3DGMA

2.4 a structure of a non-biological atp binding protein with adp bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP Binding Protein-DX
publication title A Primordial ATP Binding Protein Generated from Random Sequence Origin
rcsb
source organism Unidentified
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dgmA00
1UW1A 2P09A 3LT9A 3DGMA 3LTAA 3LTBA 3DGLA 3DGOA 3LTCA 3LTDA 3DGNA 2P0XA 2P05A 3LT8A
chains in the Genus database with same CATH superfamily
1RGAA 1IDPA 1YNVX 2QA43 1S723 2IUJA 1W4NA 3FZWA 5IG3A 1TRPA 3PS8A 4QWTA 2W2CA 5G1LA 3X40A 2F4YA 3AHSA 1JB2A 3EHCA 1TFKA 1IQYA 4O8SA 1CYUA 3CC23 4AEQA 4HZBB 3GWRA 4R1KA 2K3DA 2OCTA 3QRDA 2SBLA 3OV4A 3NBJA 1ZS7A 2XH9A 2OWPA 1LNIA 1MGRA 1V74A 5BXQA 1YJ93 3F9SA 1BNSA 5DRVA 1RJOA 1MWRA 2W56B 2GBXB 2CFLA 1YGWA 3CME3 3CCJ3 2YFJB 4BL3A 3EE1A 3ZG0A 1BRNL 1SPUA 2W9QA 4N6UA 1DMMA 2WOHA 3U1WA 1MWUA 1SIHA 3MYTA 4NHFA 1BVIA 1W6CA 3PXMA 3I553 4HZ9B 1IV9A 5M18A 3NQZA 1BNEA 1DVCA 5D81A 1V58A 1RGHA 2CX0A 4PEJA 3D5GA 4WYKA 1K41A 4HOHA 1FW7A 3DGOA 3RNTA 3CCR3 1EG9B 2RFRA 1DETA 5ELUA 3FF2A 3GZBA 3RGAA 1Q864 1N9JA 2YFLB 5KP4A 1DMQA 2HMKB 1BNIA 3V98A 5CLKA 2JQ5A 1Z1SA 1A67A 3NBBA 3FLJA 4BU4A 1UGHI 4XDWA 3PCRA 2GSPA 2O9UX 3SOAA 5AEUB 1VQL3 2F56A 1HZ1A 1RN7A 4RNYA 1N8QA 1O7WB 5AIHA 1A2KA 1FUTA 1GMRA 1O7HB 2ZHXB 3NM2A 1JZOA 2K54A 8CHOA 5AEWB 1JBRA 1QAKA 3QK9A 1LVNA 1M904 2BIRA 2Q07A 2YX9A 3WA3A 1IV7A 1UI7A 4LEHA 4O02B 1LOVA 3EC9A 3CC73 1B27A 1VQ83 1BAOA 4XM4A 4XBXA 1X1YA 4HBRA 4NREA 1VQ73 2P05A 1MOLA 1G96A 1OGZA 3G6E3 3WODG 1DMNA 2XGLA 1JB4A 2Z7AA 2M7OA 4EBGA 3SOYA 2ZA4A 1O7PB 2GXFA 4OVMA 3Q1CA 2MF7A 1RGFA 4J8TA 2QEX3 6STDA 4ILFA 3A5EA 3DH2A 1GOUA 5BVBA 1VQK3 1W7CA 4K1UA 1KQS2 2OTJ3 2BMRB 1BRJA 1EUIC 1GOVA 1TFOA 2E2VA 3FKAA 2F99A 1Y4KA 3LTBA 1IYYA 2UUGC 2H0IA 5M19A 2OTL3 2GU3A 4MMXB 3JUOA 1DVDA 1BGSA 1NB3I 3GRDA 1RCKA 4HM0B 1B2XA 5AYRB 4HAAA 3PGBA 4XBYA 4I4KA 2CG0A 1ULIB 2CFWA 3FG1A 3S29A 4GB5A 3CNXA 2F5MA 1AQZA 2CFDA 2WO0A 5M1AA 2CW9A 1TIJA 3T8NA 1VQ53 1B20A 3DXOA 5GSPA 3ZG5A 4CCVA 3F40A 1W6GA 3CPW2 3LH4A 1VQ63 3T8UA 5BU4A 1EQKA 1UCLA 1UCJA 2PNCA 2WGOA 3FG4A 3IMAB 4OUQA 5AIGA 1Q7Y4 1Q824 3KFQC 3F7SA 3NQYA 2YFIB 4U13A 1STFI 4KFDA 1RN1A 4N6TA 5IEPA 2BT3A 3PYJA 4WP5A 5LC6A 2W0QA 2CC3A 2P0MA 2W03A 2OQEA 3BB9A 3X3YA 1I3IA 1B21A 1IVWA 2KF4A 2D1WA 3AGNA 1V57A 4KFFA 2CX1A 4FCJA 4N6OB 3FCSB 4N3VA 1RNTA 2IY2A 2QGUA 3EQQB 1U5OA 3MG1A 1R4CA 1VQN3 2W6JH 2SARA 3HIIA 1LNHA 3NV0A 4BTWA 3G713 1W02A 1FGTA 3K7CA 1QVF2 3X41A 1BRGA 3NX0A 1LQMB 3CCE3 3HI7A 3STDA 1OF5A 1GY5A 3RGRA 4AKYA 5JPPA 1T3BA 1RGLA 1OPYA 2QIYA 2J8XB 3BNEA 3EN8A 3V92A 4EXRA 2OOVA 4IIAA 4JF8A 2CWTA 1RTUA 3D4AA 1BSDA 3KZTA 3SX1A 1F8NA 3ROBA 1EKMA 1KWIA 4MEIA 2HMNB 2A15A 2H0GA 5AIFA 3OWUA 3X3XA 3LTCA 2XF3A 1Q9EA 1QJGA 4K61A 4HJLB 3KN4A 1K734 5G2GA 1GMQA 2B1XB 2FGTA 3CMA3 1ISKA 3TDGA 1YJN3 2GEXA 1A2PA 3EX9A 3MSOA 1Q40A 1LXEA 2HOHA 3LOYA 1VQ93 2R4IA 4O2HA 1TRQA 3UB1A 1B2ZA 5AYSC 8RNTA 1AVLA 1JZDA 1EA2A 5IF6A 1WQLB 1NB5I 1KD14 3CC43 3X42A 7GSPA 3WMDA 3G4S3 1OF5B 2P09A 1GS3A 3BNDA 4HVNA 3EB8A 2HMOB 1JRQA 5FGOA 5G1KA 3K5TA 1KC84 1K9M4 1E3VA 1IVVA 1BUQA 1BNJA 4LGQA 1ROAA 3LYGA 1FA3A 2KF6A 3WDGB 2LYXA 1IT7A 6GSPA 1W00A 1PFPA 4MJDA 4HM8B 3S28A 2XR8B 3PZWA 1OHSA 5D83A 4FCZA 2OOVC 2CH9A 1Q40B 3H51A 3S5CA 3E99A 3VF1A 2BHMA 3LT9A 1HYFA 3WOFB 2BMOB 3OW22 3DGLA 3ZFZA 1K28A 1T5YA 5EVHA 1HKXA 4R9KA 3OWSA 4RZMA 1BNFA 3WOEB 1VQP3 1SARA 4DKIA 5IG5A 3K0ZA 4GL6A 1G0TA 1W5ZA 1B2UA 1T2HA 4K90B 3MPHA 4WYKB 3SLUA 3B8LA 4HM4B 2MC8A 1YGEA 2XEPA 1RGCA 3BNCA 2GEYA 1UI8A 2C11A 1E97A 3DZLA 1JKGA 7STDA 4RNTA 2RBIA 4H3UA 4KT3B 5IENA 2RGQA 4LYLB 4KZ1A 5IEOA 3N54B 1KSIA 1BSEA 3CCU3 1I2GA 4K1VA 1AV4A 3K9MC 1JBSA 3HX8A 3M8CA 4NPBA 1SQWA 1IVXA 2KRTA 2W04A 2L1SA 3SEDA 1DE3A 5AIIA 4CDLA 1NU3A 1WMOA 3EBTA 1LOXA 4KVHA 1ZX2A 1Q814 4N6MA 3LXUX 3DGYA 1GD4A 1O7NB 4O3VA 1JJ22 1FGQA 3HIGA 4LSOA 5CF1A 1J2BA 1GMPA 1IQ8A 3NXJA 1MNLA 4L8PA 1G02A 3D79A 1BU4A 1YHQ3 3BLZA 4BTYA 3SXXA 1RGKA 3DM8A 3UL5A 1EEJA 3LZAA 1BRHA 2V1LA 1I0VA 2PZVA 3MWZA 4OK0A 3U97A 2XFSA 2HMJB 2WGQA 3NHXA 1X1UA 2XSOB 3CCQ3 5AI1A 2P38A 2CG1A 2W9PA 1A2VA 1GD3A 2KCDA 3B4OA 1OH0A 4IPBA 1RGGA 5IG4A 1JN5A 3CD63 5BIRA 2BO9B 3MHEA 2CWUA 3NUVA 5LC7A 1B2SA 2AADA 4L8OA 4R80A 3PCSA 3L0RA 1PY3A 1ASKA 1WMPA 1BSAA 4I5QA 3I563 4MMZB 1JB5A 1UCKA 1QAFA 1UUGB 5KP3A 3LTDA 1JV2B 1NWWA 5IG0A 3BU4A 1O7GB 2C4BA 1CH0A 3DUKA 1CYVA 3UNLA 2IMJA 2KF5A 3JVCA 1X1XA 2XGNA 1IU7A 1D6UA 1O7MB 9RNTA 5EQLA 2D42A 4J5GA 2XRXB 2IA7A 1T2IA 3G0KA 2Z76A 3UJMA 7RNTA 3F14A 3GZYB 1TUHA 1YVSA 2FNQA 1IVUA 2F5WA 1UCIA 2LQVA 1FUWA 2RCDA 3OXAA 4X2HA 3N9HA 1YJW3 5IERA 3H3HA 1M1K4 2ZL8A 1JN5B 4Q53A 1RNBA 3A76A 1RMSA 2F86B 4EW5A 1RDSA 1C54A 4KFEA 4FCMA 3SYUA 3KIIA 3WA2X 2XSHB 3KCHA 3IJEB 1TJDA 4TX4A 1BRSA 1BUJA 2CK3H 2Z6BA 5A0OB 5TGNA 1D6ZA 1CQSA 1LRAA 4XBTA 2P0XA 1M1XB 1OHPA 1YIJ3 3FG3A 3EN1B 3HK4A 5DREA 6RNTA 2IYJA 3BNBA 1FZUA 1AR0A 1I8VA 3AHWA 4STDA 3RDEA 1LQGC 1BNGA 2H0HA 3NV0B 2OQEC 3LTAA 1TP6A 3FGYA 1C7HA 1NNVA 3ALAA 5CF2A 2WOFA 1BSCA 2KAAA 1W2ZA 2GU1A 3HOHA 2RNTA 3Q90A 1FUSA 3AGOA 1ZGXA 3DMCA 3ECFA 3G8ZA 2C10A 2R41A 3AMOA 3FH1A 1FYSA 4HYZA 4IT7A 1YI23 1OGXA 2E2TA 4RBNA 4EC6A 2F98A 4HKVB 3JUMA 1STDA 2O3OA 3CNMA 4J5KA 1GY7A 4XDVA 3VSYA 3CCS3 3CCM3 4ZM8A 3NBRA 1OCVA 1MWSA 1I2EA 4HM6B 4WWUC 1PU4A 4MMYB 3MG2A 3S67A 1LOWA 2HMLB 5RNTA 3BIRA 3EF8A 1QVG2 1UW1A 1NDOB 2CIUA 2I9WA 4HM3B 1HU9A 1TTOA 3D9RA 3WHOA 3MG3A 1NJI4 1D6YA 4EV5A 3GZXB 3CCV3 2BNGA 3EBYA 1NO3A 3K63A 4L7KA 1BNRA 1BOXA 4H61A 1L5GB 1FGRA 1I3FA 1W6YA 3GSPA 3I0YA 3CU3A 1FGMA 4EYCA 1SIIA 1OUNA 4FMCA 3AMOB 3B4PA 4FR9A 3J7Yd 3CCL3 1GOYA 1US1A 2JDIH 1BANA 4BIRA 1UGIA 1MGWA 1U8CB 1UDII 3KE7A 2FXTA 4G1MB 5HGRA 1VQM3 3Q2PA 1A90A 1UUWB 3V99A 1BSBA 1Q7HA 1QMAA 1WNHA 5STDA 3KSED 1IK3A 1I0XA 3FF0A 3OWYA 1VQO3 2ZDJA 4FMAA 1GYBA 1W2B2 1W01A 2Y74A 2B24B 2HMMB 3JUNA 4LZIA 4R9LA 3F8XA 1BRKA 1VZZA 2CKFB 3DY5A 4JRFA 1VQ43 3CPOA 3NM7A 4FMBA 2AAEA 5ELJA 4EV2A 3HZPA 2RSXA 3JUQA 4X2OA 1K8A4 1BIRA 1RHLA 3URPA 4HM1B 3F8HA 1RKYA 2Z77A 2CFKA 2ML5A 1PYLA 4CJNA 1RCLA 5I97A 3SVAA 1N5HA 3KSPA 1JKGB 5FW5A 5KP1A 1N8R4 4R4KA 1WMNA 1E3RA 2KXGA 5D82A 1WTHA 1TU5A 1I2FA 1DYUA 3G16A 3LMLA 2L4VA 1GSPA 1AY7A 1OACA 4N6NB 1M9GA 2K0MA 3IPTA 4RNZA 3CXC2 3UL6A 2GBWB 1MWTA 1RGEA 5IW9A 2CWVA 1X1WA 4BL2A 5HOHA 2UGIA 3D3LA 1N5PA 4N6LA 4ORLA 2CHCA 5CK6A 3MKIA 1ULJB 3F7XA 3VGNA 1FGOA 3DGMA 3Q3FA 1R4YA 1YIT3 2E2UA 2CFGA 3JUPA 4LMIA 2UX0A 1QALA 1RSNA 1SJWA 2BMQB 3DGNA 3GZRA 4WFOA 4BTXA 5JPUA 2INXA 1N9EA 4HM5B 3WR2A 1AVKA 2STDA 3X3ZA 1YVBI 2Y73A 1GY6A 1I70A 1B2MA 4J9AA 4XB5A 5CXOA 4HM7B 1RLSA 1RN4A 3T0UA 3OX9A 1Q42A 1RRLA 2ML6A 1S5AA 3S27A 4CPKA 4WHAA 4HM2B 1JBTA 3LT8A 1CEWI 3B7CA 1JNQA 1ZO2A 1UUVB 3KKGA 5JBSA 1IQXA 1VQQA 3N8BA 4AKZA 1B3SA 3GAXA 1IT8A 2BU4A 1BRIA 1RRHA 1LOYA 4GSPA 3FSDA 3O8YA 4N6V0 4GHOA 2KF3A 5EEOA 2W56A 1OHOA 2IUKA 4FMDA 1ROVA 2XFTA 3D5IA 3ER7A 3EJVA
chains in the Genus database with same CATH topology
1IDPA 2QA43 1S723 2IUJA 1W4NA 3FZWA 5IG3A 3PS8A 4QWTA 2W2CA 3X40A 1JB2A 3EHCA 1TFKA 1IQYA 4O8SA 1CYUA 3CC23 4AEQA 4HZBB 3GWRA 4R1KA 2OCTA 3QRDA 2SBLA 3OV4A 3NBJA 2XH9A 2OWPA 1V74A 5BXQA 1YJ93 3F9SA 5DRVA 1RJOA 2W56B 2GBXB 2CFLA 3CME3 3CCJ3 2YFJB 3EE1A 1SPUA 2W9QA 4N6UA 1DMMA 2WOHA 3U1WA 1SIHA 3MYTA 4NHFA 3PXMA 1W6CA 3I553 4HZ9B 1IV9A 3NQZA 1DVCA 5D81A 4PEJA 4WYKA 1K41A 3DGOA 3CCR3 1EG9B 2RFRA 5ELUA 3RGAA 3FF2A 3GZBA 1Q864 1N9JA 2YFLB 5KP4A 1DMQA 2HMKB 3V98A 5CLKA 2JQ5A 1Z1SA 1A67A 3NBBA 3FLJA 4XDWA 3PCRA 2O9UX 3SOAA 5AEUB 1VQL3 1RN7A 4RNYA 1N8QA 1O7WB 5AIHA 1A2KA 3NM2A 1O7HB 2K54A 8CHOA 5AEWB 1QAKA 3QK9A 1LVNA 1M904 2Q07A 2YX9A 3WA3A 1IV7A 1UI7A 4LEHA 4O02B 3EC9A 3CC73 1VQ83 4XM4A 4XBXA 4HBRA 4NREA 1VQ73 2P05A 1MOLA 1G96A 1OGZA 3G6E3 3WODG 1DMNA 2XGLA 1JB4A 2Z7AA 2M7OA 4EBGA 3SOYA 1O7PB 2GXFA 4OVMA 3Q1CA 2MF7A 4J8TA 2QEX3 6STDA 5BVBA 1KQS2 1VQK3 2OTJ3 1W7CA 4K1UA 2BMRB 2E2VA 1TFOA 3LTBA 3FKAA 2F99A 1Y4KA 2OTL3 2GU3A 4MMXB 3JUOA 1DVDA 1NB3I 3GRDA 4HM0B 5AYRB 3PGBA 4XBYA 4I4KA 2CG0A 1ULIB 2CFWA 3FG1A 3S29A 4GB5A 3CNXA 2CFDA 2WO0A 2CW9A 1TIJA 3T8NA 1VQ53 3DXOA 1VQ63 4CCVA 3F40A 1W6GA 3CPW2 3LH4A 3T8UA 1EQKA 1Q7Y4 2PNCA 3FG4A 2WGOA 3IMAB 1Q824 4OUQA 5AIGA 3KFQC 3F7SA 3NQYA 2YFIB 4U13A 1STFI 4KFDA 4N6TA 5IEPA 2BT3A 3PYJA 4WP5A 5LC6A 2W0QA 2CC3A 2P0MA 2W03A 2OQEA 3BB9A 3X3YA 1IVWA 2D1WA 4KFFA 4FCJA 4N6OB 3FCSB 4N3VA 2QGUA 3EQQB 1U5OA 3MG1A 1R4CA 1VQN3 2W6JH 3HIIA 1LNHA 3NV0A 4BTWA 3G713 1W02A 1FGTA 3K7CA 1QVF2 3X41A 3NX0A 3CCE3 3HI7A 3STDA 1OF5A 1GY5A 3RGRA 4AKYA 5JPPA 1OPYA 2QIYA 3BNEA 3EN8A 3V92A 4EXRA 2OOVA 4IIAA 4JF8A 2CWTA 3KZTA 3SX1A 1F8NA 3ROBA 1EKMA 1KWIA 4MEIA 2HMNB 2A15A 5AIFA 3OWUA 3X3XA 3LTCA 2XF3A 1QJGA 4K61A 4HJLB 3KN4A 1K734 5G2GA 2B1XB 2FGTA 1ISKA 3CMA3 3TDGA 1YJN3 2GEXA 3EX9A 3MSOA 1Q40A 1LXEA 3LOYA 1VQ93 2R4IA 4O2HA 3UB1A 5AYSC 1AVLA 1EA2A 5IF6A 1WQLB 1NB5I 1KD14 3CC43 3X42A 3G4S3 3WMDA 1OF5B 2P09A 1GS3A 3BNDA 4HVNA 3EB8A 2HMOB 1JRQA 5FGOA 3K5TA 1KC84 1K9M4 1E3VA 1IVVA 1BUQA 4LGQA 1ROAA 3LYGA 1FA3A 3WDGB 2LYXA 1IT7A 1W00A 1PFPA 4MJDA 4HM8B 3S28A 2XR8B 3PZWA 1OHSA 5D83A 4FCZA 2OOVC 2CH9A 1Q40B 3H51A 3S5CA 3E99A 3VF1A 2BHMA 3LT9A 3WOFB 2BMOB 3OW22 3DGLA 1K28A 1T5YA 5EVHA 1HKXA 4R9KA 3OWSA 4RZMA 3WOEB 1VQP3 5IG5A 3K0ZA 4GL6A 1W5ZA 4K90B 4WYKB 3MPHA 3SLUA 3B8LA 4HM4B 2MC8A 1YGEA 2XEPA 3BNCA 2GEYA 1UI8A 2C11A 1E97A 3DZLA 1JKGA 7STDA 4H3UA 5IENA 2RGQA 4KZ1A 5IEOA 3N54B 1KSIA 3CCU3 4K1VA 1AV4A 3K9MC 3HX8A 3M8CA 1SQWA 1IVXA 2KRTA 2W04A 3SEDA 5AIIA 4CDLA 1NU3A 1WMOA 3EBTA 1LOXA 4KVHA 1ZX2A 1Q814 4N6MA 3LXUX 1JJ22 1GD4A 1O7NB 4O3VA 1FGQA 3HIGA 4LSOA 5CF1A 1J2BA 1IQ8A 3NXJA 1MNLA 4L8PA 1YHQ3 3BLZA 4BTYA 3SXXA 3DM8A 3UL5A 3LZAA 2V1LA 2PZVA 3MWZA 4OK0A 3U97A 2XFSA 2HMJB 2WGQA 3NHXA 2XSOB 3CCQ3 5AI1A 2P38A 2CG1A 2W9PA 1A2VA 1GD3A 2KCDA 3B4OA 1OH0A 4IPBA 5IG4A 3CD63 1JN5A 2BO9B 3MHEA 2CWUA 3NUVA 5LC7A 4L8OA 4R80A 3PCSA 3L0RA 1WMPA 1ASKA 3I563 4MMZB 1JB5A 1QAFA 5KP3A 3LTDA 1JV2B 1NWWA 5IG0A 1O7GB 3DUKA 1CYVA 3UNLA 2IMJA 3JVCA 2XGNA 1IU7A 1D6UA 1O7MB 5EQLA 2D42A 2XRXB 2IA7A 3G0KA 2Z76A 3UJMA 3F14A 3GZYB 1TUHA 2FNQA 2LQVA 1IVUA 1FUWA 2RCDA 3OXAA 4X2HA 3N9HA 1YJW3 5IERA 3H3HA 1M1K4 2ZL8A 1JN5B 4Q53A 3A76A 2F86B 4KFEA 4FCMA 3KIIA 3WA2X 2XSHB 3IJEB 4TX4A 2CK3H 2Z6BA 5A0OB 5TGNA 1D6ZA 1CQSA 4XBTA 2P0XA 1M1XB 1OHPA 1YIJ3 3FG3A 3EN1B 3HK4A 5DREA 3BNBA 1AR0A 4STDA 3RDEA 3NV0B 2OQEC 3LTAA 1TP6A 3FGYA 1C7HA 3ALAA 5CF2A 2WOFA 1W2ZA 2GU1A 3Q90A 3DMCA 3ECFA 3G8ZA 2C10A 3AMOA 3FH1A 4HYZA 4IT7A 1YI23 1OGXA 2E2TA 4RBNA 4EC6A 2F98A 4HKVB 3JUMA 1STDA 2O3OA 3CNMA 4XDVA 1GY7A 3VSYA 3CCS3 3CCM3 4ZM8A 3NBRA 1OCVA 4HM6B 4WWUC 1PU4A 4MMYB 3MG2A 3S67A 2HMLB 3EF8A 1QVG2 1UW1A 1NDOB 2CIUA 2I9WA 4HM3B 1HU9A 3D9RA 1NJI4 3MG3A 1D6YA 4EV5A 3GZXB 3CCV3 2BNGA 3EBYA 1NO3A 3K63A 4L7KA 4H61A 1L5GB 1FGRA 1W6YA 3I0YA 3CU3A 1FGMA 4EYCA 1SIIA 1OUNA 4FMCA 3AMOB 3B4PA 4FR9A 3J7Yd 3CCL3 1US1A 2JDIH 1U8CB 3KE7A 2FXTA 4G1MB 5HGRA 1VQM3 3Q2PA 1A90A 1UUWB 3V99A 1QMAA 1WNHA 5STDA 3KSED 1IK3A 3FF0A 3OWYA 1VQO3 2ZDJA 4FMAA 1GYBA 1W2B2 1W01A 2Y74A 2B24B 2HMMB 3JUNA 4LZIA 4R9LA 3F8XA 1VZZA 2CKFB 3DY5A 4JRFA 1VQ43 3CPOA 3NM7A 4FMBA 5ELJA 4EV2A 3HZPA 2RSXA 3JUQA 4X2OA 1K8A4 4HM1B 3F8HA 1RKYA 2Z77A 2CFKA 2ML5A 5I97A 3SVAA 1N5HA 3KSPA 1JKGB 5FW5A 5KP1A 1N8R4 4R4KA 1WMNA 1E3RA 2KXGA 5D82A 1WTHA 1TU5A 1DYUA 3G16A 3LMLA 2L4VA 1OACA 4N6NB 1M9GA 2K0MA 3IPTA 4RNZA 3CXC2 3UL6A 2GBWB 5IW9A 2CWVA 3D3LA 1N5PA 4N6LA 4ORLA 2CHCA 5CK6A 3MKIA 1ULJB 3F7XA 3VGNA 1FGOA 3DGMA 1YIT3 2E2UA 2CFGA 3JUPA 4LMIA 2UX0A 1QALA 1SJWA 2BMQB 3DGNA 3GZRA 4WFOA 4BTXA 5JPUA 2INXA 1N9EA 4HM5B 1AVKA 2STDA 3X3ZA 1YVBI 2Y73A 1GY6A 4J9AA 4XB5A 5CXOA 4HM7B 3T0UA 3OX9A 1Q42A 1RRLA 2ML6A 1S5AA 3S27A 4WHAA 4HM2B 3LT8A 1CEWI 3B7CA 1JNQA 1ZO2A 1UUVB 3KKGA 5JBSA 1IQXA 3N8BA 4AKZA 3GAXA 1IT8A 1RRHA 3FSDA 3O8YA 4N6V0 5EEOA 2W56A 1OHOA 2IUKA 4FMDA 1ROVA 2XFTA 3ER7A 3EJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW1 A;  2P09 A;  3LT9 A;  3DGM A;  3LTA A;  3LTB A;  3DGL A;  3DGO A;  3LTC A;  3LTD A;  3DGN A;  2P0X A;  2P05 A;  3LT8 A; 
#chains in the Genus database with same CATH topology
 1RGA A;  1IDP A;  1YNV X;  2QA4 3;  1S72 3;  2IUJ A;  1W4N A;  3FZW A;  5IG3 A;  1TRP A;  3PS8 A;  4QWT A;  2W2C A;  5G1L A;  3X40 A;  2F4Y A;  3AHS A;  1JB2 A;  3EHC A;  1TFK A;  1IQY A;  4O8S A;  1CYU A;  3CC2 3;  4AEQ A;  4HZB B;  3GWR A;  4R1K A;  2K3D A;  2OCT A;  3QRD A;  2SBL A;  3OV4 A;  3NBJ A;  1ZS7 A;  2XH9 A;  2OWP A;  1LNI A;  1MGR A;  1V74 A;  5BXQ A;  1YJ9 3;  3F9S A;  1BNS A;  5DRV A;  1RJO A;  1MWR A;  2W56 B;  2GBX B;  2CFL A;  1YGW A;  3CME 3;  3CCJ 3;  2YFJ B;  4BL3 A;  3EE1 A;  3ZG0 A;  1BRN L;  1SPU A;  2W9Q A;  4N6U A;  1DMM A;  2WOH A;  3U1W A;  1MWU A;  1SIH A;  3MYT A;  4NHF A;  1BVI A;  1W6C A;  3PXM A;  3I55 3;  4HZ9 B;  1IV9 A;  5M18 A;  3NQZ A;  1BNE A;  1DVC A;  5D81 A;  1V58 A;  1RGH A;  2CX0 A;  4PEJ A;  3D5G A;  4WYK A;  1K41 A;  4HOH A;  1FW7 A;  3DGO A;  3RNT A;  3CCR 3;  1EG9 B;  2RFR A;  1DET A;  5ELU A;  3FF2 A;  3GZB A;  3RGA A;  1Q86 4;  1N9J A;  2YFL B;  5KP4 A;  1DMQ A;  2HMK B;  1BNI A;  3V98 A;  5CLK A;  2JQ5 A;  1Z1S A;  1A67 A;  3NBB A;  3FLJ A;  4BU4 A;  1UGH I;  4XDW A;  3PCR A;  2GSP A;  2O9U X;  3SOA A;  5AEU B;  1VQL 3;  2F56 A;  1HZ1 A;  1RN7 A;  4RNY A;  1N8Q A;  1O7W B;  5AIH A;  1A2K A;  1FUT A;  1GMR A;  1O7H B;  2ZHX B;  3NM2 A;  1JZO A;  2K54 A;  8CHO A;  5AEW B;  1JBR A;  1QAK A;  3QK9 A;  1LVN A;  1M90 4;  2BIR A;  2Q07 A;  2YX9 A;  3WA3 A;  1IV7 A;  1UI7 A;  4LEH A;  4O02 B;  1LOV A;  3EC9 A;  3CC7 3;  1B27 A;  1VQ8 3;  1BAO A;  4XM4 A;  4XBX A;  1X1Y A;  4HBR A;  4NRE A;  1VQ7 3;  2P05 A;  1MOL A;  1G96 A;  1OGZ A;  3G6E 3;  3WOD G;  1DMN A;  2XGL A;  1JB4 A;  2Z7A A;  2M7O A;  4EBG A;  3SOY A;  2ZA4 A;  1O7P B;  2GXF A;  4OVM A;  3Q1C A;  2MF7 A;  1RGF A;  4J8T A;  2QEX 3;  6STD A;  4ILF A;  3A5E A;  3DH2 A;  1GOU A;  5BVB A;  1VQK 3;  1W7C A;  4K1U A;  1KQS 2;  2OTJ 3;  2BMR B;  1BRJ A;  1EUI C;  1GOV A;  1TFO A;  2E2V A;  3FKA A;  2F99 A;  1Y4K A;  3LTB A;  1IYY A;  2UUG C;  2H0I A;  5M19 A;  2OTL 3;  2GU3 A;  4MMX B;  3JUO A;  1DVD A;  1BGS A;  1NB3 I;  3GRD A;  1RCK A;  4HM0 B;  1B2X A;  5AYR B;  4HAA A;  3PGB A;  4XBY A;  4I4K A;  2CG0 A;  1ULI B;  2CFW A;  3FG1 A;  3S29 A;  4GB5 A;  3CNX A;  2F5M A;  1AQZ A;  2CFD A;  2WO0 A;  5M1A A;  2CW9 A;  1TIJ A;  3T8N A;  1VQ5 3;  1B20 A;  3DXO A;  5GSP A;  3ZG5 A;  4CCV A;  3F40 A;  1W6G A;  3CPW 2;  3LH4 A;  1VQ6 3;  3T8U A;  5BU4 A;  1EQK A;  1UCL A;  1UCJ A;  2PNC A;  2WGO A;  3FG4 A;  3IMA B;  4OUQ A;  5AIG A;  1Q7Y 4;  1Q82 4;  3KFQ C;  3F7S A;  3NQY A;  2YFI B;  4U13 A;  1STF I;  4KFD A;  1RN1 A;  4N6T A;  5IEP A;  2BT3 A;  3PYJ A;  4WP5 A;  5LC6 A;  2W0Q A;  2CC3 A;  2P0M A;  2W03 A;  2OQE A;  3BB9 A;  3X3Y A;  1I3I A;  1B21 A;  1IVW A;  2KF4 A;  2D1W A;  3AGN A;  1V57 A;  4KFF A;  2CX1 A;  4FCJ A;  4N6O B;  3FCS B;  4N3V A;  1RNT A;  2IY2 A;  2QGU A;  3EQQ B;  1U5O A;  3MG1 A;  1R4C A;  1VQN 3;  2W6J H;  2SAR A;  3HII A;  1LNH A;  3NV0 A;  4BTW A;  3G71 3;  1W02 A;  1FGT A;  3K7C A;  1QVF 2;  3X41 A;  1BRG A;  3NX0 A;  1LQM B;  3CCE 3;  3HI7 A;  3STD A;  1OF5 A;  1GY5 A;  3RGR A;  4AKY A;  5JPP A;  1T3B A;  1RGL A;  1OPY A;  2QIY A;  2J8X B;  3BNE A;  3EN8 A;  3V92 A;  4EXR A;  2OOV A;  4IIA A;  4JF8 A;  2CWT A;  1RTU A;  3D4A A;  1BSD A;  3KZT A;  3SX1 A;  1F8N A;  3ROB A;  1EKM A;  1KWI A;  4MEI A;  2HMN B;  2A15 A;  2H0G A;  5AIF A;  3OWU A;  3X3X A;  3LTC A;  2XF3 A;  1Q9E A;  1QJG A;  4K61 A;  4HJL B;  3KN4 A;  1K73 4;  5G2G A;  1GMQ A;  2B1X B;  2FGT A;  3CMA 3;  1ISK A;  3TDG A;  1YJN 3;  2GEX A;  1A2P A;  3EX9 A;  3MSO A;  1Q40 A;  1LXE A;  2HOH A;  3LOY A;  1VQ9 3;  2R4I A;  4O2H A;  1TRQ A;  3UB1 A;  1B2Z A;  5AYS C;  8RNT A;  1AVL A;  1JZD A;  1EA2 A;  5IF6 A;  1WQL B;  1NB5 I;  1KD1 4;  3CC4 3;  3X42 A;  7GSP A;  3WMD A;  3G4S 3;  1OF5 B;  2P09 A;  1GS3 A;  3BND A;  4HVN A;  3EB8 A;  2HMO B;  1JRQ A;  5FGO A;  5G1K A;  3K5T A;  1KC8 4;  1K9M 4;  1E3V A;  1IVV A;  1BUQ A;  1BNJ A;  4LGQ A;  1ROA A;  3LYG A;  1FA3 A;  2KF6 A;  3WDG B;  2LYX A;  1IT7 A;  6GSP A;  1W00 A;  1PFP A;  4MJD A;  4HM8 B;  3S28 A;  2XR8 B;  3PZW A;  1OHS A;  5D83 A;  4FCZ A;  2OOV C;  2CH9 A;  1Q40 B;  3H51 A;  3S5C A;  3E99 A;  3VF1 A;  2BHM A;  3LT9 A;  1HYF A;  3WOF B;  2BMO B;  3OW2 2;  3DGL A;  3ZFZ A;  1K28 A;  1T5Y A;  5EVH A;  1HKX A;  4R9K A;  3OWS A;  4RZM A;  1BNF A;  3WOE B;  1VQP 3;  1SAR A;  4DKI A;  5IG5 A;  3K0Z A;  4GL6 A;  1G0T A;  1W5Z A;  1B2U A;  1T2H A;  4K90 B;  3MPH A;  4WYK B;  3SLU A;  3B8L A;  4HM4 B;  2MC8 A;  1YGE A;  2XEP A;  1RGC A;  3BNC A;  2GEY A;  1UI8 A;  2C11 A;  1E97 A;  3DZL A;  1JKG A;  7STD A;  4RNT A;  2RBI A;  4H3U A;  4KT3 B;  5IEN A;  2RGQ A;  4LYL B;  4KZ1 A;  5IEO A;  3N54 B;  1KSI A;  1BSE A;  3CCU 3;  1I2G A;  4K1V A;  1AV4 A;  3K9M C;  1JBS A;  3HX8 A;  3M8C A;  4NPB A;  1SQW A;  1IVX A;  2KRT A;  2W04 A;  2L1S A;  3SED A;  1DE3 A;  5AII A;  4CDL A;  1NU3 A;  1WMO A;  3EBT A;  1LOX A;  4KVH A;  1ZX2 A;  1Q81 4;  4N6M A;  3LXU X;  3DGY A;  1GD4 A;  1O7N B;  4O3V A;  1JJ2 2;  1FGQ A;  3HIG A;  4LSO A;  5CF1 A;  1J2B A;  1GMP A;  1IQ8 A;  3NXJ A;  1MNL A;  4L8P A;  1G02 A;  3D79 A;  1BU4 A;  1YHQ 3;  3BLZ A;  4BTY A;  3SXX A;  1RGK A;  3DM8 A;  3UL5 A;  1EEJ A;  3LZA A;  1BRH A;  2V1L A;  1I0V A;  2PZV A;  3MWZ A;  4OK0 A;  3U97 A;  2XFS A;  2HMJ B;  2WGQ A;  3NHX A;  1X1U A;  2XSO B;  3CCQ 3;  5AI1 A;  2P38 A;  2CG1 A;  2W9P A;  1A2V A;  1GD3 A;  2KCD A;  3B4O A;  1OH0 A;  4IPB A;  1RGG A;  5IG4 A;  1JN5 A;  3CD6 3;  5BIR A;  2BO9 B;  3MHE A;  2CWU A;  3NUV A;  5LC7 A;  1B2S A;  2AAD A;  4L8O A;  4R80 A;  3PCS A;  3L0R A;  1PY3 A;  1ASK A;  1WMP A;  1BSA A;  4I5Q A;  3I56 3;  4MMZ B;  1JB5 A;  1UCK A;  1QAF A;  1UUG B;  5KP3 A;  3LTD A;  1JV2 B;  1NWW A;  5IG0 A;  3BU4 A;  1O7G B;  2C4B A;  1CH0 A;  3DUK A;  1CYV A;  3UNL A;  2IMJ A;  2KF5 A;  3JVC A;  1X1X A;  2XGN A;  1IU7 A;  1D6U A;  1O7M B;  9RNT A;  5EQL A;  2D42 A;  4J5G A;  2XRX B;  2IA7 A;  1T2I A;  3G0K A;  2Z76 A;  3UJM A;  7RNT A;  3F14 A;  3GZY B;  1TUH A;  1YVS A;  2FNQ A;  1IVU A;  2F5W A;  1UCI A;  2LQV A;  1FUW A;  2RCD A;  3OXA A;  4X2H A;  3N9H A;  1YJW 3;  5IER A;  3H3H A;  1M1K 4;  2ZL8 A;  1JN5 B;  4Q53 A;  1RNB A;  3A76 A;  1RMS A;  2F86 B;  4EW5 A;  1RDS A;  1C54 A;  4KFE A;  4FCM A;  3SYU A;  3KII A;  3WA2 X;  2XSH B;  3KCH A;  3IJE B;  1TJD A;  4TX4 A;  1BRS A;  1BUJ A;  2CK3 H;  2Z6B A;  5A0O B;  5TGN A;  1D6Z A;  1CQS A;  1LRA A;  4XBT A;  2P0X A;  1M1X B;  1OHP A;  1YIJ 3;  3FG3 A;  3EN1 B;  3HK4 A;  5DRE A;  6RNT A;  2IYJ A;  3BNB A;  1FZU A;  1AR0 A;  1I8V A;  3AHW A;  4STD A;  3RDE A;  1LQG C;  1BNG A;  2H0H A;  3NV0 B;  2OQE C;  3LTA A;  1TP6 A;  3FGY A;  1C7H A;  1NNV A;  3ALA A;  5CF2 A;  2WOF A;  1BSC A;  2KAA A;  1W2Z A;  2GU1 A;  3HOH A;  2RNT A;  3Q90 A;  1FUS A;  3AGO A;  1ZGX A;  3DMC A;  3ECF A;  3G8Z A;  2C10 A;  2R41 A;  3AMO A;  3FH1 A;  1FYS A;  4HYZ A;  4IT7 A;  1YI2 3;  1OGX A;  2E2T A;  4RBN A;  4EC6 A;  2F98 A;  4HKV B;  3JUM A;  1STD A;  2O3O A;  3CNM A;  4J5K A;  1GY7 A;  4XDV A;  3VSY A;  3CCS 3;  3CCM 3;  4ZM8 A;  3NBR A;  1OCV A;  1MWS A;  1I2E A;  4HM6 B;  4WWU C;  1PU4 A;  4MMY B;  3MG2 A;  3S67 A;  1LOW A;  2HML B;  5RNT A;  3BIR A;  3EF8 A;  1QVG 2;  1UW1 A;  1NDO B;  2CIU A;  2I9W A;  4HM3 B;  1HU9 A;  1TTO A;  3D9R A;  3WHO A;  3MG3 A;  1NJI 4;  1D6Y A;  4EV5 A;  3GZX B;  3CCV 3;  2BNG A;  3EBY A;  1NO3 A;  3K63 A;  4L7K A;  1BNR A;  1BOX A;  4H61 A;  1L5G B;  1FGR A;  1I3F A;  1W6Y A;  3GSP A;  3I0Y A;  3CU3 A;  1FGM A;  4EYC A;  1SII A;  1OUN A;  4FMC A;  3AMO B;  3B4P A;  4FR9 A;  3J7Y d;  3CCL 3;  1GOY A;  1US1 A;  2JDI H;  1BAN A;  4BIR A;  1UGI A;  1MGW A;  1U8C B;  1UDI I;  3KE7 A;  2FXT A;  4G1M B;  5HGR A;  1VQM 3;  3Q2P A;  1A90 A;  1UUW B;  3V99 A;  1BSB A;  1Q7H A;  1QMA A;  1WNH A;  5STD A;  3KSE D;  1IK3 A;  1I0X A;  3FF0 A;  3OWY A;  1VQO 3;  2ZDJ A;  4FMA A;  1GYB A;  1W2B 2;  1W01 A;  2Y74 A;  2B24 B;  2HMM B;  3JUN A;  4LZI A;  4R9L A;  3F8X A;  1BRK A;  1VZZ A;  2CKF B;  3DY5 A;  4JRF A;  1VQ4 3;  3CPO A;  3NM7 A;  4FMB A;  2AAE A;  5ELJ A;  4EV2 A;  3HZP A;  2RSX A;  3JUQ A;  4X2O A;  1K8A 4;  1BIR A;  1RHL A;  3URP A;  4HM1 B;  3F8H A;  1RKY A;  2Z77 A;  2CFK A;  2ML5 A;  1PYL A;  4CJN A;  1RCL A;  5I97 A;  3SVA A;  1N5H A;  3KSP A;  1JKG B;  5FW5 A;  5KP1 A;  1N8R 4;  4R4K A;  1WMN A;  1E3R A;  2KXG A;  5D82 A;  1WTH A;  1TU5 A;  1I2F A;  1DYU A;  3G16 A;  3LML A;  2L4V A;  1GSP A;  1AY7 A;  1OAC A;  4N6N B;  1M9G A;  2K0M A;  3IPT A;  4RNZ A;  3CXC 2;  3UL6 A;  2GBW B;  1MWT A;  1RGE A;  5IW9 A;  2CWV A;  1X1W A;  4BL2 A;  5HOH A;  2UGI A;  3D3L A;  1N5P A;  4N6L A;  4ORL A;  2CHC A;  5CK6 A;  3MKI A;  1ULJ B;  3F7X A;  3VGN A;  1FGO A;  3DGM A;  3Q3F A;  1R4Y A;  1YIT 3;  2E2U A;  2CFG A;  3JUP A;  4LMI A;  2UX0 A;  1QAL A;  1RSN A;  1SJW A;  2BMQ B;  3DGN A;  3GZR A;  4WFO A;  4BTX A;  5JPU A;  2INX A;  1N9E A;  4HM5 B;  3WR2 A;  1AVK A;  2STD A;  3X3Z A;  1YVB I;  2Y73 A;  1GY6 A;  1I70 A;  1B2M A;  4J9A A;  4XB5 A;  5CXO A;  4HM7 B;  1RLS A;  1RN4 A;  3T0U A;  3OX9 A;  1Q42 A;  1RRL A;  2ML6 A;  1S5A A;  3S27 A;  4CPK A;  4WHA A;  4HM2 B;  1JBT A;  3LT8 A;  1CEW I;  3B7C A;  1JNQ A;  1ZO2 A;  1UUV B;  3KKG A;  5JBS A;  1IQX A;  1VQQ A;  3N8B A;  4AKZ A;  1B3S A;  3GAX A;  1IT8 A;  2BU4 A;  1BRI A;  1RRH A;  1LOY A;  4GSP A;  3FSD A;  3O8Y A;  4N6V 0;  4GHO A;  2KF3 A;  5EEO A;  2W56 A;  1OHO A;  2IUK A;  4FMD A;  1ROV A;  2XFT A;  3D5I A;  3ER7 A;  3EJV A; 
#chains in the Genus database with same CATH homology
 1IDP A;  2QA4 3;  1S72 3;  2IUJ A;  1W4N A;  3FZW A;  5IG3 A;  3PS8 A;  4QWT A;  2W2C A;  3X40 A;  1JB2 A;  3EHC A;  1TFK A;  1IQY A;  4O8S A;  1CYU A;  3CC2 3;  4AEQ A;  4HZB B;  3GWR A;  4R1K A;  2OCT A;  3QRD A;  2SBL A;  3OV4 A;  3NBJ A;  2XH9 A;  2OWP A;  1V74 A;  5BXQ A;  1YJ9 3;  3F9S A;  5DRV A;  1RJO A;  2W56 B;  2GBX B;  2CFL A;  3CME 3;  3CCJ 3;  2YFJ B;  3EE1 A;  1SPU A;  2W9Q A;  4N6U A;  1DMM A;  2WOH A;  3U1W A;  1SIH A;  3MYT A;  4NHF A;  3PXM A;  1W6C A;  3I55 3;  4HZ9 B;  1IV9 A;  3NQZ A;  1DVC A;  5D81 A;  4PEJ A;  4WYK A;  1K41 A;  3DGO A;  3CCR 3;  1EG9 B;  2RFR A;  5ELU A;  3RGA A;  3FF2 A;  3GZB A;  1Q86 4;  1N9J A;  2YFL B;  5KP4 A;  1DMQ A;  2HMK B;  3V98 A;  5CLK A;  2JQ5 A;  1Z1S A;  1A67 A;  3NBB A;  3FLJ A;  4XDW A;  3PCR A;  2O9U X;  3SOA A;  5AEU B;  1VQL 3;  1RN7 A;  4RNY A;  1N8Q A;  1O7W B;  5AIH A;  1A2K A;  3NM2 A;  1O7H B;  2K54 A;  8CHO A;  5AEW B;  1QAK A;  3QK9 A;  1LVN A;  1M90 4;  2Q07 A;  2YX9 A;  3WA3 A;  1IV7 A;  1UI7 A;  4LEH A;  4O02 B;  3EC9 A;  3CC7 3;  1VQ8 3;  4XM4 A;  4XBX A;  4HBR A;  4NRE A;  1VQ7 3;  2P05 A;  1MOL A;  1G96 A;  1OGZ A;  3G6E 3;  3WOD G;  1DMN A;  2XGL A;  1JB4 A;  2Z7A A;  2M7O A;  4EBG A;  3SOY A;  1O7P B;  2GXF A;  4OVM A;  3Q1C A;  2MF7 A;  4J8T A;  2QEX 3;  6STD A;  5BVB A;  1KQS 2;  1VQK 3;  2OTJ 3;  1W7C A;  4K1U A;  2BMR B;  2E2V A;  1TFO A;  3LTB A;  3FKA A;  2F99 A;  1Y4K A;  2OTL 3;  2GU3 A;  4MMX B;  3JUO A;  1DVD A;  1NB3 I;  3GRD A;  4HM0 B;  5AYR B;  3PGB A;  4XBY A;  4I4K A;  2CG0 A;  1ULI B;  2CFW A;  3FG1 A;  3S29 A;  4GB5 A;  3CNX A;  2CFD A;  2WO0 A;  2CW9 A;  1TIJ A;  3T8N A;  1VQ5 3;  3DXO A;  1VQ6 3;  4CCV A;  3F40 A;  1W6G A;  3CPW 2;  3LH4 A;  3T8U A;  1EQK A;  1Q7Y 4;  2PNC A;  3FG4 A;  2WGO A;  3IMA B;  1Q82 4;  4OUQ A;  5AIG A;  3KFQ C;  3F7S A;  3NQY A;  2YFI B;  4U13 A;  1STF I;  4KFD A;  4N6T A;  5IEP A;  2BT3 A;  3PYJ A;  4WP5 A;  5LC6 A;  2W0Q A;  2CC3 A;  2P0M A;  2W03 A;  2OQE A;  3BB9 A;  3X3Y A;  1IVW A;  2D1W A;  4KFF A;  4FCJ A;  4N6O B;  3FCS B;  4N3V A;  2QGU A;  3EQQ B;  1U5O A;  3MG1 A;  1R4C A;  1VQN 3;  2W6J H;  3HII A;  1LNH A;  3NV0 A;  4BTW A;  3G71 3;  1W02 A;  1FGT A;  3K7C A;  1QVF 2;  3X41 A;  3NX0 A;  3CCE 3;  3HI7 A;  3STD A;  1OF5 A;  1GY5 A;  3RGR A;  4AKY A;  5JPP A;  1OPY A;  2QIY A;  3BNE A;  3EN8 A;  3V92 A;  4EXR A;  2OOV A;  4IIA A;  4JF8 A;  2CWT A;  3KZT A;  3SX1 A;  1F8N A;  3ROB A;  1EKM A;  1KWI A;  4MEI A;  2HMN B;  2A15 A;  5AIF A;  3OWU A;  3X3X A;  3LTC A;  2XF3 A;  1QJG A;  4K61 A;  4HJL B;  3KN4 A;  1K73 4;  5G2G A;  2B1X B;  2FGT A;  1ISK A;  3CMA 3;  3TDG A;  1YJN 3;  2GEX A;  3EX9 A;  3MSO A;  1Q40 A;  1LXE A;  3LOY A;  1VQ9 3;  2R4I A;  4O2H A;  3UB1 A;  5AYS C;  1AVL A;  1EA2 A;  5IF6 A;  1WQL B;  1NB5 I;  1KD1 4;  3CC4 3;  3X42 A;  3G4S 3;  3WMD A;  1OF5 B;  2P09 A;  1GS3 A;  3BND A;  4HVN A;  3EB8 A;  2HMO B;  1JRQ A;  5FGO A;  3K5T A;  1KC8 4;  1K9M 4;  1E3V A;  1IVV A;  1BUQ A;  4LGQ A;  1ROA A;  3LYG A;  1FA3 A;  3WDG B;  2LYX A;  1IT7 A;  1W00 A;  1PFP A;  4MJD A;  4HM8 B;  3S28 A;  2XR8 B;  3PZW A;  1OHS A;  5D83 A;  4FCZ A;  2OOV C;  2CH9 A;  1Q40 B;  3H51 A;  3S5C A;  3E99 A;  3VF1 A;  2BHM A;  3LT9 A;  3WOF B;  2BMO B;  3OW2 2;  3DGL A;  1K28 A;  1T5Y A;  5EVH A;  1HKX A;  4R9K A;  3OWS A;  4RZM A;  3WOE B;  1VQP 3;  5IG5 A;  3K0Z A;  4GL6 A;  1W5Z A;  4K90 B;  4WYK B;  3MPH A;  3SLU A;  3B8L A;  4HM4 B;  2MC8 A;  1YGE A;  2XEP A;  3BNC A;  2GEY A;  1UI8 A;  2C11 A;  1E97 A;  3DZL A;  1JKG A;  7STD A;  4H3U A;  5IEN A;  2RGQ A;  4KZ1 A;  5IEO A;  3N54 B;  1KSI A;  3CCU 3;  4K1V A;  1AV4 A;  3K9M C;  3HX8 A;  3M8C A;  1SQW A;  1IVX A;  2KRT A;  2W04 A;  3SED A;  5AII A;  4CDL A;  1NU3 A;  1WMO A;  3EBT A;  1LOX A;  4KVH A;  1ZX2 A;  1Q81 4;  4N6M A;  3LXU X;  1JJ2 2;  1GD4 A;  1O7N B;  4O3V A;  1FGQ A;  3HIG A;  4LSO A;  5CF1 A;  1J2B A;  1IQ8 A;  3NXJ A;  1MNL A;  4L8P A;  1YHQ 3;  3BLZ A;  4BTY A;  3SXX A;  3DM8 A;  3UL5 A;  3LZA A;  2V1L A;  2PZV A;  3MWZ A;  4OK0 A;  3U97 A;  2XFS A;  2HMJ B;  2WGQ A;  3NHX A;  2XSO B;  3CCQ 3;  5AI1 A;  2P38 A;  2CG1 A;  2W9P A;  1A2V A;  1GD3 A;  2KCD A;  3B4O A;  1OH0 A;  4IPB A;  5IG4 A;  3CD6 3;  1JN5 A;  2BO9 B;  3MHE A;  2CWU A;  3NUV A;  5LC7 A;  4L8O A;  4R80 A;  3PCS A;  3L0R A;  1WMP A;  1ASK A;  3I56 3;  4MMZ B;  1JB5 A;  1QAF A;  5KP3 A;  3LTD A;  1JV2 B;  1NWW A;  5IG0 A;  1O7G B;  3DUK A;  1CYV A;  3UNL A;  2IMJ A;  3JVC A;  2XGN A;  1IU7 A;  1D6U A;  1O7M B;  5EQL A;  2D42 A;  2XRX B;  2IA7 A;  3G0K A;  2Z76 A;  3UJM A;  3F14 A;  3GZY B;  1TUH A;  2FNQ A;  2LQV A;  1IVU A;  1FUW A;  2RCD A;  3OXA A;  4X2H A;  3N9H A;  1YJW 3;  5IER A;  3H3H A;  1M1K 4;  2ZL8 A;  1JN5 B;  4Q53 A;  3A76 A;  2F86 B;  4KFE A;  4FCM A;  3KII A;  3WA2 X;  2XSH B;  3IJE B;  4TX4 A;  2CK3 H;  2Z6B A;  5A0O B;  5TGN A;  1D6Z A;  1CQS A;  4XBT A;  2P0X A;  1M1X B;  1OHP A;  1YIJ 3;  3FG3 A;  3EN1 B;  3HK4 A;  5DRE A;  3BNB A;  1AR0 A;  4STD A;  3RDE A;  3NV0 B;  2OQE C;  3LTA A;  1TP6 A;  3FGY A;  1C7H A;  3ALA A;  5CF2 A;  2WOF A;  1W2Z A;  2GU1 A;  3Q90 A;  3DMC A;  3ECF A;  3G8Z A;  2C10 A;  3AMO A;  3FH1 A;  4HYZ A;  4IT7 A;  1YI2 3;  1OGX A;  2E2T A;  4RBN A;  4EC6 A;  2F98 A;  4HKV B;  3JUM A;  1STD A;  2O3O A;  3CNM A;  4XDV A;  1GY7 A;  3VSY A;  3CCS 3;  3CCM 3;  4ZM8 A;  3NBR A;  1OCV A;  4HM6 B;  4WWU C;  1PU4 A;  4MMY B;  3MG2 A;  3S67 A;  2HML B;  3EF8 A;  1QVG 2;  1UW1 A;  1NDO B;  2CIU A;  2I9W A;  4HM3 B;  1HU9 A;  3D9R A;  1NJI 4;  3MG3 A;  1D6Y A;  4EV5 A;  3GZX B;  3CCV 3;  2BNG A;  3EBY A;  1NO3 A;  3K63 A;  4L7K A;  4H61 A;  1L5G B;  1FGR A;  1W6Y A;  3I0Y A;  3CU3 A;  1FGM A;  4EYC A;  1SII A;  1OUN A;  4FMC A;  3AMO B;  3B4P A;  4FR9 A;  3J7Y d;  3CCL 3;  1US1 A;  2JDI H;  1U8C B;  3KE7 A;  2FXT A;  4G1M B;  5HGR A;  1VQM 3;  3Q2P A;  1A90 A;  1UUW B;  3V99 A;  1QMA A;  1WNH A;  5STD A;  3KSE D;  1IK3 A;  3FF0 A;  3OWY A;  1VQO 3;  2ZDJ A;  4FMA A;  1GYB A;  1W2B 2;  1W01 A;  2Y74 A;  2B24 B;  2HMM B;  3JUN A;  4LZI A;  4R9L A;  3F8X A;  1VZZ A;  2CKF B;  3DY5 A;  4JRF A;  1VQ4 3;  3CPO A;  3NM7 A;  4FMB A;  5ELJ A;  4EV2 A;  3HZP A;  2RSX A;  3JUQ A;  4X2O A;  1K8A 4;  4HM1 B;  3F8H A;  1RKY A;  2Z77 A;  2CFK A;  2ML5 A;  5I97 A;  3SVA A;  1N5H A;  3KSP A;  1JKG B;  5FW5 A;  5KP1 A;  1N8R 4;  4R4K A;  1WMN A;  1E3R A;  2KXG A;  5D82 A;  1WTH A;  1TU5 A;  1DYU A;  3G16 A;  3LML A;  2L4V A;  1OAC A;  4N6N B;  1M9G A;  2K0M A;  3IPT A;  4RNZ A;  3CXC 2;  3UL6 A;  2GBW B;  5IW9 A;  2CWV A;  3D3L A;  1N5P A;  4N6L A;  4ORL A;  2CHC A;  5CK6 A;  3MKI A;  1ULJ B;  3F7X A;  3VGN A;  1FGO A;  3DGM A;  1YIT 3;  2E2U A;  2CFG A;  3JUP A;  4LMI A;  2UX0 A;  1QAL A;  1SJW A;  2BMQ B;  3DGN A;  3GZR A;  4WFO A;  4BTX A;  5JPU A;  2INX A;  1N9E A;  4HM5 B;  1AVK A;  2STD A;  3X3Z A;  1YVB I;  2Y73 A;  1GY6 A;  4J9A A;  4XB5 A;  5CXO A;  4HM7 B;  3T0U A;  3OX9 A;  1Q42 A;  1RRL A;  2ML6 A;  1S5A A;  3S27 A;  4WHA A;  4HM2 B;  3LT8 A;  1CEW I;  3B7C A;  1JNQ A;  1ZO2 A;  1UUV B;  3KKG A;  5JBS A;  1IQX A;  3N8B A;  4AKZ A;  3GAX A;  1IT8 A;  1RRH A;  3FSD A;  3O8Y A;  4N6V 0;  5EEO A;  2W56 A;  1OHO A;  2IUK A;  4FMD A;  1ROV A;  2XFT A;  3ER7 A;  3EJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...