3DGMA

2.4 a structure of a non-biological atp binding protein with adp bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords ATP Binding Protein-DX
publication title A Primordial ATP Binding Protein Generated from Random Sequence Origin
rcsb
source organism Unidentified
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dgmA00
3DGMA 3DGLA 3DGOA 3DGNA 3LT9A 3LTAA 2P0XA 1UW1A 2P05A 3LTDA 3LT8A 2P09A 3LTBA 3LTCA
chains in the Genus database with same CATH superfamily
4N6NB 1NNVA 3RGRA 1UGIA 1OH0A 2Z7AA 3D5IA 1IDPA 3AMOB 3B7CA 1VQK3 1LNIA 1UI8A 4LEHA 2LYXA 1IT7A 1DE3A 2BMRB 1EUIC 1I0VA 1JKGA 3FKAA 2P0MA 4HKVB 2W56A 2C4BA 3DH2A 3SOYA 1YI23 1N9JA 2RCDA 3BB9A 4STDA 1US1A 1CYVA 4ORLA 5EEOA 5HGRA 3T0UA 1VQM3 5DRVA 3I563 1Q824 3OWYA 1MWRA 1RGFA 2WOFA 1HYFA 1JB5A 4GB5A 5EQLA 5FGOA 5IG3A 1VQ93 3G713 3OW22 1DVDA 3EN8A 1IV9A 4HJLB 2C11A 1TFOA 2ZHXB 4U13A 3WR2A 4FMAA 3T8UA 2CK3H 4R4KA 1GD4A 1LQMB 4BL3A 7RNTA 2P0XA 1DETA 1TRPA 1BIRA 1FZUA 2P09A 4WFOA 1Q7HA 1YGEA 1NO3A 3WA2X 3X3XA 3EF8A 2YFLB 4HM2B 1AQZA 2F4YA 1AVLA 4L8OA 3EB8A 5AEUB 3LOYA 3F8HA 3N8BA 2HMKB 3SLUA 4N3VA 3D79A 3NM7A 1GY6A 2XSHB 2HOHA 3FG1A 2L1SA 1FGRA 1KSIA 3DZLA 1W6GA 1YGWA 3A76A 1VQN3 1RNTA 2LQVA 4IPBA 1NWWA 3KN4A 5JPUA 4G1MB 2XGLA 1RJOA 4J5GA 2YX9A 5STDA 2RFRA 2ZDJA 3L0RA 1BVIA 3NUVA 1AV4A 1RRLA 2IUKA 1K8A4 1GSPA 3K5TA 1I8VA 1UDII 3FF0A 1YJN3 2BMQB 4FCMA 1IQYA 3F8XA 1LXEA 3B8LA 4O3VA 4KZ1A 3WMDA 1YIJ3 3CC43 3MWZA 3F7XA 6STDA 1FGTA 3EJVA 4MJDA 1BGSA 5D81A 1QMAA 5G2GA 3CU3A 4HYZA 1FUSA 3JUPA 1BAOA 4RNZA 2KF5A 1YVSA 3GZBA 4HM5B 4L8PA 1RLSA 3V98A 1HZ1A 3I553 2GSPA 3HX8A 1LVNA 3UL6A 3EE1A 1VQQA 3SVAA 5KP1A 1M9GA 1N8QA 3DMCA 4N6OB 3N9HA 1CQSA 2KF3A 3HI7A 4WP5A 3RNTA 3WODG 3MG2A 1Q40B 4IT7A 1GYBA 1LOYA 4HVNA 1GY5A 3T8NA 1BNEA 1DMMA 1ULJB 4JF8A 3ROBA 2CWUA 2XGNA 1O7MB 1OHSA 3LTAA 4I5QA 4EW5A 1UCKA 3EN1B 4XM4A 2CFDA 2OCTA 1JBSA 3FGYA 3GSPA 3CC73 2A15A 2YFJB 4AKZA 3FH1A 2CX1A 1NJI4 3BNCA 2CFKA 4XDWA 3CCM3 1UCJA 1ZS7A 1IQ8A 3KE7A 2J8XB 4RNTA 1VQ63 3JUMA 1SPUA 4BTWA 4EV2A 3S5CA 1QVG2 3K9MC 1FUWA 1WMOA 5HOHA 3OV4A 1RN7A 2Z77A 4N6MA 1O7NB 2SARA 4WHAA 1ZX2A 5CXOA 2D1WA 1EQKA 3HIIA 2WGQA 2W9PA 1IYYA 3D9RA 3OX9A 3CCJ3 2WOHA 2GBXB 5AI1A 4TX4A 1RGHA 1KC84 3PS8A 4N6LA 3U1WA 3KFQC 3LTBA 1LRAA 5GSPA 1KD14 9RNTA 4NHFA 4R9LA 3CC23 3PCRA 4WWUC 3CCV3 4MMYB 3BNDA 3J7Yd 3SX1A 3FG3A 1D6UA 1STDA 2L4VA 3MG3A 1ULIB 3V99A 1BRSA 1DMQA 1I70A 2IA7A 3TDGA 2CHCA 1B20A 1GY7A 3NBBA 1O7WB 1MWSA 3EHCA 3G0KA 1LOVA 3DY5A 4R80A 4RBNA 1Q814 4BTXA 3LT9A 1RGGA 2GXFA 3I0YA 2RGQA 1GD3A 1SIHA 1HKXA 3E99A 1BRGA 1O7HB 2XF3A 1UCLA 4GL6A 1QAKA 2HMLB 3SXXA 1NU3A 5BIRA 3ECFA 2KCDA 2FNQA 1ZGXA 1B2SA 1WNHA 2F5WA 3VF1A 7GSPA 3CCQ3 1GOYA 2W0QA 4KT3B 4LGQA 2MC8A 1CH0A 1A2PA 5CK6A 1D6ZA 1PU4A 2Q07A 2XH9A 1VQ53 1OCVA 2JDIH 5M19A 4LMIA 5A0OB 1V74A 2UX0A 3CNMA 1U5OA 3X3YA 3PXMA 2CW9A 3Q90A 2F5MA 1IVVA 2CFGA 3S27A 1GMRA 2GU1A 1PYLA 1GS3A 1BNGA 1FUTA 4BIRA 1V57A 2XR8B 1LOWA 1VQL3 1IU7A 2AADA 3KIIA 1BRHA 2PNCA 3EC9A 4N6UA 1WTHA 1DMNA 2I9WA 3GZRA 1FGQA 3ZFZA 3CCS3 1B2ZA 1B2UA 2BT3A 2H0GA 2V1LA 1A2VA 3NQYA 1BRIA 4GSPA 1FGMA 1STFI 2KXGA 4CCVA 1BRNL 2BHMA 5G1LA 1JZOA 1W5ZA 3WA3A 1N5HA 4O02B 1KQS2 4R9KA 2WO0A 3NV0B 4HM1B 1BNFA 1W6CA 3EX9A 3F7SA 3MG1A 4HM3B 1VQ73 1VQ43 3ZG5A 3UNLA 4N6TA 1BSEA 1MWUA 5ELUA 2R41A 1OF5A 2E2VA 2BNGA 3EBYA 1UCIA 1VZZA 3PCSA 5FW5A 3NBJA 1L5GB 1EG9B 4IIAA 4X2OA 2O9UX 2GEXA 3SOAA 4O2HA 4EV5A 1I3IA 1ZO2A 1ROAA 3X42A 1BANA 1RCKA 1CEWI 3CNXA 2HMJB 3KZTA 1C7HA 2PZVA 2Z6BA 1BSAA 1RN1A 3AGNA 1B21A 1BRKA 3B4OA 3GWRA 1N8R4 1YVBI 4MEIA 3URPA 6RNTA 4GHOA 3KSED 2QGUA 6GSPA 3G8ZA 3AGOA 1IT8A 3PZWA 5M1AA 4MMXB 1FGOA 5AYSC 1JB4A 1JZDA 4WYKB 3JUOA 3M8CA 4OK0A 3CPW2 1T2IA 2KF6A 4R1KA 1BNRA 2XSOB 4EXRA 1SIIA 3G6E3 1TUHA 4HM8B 3D4AA 3NHXA 2UUGC 2HMNB 1CYUA 2BU4A 4FMDA 1Q42A 4BTYA 4HBRA 5BU4A 4K1UA 4XB5A 1VQ83 2UGIA 5KP3A 3B4PA 1RGCA 1O7GB 2CH9A 2W56B 1K734 3NBRA 4N6V0 2CG1A 1ROVA 2W04A 4K90B 3AMOA 2F99A 1M1K4 3QRDA 1S723 3BNEA 1E3RA 1RN4A 2STDA 1A2KA 4K1VA 3BU4A 2H0HA 1NB3I 3GRDA 3CCR3 3FSDA 3WHOA 1GMQA 3AHWA 5D83A 1JN5B 1LQGC 3ALAA 3MHEA 3UJMA 4EYCA 2P05A 1R4CA 1AY7A 1RRHA 2QA43 4HM6B 8CHOA 1UUGB 5IEPA 1M1XB 1JJ22 4FMBA 2OOVC 1BOXA 4HM0B 5KP4A 2OOVA 1VQP3 1W02A 2M7OA 2W6JH 3H51A 3LT8A 4OUQA 1OACA 2OTL3 1RNBA 3JUQA 2Y73A 1BNJA 1PFPA 2RNTA 4FCJA 1BRJA 3Q1CA 4HAAA 4NREA 3A5EA 4ILFA 2BO9B 3X40A 3IJEB 1RGKA 3G16A 1JRQA 2CG0A 1QJGA 1E3VA 1QAFA 3BIRA 4J5KA 2XRXB 3CCL3 1SJWA 3EBTA 4EC6A 1ISKA 4EBGA 3G4S3 3LTCA 3F9SA 1NDOB 1I0XA 3ER7A 1DVCA 3U97A 2HMOB 4KFFA 3UL5A 1U8CB 2C10A 4PEJA 3GZYB 2F98A 4XBYA 4ZM8A 1K41A 2ML6A 2IYJA 2WGOA 5AEWB 5CF2A 1MGWA 4J9AA 1C54A 2BIRA 1GOUA 1AVKA 1BNSA 1VQO3 1D6YA 1W4NA 4RNYA 3S29A 1GOVA 1BSCA 1RSNA 3O8YA 1YNVX 3STDA 1Q7Y4 5BVBA 2CIUA 2HMMB 3HOHA 1A67A 1MGRA 3D3LA 2SBLA 3D5GA 3UB1A 3DGOA 1I3FA 1UI7A 1WQLB 2E2UA 2RBIA 1E97A 5JPPA 2IY2A 1JNQA 1ASKA 1QALA 4LSOA 3DXOA 4BU4A 3LH4A 1J2BA 3QK9A 2MF7A 1I2GA 2GBWB 1X1XA 5IG0A 5IW9A 1A90A 2K54A 3WOEB 4HM7B 5AIIA 3BLZA 1JB2A 2K0MA 4H61A 1MOLA 2BMOB 1B2MA 1IVWA 3S28A 3X3ZA 1W6YA 4FCZA 3X41A 2ZA4A 2GU3A 3FF2A 4OVMA 5RNTA 2QEX3 1IVXA 1BUQA 1B3SA 1N5PA 1Q40A 1X1YA 5AIHA 4JRFA 3AHSA 1G02A 1MWTA 1W00A 3PYJA 5LC6A 1RGLA 1EKMA 2W2CA 3BNBA 4XBXA 3FG4A 4LYLB 1OUNA 2OWPA 1K28A 5D82A 1RTUA 5AYRB 1JN5A 3OXAA 2ZL8A 3FLJA 3VGNA 1G96A 1KWIA 1K9M4 2K3DA 3RGAA 3Q3FA 1IV7A 1WMNA 1FW7A 2W03A 1X1UA 4L7KA 3LYGA 3JUNA 2GEYA 1Q9EA 1LOXA 2P38A 4CDLA 1B27A 3GAXA 1T5YA 1QVF2 2W9QA 1UUWB 4KVHA 3LXUX 2KF4A 1G0TA 4X2HA 5IG4A 5IF6A 3V92A 3K7CA 4HM4B 3DGMA 3HZPA 4I4KA 4FR9A 3DGYA 3CCE3 3OWUA 3DGNA 5AIFA 3CPOA 5JBSA 3NM2A 1RCLA 2CWTA 3Q2PA 1I2EA 1YHQ3 1RKYA 1SARA 3F40A 2D42A 1W01A 2CFLA 1TFKA 1V58A 1Y4KA 2O3OA 4HOHA 5ELJA 2F86B 2IUJA 4DKIA 1OHPA 2CC3A 1Z1SA 1IQXA 3VSYA 1AR0A 1RGAA 4AKYA 1WMPA 8RNTA 3DM8A 3H3HA 2CWVA 1BUJA 1B2XA 3F14A 4H3UA 1IVUA 4CJNA 1JKGB 2Y74A 3MKIA 3WOFB 1RGEA 3RDEA 1RMSA 1TTOA 1YIT3 2KAAA 3MYTA 4HZBB 5AIGA 3SYUA 3IMAB 5EVHA 2XFSA 2YFIB 5CF1A 1FYSA 1W2ZA 4RZMA 5CLKA 5G1KA 4XDVA 4QWTA 5IENA 1MNLA 3KCHA 2RSXA 3GZXB 3NXJA 4CPKA 3IPTA 2IMJA 3LMLA 1I2FA 5LC7A 3CMA3 1T3BA 2CKFB 2XFTA 1LNHA 5I97A 4KFEA 2OQEC 3K0ZA 1OGZA 1RHLA 2OQEA 2Z76A 1BSBA 4HZ9B 1W2B2 2FGTA 1YJW3 3HK4A 5DREA 1R4YA 2B24B 2KRTA 4KFDA 3EQQB 5IG5A 1W7CA 2R4IA 4J8TA 1TJDA 1TP6A 3LTDA 3FZWA 3JVCA 3LZAA 5IERA 1N9EA 1JBRA 2ML5A 1GMPA 1BNIA 4LZIA 1TIJA 4NPBA 1OHOA 3N54B 1S5AA 2QIYA 1EEJA 3NV0A 4XBTA 3CXC2 1OF5B 1UUVB 2CFWA 2CX0A 2XEPA 3DGLA 3NX0A 5TGNA 2AAEA 5M18A 2OTJ3 4FMCA 3FCSB 1JBTA 1HU9A 2JQ5A 4AEQA 1M904 3CCU3 1BSDA 1O7PB 1JV2B 1T2HA 1RDSA 2F56A 1OPYA 2E2TA 1YJ93 1NB5I 2H0IA 3KSPA 3NQZA 4O8SA 3WDGB 1IK3A 3DUKA 3KKGA 4K61A 3S67A 1SQWA 2FXTA 1EA2A 3CD63 4Q53A 3HIGA 7STDA 3OWSA 1F8NA 2INXA 5IEOA 3CME3 1Q864 2B1XB 1UW1A 1DYUA 1OGXA 4BL2A 3ZG0A 3PGBA 1UGHI 1BU4A 3MPHA 4MMZB 5BXQA 3K63A 3SEDA 1TU5A 3MSOA 4WYKA 1FA3A 1TRQA 1X1WA 1PY3A
chains in the Genus database with same CATH topology
4N6NB 3RGRA 1OH0A 2Z7AA 1IDPA 3AMOB 3B7CA 1VQK3 1UI8A 4LEHA 2LYXA 1IT7A 2BMRB 1JKGA 3FKAA 2P0MA 4HKVB 2W56A 3SOYA 1YI23 1N9JA 2RCDA 3BB9A 4STDA 1US1A 1CYVA 4ORLA 5EEOA 5HGRA 3T0UA 1VQM3 5DRVA 3I563 1Q824 3OWYA 5EQLA 2WOFA 4GB5A 1JB5A 5FGOA 5IG3A 1VQ93 3G713 3OW22 1DVDA 3EN8A 1IV9A 4HJLB 2C11A 1TFOA 4U13A 4FMAA 3T8UA 2CK3H 4R4KA 1GD4A 2P0XA 3WA2X 4WFOA 2P09A 1YGEA 1NO3A 3X3XA 3EF8A 2YFLB 4HM2B 1AVLA 4L8OA 3EB8A 5AEUB 3LOYA 3F8HA 3N8BA 2HMKB 3SLUA 4N3VA 3NM7A 1GY6A 2XSHB 3FG1A 1FGRA 1KSIA 3DZLA 1W6GA 3A76A 1VQN3 2LQVA 4IPBA 1NWWA 3KN4A 5JPUA 4G1MB 2XGLA 1RJOA 2YX9A 5STDA 2RFRA 2ZDJA 3L0RA 3NUVA 1AV4A 1RRLA 2IUKA 1K8A4 3K5TA 3FF0A 1YJN3 2BMQB 4FCMA 1IQYA 3F8XA 1LXEA 3B8LA 4O3VA 4KZ1A 3WMDA 1YIJ3 3CC43 3MWZA 3F7XA 6STDA 1FGTA 3EJVA 4MJDA 5D81A 1QMAA 5G2GA 3CU3A 4HYZA 3JUPA 4RNZA 3GZBA 4HM5B 4L8PA 3V98A 3I553 3HX8A 1LVNA 3UL6A 3EE1A 3SVAA 5KP1A 1M9GA 1N8QA 3DMCA 4N6OB 3N9HA 1CQSA 3HI7A 4WP5A 3WODG 3MG2A 1Q40B 4IT7A 1GYBA 4HVNA 1GY5A 3T8NA 4JF8A 1DMMA 1ULJB 3ROBA 2CWUA 2XGNA 1O7MB 1OHSA 3LTAA 3EN1B 4XM4A 2CFDA 2OCTA 3FGYA 3CC73 2A15A 2YFJB 4AKZA 3FH1A 1NJI4 3BNCA 2CFKA 4XDWA 3CCM3 1IQ8A 3KE7A 1VQ63 3JUMA 1SPUA 4BTWA 4EV2A 3S5CA 1QVG2 3K9MC 1FUWA 1WMOA 3OV4A 1RN7A 2Z77A 4N6MA 1O7NB 4WHAA 1ZX2A 5CXOA 2D1WA 1EQKA 3HIIA 2WGQA 2W9PA 3D9RA 3OX9A 3CCJ3 2WOHA 2GBXB 5AI1A 4TX4A 1KC84 3PS8A 4N6LA 3U1WA 3KFQC 3LTBA 1KD14 4NHFA 4R9LA 3CC23 3PCRA 4WWUC 3CCV3 4MMYB 3BNDA 3J7Yd 3SX1A 3FG3A 1D6UA 1STDA 2L4VA 3MG3A 1ULIB 3V99A 1DMQA 2IA7A 3TDGA 2CHCA 1GY7A 3NBBA 1O7WB 3EHCA 3G0KA 4R80A 3DY5A 1Q814 4RBNA 4BTXA 3LT9A 2GXFA 3I0YA 2RGQA 1GD3A 1SIHA 1HKXA 3E99A 1O7HB 2XF3A 4GL6A 1QAKA 2HMLB 3SXXA 1NU3A 3ECFA 2KCDA 2FNQA 1WNHA 3VF1A 3CCQ3 2W0QA 1PU4A 4LGQA 2MC8A 5CK6A 1D6ZA 2Q07A 2XH9A 1VQ53 1OCVA 2JDIH 4LMIA 5A0OB 1V74A 2UX0A 3CNMA 1U5OA 3X3YA 3PXMA 2CW9A 3Q90A 5CF1A 1IVVA 2CFGA 3S27A 2GU1A 1GS3A 2XR8B 1VQL3 1IU7A 3KIIA 2PNCA 3EC9A 4N6UA 1WTHA 1DMNA 2I9WA 3GZRA 1FGQA 3CCS3 2BT3A 2V1LA 3NQYA 1A2VA 1FGMA 1STFI 2KXGA 4CCVA 2BHMA 3WA3A 1W5ZA 1N5HA 4O02B 1KQS2 4R9KA 2WO0A 3NV0B 4HM1B 1W6CA 3EX9A 3F7SA 3MG1A 4HM3B 1VQ73 1VQ43 3UNLA 4N6TA 5ELUA 1OF5A 2E2VA 2BNGA 3EBYA 5FW5A 1VZZA 3PCSA 3NBJA 1L5GB 1EG9B 4IIAA 4X2OA 2O9UX 2GEXA 3SOAA 4O2HA 4EV5A 1ZO2A 1ROAA 3X42A 1CEWI 3CNXA 2HMJB 3KZTA 1C7HA 2PZVA 2Z6BA 3B4OA 3GWRA 1N8R4 1YVBI 4MEIA 3KSED 2QGUA 3G8ZA 1IT8A 3PZWA 4MMXB 1FGOA 5AYSC 1JB4A 4WYKB 3JUOA 3M8CA 4OK0A 3CPW2 4R1KA 2XSOB 4EXRA 1SIIA 3G6E3 1TUHA 4HM8B 3NHXA 2HMNB 1CYUA 4FMDA 1Q42A 4BTYA 4HBRA 4K1UA 4XB5A 1VQ83 5KP3A 3B4PA 2CH9A 1O7GB 2W56B 1K734 3NBRA 4N6V0 2CG1A 1ROVA 2W04A 4K90B 3AMOA 2F99A 1M1K4 3QRDA 1S723 3BNEA 1E3RA 2STDA 1A2KA 4K1VA 1NB3I 3GRDA 3CCR3 3FSDA 5D83A 1JN5B 3ALAA 3MHEA 3UJMA 4EYCA 2P05A 1R4CA 1RRHA 2QA43 4HM6B 8CHOA 5IEPA 1M1XB 1JJ22 4FMBA 2OOVC 4HM0B 5KP4A 2OOVA 1VQP3 1W02A 2M7OA 2W6JH 3H51A 3LT8A 4OUQA 1OACA 2OTL3 3JUQA 2Y73A 1PFPA 4FCJA 3Q1CA 4NREA 2BO9B 3X40A 3IJEB 3G16A 1JRQA 2CG0A 1QJGA 1E3VA 1QAFA 2XRXB 3CCL3 1SJWA 3EBTA 4EC6A 1ISKA 4EBGA 3G4S3 3LTCA 3F9SA 1NDOB 3ER7A 1DVCA 3U97A 2HMOB 4KFFA 3UL5A 1U8CB 2C10A 4PEJA 3GZYB 2F98A 4XBYA 4ZM8A 1K41A 2ML6A 2WGOA 5AEWB 5CF2A 4J9AA 1VQO3 1AVKA 1D6YA 1W4NA 4RNYA 3S29A 1Q7Y4 3O8YA 3STDA 5BVBA 2CIUA 2HMMB 1A67A 3D3LA 2SBLA 3UB1A 3DGOA 1UI7A 1WQLB 2E2UA 1E97A 5JPPA 1JNQA 1ASKA 1QALA 4LSOA 3DXOA 3LH4A 1J2BA 3QK9A 2MF7A 2GBWB 5IW9A 5IG0A 1A90A 2K54A 3WOEB 4HM7B 5AIIA 3BLZA 1JB2A 2K0MA 4H61A 1MOLA 2BMOB 1IVWA 3S28A 3X3ZA 1W6YA 4FCZA 3X41A 2GU3A 3FF2A 4OVMA 2QEX3 1IVXA 1BUQA 1N5PA 1Q40A 5AIHA 4JRFA 1W00A 3PYJA 5LC6A 1EKMA 2W2CA 3BNBA 4XBXA 3FG4A 1OUNA 2OWPA 1K28A 5D82A 5AYRB 1JN5A 3OXAA 2ZL8A 3FLJA 3VGNA 1G96A 1KWIA 1K9M4 3RGAA 1IV7A 1WMNA 2W03A 4L7KA 3LYGA 3JUNA 2GEYA 1QVF2 1LOXA 2P38A 4CDLA 3GAXA 1T5YA 2W9QA 1UUWB 4KVHA 3LXUX 4X2HA 5IG4A 5IF6A 3V92A 3K7CA 4HM4B 3DGMA 3HZPA 4I4KA 4FR9A 3CCE3 3OWUA 3DGNA 5AIFA 3CPOA 5JBSA 3NM2A 2CWTA 3Q2PA 1YHQ3 1RKYA 3F40A 2D42A 1W01A 2CFLA 1TFKA 1Y4KA 2O3OA 5ELJA 2F86B 2IUJA 1OHPA 2CC3A 1Z1SA 1IQXA 3VSYA 1AR0A 4AKYA 1WMPA 3DM8A 3H3HA 2CWVA 3F14A 4H3UA 1IVUA 1JKGB 2Y74A 3MKIA 3WOFB 3RDEA 1YIT3 3MYTA 4HZBB 5AIGA 3IMAB 5EVHA 2XFSA 2YFIB 1W2ZA 4RZMA 5CLKA 5IENA 4XDVA 4QWTA 1MNLA 2RSXA 3GZXB 3NXJA 3IPTA 2IMJA 3LMLA 5LC7A 3CMA3 2CKFB 2XFTA 1LNHA 5I97A 4KFEA 2OQEC 3K0ZA 1OGZA 2OQEA 2Z76A 4HZ9B 1W2B2 2FGTA 1YJW3 3HK4A 5DREA 2B24B 2KRTA 4KFDA 3EQQB 5IG5A 1W7CA 2R4IA 4J8TA 3LTDA 1TP6A 3FZWA 3JVCA 3LZAA 5IERA 1N9EA 2ML5A 4LZIA 1TIJA 1OHOA 3N54B 1S5AA 2QIYA 3NV0A 4XBTA 3CXC2 1OF5B 1UUVB 2CFWA 2XEPA 3DGLA 3NX0A 5TGNA 2OTJ3 4FMCA 3FCSB 1HU9A 2JQ5A 4AEQA 1M904 3CCU3 1O7PB 1JV2B 1OPYA 2E2TA 1YJ93 1NB5I 3KSPA 3NQZA 4O8SA 3WDGB 1IK3A 3DUKA 3KKGA 4K61A 3S67A 1SQWA 2FXTA 1EA2A 3CD63 4Q53A 3HIGA 7STDA 3OWSA 1F8NA 2INXA 5IEOA 3CME3 1Q864 2B1XB 1UW1A 1DYUA 1OGXA 3PGBA 4MMZB 5BXQA 3MPHA 3K63A 3SEDA 1TU5A 3MSOA 4WYKA 1FA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGM A;  3DGL A;  3DGO A;  3DGN A;  3LT9 A;  3LTA A;  2P0X A;  1UW1 A;  2P05 A;  3LTD A;  3LT8 A;  2P09 A;  3LTB A;  3LTC A; 
#chains in the Genus database with same CATH topology
 4N6N B;  1NNV A;  3RGR A;  1UGI A;  1OH0 A;  2Z7A A;  3D5I A;  1IDP A;  3AMO B;  3B7C A;  1VQK 3;  1LNI A;  1UI8 A;  4LEH A;  2LYX A;  1IT7 A;  1DE3 A;  2BMR B;  1EUI C;  1I0V A;  1JKG A;  3FKA A;  2P0M A;  4HKV B;  2W56 A;  2C4B A;  3DH2 A;  3SOY A;  1YI2 3;  1N9J A;  2RCD A;  3BB9 A;  4STD A;  1US1 A;  1CYV A;  4ORL A;  5EEO A;  5HGR A;  3T0U A;  1VQM 3;  5DRV A;  3I56 3;  1Q82 4;  3OWY A;  1MWR A;  1RGF A;  2WOF A;  1HYF A;  1JB5 A;  4GB5 A;  5EQL A;  5FGO A;  5IG3 A;  1VQ9 3;  3G71 3;  3OW2 2;  1DVD A;  3EN8 A;  1IV9 A;  4HJL B;  2C11 A;  1TFO A;  2ZHX B;  4U13 A;  3WR2 A;  4FMA A;  3T8U A;  2CK3 H;  4R4K A;  1GD4 A;  1LQM B;  4BL3 A;  7RNT A;  2P0X A;  1DET A;  1TRP A;  1BIR A;  1FZU A;  2P09 A;  4WFO A;  1Q7H A;  1YGE A;  1NO3 A;  3WA2 X;  3X3X A;  3EF8 A;  2YFL B;  4HM2 B;  1AQZ A;  2F4Y A;  1AVL A;  4L8O A;  3EB8 A;  5AEU B;  3LOY A;  3F8H A;  3N8B A;  2HMK B;  3SLU A;  4N3V A;  3D79 A;  3NM7 A;  1GY6 A;  2XSH B;  2HOH A;  3FG1 A;  2L1S A;  1FGR A;  1KSI A;  3DZL A;  1W6G A;  1YGW A;  3A76 A;  1VQN 3;  1RNT A;  2LQV A;  4IPB A;  1NWW A;  3KN4 A;  5JPU A;  4G1M B;  2XGL A;  1RJO A;  4J5G A;  2YX9 A;  5STD A;  2RFR A;  2ZDJ A;  3L0R A;  1BVI A;  3NUV A;  1AV4 A;  1RRL A;  2IUK A;  1K8A 4;  1GSP A;  3K5T A;  1I8V A;  1UDI I;  3FF0 A;  1YJN 3;  2BMQ B;  4FCM A;  1IQY A;  3F8X A;  1LXE A;  3B8L A;  4O3V A;  4KZ1 A;  3WMD A;  1YIJ 3;  3CC4 3;  3MWZ A;  3F7X A;  6STD A;  1FGT A;  3EJV A;  4MJD A;  1BGS A;  5D81 A;  1QMA A;  5G2G A;  3CU3 A;  4HYZ A;  1FUS A;  3JUP A;  1BAO A;  4RNZ A;  2KF5 A;  1YVS A;  3GZB A;  4HM5 B;  4L8P A;  1RLS A;  3V98 A;  1HZ1 A;  3I55 3;  2GSP A;  3HX8 A;  1LVN A;  3UL6 A;  3EE1 A;  1VQQ A;  3SVA A;  5KP1 A;  1M9G A;  1N8Q A;  3DMC A;  4N6O B;  3N9H A;  1CQS A;  2KF3 A;  3HI7 A;  4WP5 A;  3RNT A;  3WOD G;  3MG2 A;  1Q40 B;  4IT7 A;  1GYB A;  1LOY A;  4HVN A;  1GY5 A;  3T8N A;  1BNE A;  1DMM A;  1ULJ B;  4JF8 A;  3ROB A;  2CWU A;  2XGN A;  1O7M B;  1OHS A;  3LTA A;  4I5Q A;  4EW5 A;  1UCK A;  3EN1 B;  4XM4 A;  2CFD A;  2OCT A;  1JBS A;  3FGY A;  3GSP A;  3CC7 3;  2A15 A;  2YFJ B;  4AKZ A;  3FH1 A;  2CX1 A;  1NJI 4;  3BNC A;  2CFK A;  4XDW A;  3CCM 3;  1UCJ A;  1ZS7 A;  1IQ8 A;  3KE7 A;  2J8X B;  4RNT A;  1VQ6 3;  3JUM A;  1SPU A;  4BTW A;  4EV2 A;  3S5C A;  1QVG 2;  3K9M C;  1FUW A;  1WMO A;  5HOH A;  3OV4 A;  1RN7 A;  2Z77 A;  4N6M A;  1O7N B;  2SAR A;  4WHA A;  1ZX2 A;  5CXO A;  2D1W A;  1EQK A;  3HII A;  2WGQ A;  2W9P A;  1IYY A;  3D9R A;  3OX9 A;  3CCJ 3;  2WOH A;  2GBX B;  5AI1 A;  4TX4 A;  1RGH A;  1KC8 4;  3PS8 A;  4N6L A;  3U1W A;  3KFQ C;  3LTB A;  1LRA A;  5GSP A;  1KD1 4;  9RNT A;  4NHF A;  4R9L A;  3CC2 3;  3PCR A;  4WWU C;  3CCV 3;  4MMY B;  3BND A;  3J7Y d;  3SX1 A;  3FG3 A;  1D6U A;  1STD A;  2L4V A;  3MG3 A;  1ULI B;  3V99 A;  1BRS A;  1DMQ A;  1I70 A;  2IA7 A;  3TDG A;  2CHC A;  1B20 A;  1GY7 A;  3NBB A;  1O7W B;  1MWS A;  3EHC A;  3G0K A;  1LOV A;  3DY5 A;  4R80 A;  4RBN A;  1Q81 4;  4BTX A;  3LT9 A;  1RGG A;  2GXF A;  3I0Y A;  2RGQ A;  1GD3 A;  1SIH A;  1HKX A;  3E99 A;  1BRG A;  1O7H B;  2XF3 A;  1UCL A;  4GL6 A;  1QAK A;  2HML B;  3SXX A;  1NU3 A;  5BIR A;  3ECF A;  2KCD A;  2FNQ A;  1ZGX A;  1B2S A;  1WNH A;  2F5W A;  3VF1 A;  7GSP A;  3CCQ 3;  1GOY A;  2W0Q A;  4KT3 B;  4LGQ A;  2MC8 A;  1CH0 A;  1A2P A;  5CK6 A;  1D6Z A;  1PU4 A;  2Q07 A;  2XH9 A;  1VQ5 3;  1OCV A;  2JDI H;  5M19 A;  4LMI A;  5A0O B;  1V74 A;  2UX0 A;  3CNM A;  1U5O A;  3X3Y A;  3PXM A;  2CW9 A;  3Q90 A;  2F5M A;  1IVV A;  2CFG A;  3S27 A;  1GMR A;  2GU1 A;  1PYL A;  1GS3 A;  1BNG A;  1FUT A;  4BIR A;  1V57 A;  2XR8 B;  1LOW A;  1VQL 3;  1IU7 A;  2AAD A;  3KII A;  1BRH A;  2PNC A;  3EC9 A;  4N6U A;  1WTH A;  1DMN A;  2I9W A;  3GZR A;  1FGQ A;  3ZFZ A;  3CCS 3;  1B2Z A;  1B2U A;  2BT3 A;  2H0G A;  2V1L A;  1A2V A;  3NQY A;  1BRI A;  4GSP A;  1FGM A;  1STF I;  2KXG A;  4CCV A;  1BRN L;  2BHM A;  5G1L A;  1JZO A;  1W5Z A;  3WA3 A;  1N5H A;  4O02 B;  1KQS 2;  4R9K A;  2WO0 A;  3NV0 B;  4HM1 B;  1BNF A;  1W6C A;  3EX9 A;  3F7S A;  3MG1 A;  4HM3 B;  1VQ7 3;  1VQ4 3;  3ZG5 A;  3UNL A;  4N6T A;  1BSE A;  1MWU A;  5ELU A;  2R41 A;  1OF5 A;  2E2V A;  2BNG A;  3EBY A;  1UCI A;  1VZZ A;  3PCS A;  5FW5 A;  3NBJ A;  1L5G B;  1EG9 B;  4IIA A;  4X2O A;  2O9U X;  2GEX A;  3SOA A;  4O2H A;  4EV5 A;  1I3I A;  1ZO2 A;  1ROA A;  3X42 A;  1BAN A;  1RCK A;  1CEW I;  3CNX A;  2HMJ B;  3KZT A;  1C7H A;  2PZV A;  2Z6B A;  1BSA A;  1RN1 A;  3AGN A;  1B21 A;  1BRK A;  3B4O A;  3GWR A;  1N8R 4;  1YVB I;  4MEI A;  3URP A;  6RNT A;  4GHO A;  3KSE D;  2QGU A;  6GSP A;  3G8Z A;  3AGO A;  1IT8 A;  3PZW A;  5M1A A;  4MMX B;  1FGO A;  5AYS C;  1JB4 A;  1JZD A;  4WYK B;  3JUO A;  3M8C A;  4OK0 A;  3CPW 2;  1T2I A;  2KF6 A;  4R1K A;  1BNR A;  2XSO B;  4EXR A;  1SII A;  3G6E 3;  1TUH A;  4HM8 B;  3D4A A;  3NHX A;  2UUG C;  2HMN B;  1CYU A;  2BU4 A;  4FMD A;  1Q42 A;  4BTY A;  4HBR A;  5BU4 A;  4K1U A;  4XB5 A;  1VQ8 3;  2UGI A;  5KP3 A;  3B4P A;  1RGC A;  1O7G B;  2CH9 A;  2W56 B;  1K73 4;  3NBR A;  4N6V 0;  2CG1 A;  1ROV A;  2W04 A;  4K90 B;  3AMO A;  2F99 A;  1M1K 4;  3QRD A;  1S72 3;  3BNE A;  1E3R A;  1RN4 A;  2STD A;  1A2K A;  4K1V A;  3BU4 A;  2H0H A;  1NB3 I;  3GRD A;  3CCR 3;  3FSD A;  3WHO A;  1GMQ A;  3AHW A;  5D83 A;  1JN5 B;  1LQG C;  3ALA A;  3MHE A;  3UJM A;  4EYC A;  2P05 A;  1R4C A;  1AY7 A;  1RRH A;  2QA4 3;  4HM6 B;  8CHO A;  1UUG B;  5IEP A;  1M1X B;  1JJ2 2;  4FMB A;  2OOV C;  1BOX A;  4HM0 B;  5KP4 A;  2OOV A;  1VQP 3;  1W02 A;  2M7O A;  2W6J H;  3H51 A;  3LT8 A;  4OUQ A;  1OAC A;  2OTL 3;  1RNB A;  3JUQ A;  2Y73 A;  1BNJ A;  1PFP A;  2RNT A;  4FCJ A;  1BRJ A;  3Q1C A;  4HAA A;  4NRE A;  3A5E A;  4ILF A;  2BO9 B;  3X40 A;  3IJE B;  1RGK A;  3G16 A;  1JRQ A;  2CG0 A;  1QJG A;  1E3V A;  1QAF A;  3BIR A;  4J5K A;  2XRX B;  3CCL 3;  1SJW A;  3EBT A;  4EC6 A;  1ISK A;  4EBG A;  3G4S 3;  3LTC A;  3F9S A;  1NDO B;  1I0X A;  3ER7 A;  1DVC A;  3U97 A;  2HMO B;  4KFF A;  3UL5 A;  1U8C B;  2C10 A;  4PEJ A;  3GZY B;  2F98 A;  4XBY A;  4ZM8 A;  1K41 A;  2ML6 A;  2IYJ A;  2WGO A;  5AEW B;  5CF2 A;  1MGW A;  4J9A A;  1C54 A;  2BIR A;  1GOU A;  1AVK A;  1BNS A;  1VQO 3;  1D6Y A;  1W4N A;  4RNY A;  3S29 A;  1GOV A;  1BSC A;  1RSN A;  3O8Y A;  1YNV X;  3STD A;  1Q7Y 4;  5BVB A;  2CIU A;  2HMM B;  3HOH A;  1A67 A;  1MGR A;  3D3L A;  2SBL A;  3D5G A;  3UB1 A;  3DGO A;  1I3F A;  1UI7 A;  1WQL B;  2E2U A;  2RBI A;  1E97 A;  5JPP A;  2IY2 A;  1JNQ A;  1ASK A;  1QAL A;  4LSO A;  3DXO A;  4BU4 A;  3LH4 A;  1J2B A;  3QK9 A;  2MF7 A;  1I2G A;  2GBW B;  1X1X A;  5IG0 A;  5IW9 A;  1A90 A;  2K54 A;  3WOE B;  4HM7 B;  5AII A;  3BLZ A;  1JB2 A;  2K0M A;  4H61 A;  1MOL A;  2BMO B;  1B2M A;  1IVW A;  3S28 A;  3X3Z A;  1W6Y A;  4FCZ A;  3X41 A;  2ZA4 A;  2GU3 A;  3FF2 A;  4OVM A;  5RNT A;  2QEX 3;  1IVX A;  1BUQ A;  1B3S A;  1N5P A;  1Q40 A;  1X1Y A;  5AIH A;  4JRF A;  3AHS A;  1G02 A;  1MWT A;  1W00 A;  3PYJ A;  5LC6 A;  1RGL A;  1EKM A;  2W2C A;  3BNB A;  4XBX A;  3FG4 A;  4LYL B;  1OUN A;  2OWP A;  1K28 A;  5D82 A;  1RTU A;  5AYR B;  1JN5 A;  3OXA A;  2ZL8 A;  3FLJ A;  3VGN A;  1G96 A;  1KWI A;  1K9M 4;  2K3D A;  3RGA A;  3Q3F A;  1IV7 A;  1WMN A;  1FW7 A;  2W03 A;  1X1U A;  4L7K A;  3LYG A;  3JUN A;  2GEY A;  1Q9E A;  1LOX A;  2P38 A;  4CDL A;  1B27 A;  3GAX A;  1T5Y A;  1QVF 2;  2W9Q A;  1UUW B;  4KVH A;  3LXU X;  2KF4 A;  1G0T A;  4X2H A;  5IG4 A;  5IF6 A;  3V92 A;  3K7C A;  4HM4 B;  3DGM A;  3HZP A;  4I4K A;  4FR9 A;  3DGY A;  3CCE 3;  3OWU A;  3DGN A;  5AIF A;  3CPO A;  5JBS A;  3NM2 A;  1RCL A;  2CWT A;  3Q2P A;  1I2E A;  1YHQ 3;  1RKY A;  1SAR A;  3F40 A;  2D42 A;  1W01 A;  2CFL A;  1TFK A;  1V58 A;  1Y4K A;  2O3O A;  4HOH A;  5ELJ A;  2F86 B;  2IUJ A;  4DKI A;  1OHP A;  2CC3 A;  1Z1S A;  1IQX A;  3VSY A;  1AR0 A;  1RGA A;  4AKY A;  1WMP A;  8RNT A;  3DM8 A;  3H3H A;  2CWV A;  1BUJ A;  1B2X A;  3F14 A;  4H3U A;  1IVU A;  4CJN A;  1JKG B;  2Y74 A;  3MKI A;  3WOF B;  1RGE A;  3RDE A;  1RMS A;  1TTO A;  1YIT 3;  2KAA A;  3MYT A;  4HZB B;  5AIG A;  3SYU A;  3IMA B;  5EVH A;  2XFS A;  2YFI B;  5CF1 A;  1FYS A;  1W2Z A;  4RZM A;  5CLK A;  5G1K A;  4XDV A;  4QWT A;  5IEN A;  1MNL A;  3KCH A;  2RSX A;  3GZX B;  3NXJ A;  4CPK A;  3IPT A;  2IMJ A;  3LML A;  1I2F A;  5LC7 A;  3CMA 3;  1T3B A;  2CKF B;  2XFT A;  1LNH A;  5I97 A;  4KFE A;  2OQE C;  3K0Z A;  1OGZ A;  1RHL A;  2OQE A;  2Z76 A;  1BSB A;  4HZ9 B;  1W2B 2;  2FGT A;  1YJW 3;  3HK4 A;  5DRE A;  1R4Y A;  2B24 B;  2KRT A;  4KFD A;  3EQQ B;  5IG5 A;  1W7C A;  2R4I A;  4J8T A;  1TJD A;  1TP6 A;  3LTD A;  3FZW A;  3JVC A;  3LZA A;  5IER A;  1N9E A;  1JBR A;  2ML5 A;  1GMP A;  1BNI A;  4LZI A;  1TIJ A;  4NPB A;  1OHO A;  3N54 B;  1S5A A;  2QIY A;  1EEJ A;  3NV0 A;  4XBT A;  3CXC 2;  1OF5 B;  1UUV B;  2CFW A;  2CX0 A;  2XEP A;  3DGL A;  3NX0 A;  5TGN A;  2AAE A;  5M18 A;  2OTJ 3;  4FMC A;  3FCS B;  1JBT A;  1HU9 A;  2JQ5 A;  4AEQ A;  1M90 4;  3CCU 3;  1BSD A;  1O7P B;  1JV2 B;  1T2H A;  1RDS A;  2F56 A;  1OPY A;  2E2T A;  1YJ9 3;  1NB5 I;  2H0I A;  3KSP A;  3NQZ A;  4O8S A;  3WDG B;  1IK3 A;  3DUK A;  3KKG A;  4K61 A;  3S67 A;  1SQW A;  2FXT A;  1EA2 A;  3CD6 3;  4Q53 A;  3HIG A;  7STD A;  3OWS A;  1F8N A;  2INX A;  5IEO A;  3CME 3;  1Q86 4;  2B1X B;  1UW1 A;  1DYU A;  1OGX A;  4BL2 A;  3ZG0 A;  3PGB A;  1UGH I;  1BU4 A;  3MPH A;  4MMZ B;  5BXQ A;  3K63 A;  3SED A;  1TU5 A;  3MSO A;  4WYK A;  1FA3 A;  1TRQ A;  1X1W A;  1PY3 A; 
#chains in the Genus database with same CATH homology
 4N6N B;  3RGR A;  1OH0 A;  2Z7A A;  1IDP A;  3AMO B;  3B7C A;  1VQK 3;  1UI8 A;  4LEH A;  2LYX A;  1IT7 A;  2BMR B;  1JKG A;  3FKA A;  2P0M A;  4HKV B;  2W56 A;  3SOY A;  1YI2 3;  1N9J A;  2RCD A;  3BB9 A;  4STD A;  1US1 A;  1CYV A;  4ORL A;  5EEO A;  5HGR A;  3T0U A;  1VQM 3;  5DRV A;  3I56 3;  1Q82 4;  3OWY A;  5EQL A;  2WOF A;  4GB5 A;  1JB5 A;  5FGO A;  5IG3 A;  1VQ9 3;  3G71 3;  3OW2 2;  1DVD A;  3EN8 A;  1IV9 A;  4HJL B;  2C11 A;  1TFO A;  4U13 A;  4FMA A;  3T8U A;  2CK3 H;  4R4K A;  1GD4 A;  2P0X A;  3WA2 X;  4WFO A;  2P09 A;  1YGE A;  1NO3 A;  3X3X A;  3EF8 A;  2YFL B;  4HM2 B;  1AVL A;  4L8O A;  3EB8 A;  5AEU B;  3LOY A;  3F8H A;  3N8B A;  2HMK B;  3SLU A;  4N3V A;  3NM7 A;  1GY6 A;  2XSH B;  3FG1 A;  1FGR A;  1KSI A;  3DZL A;  1W6G A;  3A76 A;  1VQN 3;  2LQV A;  4IPB A;  1NWW A;  3KN4 A;  5JPU A;  4G1M B;  2XGL A;  1RJO A;  2YX9 A;  5STD A;  2RFR A;  2ZDJ A;  3L0R A;  3NUV A;  1AV4 A;  1RRL A;  2IUK A;  1K8A 4;  3K5T A;  3FF0 A;  1YJN 3;  2BMQ B;  4FCM A;  1IQY A;  3F8X A;  1LXE A;  3B8L A;  4O3V A;  4KZ1 A;  3WMD A;  1YIJ 3;  3CC4 3;  3MWZ A;  3F7X A;  6STD A;  1FGT A;  3EJV A;  4MJD A;  5D81 A;  1QMA A;  5G2G A;  3CU3 A;  4HYZ A;  3JUP A;  4RNZ A;  3GZB A;  4HM5 B;  4L8P A;  3V98 A;  3I55 3;  3HX8 A;  1LVN A;  3UL6 A;  3EE1 A;  3SVA A;  5KP1 A;  1M9G A;  1N8Q A;  3DMC A;  4N6O B;  3N9H A;  1CQS A;  3HI7 A;  4WP5 A;  3WOD G;  3MG2 A;  1Q40 B;  4IT7 A;  1GYB A;  4HVN A;  1GY5 A;  3T8N A;  4JF8 A;  1DMM A;  1ULJ B;  3ROB A;  2CWU A;  2XGN A;  1O7M B;  1OHS A;  3LTA A;  3EN1 B;  4XM4 A;  2CFD A;  2OCT A;  3FGY A;  3CC7 3;  2A15 A;  2YFJ B;  4AKZ A;  3FH1 A;  1NJI 4;  3BNC A;  2CFK A;  4XDW A;  3CCM 3;  1IQ8 A;  3KE7 A;  1VQ6 3;  3JUM A;  1SPU A;  4BTW A;  4EV2 A;  3S5C A;  1QVG 2;  3K9M C;  1FUW A;  1WMO A;  3OV4 A;  1RN7 A;  2Z77 A;  4N6M A;  1O7N B;  4WHA A;  1ZX2 A;  5CXO A;  2D1W A;  1EQK A;  3HII A;  2WGQ A;  2W9P A;  3D9R A;  3OX9 A;  3CCJ 3;  2WOH A;  2GBX B;  5AI1 A;  4TX4 A;  1KC8 4;  3PS8 A;  4N6L A;  3U1W A;  3KFQ C;  3LTB A;  1KD1 4;  4NHF A;  4R9L A;  3CC2 3;  3PCR A;  4WWU C;  3CCV 3;  4MMY B;  3BND A;  3J7Y d;  3SX1 A;  3FG3 A;  1D6U A;  1STD A;  2L4V A;  3MG3 A;  1ULI B;  3V99 A;  1DMQ A;  2IA7 A;  3TDG A;  2CHC A;  1GY7 A;  3NBB A;  1O7W B;  3EHC A;  3G0K A;  4R80 A;  3DY5 A;  1Q81 4;  4RBN A;  4BTX A;  3LT9 A;  2GXF A;  3I0Y A;  2RGQ A;  1GD3 A;  1SIH A;  1HKX A;  3E99 A;  1O7H B;  2XF3 A;  4GL6 A;  1QAK A;  2HML B;  3SXX A;  1NU3 A;  3ECF A;  2KCD A;  2FNQ A;  1WNH A;  3VF1 A;  3CCQ 3;  2W0Q A;  1PU4 A;  4LGQ A;  2MC8 A;  5CK6 A;  1D6Z A;  2Q07 A;  2XH9 A;  1VQ5 3;  1OCV A;  2JDI H;  4LMI A;  5A0O B;  1V74 A;  2UX0 A;  3CNM A;  1U5O A;  3X3Y A;  3PXM A;  2CW9 A;  3Q90 A;  5CF1 A;  1IVV A;  2CFG A;  3S27 A;  2GU1 A;  1GS3 A;  2XR8 B;  1VQL 3;  1IU7 A;  3KII A;  2PNC A;  3EC9 A;  4N6U A;  1WTH A;  1DMN A;  2I9W A;  3GZR A;  1FGQ A;  3CCS 3;  2BT3 A;  2V1L A;  3NQY A;  1A2V A;  1FGM A;  1STF I;  2KXG A;  4CCV A;  2BHM A;  3WA3 A;  1W5Z A;  1N5H A;  4O02 B;  1KQS 2;  4R9K A;  2WO0 A;  3NV0 B;  4HM1 B;  1W6C A;  3EX9 A;  3F7S A;  3MG1 A;  4HM3 B;  1VQ7 3;  1VQ4 3;  3UNL A;  4N6T A;  5ELU A;  1OF5 A;  2E2V A;  2BNG A;  3EBY A;  5FW5 A;  1VZZ A;  3PCS A;  3NBJ A;  1L5G B;  1EG9 B;  4IIA A;  4X2O A;  2O9U X;  2GEX A;  3SOA A;  4O2H A;  4EV5 A;  1ZO2 A;  1ROA A;  3X42 A;  1CEW I;  3CNX A;  2HMJ B;  3KZT A;  1C7H A;  2PZV A;  2Z6B A;  3B4O A;  3GWR A;  1N8R 4;  1YVB I;  4MEI A;  3KSE D;  2QGU A;  3G8Z A;  1IT8 A;  3PZW A;  4MMX B;  1FGO A;  5AYS C;  1JB4 A;  4WYK B;  3JUO A;  3M8C A;  4OK0 A;  3CPW 2;  4R1K A;  2XSO B;  4EXR A;  1SII A;  3G6E 3;  1TUH A;  4HM8 B;  3NHX A;  2HMN B;  1CYU A;  4FMD A;  1Q42 A;  4BTY A;  4HBR A;  4K1U A;  4XB5 A;  1VQ8 3;  5KP3 A;  3B4P A;  2CH9 A;  1O7G B;  2W56 B;  1K73 4;  3NBR A;  4N6V 0;  2CG1 A;  1ROV A;  2W04 A;  4K90 B;  3AMO A;  2F99 A;  1M1K 4;  3QRD A;  1S72 3;  3BNE A;  1E3R A;  2STD A;  1A2K A;  4K1V A;  1NB3 I;  3GRD A;  3CCR 3;  3FSD A;  5D83 A;  1JN5 B;  3ALA A;  3MHE A;  3UJM A;  4EYC A;  2P05 A;  1R4C A;  1RRH A;  2QA4 3;  4HM6 B;  8CHO A;  5IEP A;  1M1X B;  1JJ2 2;  4FMB A;  2OOV C;  4HM0 B;  5KP4 A;  2OOV A;  1VQP 3;  1W02 A;  2M7O A;  2W6J H;  3H51 A;  3LT8 A;  4OUQ A;  1OAC A;  2OTL 3;  3JUQ A;  2Y73 A;  1PFP A;  4FCJ A;  3Q1C A;  4NRE A;  2BO9 B;  3X40 A;  3IJE B;  3G16 A;  1JRQ A;  2CG0 A;  1QJG A;  1E3V A;  1QAF A;  2XRX B;  3CCL 3;  1SJW A;  3EBT A;  4EC6 A;  1ISK A;  4EBG A;  3G4S 3;  3LTC A;  3F9S A;  1NDO B;  3ER7 A;  1DVC A;  3U97 A;  2HMO B;  4KFF A;  3UL5 A;  1U8C B;  2C10 A;  4PEJ A;  3GZY B;  2F98 A;  4XBY A;  4ZM8 A;  1K41 A;  2ML6 A;  2WGO A;  5AEW B;  5CF2 A;  4J9A A;  1VQO 3;  1AVK A;  1D6Y A;  1W4N A;  4RNY A;  3S29 A;  1Q7Y 4;  3O8Y A;  3STD A;  5BVB A;  2CIU A;  2HMM B;  1A67 A;  3D3L A;  2SBL A;  3UB1 A;  3DGO A;  1UI7 A;  1WQL B;  2E2U A;  1E97 A;  5JPP A;  1JNQ A;  1ASK A;  1QAL A;  4LSO A;  3DXO A;  3LH4 A;  1J2B A;  3QK9 A;  2MF7 A;  2GBW B;  5IW9 A;  5IG0 A;  1A90 A;  2K54 A;  3WOE B;  4HM7 B;  5AII A;  3BLZ A;  1JB2 A;  2K0M A;  4H61 A;  1MOL A;  2BMO B;  1IVW A;  3S28 A;  3X3Z A;  1W6Y A;  4FCZ A;  3X41 A;  2GU3 A;  3FF2 A;  4OVM A;  2QEX 3;  1IVX A;  1BUQ A;  1N5P A;  1Q40 A;  5AIH A;  4JRF A;  1W00 A;  3PYJ A;  5LC6 A;  1EKM A;  2W2C A;  3BNB A;  4XBX A;  3FG4 A;  1OUN A;  2OWP A;  1K28 A;  5D82 A;  5AYR B;  1JN5 A;  3OXA A;  2ZL8 A;  3FLJ A;  3VGN A;  1G96 A;  1KWI A;  1K9M 4;  3RGA A;  1IV7 A;  1WMN A;  2W03 A;  4L7K A;  3LYG A;  3JUN A;  2GEY A;  1QVF 2;  1LOX A;  2P38 A;  4CDL A;  3GAX A;  1T5Y A;  2W9Q A;  1UUW B;  4KVH A;  3LXU X;  4X2H A;  5IG4 A;  5IF6 A;  3V92 A;  3K7C A;  4HM4 B;  3DGM A;  3HZP A;  4I4K A;  4FR9 A;  3CCE 3;  3OWU A;  3DGN A;  5AIF A;  3CPO A;  5JBS A;  3NM2 A;  2CWT A;  3Q2P A;  1YHQ 3;  1RKY A;  3F40 A;  2D42 A;  1W01 A;  2CFL A;  1TFK A;  1Y4K A;  2O3O A;  5ELJ A;  2F86 B;  2IUJ A;  1OHP A;  2CC3 A;  1Z1S A;  1IQX A;  3VSY A;  1AR0 A;  4AKY A;  1WMP A;  3DM8 A;  3H3H A;  2CWV A;  3F14 A;  4H3U A;  1IVU A;  1JKG B;  2Y74 A;  3MKI A;  3WOF B;  3RDE A;  1YIT 3;  3MYT A;  4HZB B;  5AIG A;  3IMA B;  5EVH A;  2XFS A;  2YFI B;  1W2Z A;  4RZM A;  5CLK A;  5IEN A;  4XDV A;  4QWT A;  1MNL A;  2RSX A;  3GZX B;  3NXJ A;  3IPT A;  2IMJ A;  3LML A;  5LC7 A;  3CMA 3;  2CKF B;  2XFT A;  1LNH A;  5I97 A;  4KFE A;  2OQE C;  3K0Z A;  1OGZ A;  2OQE A;  2Z76 A;  4HZ9 B;  1W2B 2;  2FGT A;  1YJW 3;  3HK4 A;  5DRE A;  2B24 B;  2KRT A;  4KFD A;  3EQQ B;  5IG5 A;  1W7C A;  2R4I A;  4J8T A;  3LTD A;  1TP6 A;  3FZW A;  3JVC A;  3LZA A;  5IER A;  1N9E A;  2ML5 A;  4LZI A;  1TIJ A;  1OHO A;  3N54 B;  1S5A A;  2QIY A;  3NV0 A;  4XBT A;  3CXC 2;  1OF5 B;  1UUV B;  2CFW A;  2XEP A;  3DGL A;  3NX0 A;  5TGN A;  2OTJ 3;  4FMC A;  3FCS B;  1HU9 A;  2JQ5 A;  4AEQ A;  1M90 4;  3CCU 3;  1O7P B;  1JV2 B;  1OPY A;  2E2T A;  1YJ9 3;  1NB5 I;  3KSP A;  3NQZ A;  4O8S A;  3WDG B;  1IK3 A;  3DUK A;  3KKG A;  4K61 A;  3S67 A;  1SQW A;  2FXT A;  1EA2 A;  3CD6 3;  4Q53 A;  3HIG A;  7STD A;  3OWS A;  1F8N A;  2INX A;  5IEO A;  3CME 3;  1Q86 4;  2B1X B;  1UW1 A;  1DYU A;  1OGX A;  3PGB A;  4MMZ B;  5BXQ A;  3MPH A;  3K63 A;  3SED A;  1TU5 A;  3MSO A;  4WYK A;  1FA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...