1V74A

Structure of the e. coli colicin d bound to its immunity protein immd
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
LNDPLDSGRFSRKQLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Colicin D
publication title Structural inhibition of the colicin D tRNase by the tRNA-mimicking immunity protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Antibiotic/immune system
total genus 33
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11429 Colicin_D Colicin D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.200 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1v74A00
1V74A 1TFOA 1TFKA
chains in the Genus database with same CATH superfamily
3JVCA 2BNGA 3FZWA 4R80A 3ZG5A 2INXA 1YIT3 1US1A 2F99A 2HMLB 4K90B 1RJOA 1DMMA 1W01A 2AAEA 4ZM8A 1UI7A 3MKIA 3NX0A 4X2HA 1N9EA 1JJ22 1ISKA 1BNRA 3MG1A 2AADA 1IVVA 2CWUA 5LC6A 2C4BA 1BNEA 1BU4A 1GYBA 3LTBA 3Q2PA 1GD4A 1IVXA 1E97A 2A15A 2CC3A 1KWIA 2F56A 5ELJA 1JV2B 2KCDA 1M1K4 2Y74A 1MWTA 4OVMA 3FH1A 3Q3FA 1STDA 5IG0A 1TJDA 2W0QA 3G4S3 4BTYA 1RGGA 1PFPA 5M18A 1BRKA 5EVHA 4EBGA 2CX1A 4NHFA 4L7KA 2WGOA 4TX4A 1M9GA 3D3LA 3CC73 1MWRA 4FMDA 1AVKA 1HU9A 3KKGA 3BNEA 3KIIA 1Q40B 1VQ93 2P38A 1OUNA 4HBRA 1YVBI 3GRDA 2XRXB 1S5AA 2BMRB 3PGBA 4XM4A 3NM7A 3JUNA 3LYGA 3SYUA 3ALAA 3DGYA 5IENA 1VQL3 3OW22 1BSAA 3EN8A 1NDOB 3PS8A 1SIIA 1A67A 2GU3A 3ZFZA 3CC43 4GHOA 3WDGB 3TDGA 1QMAA 3RDEA 2XSHB 3ROBA 3F8XA 1DETA 1FUSA 1LRAA 4OUQA 1UGHI 1VQM3 3D79A 1TP6A 5IERA 3UB1A 1VZZA 2XFSA 2F98A 1OF5B 1B2XA 1QVF2 1WMPA 3JUOA 3G8ZA 1BNSA 1B3SA 1VQQA 4J5KA 5CLKA 2RCDA 4EV2A 1BVIA 1EA2A 4RBNA 1I70A 2LYXA 3G713 2GBXB 3WHOA 4BIRA 1N9JA 2BMOB 2H0GA 2KF3A 3NQZA 4N6NB 3CCL3 1GY7A 1JBRA 1CQSA 3NBJA 3FG3A 5CF2A 1M1XB 3LT9A 3CME3 3T0UA 3KFQC 1VQ73 2WGQA 3X3YA 5JPUA 2KAAA 2W03A 1YJ93 1TRPA 2PZVA 3ECFA 1O7MB 1E3VA 2KXGA 3VGNA 4XDWA 1JBTA 1U8CB 1B2MA 2CFGA 3X41A 1RRLA 1JN5B 2BO9B 1IQYA 2E2VA 3CCU3 1NWWA 1FGRA 1MWSA 1UCIA 7STDA 2RNTA 1BSCA 3CCE3 2XGLA 1PY3A 3B4OA 4KFEA 3UL6A 2GSPA 4WYKB 3QRDA 1LXEA 1RNBA 1UCLA 1AY7A 1AVLA 4RZMA 1PYLA 3CMA3 4G1MB 3MG2A 3CCS3 1DVDA 4BU4A 1OH0A 4KZ1A 1W2B2 1SQWA 4GSPA 5M19A 1FUWA 1MGRA 4XB5A 1ZGXA 4WFOA 3DGNA 2Z7AA 4J5GA 1I0XA 3K7CA 2I9WA 3OWYA 3CXC2 4EYCA 3M8CA 1BIRA 1AV4A 1LOXA 5D81A 4LGQA 1FA3A 3EX9A 3SLUA 1BOXA 2P0XA 3LXUX 1IU7A 3GZYB 4GL6A 3EBYA 1D6ZA 2V1LA 1IYYA 4EXRA 1RN1A 1A2KA 1DMQA 1UW1A 2RSXA 4HOHA 4OK0A 2XF3A 1A2VA 1GOUA 4DKIA 1GOYA 4JF8A 4RNZA 1JKGA 4MMZB 1RCKA 1GMRA 1STFI 2HOHA 1IV7A 3CCR3 1GSPA 3FCSB 1IQXA 4IT7A 4N6UA 4EV5A 3HX8A 1IV9A 3STDA 3PCSA 4HM5B 1KQS2 3KZTA 5STDA 4R9LA 5JPPA 3EC9A 5AYRB 2OOVA 1DMNA 3ZG0A 2K54A 3GZXB 2F86B 3B4PA 3WR2A 1X1YA 3PYJA 4CJNA 4L8OA 5IEOA 2CG1A 1YJN3 2HMOB 3OWSA 1I0VA 2BHMA 3DGLA 2R41A 3IJEB 2W6JH 3OWUA 1YGWA 3DMCA 1GY5A 3CCJ3 1LQGC 2CH9A 1W00A 2W9QA 2CWTA 1VQ53 3LT8A 4WWUC 1HZ1A 3X3XA 1JB2A 3N9HA 4HJLB 5AI1A 1RNTA 4BTWA 5G2GA 1BUJA 1FW7A 3KN4A 1YNVX 2GU1A 5AIGA 5CK6A 1O7HB 3HK4A 3X40A 4O02B 1G96A 1T2IA 3RGRA 4XBTA 3OXAA 1WTHA 3F7SA 4XDVA 1N5HA 3X3ZA 2UUGC 3WMDA 1I2EA 2GEYA 5FGOA 1R4CA 3CPW2 2YX9A 1NJI4 1RRHA 1X1XA 1RGFA 1W5ZA 2ZA4A 3HIIA 2W56B 3DM8A 2Q07A 2HMJB 4EC6A 3CU3A 2CW9A 3AMOB 4IPBA 1VQO3 1VQ83 2XFTA 1BRGA 3F40A 4MMYB 1B2ZA 1JZDA 2KRTA 2E2TA 4FMAA 3KE7A 1Q824 1B27A 1W4NA 3CCM3 4XBXA 1LOYA 2ZL8A 1RN7A 1TFKA 2M7OA 2OOVC 3LOYA 1EEJA 4HZ9B 3J7Yd 4PEJA 1ZX2A 2BMQB 3EE1A 3HOHA 4RNTA 3I563 1UGIA 1TRQA 2STDA 4K61A 2CX0A 3NBRA 2H0IA 3LH4A 1RGHA 5KP4A 1D6UA 9RNTA 1CEWI 4CPKA 1BSBA 1MGWA 1IT8A 4IIAA 2HMMB 1IVWA 3SOAA 2D42A 3K0ZA 3DXOA 4N3VA 3NV0B 3NUVA 1JB4A 3T8UA 4HYZA 3OX9A 3O8YA 1U5OA 2CFWA 4FR9A 3NXJA 1IK3A 3KCHA 1GOVA 1Q40A 1SPUA 1GMPA 3UNLA 3GWRA 4HM0B 6GSPA 2CKFB 5AIIA 4I4KA 3SOYA 1BRSA 1JNQA 2XSOB 1RMSA 3CNMA 3HI7A 4ILFA 2P0MA 1LVNA 3T8NA 2CHCA 1TFOA 4MMXB 3VSYA 3EJVA 4K1UA 3BNDA 3SXXA 1N8R4 2YFLB 1Z1SA 1X1WA 2Z76A 3DGMA 3LMLA 4HZBB 3FGYA 4AKYA 4HM8B 1CYUA 4HM3B 2OTJ3 3SX1A 1K28A 1A90A 1LQMB 1UUWB 2QGUA 2RFRA 1OF5A 1Q9EA 1SJWA 5FW5A 5TGNA 1LNHA 5BVBA 5RNTA 4MJDA 3F9SA 4K1VA 3D9RA 1MNLA 1WMOA 1YJW3 2QIYA 3LTDA 2SBLA 1W6GA 3NHXA 1W2ZA 4AKZA 2XGNA 5IG3A 1G0TA 1I2GA 4H61A 2ML5A 1I8VA 1V74A 3CCV3 4HVNA 2Y73A 4BL2A 3EBTA 3SEDA 2XR8B 3K9MC 2CG0A 3MG3A 3PZWA 1JZOA 1JN5A 2C10A 2ML6A 3LTAA 1W6CA 4U13A 2XEPA 4STDA 3IMAB 3I553 1Q7Y4 3MWZA 1OCVA 1ULJB 2F5MA 2IA7A 3ER7A 2R4IA 4HM7B 4WYKA 1R4YA 1K8A4 2E2UA 3G0KA 3NBBA 4XBYA 3FG4A 2K3DA 4LYLB 1GD3A 2BIRA 5I97A 1FGTA 1B21A 1W6YA 1BSEA 1FGMA 6STDA 1GY6A 1OHSA 3DH2A 5LC7A 2P09A 1ZO2A 1O7NB 5KP3A 1WNHA 3DY5A 5D82A 3B8LA 3UL5A 1VQ43 4FCMA 1AQZA 1J2BA 3GAXA 1QAFA 1QVG2 1GS3A 1RDSA 3V99A 4J8TA 5IEPA 3EQQB 1BRHA 3EN1B 1UDII 3NM2A 4O2HA 5IG4A 5G1KA 3BLZA 5JBSA 1DYUA 5BU4A 4WHAA 2KF6A 1WMNA 1RGLA 2GBWB 2IMJA 1BRJA 3S67A 1VQK3 1YI23 1HYFA 2W04A 1VQ63 2O3OA 3OV4A 4N6OB 3S27A 1KD14 3I0YA 4HKVB 5ELUA 1NB5I 3GZRA 2Z6BA 1ULIB 4HAAA 3MYTA 1DVCA 2FXTA 3HZPA 2IYJA 4R1KA 5IG5A 2CFLA 1YVSA 7RNTA 4O8SA 1RHLA 5DREA 2OWPA 3V98A 3X42A 4KFDA 1O7GB 2XH9A 1Q814 2CWVA 3EHCA 1X1UA 2OQEA 1ASKA 1N5PA 5CXOA 1ROVA 1F8NA 2UX0A 1BNGA 3AHSA 3CPOA 1UI8A 4LEHA 1SARA 2CIUA 1B20A 1CH0A 3FSDA 5EQLA 4O3VA 3CCQ3 1BSDA 2LQVA 1D6YA 2WOHA 4FCZA 4HM1B 1BNIA 1Q864 1OGXA 1Q42A 1Y4KA 1JB5A 3JUQA 1OACA 2WOFA 1YIJ3 4FMCA 1B2SA 2W9PA 4MEIA 1FZUA 2F4YA 1BNFA 4BTXA 3D4AA 5DRVA 5KP1A 8CHOA 2B24B 1RGAA 4ORLA 3WA2X 1FYSA 4N6MA 3CD63 1A2PA 4N6V0 3AGNA 2IUJA 4I5QA 1HKXA 2KF4A 3BIRA 1O7PB 1ROAA 3EB8A 3F14A 4KVHA 2J8XB 5CF1A 5AYSC 3PXMA 1LNIA 3U1WA 1QJGA 3H51A 1RGCA 4BL3A 2ZHXB 8RNTA 3S29A 2SARA 2K0MA 3E99A 2H0HA 3LTCA 2GXFA 1RSNA 1MWUA 3AHWA 3WODG 5BXQA 1LOVA 2D1WA 2O9UX 2P05A 2MC8A 3D5IA 1T2HA 2W56A 2BT3A 7GSPA 4GB5A 1G02A 3MSOA 1BRIA 5BIRA 3U97A 2OCTA 3AMOA 4JRFA 1TIJA 1MOLA 1O7WB 1RCLA 4LZIA 2Z77A 1IDPA 2YFJB 3JUPA 1KC84 4LSOA 1DE3A 1GMQA 1QAKA 2OQEC 1RN4A 1BRNL 1BUQA 2RBIA 4NPBA 3WOEB 3EF8A 2BU4A 3Q90A 1UUVB 5IF6A 1C7HA 1PU4A 4QWTA 1NB3I 1BANA 4HM2B 4HM6B 1I2FA 2WO0A 4N6TA 3LZAA 1W7CA 5G1LA 3V92A 1BNJA 1OGZA 2IUKA 1C54A 1IVUA 1L5GB 1NO3A 1K9M4 5D83A 1I3IA 2L4VA 4FMBA 2CFDA 3IPTA 4HM4B 3JUMA 2F5WA 2L1SA 1B2UA 3FF0A 3L0RA 3BU4A 3N54B 3NV0A 3RGAA 1BAOA 3NQYA 1RTUA 1V57A 3GZBA 4J9AA 2GEXA 4CCVA 3CC23 2FNQA 5HOHA 3UJMA 1WQLB 1VQN3 3CNXA 2RGQA 3DZLA 3G6E3 1QALA 3A5EA 3BB9A 5EEOA 3KSPA 4H3UA 2FGTA 4NREA 1JKGB 3BNCA 5M1AA 1UCJA 1KSIA 1ZS7A 3N8BA 4CDLA 3AGOA 3VF1A 1M904 3B7CA 6RNTA 2W2CA 1S723 1UUGB 3K63A 5A0OB 1RKYA 5AEWB 3FG1A 2IY2A 2OTL3 1VQP3 1JBSA 3FF2A 1CYVA 2KF5A 1LOWA 1UCKA 5AIFA 1FUTA 4R4KA 4FCJA 4WP5A 3GSPA 3PCRA 5AEUB 1TU5A 3MPHA 3QK9A 3S28A 3D5GA 1RGEA 4R9KA 1E3RA 2C11A 1V58A 1BGSA 1N8QA 3F8HA 3Q1CA 1YGEA 3H3HA 4L8PA 2B1XB 2QA43 4LMIA 3URPA 1K41A 1RLSA 2UGIA 1FGQA 4Q53A 4KFFA 2MF7A 2HMNB 5GSPA 2JDIH 3BNBA 3WOFB 1SIHA 3F7XA 2HMKB 3DGOA 2PNCA 4N6LA 1IT7A 1OHOA 4EW5A 5IW9A 1EUIC 3G16A 1AR0A 4X2OA 1OPYA 1JRQA 1T5YA 2ZDJA 1NNVA 4KT3B 2YFIB 3SVAA 2JQ5A 4AEQA 1TTOA 2CFKA 3S5CA 1K734 3DUKA 1EQKA 1FGOA 1Q7HA 1EKMA 1T3BA 1EG9B 1OHPA 3A76A 3RNTA 5AIHA 1I3FA 3KSED 3FLJA 1YHQ3 5HGRA 3WA3A 3FKAA 2CK3H 2QEX3 3K5TA 1RGKA 1NU3A 4RNYA 1TUHA 1W02A 1IQ8A 3HIGA 3MHEA
chains in the Genus database with same CATH topology
3JVCA 2BNGA 3FZWA 4R80A 1YIT3 2INXA 1US1A 2F99A 2HMLB 4K90B 1RJOA 1DMMA 1W01A 3CC73 4ZM8A 1UI7A 3MKIA 3NX0A 4X2HA 1N9EA 1JJ22 1ISKA 3MG1A 1IVVA 2CWUA 5LC6A 1GYBA 3LTBA 3Q2PA 1GD4A 1IVXA 1E97A 2A15A 2CC3A 1KWIA 5ELJA 1JV2B 2KCDA 1M1K4 2Y74A 4OVMA 3FH1A 5IG0A 1STDA 3G4S3 2W0QA 4BTYA 1PFPA 5EVHA 4EBGA 4NHFA 4L7KA 2WGOA 4TX4A 1M9GA 3D3LA 4FMDA 1AVKA 1HU9A 3KKGA 3BNEA 3KIIA 1Q40B 1VQ93 2P38A 1OUNA 4HBRA 1YVBI 3GRDA 2XRXB 1S5AA 2BMRB 3PGBA 4XM4A 3NM7A 3JUNA 3LYGA 3ALAA 1VQL3 5IENA 3OW22 3EN8A 1NDOB 3PS8A 1IQ8A 1SIIA 1A67A 2GU3A 3CC43 3WDGB 3TDGA 1QMAA 3RDEA 2XSHB 3ROBA 3F8XA 4OUQA 1VQM3 5IERA 1TP6A 3UB1A 1VZZA 2XFSA 2F98A 1OF5B 1QVF2 1WMPA 3JUOA 3G8ZA 5CLKA 2RCDA 4EV2A 1EA2A 4RBNA 2LYXA 3G713 2GBXB 1N9JA 2BMOB 3NQZA 4N6NB 3CCL3 1GY7A 1CQSA 3NBJA 3FG3A 5CF2A 1M1XB 3LT9A 3CME3 3T0UA 3KFQC 1VQ73 2WGQA 3X3YA 5JPUA 2W03A 1YJ93 2PZVA 3ECFA 1O7MB 1E3VA 2KXGA 3VGNA 4XDWA 1U8CB 2CFGA 3X41A 1RRLA 1JN5B 2BO9B 1IQYA 2E2VA 3CCU3 1NWWA 1FGRA 7STDA 3CCE3 2XGLA 3B4OA 4KFEA 3UL6A 4WYKB 3QRDA 1LXEA 1AVLA 4RZMA 3CMA3 4G1MB 3MG2A 3CCS3 1DVDA 1OH0A 4KZ1A 1W2B2 1SQWA 1FUWA 4XB5A 4WFOA 3DGNA 2Z7AA 3K7CA 2I9WA 3OWYA 3CXC2 4EYCA 3M8CA 1AV4A 1LOXA 5D81A 4LGQA 1FA3A 3EX9A 3SLUA 2P0XA 3LXUX 1IU7A 3GZYB 4GL6A 3EBYA 1D6ZA 2V1LA 4EXRA 1A2KA 1DMQA 1UW1A 2RSXA 4OK0A 2XF3A 1A2VA 4JF8A 4RNZA 1JKGA 4MMZB 1STFI 1IV7A 3CCR3 3FCSB 1IQXA 4IT7A 4N6UA 4EV5A 3HX8A 1IV9A 3STDA 3PCSA 4HM5B 1KQS2 3KZTA 5STDA 4R9LA 5JPPA 3EC9A 5AYRB 2OOVA 1DMNA 2K54A 3GZXB 2F86B 3B4PA 3PYJA 4L8OA 5IEOA 2CG1A 1YJN3 2HMOB 3OWSA 2BHMA 3DGLA 3IJEB 2W6JH 3OWUA 3DMCA 1GY5A 3CCJ3 2CH9A 1W00A 2W9QA 2CWTA 1VQ53 3LT8A 4WWUC 3X3XA 1JB2A 3N9HA 4HJLB 5AI1A 4BTWA 5G2GA 3KN4A 5AIGA 2GU1A 5CK6A 1O7HB 3HK4A 3X40A 4O02B 1G96A 3RGRA 4XBTA 3OXAA 1WTHA 3F7SA 4XDVA 1N5HA 3X3ZA 3WMDA 2GEYA 5FGOA 1R4CA 3CPW2 2YX9A 1NJI4 1RRHA 3HIIA 1W5ZA 2W56B 3DM8A 2Q07A 2HMJB 4EC6A 3CU3A 2CW9A 3AMOB 4IPBA 1VQO3 1VQ83 2XFTA 3F40A 4MMYB 2KRTA 2E2TA 4FMAA 3KE7A 1Q824 1W4NA 3CCM3 4XBXA 2ZL8A 1RN7A 1TFKA 2M7OA 2OOVC 3LOYA 4HZ9B 3J7Yd 4PEJA 1ZX2A 2BMQB 3EE1A 3I563 2STDA 4K61A 3NBRA 3LH4A 5KP4A 1D6UA 1CEWI 1IT8A 4IIAA 2HMMB 1IVWA 3SOAA 2D42A 3K0ZA 3DXOA 4N3VA 3NV0B 3NUVA 1JB4A 3T8UA 4HYZA 3OX9A 3O8YA 1U5OA 2CFWA 4FR9A 3NXJA 1IK3A 1Q40A 1SPUA 3UNLA 3GWRA 4HM0B 2CKFB 5AIIA 4I4KA 3SOYA 1JNQA 2XSOB 3CNMA 3HI7A 2P0MA 1LVNA 3T8NA 2CHCA 1TFOA 4MMXB 3VSYA 3EJVA 4K1UA 3BNDA 3SXXA 1N8R4 2YFLB 1Z1SA 3DGMA 2Z76A 3LMLA 4HZBB 4AKYA 3FGYA 1CYUA 4HM8B 4HM3B 2OTJ3 3SX1A 1K28A 1A90A 2QGUA 1UUWB 2RFRA 5TGNA 1OF5A 1SJWA 1YIJ3 5FW5A 5BVBA 1LNHA 4MJDA 3F9SA 4K1VA 3D9RA 1MNLA 1WMOA 1YJW3 2QIYA 3LTDA 2SBLA 1W6GA 3NHXA 1W2ZA 2XGNA 5IG3A 4H61A 2ML5A 1V74A 3CCV3 4HVNA 2Y73A 3EBTA 3SEDA 2XR8B 3K9MC 2CG0A 3MG3A 3PZWA 1JN5A 2C10A 2ML6A 3LTAA 1W6CA 4U13A 2XEPA 4STDA 3IMAB 3I553 1Q7Y4 3MWZA 1OCVA 1ULJB 2IA7A 3ER7A 4HM7B 2R4IA 4WYKA 1K8A4 2E2UA 3G0KA 3NBBA 3FG4A 1GD3A 5I97A 1FGTA 1W6YA 1FGMA 6STDA 1GY6A 1OHSA 5LC7A 2P09A 1ZO2A 1O7NB 5KP3A 1WNHA 3DY5A 5D82A 3B8LA 3UL5A 1VQ43 4FCMA 1J2BA 3GAXA 1QAFA 1QVG2 1GS3A 3V99A 4J8TA 5IEPA 3EQQB 3EN1B 3NM2A 4O2HA 5IG4A 3BLZA 5JBSA 1DYUA 4WHAA 1WMNA 2GBWB 2IMJA 3S67A 1VQK3 1YI23 2W04A 1VQ63 2O3OA 3OV4A 4N6OB 3S27A 1KD14 3I0YA 4HKVB 5ELUA 1NB5I 3GZRA 2Z6BA 1ULIB 3MYTA 1DVCA 2FXTA 3HZPA 4R1KA 5IG5A 2CFLA 4O8SA 5DREA 2OWPA 3X42A 4KFDA 2XH9A 1O7GB 1Q814 2CWVA 3EHCA 2OQEA 1ASKA 1N5PA 5CXOA 1ROVA 1F8NA 3CPOA 1UI8A 4LEHA 2CIUA 5EQLA 3FSDA 4O3VA 3CCQ3 2LQVA 1D6YA 2WOHA 4FCZA 4HM1B 1Q864 1OGXA 1Q42A 1Y4KA 1JB5A 3JUQA 1OACA 2WOFA 4FMCA 2W9PA 4MEIA 4BTXA 5DRVA 5KP1A 8CHOA 2B24B 4ORLA 3WA2X 3CD63 4N6MA 4N6V0 2IUJA 1HKXA 1O7PB 1ROAA 3EB8A 3F14A 4KVHA 5CF1A 5AYSC 3PXMA 3U1WA 1QJGA 3H51A 3S29A 2K0MA 3E99A 3LTCA 3WODG 2GXFA 5BXQA 2D1WA 2O9UX 2P05A 2MC8A 2W56A 2BT3A 4GB5A 3MSOA 3U97A 2OCTA 3AMOA 4JRFA 1TIJA 1MOLA 1O7WB 4LZIA 2Z77A 1IDPA 2YFJB 3JUPA 1KC84 4LSOA 1QAKA 2OQEC 1BUQA 3WOEB 3EF8A 3Q90A 1UUVB 5IF6A 1C7HA 1PU4A 4QWTA 1NB3I 4HM2B 4HM6B 2WO0A 4N6TA 3LZAA 1W7CA 3V92A 1OGZA 2IUKA 1IVUA 1L5GB 1NO3A 1K9M4 5D83A 2L4VA 4FMBA 2CFDA 3IPTA 4HM4B 3JUMA 4XBYA 3V98A 3NV0A 3FF0A 3L0RA 3N54B 4AKZA 1M904 3RGAA 3CC23 3NQYA 4J9AA 3GZBA 4CCVA 2GEXA 2FNQA 3UJMA 1WQLB 1VQN3 3CNXA 2RGQA 3DZLA 3G6E3 1QALA 3BB9A 5EEOA 3KSPA 4H3UA 2FGTA 4NREA 1JKGB 3BNCA 3N8BA 1KSIA 4CDLA 3VF1A 3B7CA 2W2CA 1S723 3K63A 5A0OB 1RKYA 5AEWB 3FG1A 2OTL3 1VQP3 3FF2A 1CYVA 5AIFA 4R4KA 4FCJA 4WP5A 3PCRA 5AEUB 1TU5A 3MPHA 3QK9A 3S28A 4R9KA 1E3RA 2C11A 3F8HA 1N8QA 3Q1CA 1YGEA 3H3HA 4L8PA 2B1XB 2QA43 4LMIA 1K41A 4Q53A 1FGQA 4KFFA 2MF7A 2HMNB 2JDIH 3BNBA 3WOFB 1SIHA 3F7XA 2HMKB 3DGOA 2PNCA 4N6LA 1IT7A 1OHOA 5IW9A 3G16A 1AR0A 4X2OA 1OPYA 1JRQA 1T5YA 2ZDJA 2YFIB 3SVAA 2JQ5A 4AEQA 2CFKA 3S5CA 1K734 3DUKA 1EQKA 1FGOA 1EKMA 1EG9B 1OHPA 3A76A 5AIHA 3KSED 3FLJA 1YHQ3 5HGRA 3WA3A 3FKAA 2CK3H 2QEX3 3K5TA 1NU3A 4RNYA 1TUHA 1W02A 2UX0A 3HIGA 3MHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V74 A;  1TFO A;  1TFK A; 
#chains in the Genus database with same CATH topology
 3JVC A;  2BNG A;  3FZW A;  4R80 A;  3ZG5 A;  2INX A;  1YIT 3;  1US1 A;  2F99 A;  2HML B;  4K90 B;  1RJO A;  1DMM A;  1W01 A;  2AAE A;  4ZM8 A;  1UI7 A;  3MKI A;  3NX0 A;  4X2H A;  1N9E A;  1JJ2 2;  1ISK A;  1BNR A;  3MG1 A;  2AAD A;  1IVV A;  2CWU A;  5LC6 A;  2C4B A;  1BNE A;  1BU4 A;  1GYB A;  3LTB A;  3Q2P A;  1GD4 A;  1IVX A;  1E97 A;  2A15 A;  2CC3 A;  1KWI A;  2F56 A;  5ELJ A;  1JV2 B;  2KCD A;  1M1K 4;  2Y74 A;  1MWT A;  4OVM A;  3FH1 A;  3Q3F A;  1STD A;  5IG0 A;  1TJD A;  2W0Q A;  3G4S 3;  4BTY A;  1RGG A;  1PFP A;  5M18 A;  1BRK A;  5EVH A;  4EBG A;  2CX1 A;  4NHF A;  4L7K A;  2WGO A;  4TX4 A;  1M9G A;  3D3L A;  3CC7 3;  1MWR A;  4FMD A;  1AVK A;  1HU9 A;  3KKG A;  3BNE A;  3KII A;  1Q40 B;  1VQ9 3;  2P38 A;  1OUN A;  4HBR A;  1YVB I;  3GRD A;  2XRX B;  1S5A A;  2BMR B;  3PGB A;  4XM4 A;  3NM7 A;  3JUN A;  3LYG A;  3SYU A;  3ALA A;  3DGY A;  5IEN A;  1VQL 3;  3OW2 2;  1BSA A;  3EN8 A;  1NDO B;  3PS8 A;  1SII A;  1A67 A;  2GU3 A;  3ZFZ A;  3CC4 3;  4GHO A;  3WDG B;  3TDG A;  1QMA A;  3RDE A;  2XSH B;  3ROB A;  3F8X A;  1DET A;  1FUS A;  1LRA A;  4OUQ A;  1UGH I;  1VQM 3;  3D79 A;  1TP6 A;  5IER A;  3UB1 A;  1VZZ A;  2XFS A;  2F98 A;  1OF5 B;  1B2X A;  1QVF 2;  1WMP A;  3JUO A;  3G8Z A;  1BNS A;  1B3S A;  1VQQ A;  4J5K A;  5CLK A;  2RCD A;  4EV2 A;  1BVI A;  1EA2 A;  4RBN A;  1I70 A;  2LYX A;  3G71 3;  2GBX B;  3WHO A;  4BIR A;  1N9J A;  2BMO B;  2H0G A;  2KF3 A;  3NQZ A;  4N6N B;  3CCL 3;  1GY7 A;  1JBR A;  1CQS A;  3NBJ A;  3FG3 A;  5CF2 A;  1M1X B;  3LT9 A;  3CME 3;  3T0U A;  3KFQ C;  1VQ7 3;  2WGQ A;  3X3Y A;  5JPU A;  2KAA A;  2W03 A;  1YJ9 3;  1TRP A;  2PZV A;  3ECF A;  1O7M B;  1E3V A;  2KXG A;  3VGN A;  4XDW A;  1JBT A;  1U8C B;  1B2M A;  2CFG A;  3X41 A;  1RRL A;  1JN5 B;  2BO9 B;  1IQY A;  2E2V A;  3CCU 3;  1NWW A;  1FGR A;  1MWS A;  1UCI A;  7STD A;  2RNT A;  1BSC A;  3CCE 3;  2XGL A;  1PY3 A;  3B4O A;  4KFE A;  3UL6 A;  2GSP A;  4WYK B;  3QRD A;  1LXE A;  1RNB A;  1UCL A;  1AY7 A;  1AVL A;  4RZM A;  1PYL A;  3CMA 3;  4G1M B;  3MG2 A;  3CCS 3;  1DVD A;  4BU4 A;  1OH0 A;  4KZ1 A;  1W2B 2;  1SQW A;  4GSP A;  5M19 A;  1FUW A;  1MGR A;  4XB5 A;  1ZGX A;  4WFO A;  3DGN A;  2Z7A A;  4J5G A;  1I0X A;  3K7C A;  2I9W A;  3OWY A;  3CXC 2;  4EYC A;  3M8C A;  1BIR A;  1AV4 A;  1LOX A;  5D81 A;  4LGQ A;  1FA3 A;  3EX9 A;  3SLU A;  1BOX A;  2P0X A;  3LXU X;  1IU7 A;  3GZY B;  4GL6 A;  3EBY A;  1D6Z A;  2V1L A;  1IYY A;  4EXR A;  1RN1 A;  1A2K A;  1DMQ A;  1UW1 A;  2RSX A;  4HOH A;  4OK0 A;  2XF3 A;  1A2V A;  1GOU A;  4DKI A;  1GOY A;  4JF8 A;  4RNZ A;  1JKG A;  4MMZ B;  1RCK A;  1GMR A;  1STF I;  2HOH A;  1IV7 A;  3CCR 3;  1GSP A;  3FCS B;  1IQX A;  4IT7 A;  4N6U A;  4EV5 A;  3HX8 A;  1IV9 A;  3STD A;  3PCS A;  4HM5 B;  1KQS 2;  3KZT A;  5STD A;  4R9L A;  5JPP A;  3EC9 A;  5AYR B;  2OOV A;  1DMN A;  3ZG0 A;  2K54 A;  3GZX B;  2F86 B;  3B4P A;  3WR2 A;  1X1Y A;  3PYJ A;  4CJN A;  4L8O A;  5IEO A;  2CG1 A;  1YJN 3;  2HMO B;  3OWS A;  1I0V A;  2BHM A;  3DGL A;  2R41 A;  3IJE B;  2W6J H;  3OWU A;  1YGW A;  3DMC A;  1GY5 A;  3CCJ 3;  1LQG C;  2CH9 A;  1W00 A;  2W9Q A;  2CWT A;  1VQ5 3;  3LT8 A;  4WWU C;  1HZ1 A;  3X3X A;  1JB2 A;  3N9H A;  4HJL B;  5AI1 A;  1RNT A;  4BTW A;  5G2G A;  1BUJ A;  1FW7 A;  3KN4 A;  1YNV X;  2GU1 A;  5AIG A;  5CK6 A;  1O7H B;  3HK4 A;  3X40 A;  4O02 B;  1G96 A;  1T2I A;  3RGR A;  4XBT A;  3OXA A;  1WTH A;  3F7S A;  4XDV A;  1N5H A;  3X3Z A;  2UUG C;  3WMD A;  1I2E A;  2GEY A;  5FGO A;  1R4C A;  3CPW 2;  2YX9 A;  1NJI 4;  1RRH A;  1X1X A;  1RGF A;  1W5Z A;  2ZA4 A;  3HII A;  2W56 B;  3DM8 A;  2Q07 A;  2HMJ B;  4EC6 A;  3CU3 A;  2CW9 A;  3AMO B;  4IPB A;  1VQO 3;  1VQ8 3;  2XFT A;  1BRG A;  3F40 A;  4MMY B;  1B2Z A;  1JZD A;  2KRT A;  2E2T A;  4FMA A;  3KE7 A;  1Q82 4;  1B27 A;  1W4N A;  3CCM 3;  4XBX A;  1LOY A;  2ZL8 A;  1RN7 A;  1TFK A;  2M7O A;  2OOV C;  3LOY A;  1EEJ A;  4HZ9 B;  3J7Y d;  4PEJ A;  1ZX2 A;  2BMQ B;  3EE1 A;  3HOH A;  4RNT A;  3I56 3;  1UGI A;  1TRQ A;  2STD A;  4K61 A;  2CX0 A;  3NBR A;  2H0I A;  3LH4 A;  1RGH A;  5KP4 A;  1D6U A;  9RNT A;  1CEW I;  4CPK A;  1BSB A;  1MGW A;  1IT8 A;  4IIA A;  2HMM B;  1IVW A;  3SOA A;  2D42 A;  3K0Z A;  3DXO A;  4N3V A;  3NV0 B;  3NUV A;  1JB4 A;  3T8U A;  4HYZ A;  3OX9 A;  3O8Y A;  1U5O A;  2CFW A;  4FR9 A;  3NXJ A;  1IK3 A;  3KCH A;  1GOV A;  1Q40 A;  1SPU A;  1GMP A;  3UNL A;  3GWR A;  4HM0 B;  6GSP A;  2CKF B;  5AII A;  4I4K A;  3SOY A;  1BRS A;  1JNQ A;  2XSO B;  1RMS A;  3CNM A;  3HI7 A;  4ILF A;  2P0M A;  1LVN A;  3T8N A;  2CHC A;  1TFO A;  4MMX B;  3VSY A;  3EJV A;  4K1U A;  3BND A;  3SXX A;  1N8R 4;  2YFL B;  1Z1S A;  1X1W A;  2Z76 A;  3DGM A;  3LML A;  4HZB B;  3FGY A;  4AKY A;  4HM8 B;  1CYU A;  4HM3 B;  2OTJ 3;  3SX1 A;  1K28 A;  1A90 A;  1LQM B;  1UUW B;  2QGU A;  2RFR A;  1OF5 A;  1Q9E A;  1SJW A;  5FW5 A;  5TGN A;  1LNH A;  5BVB A;  5RNT A;  4MJD A;  3F9S A;  4K1V A;  3D9R A;  1MNL A;  1WMO A;  1YJW 3;  2QIY A;  3LTD A;  2SBL A;  1W6G A;  3NHX A;  1W2Z A;  4AKZ A;  2XGN A;  5IG3 A;  1G0T A;  1I2G A;  4H61 A;  2ML5 A;  1I8V A;  1V74 A;  3CCV 3;  4HVN A;  2Y73 A;  4BL2 A;  3EBT A;  3SED A;  2XR8 B;  3K9M C;  2CG0 A;  3MG3 A;  3PZW A;  1JZO A;  1JN5 A;  2C10 A;  2ML6 A;  3LTA A;  1W6C A;  4U13 A;  2XEP A;  4STD A;  3IMA B;  3I55 3;  1Q7Y 4;  3MWZ A;  1OCV A;  1ULJ B;  2F5M A;  2IA7 A;  3ER7 A;  2R4I A;  4HM7 B;  4WYK A;  1R4Y A;  1K8A 4;  2E2U A;  3G0K A;  3NBB A;  4XBY A;  3FG4 A;  2K3D A;  4LYL B;  1GD3 A;  2BIR A;  5I97 A;  1FGT A;  1B21 A;  1W6Y A;  1BSE A;  1FGM A;  6STD A;  1GY6 A;  1OHS A;  3DH2 A;  5LC7 A;  2P09 A;  1ZO2 A;  1O7N B;  5KP3 A;  1WNH A;  3DY5 A;  5D82 A;  3B8L A;  3UL5 A;  1VQ4 3;  4FCM A;  1AQZ A;  1J2B A;  3GAX A;  1QAF A;  1QVG 2;  1GS3 A;  1RDS A;  3V99 A;  4J8T A;  5IEP A;  3EQQ B;  1BRH A;  3EN1 B;  1UDI I;  3NM2 A;  4O2H A;  5IG4 A;  5G1K A;  3BLZ A;  5JBS A;  1DYU A;  5BU4 A;  4WHA A;  2KF6 A;  1WMN A;  1RGL A;  2GBW B;  2IMJ A;  1BRJ A;  3S67 A;  1VQK 3;  1YI2 3;  1HYF A;  2W04 A;  1VQ6 3;  2O3O A;  3OV4 A;  4N6O B;  3S27 A;  1KD1 4;  3I0Y A;  4HKV B;  5ELU A;  1NB5 I;  3GZR A;  2Z6B A;  1ULI B;  4HAA A;  3MYT A;  1DVC A;  2FXT A;  3HZP A;  2IYJ A;  4R1K A;  5IG5 A;  2CFL A;  1YVS A;  7RNT A;  4O8S A;  1RHL A;  5DRE A;  2OWP A;  3V98 A;  3X42 A;  4KFD A;  1O7G B;  2XH9 A;  1Q81 4;  2CWV A;  3EHC A;  1X1U A;  2OQE A;  1ASK A;  1N5P A;  5CXO A;  1ROV A;  1F8N A;  2UX0 A;  1BNG A;  3AHS A;  3CPO A;  1UI8 A;  4LEH A;  1SAR A;  2CIU A;  1B20 A;  1CH0 A;  3FSD A;  5EQL A;  4O3V A;  3CCQ 3;  1BSD A;  2LQV A;  1D6Y A;  2WOH A;  4FCZ A;  4HM1 B;  1BNI A;  1Q86 4;  1OGX A;  1Q42 A;  1Y4K A;  1JB5 A;  3JUQ A;  1OAC A;  2WOF A;  1YIJ 3;  4FMC A;  1B2S A;  2W9P A;  4MEI A;  1FZU A;  2F4Y A;  1BNF A;  4BTX A;  3D4A A;  5DRV A;  5KP1 A;  8CHO A;  2B24 B;  1RGA A;  4ORL A;  3WA2 X;  1FYS A;  4N6M A;  3CD6 3;  1A2P A;  4N6V 0;  3AGN A;  2IUJ A;  4I5Q A;  1HKX A;  2KF4 A;  3BIR A;  1O7P B;  1ROA A;  3EB8 A;  3F14 A;  4KVH A;  2J8X B;  5CF1 A;  5AYS C;  3PXM A;  1LNI A;  3U1W A;  1QJG A;  3H51 A;  1RGC A;  4BL3 A;  2ZHX B;  8RNT A;  3S29 A;  2SAR A;  2K0M A;  3E99 A;  2H0H A;  3LTC A;  2GXF A;  1RSN A;  1MWU A;  3AHW A;  3WOD G;  5BXQ A;  1LOV A;  2D1W A;  2O9U X;  2P05 A;  2MC8 A;  3D5I A;  1T2H A;  2W56 A;  2BT3 A;  7GSP A;  4GB5 A;  1G02 A;  3MSO A;  1BRI A;  5BIR A;  3U97 A;  2OCT A;  3AMO A;  4JRF A;  1TIJ A;  1MOL A;  1O7W B;  1RCL A;  4LZI A;  2Z77 A;  1IDP A;  2YFJ B;  3JUP A;  1KC8 4;  4LSO A;  1DE3 A;  1GMQ A;  1QAK A;  2OQE C;  1RN4 A;  1BRN L;  1BUQ A;  2RBI A;  4NPB A;  3WOE B;  3EF8 A;  2BU4 A;  3Q90 A;  1UUV B;  5IF6 A;  1C7H A;  1PU4 A;  4QWT A;  1NB3 I;  1BAN A;  4HM2 B;  4HM6 B;  1I2F A;  2WO0 A;  4N6T A;  3LZA A;  1W7C A;  5G1L A;  3V92 A;  1BNJ A;  1OGZ A;  2IUK A;  1C54 A;  1IVU A;  1L5G B;  1NO3 A;  1K9M 4;  5D83 A;  1I3I A;  2L4V A;  4FMB A;  2CFD A;  3IPT A;  4HM4 B;  3JUM A;  2F5W A;  2L1S A;  1B2U A;  3FF0 A;  3L0R A;  3BU4 A;  3N54 B;  3NV0 A;  3RGA A;  1BAO A;  3NQY A;  1RTU A;  1V57 A;  3GZB A;  4J9A A;  2GEX A;  4CCV A;  3CC2 3;  2FNQ A;  5HOH A;  3UJM A;  1WQL B;  1VQN 3;  3CNX A;  2RGQ A;  3DZL A;  3G6E 3;  1QAL A;  3A5E A;  3BB9 A;  5EEO A;  3KSP A;  4H3U A;  2FGT A;  4NRE A;  1JKG B;  3BNC A;  5M1A A;  1UCJ A;  1KSI A;  1ZS7 A;  3N8B A;  4CDL A;  3AGO A;  3VF1 A;  1M90 4;  3B7C A;  6RNT A;  2W2C A;  1S72 3;  1UUG B;  3K63 A;  5A0O B;  1RKY A;  5AEW B;  3FG1 A;  2IY2 A;  2OTL 3;  1VQP 3;  1JBS A;  3FF2 A;  1CYV A;  2KF5 A;  1LOW A;  1UCK A;  5AIF A;  1FUT A;  4R4K A;  4FCJ A;  4WP5 A;  3GSP A;  3PCR A;  5AEU B;  1TU5 A;  3MPH A;  3QK9 A;  3S28 A;  3D5G A;  1RGE A;  4R9K A;  1E3R A;  2C11 A;  1V58 A;  1BGS A;  1N8Q A;  3F8H A;  3Q1C A;  1YGE A;  3H3H A;  4L8P A;  2B1X B;  2QA4 3;  4LMI A;  3URP A;  1K41 A;  1RLS A;  2UGI A;  1FGQ A;  4Q53 A;  4KFF A;  2MF7 A;  2HMN B;  5GSP A;  2JDI H;  3BNB A;  3WOF B;  1SIH A;  3F7X A;  2HMK B;  3DGO A;  2PNC A;  4N6L A;  1IT7 A;  1OHO A;  4EW5 A;  5IW9 A;  1EUI C;  3G16 A;  1AR0 A;  4X2O A;  1OPY A;  1JRQ A;  1T5Y A;  2ZDJ A;  1NNV A;  4KT3 B;  2YFI B;  3SVA A;  2JQ5 A;  4AEQ A;  1TTO A;  2CFK A;  3S5C A;  1K73 4;  3DUK A;  1EQK A;  1FGO A;  1Q7H A;  1EKM A;  1T3B A;  1EG9 B;  1OHP A;  3A76 A;  3RNT A;  5AIH A;  1I3F A;  3KSE D;  3FLJ A;  1YHQ 3;  5HGR A;  3WA3 A;  3FKA A;  2CK3 H;  2QEX 3;  3K5T A;  1RGK A;  1NU3 A;  4RNY A;  1TUH A;  1W02 A;  1IQ8 A;  3HIG A;  3MHE A; 
#chains in the Genus database with same CATH homology
 3JVC A;  2BNG A;  3FZW A;  4R80 A;  1YIT 3;  2INX A;  1US1 A;  2F99 A;  2HML B;  4K90 B;  1RJO A;  1DMM A;  1W01 A;  3CC7 3;  4ZM8 A;  1UI7 A;  3MKI A;  3NX0 A;  4X2H A;  1N9E A;  1JJ2 2;  1ISK A;  3MG1 A;  1IVV A;  2CWU A;  5LC6 A;  1GYB A;  3LTB A;  3Q2P A;  1GD4 A;  1IVX A;  1E97 A;  2A15 A;  2CC3 A;  1KWI A;  5ELJ A;  1JV2 B;  2KCD A;  1M1K 4;  2Y74 A;  4OVM A;  3FH1 A;  5IG0 A;  1STD A;  3G4S 3;  2W0Q A;  4BTY A;  1PFP A;  5EVH A;  4EBG A;  4NHF A;  4L7K A;  2WGO A;  4TX4 A;  1M9G A;  3D3L A;  4FMD A;  1AVK A;  1HU9 A;  3KKG A;  3BNE A;  3KII A;  1Q40 B;  1VQ9 3;  2P38 A;  1OUN A;  4HBR A;  1YVB I;  3GRD A;  2XRX B;  1S5A A;  2BMR B;  3PGB A;  4XM4 A;  3NM7 A;  3JUN A;  3LYG A;  3ALA A;  1VQL 3;  5IEN A;  3OW2 2;  3EN8 A;  1NDO B;  3PS8 A;  1IQ8 A;  1SII A;  1A67 A;  2GU3 A;  3CC4 3;  3WDG B;  3TDG A;  1QMA A;  3RDE A;  2XSH B;  3ROB A;  3F8X A;  4OUQ A;  1VQM 3;  5IER A;  1TP6 A;  3UB1 A;  1VZZ A;  2XFS A;  2F98 A;  1OF5 B;  1QVF 2;  1WMP A;  3JUO A;  3G8Z A;  5CLK A;  2RCD A;  4EV2 A;  1EA2 A;  4RBN A;  2LYX A;  3G71 3;  2GBX B;  1N9J A;  2BMO B;  3NQZ A;  4N6N B;  3CCL 3;  1GY7 A;  1CQS A;  3NBJ A;  3FG3 A;  5CF2 A;  1M1X B;  3LT9 A;  3CME 3;  3T0U A;  3KFQ C;  1VQ7 3;  2WGQ A;  3X3Y A;  5JPU A;  2W03 A;  1YJ9 3;  2PZV A;  3ECF A;  1O7M B;  1E3V A;  2KXG A;  3VGN A;  4XDW A;  1U8C B;  2CFG A;  3X41 A;  1RRL A;  1JN5 B;  2BO9 B;  1IQY A;  2E2V A;  3CCU 3;  1NWW A;  1FGR A;  7STD A;  3CCE 3;  2XGL A;  3B4O A;  4KFE A;  3UL6 A;  4WYK B;  3QRD A;  1LXE A;  1AVL A;  4RZM A;  3CMA 3;  4G1M B;  3MG2 A;  3CCS 3;  1DVD A;  1OH0 A;  4KZ1 A;  1W2B 2;  1SQW A;  1FUW A;  4XB5 A;  4WFO A;  3DGN A;  2Z7A A;  3K7C A;  2I9W A;  3OWY A;  3CXC 2;  4EYC A;  3M8C A;  1AV4 A;  1LOX A;  5D81 A;  4LGQ A;  1FA3 A;  3EX9 A;  3SLU A;  2P0X A;  3LXU X;  1IU7 A;  3GZY B;  4GL6 A;  3EBY A;  1D6Z A;  2V1L A;  4EXR A;  1A2K A;  1DMQ A;  1UW1 A;  2RSX A;  4OK0 A;  2XF3 A;  1A2V A;  4JF8 A;  4RNZ A;  1JKG A;  4MMZ B;  1STF I;  1IV7 A;  3CCR 3;  3FCS B;  1IQX A;  4IT7 A;  4N6U A;  4EV5 A;  3HX8 A;  1IV9 A;  3STD A;  3PCS A;  4HM5 B;  1KQS 2;  3KZT A;  5STD A;  4R9L A;  5JPP A;  3EC9 A;  5AYR B;  2OOV A;  1DMN A;  2K54 A;  3GZX B;  2F86 B;  3B4P A;  3PYJ A;  4L8O A;  5IEO A;  2CG1 A;  1YJN 3;  2HMO B;  3OWS A;  2BHM A;  3DGL A;  3IJE B;  2W6J H;  3OWU A;  3DMC A;  1GY5 A;  3CCJ 3;  2CH9 A;  1W00 A;  2W9Q A;  2CWT A;  1VQ5 3;  3LT8 A;  4WWU C;  3X3X A;  1JB2 A;  3N9H A;  4HJL B;  5AI1 A;  4BTW A;  5G2G A;  3KN4 A;  5AIG A;  2GU1 A;  5CK6 A;  1O7H B;  3HK4 A;  3X40 A;  4O02 B;  1G96 A;  3RGR A;  4XBT A;  3OXA A;  1WTH A;  3F7S A;  4XDV A;  1N5H A;  3X3Z A;  3WMD A;  2GEY A;  5FGO A;  1R4C A;  3CPW 2;  2YX9 A;  1NJI 4;  1RRH A;  3HII A;  1W5Z A;  2W56 B;  3DM8 A;  2Q07 A;  2HMJ B;  4EC6 A;  3CU3 A;  2CW9 A;  3AMO B;  4IPB A;  1VQO 3;  1VQ8 3;  2XFT A;  3F40 A;  4MMY B;  2KRT A;  2E2T A;  4FMA A;  3KE7 A;  1Q82 4;  1W4N A;  3CCM 3;  4XBX A;  2ZL8 A;  1RN7 A;  1TFK A;  2M7O A;  2OOV C;  3LOY A;  4HZ9 B;  3J7Y d;  4PEJ A;  1ZX2 A;  2BMQ B;  3EE1 A;  3I56 3;  2STD A;  4K61 A;  3NBR A;  3LH4 A;  5KP4 A;  1D6U A;  1CEW I;  1IT8 A;  4IIA A;  2HMM B;  1IVW A;  3SOA A;  2D42 A;  3K0Z A;  3DXO A;  4N3V A;  3NV0 B;  3NUV A;  1JB4 A;  3T8U A;  4HYZ A;  3OX9 A;  3O8Y A;  1U5O A;  2CFW A;  4FR9 A;  3NXJ A;  1IK3 A;  1Q40 A;  1SPU A;  3UNL A;  3GWR A;  4HM0 B;  2CKF B;  5AII A;  4I4K A;  3SOY A;  1JNQ A;  2XSO B;  3CNM A;  3HI7 A;  2P0M A;  1LVN A;  3T8N A;  2CHC A;  1TFO A;  4MMX B;  3VSY A;  3EJV A;  4K1U A;  3BND A;  3SXX A;  1N8R 4;  2YFL B;  1Z1S A;  3DGM A;  2Z76 A;  3LML A;  4HZB B;  4AKY A;  3FGY A;  1CYU A;  4HM8 B;  4HM3 B;  2OTJ 3;  3SX1 A;  1K28 A;  1A90 A;  2QGU A;  1UUW B;  2RFR A;  5TGN A;  1OF5 A;  1SJW A;  1YIJ 3;  5FW5 A;  5BVB A;  1LNH A;  4MJD A;  3F9S A;  4K1V A;  3D9R A;  1MNL A;  1WMO A;  1YJW 3;  2QIY A;  3LTD A;  2SBL A;  1W6G A;  3NHX A;  1W2Z A;  2XGN A;  5IG3 A;  4H61 A;  2ML5 A;  1V74 A;  3CCV 3;  4HVN A;  2Y73 A;  3EBT A;  3SED A;  2XR8 B;  3K9M C;  2CG0 A;  3MG3 A;  3PZW A;  1JN5 A;  2C10 A;  2ML6 A;  3LTA A;  1W6C A;  4U13 A;  2XEP A;  4STD A;  3IMA B;  3I55 3;  1Q7Y 4;  3MWZ A;  1OCV A;  1ULJ B;  2IA7 A;  3ER7 A;  4HM7 B;  2R4I A;  4WYK A;  1K8A 4;  2E2U A;  3G0K A;  3NBB A;  3FG4 A;  1GD3 A;  5I97 A;  1FGT A;  1W6Y A;  1FGM A;  6STD A;  1GY6 A;  1OHS A;  5LC7 A;  2P09 A;  1ZO2 A;  1O7N B;  5KP3 A;  1WNH A;  3DY5 A;  5D82 A;  3B8L A;  3UL5 A;  1VQ4 3;  4FCM A;  1J2B A;  3GAX A;  1QAF A;  1QVG 2;  1GS3 A;  3V99 A;  4J8T A;  5IEP A;  3EQQ B;  3EN1 B;  3NM2 A;  4O2H A;  5IG4 A;  3BLZ A;  5JBS A;  1DYU A;  4WHA A;  1WMN A;  2GBW B;  2IMJ A;  3S67 A;  1VQK 3;  1YI2 3;  2W04 A;  1VQ6 3;  2O3O A;  3OV4 A;  4N6O B;  3S27 A;  1KD1 4;  3I0Y A;  4HKV B;  5ELU A;  1NB5 I;  3GZR A;  2Z6B A;  1ULI B;  3MYT A;  1DVC A;  2FXT A;  3HZP A;  4R1K A;  5IG5 A;  2CFL A;  4O8S A;  5DRE A;  2OWP A;  3X42 A;  4KFD A;  2XH9 A;  1O7G B;  1Q81 4;  2CWV A;  3EHC A;  2OQE A;  1ASK A;  1N5P A;  5CXO A;  1ROV A;  1F8N A;  3CPO A;  1UI8 A;  4LEH A;  2CIU A;  5EQL A;  3FSD A;  4O3V A;  3CCQ 3;  2LQV A;  1D6Y A;  2WOH A;  4FCZ A;  4HM1 B;  1Q86 4;  1OGX A;  1Q42 A;  1Y4K A;  1JB5 A;  3JUQ A;  1OAC A;  2WOF A;  4FMC A;  2W9P A;  4MEI A;  4BTX A;  5DRV A;  5KP1 A;  8CHO A;  2B24 B;  4ORL A;  3WA2 X;  3CD6 3;  4N6M A;  4N6V 0;  2IUJ A;  1HKX A;  1O7P B;  1ROA A;  3EB8 A;  3F14 A;  4KVH A;  5CF1 A;  5AYS C;  3PXM A;  3U1W A;  1QJG A;  3H51 A;  3S29 A;  2K0M A;  3E99 A;  3LTC A;  3WOD G;  2GXF A;  5BXQ A;  2D1W A;  2O9U X;  2P05 A;  2MC8 A;  2W56 A;  2BT3 A;  4GB5 A;  3MSO A;  3U97 A;  2OCT A;  3AMO A;  4JRF A;  1TIJ A;  1MOL A;  1O7W B;  4LZI A;  2Z77 A;  1IDP A;  2YFJ B;  3JUP A;  1KC8 4;  4LSO A;  1QAK A;  2OQE C;  1BUQ A;  3WOE B;  3EF8 A;  3Q90 A;  1UUV B;  5IF6 A;  1C7H A;  1PU4 A;  4QWT A;  1NB3 I;  4HM2 B;  4HM6 B;  2WO0 A;  4N6T A;  3LZA A;  1W7C A;  3V92 A;  1OGZ A;  2IUK A;  1IVU A;  1L5G B;  1NO3 A;  1K9M 4;  5D83 A;  2L4V A;  4FMB A;  2CFD A;  3IPT A;  4HM4 B;  3JUM A;  4XBY A;  3V98 A;  3NV0 A;  3FF0 A;  3L0R A;  3N54 B;  4AKZ A;  1M90 4;  3RGA A;  3CC2 3;  3NQY A;  4J9A A;  3GZB A;  4CCV A;  2GEX A;  2FNQ A;  3UJM A;  1WQL B;  1VQN 3;  3CNX A;  2RGQ A;  3DZL A;  3G6E 3;  1QAL A;  3BB9 A;  5EEO A;  3KSP A;  4H3U A;  2FGT A;  4NRE A;  1JKG B;  3BNC A;  3N8B A;  1KSI A;  4CDL A;  3VF1 A;  3B7C A;  2W2C A;  1S72 3;  3K63 A;  5A0O B;  1RKY A;  5AEW B;  3FG1 A;  2OTL 3;  1VQP 3;  3FF2 A;  1CYV A;  5AIF A;  4R4K A;  4FCJ A;  4WP5 A;  3PCR A;  5AEU B;  1TU5 A;  3MPH A;  3QK9 A;  3S28 A;  4R9K A;  1E3R A;  2C11 A;  3F8H A;  1N8Q A;  3Q1C A;  1YGE A;  3H3H A;  4L8P A;  2B1X B;  2QA4 3;  4LMI A;  1K41 A;  4Q53 A;  1FGQ A;  4KFF A;  2MF7 A;  2HMN B;  2JDI H;  3BNB A;  3WOF B;  1SIH A;  3F7X A;  2HMK B;  3DGO A;  2PNC A;  4N6L A;  1IT7 A;  1OHO A;  5IW9 A;  3G16 A;  1AR0 A;  4X2O A;  1OPY A;  1JRQ A;  1T5Y A;  2ZDJ A;  2YFI B;  3SVA A;  2JQ5 A;  4AEQ A;  2CFK A;  3S5C A;  1K73 4;  3DUK A;  1EQK A;  1FGO A;  1EKM A;  1EG9 B;  1OHP A;  3A76 A;  5AIH A;  3KSE D;  3FLJ A;  1YHQ 3;  5HGR A;  3WA3 A;  3FKA A;  2CK3 H;  2QEX 3;  3K5T A;  1NU3 A;  4RNY A;  1TUH A;  1W02 A;  2UX0 A;  3HIG A;  3MHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...