOYA 3K63A 1GOYA 2R41A 2H0IA 3N9HA 1HYFA 2RFRA 1L5GB 1UUGB 1M1XB 1EG9B 1RRHA 3OXAA 5DREA 3AHWA 3GAXA 1A2VA 1YVBI 4R9LA 2GSPA 3LYGA 3VSYA 5AEWB 2HMOB 2CFDA 3D4AA 1RKYA 2CFWA 2Z77A 3CCR3 4BTYA 4MEIA 1QAKA 1LRAA 3NM7A 1GY5A 1GY7A 3N54B 1A2KA 5BVBA 1JNQA 1DETA 1IYYA 4FCJA 1TTOA 1LOVA 2IMJA 2QEX3 1RMSA 2FGTA 3PCRA 3EB8A 3E99A 3KFQC 3Q3FA 5HOHA 2XEPA 1WNHA 5FW5A 5JPPA 4ZM8A 1YJN3 1DYUA 3UB1A 1O7PB 2CX1A 1O7HB 4O8SA 4BU4A 3X3YA 5CF1A 5IF6A 1I0VA 1BRNL 5BIRA 1JN5A 2F5MA 1V74A 1TRPA 2F4YA 1K8A4 1B2UA 4IIAA 1BU4A 8CHOA 1B27A 1ASKA 4QWTA 3SOAA 3STDA 1OGXA 4ORLA 1T2IA 4J5GA 3CC23 1AVLA 3UL5A 1QJGA 4HZBB 1GMQA 1UGIA 3GZXB 1RCLA 1OH0A 2KF3A 2HMKB 1QMAA 1B2SA 2OWPA 4KT3B 1NB3I 1MWRA 1TRQA 3A5EA 3IMAB 2K54A 2F5WA 1FZUA 1HZ1A 1WMNA 2IUKA 3CD63 3K5TA 3CCE3 1BUQA 1X1XA 4NHFA 3J7Yd 1UUVB 5KP3A 1VQM3 2CKFB 3OX9A 1N8QA 1JN5B 2W03A 2W9QA 4WFOA 1V58A 5ELJA 1AY7A 2RCDA 1RHLA 3CCL3 3CCQ3 2GEYA 1YHQ3 1STDA 3GZRA 1ROVA 6GSPA 1KWIA 1EQKA 2KRTA 1VQ83 2AADA 1A2PA 1UCIA 1NNVA 4EV5A 1NO3A 1PFPA 4AKYA 2P05A 1GD4A 3T0UA 2QIYA 3I553 4GB5A 1YVSA 4RNTA 1VQO3 1BSDA 3WDGB 3ZG0A 1OCVA 1RGKA 1ZX2A 4LMIA 1PU4A 1M904 1DVDA 1DMNA 3AHSA 3AGNA 1RN1A 3JVCA 3ALAA 3QK9A 4MMZB 1RN4A 4N6NB 5KP4A 3LTDA 3KKGA 3DGLA 2C11A 1GOVA 1OHSA 4MMXB 1TUHA 2L1SA 1ULJB 2GBWB 3EE1A 3WA2X 2ML5A 3O8YA 2ZL8A 4HAAA 1BVIA 1RSNA 1W6GA 3VF1A 3OWYA 3CPOA 1O7WB 3EN8A 3D9RA 2GU3A 4XBXA 1FUWA 2KCDA 1F8NA 1IK3A 3SYUA 3NHXA 1BRHA 4FR9A 3BNDA 2OCTA 2O9UX 1FGQA 3FLJA 1Q864 3CNMA 1JRQA 1TP6A 3LTBA 2JDIH 3CCS3 4N6MA 3CCJ3 2ZDJA 1GOUA 3HIGA 1TFKA 3BU4A 4L8OA 3OW22 5CF2A 1A90A 7STDA 3KN4A 1VQN3 3DY5A 4FMCA 1JZDA 1VQL3 2BIRA 2W6JH 1RJOA 5D82A 1SARA 1BOXA 1JBTA 1O7NB 3EX9A 1GD3A 1RLSA 5AIFA 3BNEA 3ROBA 3F7XA 5I97A 3LTAA 4L8PA 1AQZA 1BNIA 2FNQA 2STDA 3LTCA 1LOXA 3EHCA 2LYXA 2W2CA 3V92A 1RNBA 4XM4A 1SIHA 1MWTA 2L4VA 1A67A 3K0ZA 2Y73A 3PYJA 2BMRB 1X1YA 2F99A 1LQMB 1R4CA 1VQP3 5BU4A 3GRDA 1JJ22 3K7CA 5M18A 2BU4A 2IY2A 5KP1A 1GS3A 3HZPA 5FGOA 3URPA 4WYKA 4CPKA 1OGZA 5CXOA 1I2FA 1G02A 1MGWA 2C10A 1YIJ3 1VQ73 4XBTA 3KCHA 5G1KA 5AIIA 1O7GB 3CCU3 4LGQA 3MHEA 1PYLA 1OACA 3S29A 2BO9B 1BIRA 1RGAA 1UUWB 2W0QA 4X2HA 5IERA 2SBLA 5ELUA 4JF8A 3FKAA 2CWVA 5IG3A 3CME3 2D1WA 2E2VA 2XGLA 4PEJA 3FF0A 2IA7A 3UJMA 5EVHA 3DXOA 4R9KA 4EV2A 1N9EA 1BNGA 1I70A 4FCZA 5IEPA 5JPUA 3LT8A 3NV0A 1JV2B 4EW5A 1FYSA 2YX9A 2HMMB 3Q2PA 1Y4KA 4EXRA 4WYKB 4RNZA 4HM8B 3G4S3 1BNEA 3CMA3 2A15A 1LQGC 1QALA 3NM2A 2MF7A 3GSPA 1W6YA 1IVVA 3FG3A 1Q7HA 1K9M4 4R1KA 3WHOA 2M7OA 4OVMA 3WR2A 1KQS2 4N6UA 2XH9A 4LSOA 1BSEA 4HVNA 4KVHA 4NPBA 1AV4A 1JZOA 1JBSA 3F14A 4KFDA 2RSXA 4STDA 1I3IA 1ZGXA 3DH2A 1IDPA 1MOLA 2Z7AA 5IG5A 1D6UA 1OHPA 3EBTA 4WHAA 3FCSB 4XB5A 5LC6A 4BIRA 1S723 3NV0B 1DE3A 1W2ZA 4GSPA 2Z76A 3OWSA 3U1WA 1SIIA 4FMBA 2RNTA 1DVCA 3FZWA 3NBJA 3GZBA 3NBRA 2CX0A 3OV4A 3SLUA 3BNCA 3LMLA 1GY6A 1ISKA 1JB5A 1X1WA 2ZA4A 1NJI4 3DGOA 1KD14 1RGFA 3UL6A 1IQYA 3SXXA 1EEJA 3PXMA 1CH0A 3T8NA 5AYRB 1E97A 1ROAA 1BUJA 1E3RA 3F8XA 3WMDA 5AIHA 3ZFZA 1IT7A 2YFIB 3JUQA 4BL3A 3SX1A 3F9SA 3G8ZA 3GWRA 4FMAA 2F98A 5D83A 1NDOB 2CFGA 3EQQB 2WGQA 3JUMA 2XR8B 4MMYB 5JBSA 3HK4A 2E2UA 5G1LA 1UI8A 7RNTA 1QVG2 1BNRA 1UCJA 2XSOB 4H61A 3BNBA 4IPBA 2B24B 1LXEA 1N9JA 3RNTA 4CJNA 2WOFA 1B20A 1W01A 2P0XA 2PZVA 5STDA 3N8BA 5D81A 3V99A 3SVAA 4G1MB 1WQLB 3X40A 3FSDA 3KIIA 4HM0B 1IQXA 2OQEC 3DGNA 3QRDA 2IYJA 2ML6A 1BRGA 1I2GA 3WA3A 1MGRA 3S67A 1LNHA 1OUNA 2AAEA 2CIUA 2OTJ3 3OWUA 1AVKA 3B7CA 4LYLB 4BL2A 1QVF2 5EEOA 1RGLA 2WOHA 3D3LA 3RDEA 2W56A 1NU3A 5AIGA 1LVNA 1O7MB 3HIIA 3M8CA 4XDVA 4WWUC 1BGSA 3WOEB 1FGMA 2CC3A 1STFI 4I4KA 4HM7B 1D6ZA 1FGTA 1B3SA 1K28A 4RZMA 2OQEA 3ZG5A 3FG4A 3L0RA 3LZAA 6RNTA 2CK3H 1RTUA 2XFTA 2CG1A 3X41A 1W6CA 2W04A 1UDII 1J2BA 2WGOA 5CLKA 2XFSA 3PCSA 4FMDA 4I5QA 1I8VA 3RGRA 4CDLA 3CC73 3B8LA 3B4PA 1YIT3 3JUNA 1U8CB 2F56A 2XRXB 4N6TA 1FUSA 3VGNA 3WOFB 3LT9A 1B2MA 3UNLA 2W56B 1EKMA 4O3VA 1YJW3 1IT8A 2CG0A 1BNSA 2OOVC 3LH4A 2HMJB 1T5YA 1T2HA 1ULIB 2C4BA 6STDA 1GMRA 3CCV3 1IVWA 4HOHA 4EBGA 1UI7A 3I0YA 4GL6A 3SEDA 1AR0A 1C54A 2UX0A 3FGYA 4ILFA 2XSHB 1Z1SA 4EC6A 5RNTA 3G6E3 1EUIC 1V57A 3MPHA 3RGAA 3EJVA 2CFKA 1T3BA 1UCKA 4HM2B 3S28A 1Q9EA 1Q7Y4 2GBXB 4XBYA 1HKXA 1M9GA 3PZWA 1BNJA 1KSIA 1UGHI 3BLZA 1VQ43 3IPTA 5GSPA 3X3ZA 1CYUA 1HU9A 2GXFA 3BIRA 1RNTA 1IQ8A 2UUGC 3DM8A 2OOVA 4CCVA 1DMMA 1TFOA 2P38A 3D5GA 2XF3A 3EN1B 4HJLB 1OPYA 1BAOA 2QA43 1DMQA 1JBRA 1TIJA 1MNLA 1VZZA 3CNXA 2B1XB 1EA2A 4AKZA 1RCKA 4O2HA 2H0HA 2FXTA 2R4IA 2W9PA 1G0TA 1TJDA 1FUTA 4BTXA 1CQSA 1YJ93 2KF6A 4N6V0 5IG0A 3I563 1BRIA 1GSPA 4BTWA 1W5ZA 1IVUA 4R80A 3D79A 4HKVB 4H3UA 1B2XA 1QAFA 1R4YA 1PY3A 2CH9A 1SJWA 2I9WA 4J8TA 7GSPA 3X3XA 2BNGA 2CHCA 5A0OB 3U97A 5EQLA 2E2TA 4HYZA 2P0MA 2H0GA 4AEQA 1I3FA 1LNIA 4RNYA 4XDWA 1M1K4 2KF4A 3KSED 1UCLA 3NXJA 2IUJA 3PS8A 4IT7A
chains in the Genus database with same CATH topology
4EYCA 2Z6BA 1K734 3Q1CA 3IJEB 3MG1A 3F40A 2CFLA 2KXGA 4X2OA 3EF8A 2LQVA 4FCMA 1Q814 2BT3A 1W00A 5DRVA 3ECFA 3ER7A 3HX8A 2WO0A 4J9AA 5TGNA 1CEWI 1W02A 4HZ9B 4N6LA 1N5PA 3F8HA 3FH1A 2HMNB 3CU3A 1G96A 3LOYA 3NX0A 2HMLB 3FG1A 1JKGA 4HM1B 3TDGA 1VQ63 1SPUA 2CW9A 5BXQA 3K9MC 2RGQA 1TU5A 4K1VA 1W4NA 2V1LA 1IV7A 2YFJB 1NWWA 4HM4B 2Q07A 1IVXA 3JUPA 3DZLA 3S5CA 3KE7A 3MSOA 3DGMA 4K61A 4HBRA 3T8UA 2MC8A 1RRLA 3A76A 3B4OA 2BHMA 4TX4A 5AYSC 4MJDA 1D6YA 1Q42A 4U13A 5IW9A 4HM5B 1VQK3 1N8R4 1VQ53 4OK0A 4KZ1A 2F86B 1UW1A 1YGEA 1N5HA 3MKIA 4KFFA 3G0KA 2BMQB 3JUOA 1JKGB 1Q40A 3V98A 5IEOA 4HM3B 1OF5A 2INXA 3MG2A 3MG3A 4LEHA 1SQWA 2P09A 3Q90A 2K0MA 1US1A 4N3VA 1ZO2A 1C7HA 2QGUA 3F7SA 3H51A 4Q53A 3NQYA 5LC7A 4K90B 1IU7A 1GYBA 1Q824 1YI23 5CK6A 3FF2A 3H3HA 3NQZA 2CWUA 2JQ5A 3AMOA 3WODG 1S5AA 3MYTA 1W7CA 1IV9A 2GU1A 1U5OA 2BMOB 4R4KA 3DUKA 2PNCA 5AI1A 3MWZA 4O02B 1Q40B 2YFLB 3CPW2 2GEXA 3NBBA 1K41A 1OF5B 3KSPA 1WMOA 3G713 5HGRA 2Y74A 1E3VA 1WTHA 1FGRA 2D42A 3GZYB 3LXUX 3NUVA 1KC84 5IENA 3HI7A 1WMPA 4JRFA 3S27A 1CYVA 1FA3A 4OUQA 5AEUB 2O3OA 1JB4A 3KZTA 1OHOA 1NB5I 3EC9A 3EBYA 1RN7A 4LZIA 1W2B2 3AMOB 3X42A 3BB9A 4N6OB 4HM6B 2CWTA 5G2GA 4KFEA 4K1UA 3PGBA 1FGOA 4WP5A 3CCM3 1VQ93 3G16A 2OTL3 3DMCA 3CXC2 4L7KA 4RBNA 4NREA 5IG4A 2XGNA 1JB2A 3SOYA 3K63A 3N9HA 2RFRA 1L5GB 1M1XB 1EG9B 1RRHA 3OXAA 5DREA 3GAXA 1A2VA 1YVBI 4R9LA 3LYGA 3VSYA 5AEWB 2HMOB 2CFDA 1RKYA 2CFWA 2Z77A 3CCR3 4BTYA 4MEIA 1QAKA 3NM7A 1GY5A 1GY7A 3N54B 1A2KA 5BVBA 1JNQA 4FCJA 2IMJA 2QEX3 2FGTA 3PCRA 3EB8A 3E99A 3KFQC 2XEPA 1WNHA 5FW5A 5JPPA 4ZM8A 1YJN3 1DYUA 3UB1A 1O7PB 1O7HB 4O8SA 5CF1A 3X3YA 5IF6A 1JN5A 1V74A 1K8A4 4IIAA 8CHOA 4QWTA 1ASKA 3SOAA 3STDA 1OGXA 4ORLA 3CC23 1AVLA 3UL5A 1QJGA 4HZBB 3GZXB 1OH0A 2HMKB 1QMAA 2OWPA 1NB3I 3IMAB 2K54A 1WMNA 2IUKA 3CD63 3K5TA 3CCE3 1BUQA 4NHFA 1VQM3 3J7Yd 1UUVB 5KP3A 2CKFB 3OX9A 1N8QA 1JN5B 2W03A 2W9QA 4WFOA 5ELJA 2RCDA 3CCL3 3CCQ3 2GEYA 1YHQ3 1STDA 3GZRA 1ROVA 1KWIA 1EQKA 2KRTA 1VQ83 4EV5A 1NO3A 1PFPA 4AKYA 2P05A 1GD4A 3T0UA 2QIYA 3I553 4GB5A 1VQO3 3WDGB 1OCVA 1ZX2A 4LMIA 1M904 1PU4A 1DVDA 1DMNA 3JVCA 4MMZB 3ALAA 3QK9A 4N6NB 5KP4A 3LTDA 3KKGA 3DGLA 2C11A 1OHSA 4MMXB 1TUHA 1ULJB 2GBWB 3EE1A 3WA2X 2ML5A 3O8YA 2ZL8A 3VF1A 1W6GA 3OWYA 3CPOA 1O7WB 3EN8A 3D9RA 2GU3A 4XBXA 1FUWA 2KCDA 1F8NA 1IK3A 3NHXA 4FR9A 3BNDA 2OCTA 2O9UX 1FGQA 3FLJA 1Q864 3CNMA 1JRQA 1TP6A 3LTBA 2JDIH 3CCS3 4N6MA 3CCJ3 2ZDJA 3HIGA 1TFKA 4L8OA 3OW22 5CF2A 1A90A 7STDA 3KN4A 1VQN3 3DY5A 4FMCA 1VQL3 5D82A 2W6JH 1RJOA 1O7NB 3EX9A 1GD3A 5AIFA 3ROBA 3BNEA 3F7XA 5I97A 3LTAA 4L8PA 3LTCA 2FNQA 2STDA 1LOXA 3EHCA 2LYXA 2W2CA 3V92A 4XM4A 1SIHA 2L4VA 1A67A 3K0ZA 2Y73A 3PYJA 2BMRB 2F99A 1R4CA 1VQP3 3GRDA 1JJ22 3K7CA 5KP1A 1GS3A 3HZPA 5FGOA 4WYKA 1OGZA 5CXOA 2C10A 1YIJ3 1VQ73 4XBTA 5AIIA 1O7GB 3CCU3 4LGQA 3MHEA 1OACA 3S29A 2BO9B 1UUWB 2W0QA 4X2HA 5IERA 2SBLA 5ELUA 4JF8A 3FKAA 2CWVA 5IG3A 3CME3 2D1WA 2E2VA 2XGLA 4PEJA 3FF0A 2IA7A 3UJMA 5EVHA 3DXOA 4R9KA 4EV2A 1N9EA 5IEPA 4FCZA 5JPUA 3LT8A 3NV0A 1JV2B 2YX9A 2HMMB 3Q2PA 1Y4KA 4EXRA 4WYKB 4RNZA 4HM8B 3G4S3 3CMA3 2A15A 1QALA 3NM2A 2MF7A 1W6YA 1IVVA 3FG3A 1K9M4 4R1KA 2M7OA 4OVMA 1KQS2 4N6UA 2XH9A 4LSOA 4HVNA 4KVHA 1AV4A 3F14A 4KFDA 2RSXA 4STDA 3CC43 5IG5A 1IDPA 1MOLA 2Z7AA 1D6UA 1OHPA 3EBTA 4WHAA 3FCSB 4XB5A 5LC6A 1S723 3NV0B 1W2ZA 3U1WA 2Z76A 3OWSA 1SIIA 4FMBA 1DVCA 3FZWA 3NBJA 3GZBA 3NBRA 3OV4A 3SLUA 3BNCA 3LMLA 1GY6A 1ISKA 1JB5A 1NJI4 3DGOA 1KD14 3UL6A 1IQYA 3SXXA 3PXMA 3T8NA 5AYRB 1E97A 1ROAA 1E3RA 3F8XA 3WMDA 5AIHA 1IT7A 2YFIB 3JUQA 3SX1A 3F9SA 3G8ZA 3GWRA 4FMAA 2F98A 5D83A 1NDOB 2CFGA 3EQQB 2WGQA 3JUMA 2XR8B 4MMYB 5JBSA 3HK4A 2E2UA 1QVG2 1UI8A 2XSOB 4H61A 3BNBA 4IPBA 2B24B 1LXEA 1N9JA 2WOFA 1W01A 2P0XA 2PZVA 5STDA 3N8BA 5D81A 3V99A 3SVAA 4G1MB 1WQLB 3X40A 3FSDA 3KIIA 4HM0B 1IQXA 2OQEC 3DGNA 3QRDA 2ML6A 3WA3A 3S67A 1LNHA 1OUNA 2OTJ3 2CIUA 3OWUA 1AVKA 3B7CA 1QVF2 5EEOA 2WOHA 3D3LA 3RDEA 2W56A 1NU3A 5AIGA 1LVNA 1O7MB 3HIIA 3M8CA 4XDVA 4WWUC 3WOEB 1FGMA 2CC3A 1STFI 4I4KA 4HM7B 1D6ZA 1FGTA 1K28A 4RZMA 2OQEA 3FG4A 3L0RA 3LZAA 2CK3H 2CG1A 2XFTA 3X41A 1W6CA 2W04A 1J2BA 2WGOA 5CLKA 2XFSA 3PCSA 4FMDA 4CDLA 3RGRA 3CC73 3B8LA 3B4PA 1YIT3 3JUNA 1U8CB 2XRXB 4N6TA 3VGNA 3WOFB 3LT9A 3UNLA 2W56B 1EKMA 4O3VA 1YJW3 1IT8A 2CG0A 2OOVC 3LH4A 2HMJB 1T5YA 1ULIB 6STDA 3CCV3 1IVWA 4EBGA 1UI7A 3I0YA 4GL6A 3SEDA 1AR0A 2UX0A 3FGYA 2XSHB 1Z1SA 4EC6A 3G6E3 3MPHA 3RGAA 3EJVA 2CFKA 4HM2B 3S28A 1Q7Y4 2GBXB 4XBYA 1HKXA 1M9GA 3PZWA 1KSIA 3BLZA 1VQ43 3IPTA 3X3ZA 1CYUA 1HU9A 2GXFA 3DM8A 1IQ8A 2OOVA 4CCVA 1DMMA 1TFOA 2P38A 3EN1B 2XF3A 4HJLB 2QA43 1OPYA 1DMQA 1TIJA 1MNLA 1VZZA 3CNXA 2B1XB 1EA2A 4AKZA 4O2HA 2FXTA 2R4IA 2W9PA 4BTXA 1CQSA 1YJ93 4N6V0 5IG0A 3I563 4BTWA 1W5ZA 1IVUA 4R80A 4HKVB 4H3UA 1QAFA 2CH9A 1SJWA 2I9WA 4J8TA 3X3XA 2BNGA 2CHCA 5A0OB 3U97A 5EQLA 2E2TA 4HYZA 2P0MA 4AEQA 4RNYA 4XDWA 1M1K4 3KSED 3NXJA 2IUJA 3PS8A 4IT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LT8 A;  2P09 A;  3LTA A;  1UW1 A;  3LTC A;  2P0X A;  3LT9 A;  3LTD A;  3DGL A;  3LTB A;  3DGN A;  2P05 A;  3DGO A;  3DGM A; 
#chains in the Genus database with same CATH topology
 3D5I A;  4EYC A;  2Z6B A;  1K73 4;  3Q1C A;  3IJE B;  3MG1 A;  3F40 A;  2CFL A;  2KXG A;  1RGE A;  2HOH A;  4X2O A;  1B21 A;  3EF8 A;  2LQV A;  4FCM A;  1Q81 4;  2BT3 A;  1W00 A;  5DRV A;  3ECF A;  3ER7 A;  3HX8 A;  2WO0 A;  4J9A A;  5M19 A;  5TGN A;  1CEW I;  1W02 A;  4HZ9 B;  4N6L A;  1N5P A;  3F8H A;  3AGO A;  3FH1 A;  2HMN B;  3CU3 A;  1G96 A;  3LOY A;  3NX0 A;  2HML B;  3FG1 A;  1JKG A;  1RGG A;  4HM1 B;  3TDG A;  1LOY A;  9RNT A;  1SPU A;  1VQ6 3;  1VQQ A;  1ZS7 A;  2CW9 A;  5BXQ A;  3K9M C;  1RDS A;  2RGQ A;  1TU5 A;  4K1V A;  1GMP A;  1W4N A;  2V1L A;  1IV7 A;  2YFJ B;  1NWW A;  4HM4 B;  2Q07 A;  1IVX A;  3JUP A;  3DZL A;  3S5C A;  1BSC A;  3HOH A;  3KE7 A;  1X1U A;  3MSO A;  3DGM A;  4K61 A;  4HBR A;  3T8U A;  3CC4 3;  2MC8 A;  2SAR A;  1RRL A;  3A76 A;  3B4O A;  2BHM A;  4TX4 A;  5AYS C;  4MJD A;  1D6Y A;  1Q42 A;  4U13 A;  1RGC A;  4HM5 B;  5IW9 A;  1VQK 3;  1N8R 4;  1VQ5 3;  4OK0 A;  1BSA A;  2F86 B;  1UW1 A;  1YGE A;  4KZ1 A;  1N5H A;  3MKI A;  4KFF A;  3G0K A;  2BMQ B;  3JUO A;  1JKG B;  1Q40 A;  3V98 A;  5IEO A;  4HM3 B;  1OF5 A;  2INX A;  3MG2 A;  3MG3 A;  4LEH A;  1SQW A;  2P09 A;  3Q90 A;  2K0M A;  1US1 A;  4N3V A;  1ZO2 A;  1C7H A;  1YGW A;  8RNT A;  2QGU A;  3F7S A;  3H51 A;  4Q53 A;  1MWU A;  3NQY A;  4K90 B;  1IU7 A;  1GYB A;  4GHO A;  5LC7 A;  1Q82 4;  1BRJ A;  1YI2 3;  5CK6 A;  3FF2 A;  3H3H A;  3NQZ A;  2CWU A;  1I0X A;  2JQ5 A;  2ZHX B;  3AMO A;  1LOW A;  3WOD G;  1S5A A;  3MYT A;  5M1A A;  1W7C A;  1IV9 A;  2GU1 A;  1U5O A;  2BMO B;  4R4K A;  3DGY A;  2PNC A;  3DUK A;  3MWZ A;  4O02 B;  1Q40 B;  2YFL B;  5AI1 A;  3CPW 2;  2GEX A;  3NBB A;  1K41 A;  1OF5 B;  3KSP A;  1FW7 A;  1WMO A;  4J5K A;  3G71 3;  2KF5 A;  2UGI A;  5HGR A;  2Y74 A;  1BNF A;  1E3V A;  1FGR A;  1WTH A;  2D42 A;  3GZY B;  3LXU X;  3NUV A;  1KC8 4;  5IEN A;  3HI7 A;  1WMP A;  1MWS A;  4JRF A;  1CYV A;  2J8X B;  2RBI A;  3S27 A;  1RGH A;  1FA3 A;  4OUQ A;  5AEU B;  2O3O A;  1JB4 A;  3KZT A;  1OHO A;  1NB5 I;  3EC9 A;  1B2Z A;  2KAA A;  3EBY A;  1RN7 A;  4LZI A;  1W2B 2;  3AMO B;  3X42 A;  1BAN A;  3BB9 A;  4N6O B;  4HM6 B;  2CWT A;  5G2G A;  4KFE A;  1I2E A;  4DKI A;  1YNV X;  4K1U A;  3PGB A;  1FGO A;  4WP5 A;  1BRS A;  2K3D A;  3CCM 3;  1VQ9 3;  3G16 A;  2OTL 3;  3DMC A;  3CXC 2;  1BRK A;  4L7K A;  4RBN A;  4NRE A;  5IG4 A;  2XGN A;  1JB2 A;  1BSB A;  3SOY A;  3K63 A;  1GOY A;  2R41 A;  2H0I A;  3N9H A;  1HYF A;  2RFR A;  1L5G B;  1UUG B;  1M1X B;  1EG9 B;  1RRH A;  3OXA A;  5DRE A;  3AHW A;  3GAX A;  1A2V A;  1YVB I;  4R9L A;  2GSP A;  3LYG A;  3VSY A;  5AEW B;  2HMO B;  2CFD A;  3D4A A;  1RKY A;  2CFW A;  2Z77 A;  3CCR 3;  4BTY A;  4MEI A;  1QAK A;  1LRA A;  3NM7 A;  1GY5 A;  1GY7 A;  3N54 B;  1A2K A;  5BVB A;  1JNQ A;  1DET A;  1IYY A;  4FCJ A;  1TTO A;  1LOV A;  2IMJ A;  2QEX 3;  1RMS A;  2FGT A;  3PCR A;  3EB8 A;  3E99 A;  3KFQ C;  3Q3F A;  5HOH A;  2XEP A;  1WNH A;  5FW5 A;  5JPP A;  4ZM8 A;  1YJN 3;  1DYU A;  3UB1 A;  1O7P B;  2CX1 A;  1O7H B;  4O8S A;  4BU4 A;  3X3Y A;  5CF1 A;  5IF6 A;  1I0V A;  1BRN L;  5BIR A;  1JN5 A;  2F5M A;  1V74 A;  1TRP A;  2F4Y A;  1K8A 4;  1B2U A;  4IIA A;  1BU4 A;  8CHO A;  1B27 A;  1ASK A;  4QWT A;  3SOA A;  3STD A;  1OGX A;  4ORL A;  1T2I A;  4J5G A;  3CC2 3;  1AVL A;  3UL5 A;  1QJG A;  4HZB B;  1GMQ A;  1UGI A;  3GZX B;  1RCL A;  1OH0 A;  2KF3 A;  2HMK B;  1QMA A;  1B2S A;  2OWP A;  4KT3 B;  1NB3 I;  1MWR A;  1TRQ A;  3A5E A;  3IMA B;  2K54 A;  2F5W A;  1FZU A;  1HZ1 A;  1WMN A;  2IUK A;  3CD6 3;  3K5T A;  3CCE 3;  1BUQ A;  1X1X A;  4NHF A;  3J7Y d;  1UUV B;  5KP3 A;  1VQM 3;  2CKF B;  3OX9 A;  1N8Q A;  1JN5 B;  2W03 A;  2W9Q A;  4WFO A;  1V58 A;  5ELJ A;  1AY7 A;  2RCD A;  1RHL A;  3CCL 3;  3CCQ 3;  2GEY A;  1YHQ 3;  1STD A;  3GZR A;  1ROV A;  6GSP A;  1KWI A;  1EQK A;  2KRT A;  1VQ8 3;  2AAD A;  1A2P A;  1UCI A;  1NNV A;  4EV5 A;  1NO3 A;  1PFP A;  4AKY A;  2P05 A;  1GD4 A;  3T0U A;  2QIY A;  3I55 3;  4GB5 A;  1YVS A;  4RNT A;  1VQO 3;  1BSD A;  3WDG B;  3ZG0 A;  1OCV A;  1RGK A;  1ZX2 A;  4LMI A;  1PU4 A;  1M90 4;  1DVD A;  1DMN A;  3AHS A;  3AGN A;  1RN1 A;  3JVC A;  3ALA A;  3QK9 A;  4MMZ B;  1RN4 A;  4N6N B;  5KP4 A;  3LTD A;  3KKG A;  3DGL A;  2C11 A;  1GOV A;  1OHS A;  4MMX B;  1TUH A;  2L1S A;  1ULJ B;  2GBW B;  3EE1 A;  3WA2 X;  2ML5 A;  3O8Y A;  2ZL8 A;  4HAA A;  1BVI A;  1RSN A;  1W6G A;  3VF1 A;  3OWY A;  3CPO A;  1O7W B;  3EN8 A;  3D9R A;  2GU3 A;  4XBX A;  1FUW A;  2KCD A;  1F8N A;  1IK3 A;  3SYU A;  3NHX A;  1BRH A;  4FR9 A;  3BND A;  2OCT A;  2O9U X;  1FGQ A;  3FLJ A;  1Q86 4;  3CNM A;  1JRQ A;  1TP6 A;  3LTB A;  2JDI H;  3CCS 3;  4N6M A;  3CCJ 3;  2ZDJ A;  1GOU A;  3HIG A;  1TFK A;  3BU4 A;  4L8O A;  3OW2 2;  5CF2 A;  1A90 A;  7STD A;  3KN4 A;  1VQN 3;  3DY5 A;  4FMC A;  1JZD A;  1VQL 3;  2BIR A;  2W6J H;  1RJO A;  5D82 A;  1SAR A;  1BOX A;  1JBT A;  1O7N B;  3EX9 A;  1GD3 A;  1RLS A;  5AIF A;  3BNE A;  3ROB A;  3F7X A;  5I97 A;  3LTA A;  4L8P A;  1AQZ A;  1BNI A;  2FNQ A;  2STD A;  3LTC A;  1LOX A;  3EHC A;  2LYX A;  2W2C A;  3V92 A;  1RNB A;  4XM4 A;  1SIH A;  1MWT A;  2L4V A;  1A67 A;  3K0Z A;  2Y73 A;  3PYJ A;  2BMR B;  1X1Y A;  2F99 A;  1LQM B;  1R4C A;  1VQP 3;  5BU4 A;  3GRD A;  1JJ2 2;  3K7C A;  5M18 A;  2BU4 A;  2IY2 A;  5KP1 A;  1GS3 A;  3HZP A;  5FGO A;  3URP A;  4WYK A;  4CPK A;  1OGZ A;  5CXO A;  1I2F A;  1G02 A;  1MGW A;  2C10 A;  1YIJ 3;  1VQ7 3;  4XBT A;  3KCH A;  5G1K A;  5AII A;  1O7G B;  3CCU 3;  4LGQ A;  3MHE A;  1PYL A;  1OAC A;  3S29 A;  2BO9 B;  1BIR A;  1RGA A;  1UUW B;  2W0Q A;  4X2H A;  5IER A;  2SBL A;  5ELU A;  4JF8 A;  3FKA A;  2CWV A;  5IG3 A;  3CME 3;  2D1W A;  2E2V A;  2XGL A;  4PEJ A;  3FF0 A;  2IA7 A;  3UJM A;  5EVH A;  3DXO A;  4R9K A;  4EV2 A;  1N9E A;  1BNG A;  1I70 A;  4FCZ A;  5IEP A;  5JPU A;  3LT8 A;  3NV0 A;  1JV2 B;  4EW5 A;  1FYS A;  2YX9 A;  2HMM B;  3Q2P A;  1Y4K A;  4EXR A;  4WYK B;  4RNZ A;  4HM8 B;  3G4S 3;  1BNE A;  3CMA 3;  2A15 A;  1LQG C;  1QAL A;  3NM2 A;  2MF7 A;  3GSP A;  1W6Y A;  1IVV A;  3FG3 A;  1Q7H A;  1K9M 4;  4R1K A;  3WHO A;  2M7O A;  4OVM A;  3WR2 A;  1KQS 2;  4N6U A;  2XH9 A;  4LSO A;  1BSE A;  4HVN A;  4KVH A;  4NPB A;  1AV4 A;  1JZO A;  1JBS A;  3F14 A;  4KFD A;  2RSX A;  4STD A;  1I3I A;  1ZGX A;  3DH2 A;  1IDP A;  1MOL A;  2Z7A A;  5IG5 A;  1D6U A;  1OHP A;  3EBT A;  4WHA A;  3FCS B;  4XB5 A;  5LC6 A;  4BIR A;  1S72 3;  3NV0 B;  1DE3 A;  1W2Z A;  4GSP A;  2Z76 A;  3OWS A;  3U1W A;  1SII A;  4FMB A;  2RNT A;  1DVC A;  3FZW A;  3NBJ A;  3GZB A;  3NBR A;  2CX0 A;  3OV4 A;  3SLU A;  3BNC A;  3LML A;  1GY6 A;  1ISK A;  1JB5 A;  1X1W A;  2ZA4 A;  1NJI 4;  3DGO A;  1KD1 4;  1RGF A;  3UL6 A;  1IQY A;  3SXX A;  1EEJ A;  3PXM A;  1CH0 A;  3T8N A;  5AYR B;  1E97 A;  1ROA A;  1BUJ A;  1E3R A;  3F8X A;  3WMD A;  5AIH A;  3ZFZ A;  1IT7 A;  2YFI B;  3JUQ A;  4BL3 A;  3SX1 A;  3F9S A;  3G8Z A;  3GWR A;  4FMA A;  2F98 A;  5D83 A;  1NDO B;  2CFG A;  3EQQ B;  2WGQ A;  3JUM A;  2XR8 B;  4MMY B;  5JBS A;  3HK4 A;  2E2U A;  5G1L A;  1UI8 A;  7RNT A;  1QVG 2;  1BNR A;  1UCJ A;  2XSO B;  4H61 A;  3BNB A;  4IPB A;  2B24 B;  1LXE A;  1N9J A;  3RNT A;  4CJN A;  2WOF A;  1B20 A;  1W01 A;  2P0X A;  2PZV A;  5STD A;  3N8B A;  5D81 A;  3V99 A;  3SVA A;  4G1M B;  1WQL B;  3X40 A;  3FSD A;  3KII A;  4HM0 B;  1IQX A;  2OQE C;  3DGN A;  3QRD A;  2IYJ A;  2ML6 A;  1BRG A;  1I2G A;  3WA3 A;  1MGR A;  3S67 A;  1LNH A;  1OUN A;  2AAE A;  2CIU A;  2OTJ 3;  3OWU A;  1AVK A;  3B7C A;  4LYL B;  4BL2 A;  1QVF 2;  5EEO A;  1RGL A;  2WOH A;  3D3L A;  3RDE A;  2W56 A;  1NU3 A;  5AIG A;  1LVN A;  1O7M B;  3HII A;  3M8C A;  4XDV A;  4WWU C;  1BGS A;  3WOE B;  1FGM A;  2CC3 A;  1STF I;  4I4K A;  4HM7 B;  1D6Z A;  1FGT A;  1B3S A;  1K28 A;  4RZM A;  2OQE A;  3ZG5 A;  3FG4 A;  3L0R A;  3LZA A;  6RNT A;  2CK3 H;  1RTU A;  2XFT A;  2CG1 A;  3X41 A;  1W6C A;  2W04 A;  1UDI I;  1J2B A;  2WGO A;  5CLK A;  2XFS A;  3PCS A;  4FMD A;  4I5Q A;  1I8V A;  3RGR A;  4CDL A;  3CC7 3;  3B8L A;  3B4P A;  1YIT 3;  3JUN A;  1U8C B;  2F56 A;  2XRX B;  4N6T A;  1FUS A;  3VGN A;  3WOF B;  3LT9 A;  1B2M A;  3UNL A;  2W56 B;  1EKM A;  4O3V A;  1YJW 3;  1IT8 A;  2CG0 A;  1BNS A;  2OOV C;  3LH4 A;  2HMJ B;  1T5Y A;  1T2H A;  1ULI B;  2C4B A;  6STD A;  1GMR A;  3CCV 3;  1IVW A;  4HOH A;  4EBG A;  1UI7 A;  3I0Y A;  4GL6 A;  3SED A;  1AR0 A;  1C54 A;  2UX0 A;  3FGY A;  4ILF A;  2XSH B;  1Z1S A;  4EC6 A;  5RNT A;  3G6E 3;  1EUI C;  1V57 A;  3MPH A;  3RGA A;  3EJV A;  2CFK A;  1T3B A;  1UCK A;  4HM2 B;  3S28 A;  1Q9E A;  1Q7Y 4;  2GBX B;  4XBY A;  1HKX A;  1M9G A;  3PZW A;  1BNJ A;  1KSI A;  1UGH I;  3BLZ A;  1VQ4 3;  3IPT A;  5GSP A;  3X3Z A;  1CYU A;  1HU9 A;  2GXF A;  3BIR A;  1RNT A;  1IQ8 A;  2UUG C;  3DM8 A;  2OOV A;  4CCV A;  1DMM A;  1TFO A;  2P38 A;  3D5G A;  2XF3 A;  3EN1 B;  4HJL B;  1OPY A;  1BAO A;  2QA4 3;  1DMQ A;  1JBR A;  1TIJ A;  1MNL A;  1VZZ A;  3CNX A;  2B1X B;  1EA2 A;  4AKZ A;  1RCK A;  4O2H A;  2H0H A;  2FXT A;  2R4I A;  2W9P A;  1G0T A;  1TJD A;  1FUT A;  4BTX A;  1CQS A;  1YJ9 3;  2KF6 A;  4N6V 0;  5IG0 A;  3I56 3;  1BRI A;  1GSP A;  4BTW A;  1W5Z A;  1IVU A;  4R80 A;  3D79 A;  4HKV B;  4H3U A;  1B2X A;  1QAF A;  1R4Y A;  1PY3 A;  2CH9 A;  1SJW A;  2I9W A;  4J8T A;  7GSP A;  3X3X A;  2BNG A;  2CHC A;  5A0O B;  3U97 A;  5EQL A;  2E2T A;  4HYZ A;  2P0M A;  2H0G A;  4AEQ A;  1I3F A;  1LNI A;  4RNY A;  4XDW A;  1M1K 4;  2KF4 A;  3KSE D;  1UCL A;  3NXJ A;  2IUJ A;  3PS8 A;  4IT7 A; 
#chains in the Genus database with same CATH homology
 4EYC A;  2Z6B A;  1K73 4;  3Q1C A;  3IJE B;  3MG1 A;  3F40 A;  2CFL A;  2KXG A;  4X2O A;  3EF8 A;  2LQV A;  4FCM A;  1Q81 4;  2BT3 A;  1W00 A;  5DRV A;  3ECF A;  3ER7 A;  3HX8 A;  2WO0 A;  4J9A A;  5TGN A;  1CEW I;  1W02 A;  4HZ9 B;  4N6L A;  1N5P A;  3F8H A;  3FH1 A;  2HMN B;  3CU3 A;  1G96 A;  3LOY A;  3NX0 A;  2HML B;  3FG1 A;  1JKG A;  4HM1 B;  3TDG A;  1VQ6 3;  1SPU A;  2CW9 A;  5BXQ A;  3K9M C;  2RGQ A;  1TU5 A;  4K1V A;  1W4N A;  2V1L A;  1IV7 A;  2YFJ B;  1NWW A;  4HM4 B;  2Q07 A;  1IVX A;  3JUP A;  3DZL A;  3S5C A;  3KE7 A;  3MSO A;  3DGM A;  4K61 A;  4HBR A;  3T8U A;  2MC8 A;  1RRL A;  3A76 A;  3B4O A;  2BHM A;  4TX4 A;  5AYS C;  4MJD A;  1D6Y A;  1Q42 A;  4U13 A;  5IW9 A;  4HM5 B;  1VQK 3;  1N8R 4;  1VQ5 3;  4OK0 A;  4KZ1 A;  2F86 B;  1UW1 A;  1YGE A;  1N5H A;  3MKI A;  4KFF A;  3G0K A;  2BMQ B;  3JUO A;  1JKG B;  1Q40 A;  3V98 A;  5IEO A;  4HM3 B;  1OF5 A;  2INX A;  3MG2 A;  3MG3 A;  4LEH A;  1SQW A;  2P09 A;  3Q90 A;  2K0M A;  1US1 A;  4N3V A;  1ZO2 A;  1C7H A;  2QGU A;  3F7S A;  3H51 A;  4Q53 A;  3NQY A;  5LC7 A;  4K90 B;  1IU7 A;  1GYB A;  1Q82 4;  1YI2 3;  5CK6 A;  3FF2 A;  3H3H A;  3NQZ A;  2CWU A;  2JQ5 A;  3AMO A;  3WOD G;  1S5A A;  3MYT A;  1W7C A;  1IV9 A;  2GU1 A;  1U5O A;  2BMO B;  4R4K A;  3DUK A;  2PNC A;  5AI1 A;  3MWZ A;  4O02 B;  1Q40 B;  2YFL B;  3CPW 2;  2GEX A;  3NBB A;  1K41 A;  1OF5 B;  3KSP A;  1WMO A;  3G71 3;  5HGR A;  2Y74 A;  1E3V A;  1WTH A;  1FGR A;  2D42 A;  3GZY B;  3LXU X;  3NUV A;  1KC8 4;  5IEN A;  3HI7 A;  1WMP A;  4JRF A;  3S27 A;  1CYV A;  1FA3 A;  4OUQ A;  5AEU B;  2O3O A;  1JB4 A;  3KZT A;  1OHO A;  1NB5 I;  3EC9 A;  3EBY A;  1RN7 A;  4LZI A;  1W2B 2;  3AMO B;  3X42 A;  3BB9 A;  4N6O B;  4HM6 B;  2CWT A;  5G2G A;  4KFE A;  4K1U A;  3PGB A;  1FGO A;  4WP5 A;  3CCM 3;  1VQ9 3;  3G16 A;  2OTL 3;  3DMC A;  3CXC 2;  4L7K A;  4RBN A;  4NRE A;  5IG4 A;  2XGN A;  1JB2 A;  3SOY A;  3K63 A;  3N9H A;  2RFR A;  1L5G B;  1M1X B;  1EG9 B;  1RRH A;  3OXA A;  5DRE A;  3GAX A;  1A2V A;  1YVB I;  4R9L A;  3LYG A;  3VSY A;  5AEW B;  2HMO B;  2CFD A;  1RKY A;  2CFW A;  2Z77 A;  3CCR 3;  4BTY A;  4MEI A;  1QAK A;  3NM7 A;  1GY5 A;  1GY7 A;  3N54 B;  1A2K A;  5BVB A;  1JNQ A;  4FCJ A;  2IMJ A;  2QEX 3;  2FGT A;  3PCR A;  3EB8 A;  3E99 A;  3KFQ C;  2XEP A;  1WNH A;  5FW5 A;  5JPP A;  4ZM8 A;  1YJN 3;  1DYU A;  3UB1 A;  1O7P B;  1O7H B;  4O8S A;  5CF1 A;  3X3Y A;  5IF6 A;  1JN5 A;  1V74 A;  1K8A 4;  4IIA A;  8CHO A;  4QWT A;  1ASK A;  3SOA A;  3STD A;  1OGX A;  4ORL A;  3CC2 3;  1AVL A;  3UL5 A;  1QJG A;  4HZB B;  3GZX B;  1OH0 A;  2HMK B;  1QMA A;  2OWP A;  1NB3 I;  3IMA B;  2K54 A;  1WMN A;  2IUK A;  3CD6 3;  3K5T A;  3CCE 3;  1BUQ A;  4NHF A;  1VQM 3;  3J7Y d;  1UUV B;  5KP3 A;  2CKF B;  3OX9 A;  1N8Q A;  1JN5 B;  2W03 A;  2W9Q A;  4WFO A;  5ELJ A;  2RCD A;  3CCL 3;  3CCQ 3;  2GEY A;  1YHQ 3;  1STD A;  3GZR A;  1ROV A;  1KWI A;  1EQK A;  2KRT A;  1VQ8 3;  4EV5 A;  1NO3 A;  1PFP A;  4AKY A;  2P05 A;  1GD4 A;  3T0U A;  2QIY A;  3I55 3;  4GB5 A;  1VQO 3;  3WDG B;  1OCV A;  1ZX2 A;  4LMI A;  1M90 4;  1PU4 A;  1DVD A;  1DMN A;  3JVC A;  4MMZ B;  3ALA A;  3QK9 A;  4N6N B;  5KP4 A;  3LTD A;  3KKG A;  3DGL A;  2C11 A;  1OHS A;  4MMX B;  1TUH A;  1ULJ B;  2GBW B;  3EE1 A;  3WA2 X;  2ML5 A;  3O8Y A;  2ZL8 A;  3VF1 A;  1W6G A;  3OWY A;  3CPO A;  1O7W B;  3EN8 A;  3D9R A;  2GU3 A;  4XBX A;  1FUW A;  2KCD A;  1F8N A;  1IK3 A;  3NHX A;  4FR9 A;  3BND A;  2OCT A;  2O9U X;  1FGQ A;  3FLJ A;  1Q86 4;  3CNM A;  1JRQ A;  1TP6 A;  3LTB A;  2JDI H;  3CCS 3;  4N6M A;  3CCJ 3;  2ZDJ A;  3HIG A;  1TFK A;  4L8O A;  3OW2 2;  5CF2 A;  1A90 A;  7STD A;  3KN4 A;  1VQN 3;  3DY5 A;  4FMC A;  1VQL 3;  5D82 A;  2W6J H;  1RJO A;  1O7N B;  3EX9 A;  1GD3 A;  5AIF A;  3ROB A;  3BNE A;  3F7X A;  5I97 A;  3LTA A;  4L8P A;  3LTC A;  2FNQ A;  2STD A;  1LOX A;  3EHC A;  2LYX A;  2W2C A;  3V92 A;  4XM4 A;  1SIH A;  2L4V A;  1A67 A;  3K0Z A;  2Y73 A;  3PYJ A;  2BMR B;  2F99 A;  1R4C A;  1VQP 3;  3GRD A;  1JJ2 2;  3K7C A;  5KP1 A;  1GS3 A;  3HZP A;  5FGO A;  4WYK A;  1OGZ A;  5CXO A;  2C10 A;  1YIJ 3;  1VQ7 3;  4XBT A;  5AII A;  1O7G B;  3CCU 3;  4LGQ A;  3MHE A;  1OAC A;  3S29 A;  2BO9 B;  1UUW B;  2W0Q A;  4X2H A;  5IER A;  2SBL A;  5ELU A;  4JF8 A;  3FKA A;  2CWV A;  5IG3 A;  3CME 3;  2D1W A;  2E2V A;  2XGL A;  4PEJ A;  3FF0 A;  2IA7 A;  3UJM A;  5EVH A;  3DXO A;  4R9K A;  4EV2 A;  1N9E A;  5IEP A;  4FCZ A;  5JPU A;  3LT8 A;  3NV0 A;  1JV2 B;  2YX9 A;  2HMM B;  3Q2P A;  1Y4K A;  4EXR A;  4WYK B;  4RNZ A;  4HM8 B;  3G4S 3;  3CMA 3;  2A15 A;  1QAL A;  3NM2 A;  2MF7 A;  1W6Y A;  1IVV A;  3FG3 A;  1K9M 4;  4R1K A;  2M7O A;  4OVM A;  1KQS 2;  4N6U A;  2XH9 A;  4LSO A;  4HVN A;  4KVH A;  1AV4 A;  3F14 A;  4KFD A;  2RSX A;  4STD A;  3CC4 3;  5IG5 A;  1IDP A;  1MOL A;  2Z7A A;  1D6U A;  1OHP A;  3EBT A;  4WHA A;  3FCS B;  4XB5 A;  5LC6 A;  1S72 3;  3NV0 B;  1W2Z A;  3U1W A;  2Z76 A;  3OWS A;  1SII A;  4FMB A;  1DVC A;  3FZW A;  3NBJ A;  3GZB A;  3NBR A;  3OV4 A;  3SLU A;  3BNC A;  3LML A;  1GY6 A;  1ISK A;  1JB5 A;  1NJI 4;  3DGO A;  1KD1 4;  3UL6 A;  1IQY A;  3SXX A;  3PXM A;  3T8N A;  5AYR B;  1E97 A;  1ROA A;  1E3R A;  3F8X A;  3WMD A;  5AIH A;  1IT7 A;  2YFI B;  3JUQ A;  3SX1 A;  3F9S A;  3G8Z A;  3GWR A;  4FMA A;  2F98 A;  5D83 A;  1NDO B;  2CFG A;  3EQQ B;  2WGQ A;  3JUM A;  2XR8 B;  4MMY B;  5JBS A;  3HK4 A;  2E2U A;  1QVG 2;  1UI8 A;  2XSO B;  4H61 A;  3BNB A;  4IPB A;  2B24 B;  1LXE A;  1N9J A;  2WOF A;  1W01 A;  2P0X A;  2PZV A;  5STD A;  3N8B A;  5D81 A;  3V99 A;  3SVA A;  4G1M B;  1WQL B;  3X40 A;  3FSD A;  3KII A;  4HM0 B;  1IQX A;  2OQE C;  3DGN A;  3QRD A;  2ML6 A;  3WA3 A;  3S67 A;  1LNH A;  1OUN A;  2OTJ 3;  2CIU A;  3OWU A;  1AVK A;  3B7C A;  1QVF 2;  5EEO A;  2WOH A;  3D3L A;  3RDE A;  2W56 A;  1NU3 A;  5AIG A;  1LVN A;  1O7M B;  3HII A;  3M8C A;  4XDV A;  4WWU C;  3WOE B;  1FGM A;  2CC3 A;  1STF I;  4I4K A;  4HM7 B;  1D6Z A;  1FGT A;  1K28 A;  4RZM A;  2OQE A;  3FG4 A;  3L0R A;  3LZA A;  2CK3 H;  2CG1 A;  2XFT A;  3X41 A;  1W6C A;  2W04 A;  1J2B A;  2WGO A;  5CLK A;  2XFS A;  3PCS A;  4FMD A;  4CDL A;  3RGR A;  3CC7 3;  3B8L A;  3B4P A;  1YIT 3;  3JUN A;  1U8C B;  2XRX B;  4N6T A;  3VGN A;  3WOF B;  3LT9 A;  3UNL A;  2W56 B;  1EKM A;  4O3V A;  1YJW 3;  1IT8 A;  2CG0 A;  2OOV C;  3LH4 A;  2HMJ B;  1T5Y A;  1ULI B;  6STD A;  3CCV 3;  1IVW A;  4EBG A;  1UI7 A;  3I0Y A;  4GL6 A;  3SED A;  1AR0 A;  2UX0 A;  3FGY A;  2XSH B;  1Z1S A;  4EC6 A;  3G6E 3;  3MPH A;  3RGA A;  3EJV A;  2CFK A;  4HM2 B;  3S28 A;  1Q7Y 4;  2GBX B;  4XBY A;  1HKX A;  1M9G A;  3PZW A;  1KSI A;  3BLZ A;  1VQ4 3;  3IPT A;  3X3Z A;  1CYU A;  1HU9 A;  2GXF A;  3DM8 A;  1IQ8 A;  2OOV A;  4CCV A;  1DMM A;  1TFO A;  2P38 A;  3EN1 B;  2XF3 A;  4HJL B;  2QA4 3;  1OPY A;  1DMQ A;  1TIJ A;  1MNL A;  1VZZ A;  3CNX A;  2B1X B;  1EA2 A;  4AKZ A;  4O2H A;  2FXT A;  2R4I A;  2W9P A;  4BTX A;  1CQS A;  1YJ9 3;  4N6V 0;  5IG0 A;  3I56 3;  4BTW A;  1W5Z A;  1IVU A;  4R80 A;  4HKV B;  4H3U A;  1QAF A;  2CH9 A;  1SJW A;  2I9W A;  4J8T A;  3X3X A;  2BNG A;  2CHC A;  5A0O B;  3U97 A;  5EQL A;  2E2T A;  4HYZ A;  2P0M A;  4AEQ A;  4RNY A;  4XDW A;  1M1K 4;  3KSE D;  3NXJ A;  2IUJ A;  3PS8 A;  4IT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...