1V74A

Structure of the e. coli colicin d bound to its immunity protein immd
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
LNDPLDSGRFSRKQLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antibiotic/immune system
molecule keywords Colicin D
publication title Structural inhibition of the colicin D tRNase by the tRNA-mimicking immunity protein
pubmed doi rcsb
source organism Escherichia coli
total genus 33
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11429 Colicin_D Colicin D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.200 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1v74A00
1TFOA 1V74A 1TFKA
chains in the Genus database with same CATH superfamily
1D6UA 1BRSA 3FG3A 2CFWA 3DH2A 1W2ZA 2BT3A 4AKZA 3MHEA 1YIT3 1I0XA 3KN4A 2K0MA 1UUGB 3NXJA 3I0YA 3MPHA 1UCJA 2OWPA 1YJN3 3V98A 1TIJA 1VQN3 1LQGC 2YFLB 3NQYA 3PZWA 3SLUA 4H61A 3KE7A 3NM2A 3LXUX 4RBNA 1CYUA 1ISKA 4LZIA 2CW9A 4FMDA 2GBXB 4N6V0 2IUJA 2RFRA 2RCDA 5IW9A 1EKMA 5JPPA 1RSNA 1I2GA 1I0VA 4HOHA 2F56A 1LOVA 2H0HA 4WFOA 1LOYA 1IT8A 4HJLB 3CCL3 1CEWI 3UJMA 3DGOA 1U8CB 1Q7Y4 5KP3A 3PS8A 5LC7A 1GOUA 4MMYB 3BNDA 1SARA 4ORLA 5GSPA 1W7CA 1AV4A 1UW1A 3X40A 4HYZA 3LH4A 4R9KA 1FW7A 4I5QA 2LYXA 3HX8A 1BNFA 3G713 3LTAA 1ZGXA 1RMSA 3D79A 1Q814 8CHOA 1YVSA 3ZFZA 1GY5A 2CX0A 2CWUA 3F7SA 1JBRA 2RGQA 1EEJA 2F98A 1BRIA 1X1WA 3FG4A 3N8BA 1Q9EA 1RLSA 1ZO2A 2Q07A 4HM4B 2XH9A 4K61A 5D82A 3URPA 3UNLA 1RNBA 1FA3A 1MGWA 1BNRA 1T2IA 2CHCA 2HMNB 1O7HB 3E99A 5G2GA 1T5YA 2RSXA 4FMBA 4HKVB 1LRAA 4HM1B 3CC23 1CQSA 4CDLA 2D42A 2UX0A 5BIRA 3OX9A 4WYKB 1FUSA 3SVAA 2KF3A 3AGOA 3K5TA 1KQS2 4R80A 3T8UA 2K54A 2MF7A 1IQ8A 3PXMA 2GEYA 3LYGA 2CKFB 1BUJA 1WNHA 1J2BA 1GY7A 4H3UA 2P09A 2W9QA 1RDSA 4XBYA 4LGQA 1I8VA 1FGMA 1GOVA 1U5OA 4O2HA 2CFKA 3EF8A 1BSAA 1BSDA 1M9GA 1IQXA 2HOHA 5ELUA 3CD63 1GS3A 3D4AA 3SEDA 3PCSA 3EN1B 4KFDA 4MJDA 5CK6A 3JUMA 3OWUA 3CPOA 2CFDA 3A76A 4I4KA 3Q2PA 5IF6A 1YNVX 1RGEA 2BO9B 1BSEA 1GY6A 5STDA 1GD4A 1B27A 1IDPA 1K28A 1LQMB 3LZAA 5TGNA 2BMOB 3FH1A 1BAOA 2KF5A 1N9JA 1KD14 1O7WB 2A15A 1AR0A 2W2CA 3G0KA 5AIGA 1YIJ3 3CNMA 3CMA3 1IT7A 3IMAB 4BIRA 1VQ73 2HMMB 2ZL8A 2GXFA 1BUQA 3BNEA 3OWSA 1DMNA 5CF2A 1MOLA 4WWUC 3QK9A 3IPTA 4G1MB 3CCV3 2XEPA 1TRPA 1WMOA 1FUWA 1JZOA 5IEPA 1S5AA 3DGYA 3GZYB 3BB9A 3EBYA 2JQ5A 3HZPA 1I2EA 2R41A 1TJDA 4HM2B 3VSYA 2CWVA 2P05A 5HOHA 5I97A 3OW22 4K90B 1M1K4 1OHOA 3U97A 4GSPA 1ASKA 1GD3A 2XRXB 5DRVA 1UGHI 1GOYA 5AIIA 4L8OA 3T0UA 3S67A 5JBSA 1VQQA 1OGXA 4PEJA 2Z7AA 3FCSB 2IUKA 4LYLB 1JV2B 4L7KA 1N5PA 2P0MA 3KCHA 2O3OA 3GSPA 7GSPA 5IG3A 2XSHB 2UUGC 4MEIA 1V58A 2F99A 1SJWA 3LT8A 4WYKA 4KFEA 1SIHA 3S5CA 1OGZA 1BU4A 4CCVA 4KVHA 3NQZA 3FF0A 2ML6A 4J5KA 5LC6A 1JBSA 3OV4A 6RNTA 1RCKA 5AEUB 1V74A 2W6JH 2W9PA 1QVG2 1JJ22 1IVVA 1TFOA 5EQLA 3DY5A 1DMQA 1JKGB 4HM7B 1A2VA 1UGIA 3HK4A 3V99A 1E3RA 1ZS7A 1NO3A 2J8XB 4BTYA 5M19A 3LMLA 1LNHA 1JB4A 1N9EA 4N6LA 6STDA 1OCVA 1OPYA 1OHSA 3HIGA 1OUNA 3ZG0A 2R4IA 1GYBA 2Z6BA 4EXRA 3CCR3 2CK3H 1KC84 2B1XB 3F8HA 1RHLA 3UB1A 3SYUA 5CLKA 1K8A4 1RN1A 1BSCA 1T2HA 3UL5A 9RNTA 1MWRA 2I9WA 2XR8B 3ALAA 1GMQA 1ROAA 3JUPA 2M7OA 3AHSA 5IG4A 3JUOA 2OOVA 4HM0B 1YGEA 4HZ9B 3EX9A 3JUNA 1BRKA 1K41A 3DZLA 3RNTA 1I3FA 4MMXB 1AVLA 2KAAA 4XDWA 2F4YA 4RNZA 5IENA 4N6MA 2O9UX 1CYVA 1Q864 1BNSA 3S27A 3STDA 1STDA 4RNTA 3X42A 4LEHA 2W04A 3EJVA 1N8QA 1IVXA 2YFIB 1RGFA 3GAXA 3VGNA 1S723 1K734 3GZBA 1QAKA 2RNTA 3CPW2 1TUHA 3X3YA 1BGSA 3KSPA 1N8R4 4WP5A 4J5GA 4ILFA 2KF4A 3VF1A 3FKAA 1MGRA 3CC43 3JUQA 2CG0A 3K7CA 2HMOB 1TRQA 3ER7A 3WOEB 3PCRA 5G1LA 2Y74A 5AIHA 1E97A 3D5IA 3H51A 1JB5A 2V1LA 3G8ZA 3H3HA 4J8TA 4TX4A 2MC8A 2SBLA 3SXXA 5AEWB 3CCS3 1D6YA 4GHOA 4EV5A 2E2TA 2C4BA 3F9SA 4N6OB 2KCDA 1UDII 2OQEA 3Q1CA 3DMCA 5HGRA 3B4PA 4HAAA 1BNJA 1X1UA 1OH0A 2GEXA 5CXOA 5CF1A 1DYUA 1FGOA 3AMOB 4N6TA 1FZUA 2QA43 3NBRA 1KWIA 4EV2A 2CWTA 1JKGA 1RGKA 4GB5A 3EHCA 2WOFA 3HI7A 1NDOB 3MSOA 1QVF2 3BU4A 3WR2A 3SOYA 2WGOA 3RGAA 4JRFA 5AIFA 1YI23 2ZHXB 1EQKA 1Y4KA 1LVNA 1BIRA 5BU4A 1Q824 1JBTA 2GU3A 4HM5B 1JN5B 2FXTA 3EN8A 1B2SA 3CME3 3CCU3 1Q40B 3KSED 1HKXA 5FGOA 3GWRA 2FGTA 1RCLA 3MWZA 1RGAA 4OVMA 2QEX3 1VQ93 3F40A 5EEOA 3MYTA 1FUTA 1IU7A 1STFI 5IEOA 3CCJ3 3G6E3 1W2B2 1E3VA 1BRJA 4XBXA 4HBRA 4BU4A 2HMKB 2STDA 3U1WA 5ELJA 2P38A 5KP4A 3CNXA 1AVKA 2HMJB 3KIIA 1ULIB 1KSIA 1UUVB 1BRNL 3CU3A 1VZZA 4LMIA 3JVCA 1AY7A 4CJNA 5BXQA 1SPUA 1W02A 4FCZA 4WHAA 3S29A 1GMRA 3DGNA 3EB8A 2BHMA 1BSBA 2D1WA 2OOVC 4HM8B 1RTUA 1TFKA 3I553 2LQVA 1RN4A 3A5EA 4EBGA 3CXC2 1B21A 1JZDA 2YFJB 4XB5A 2AAEA 2CH9A 4HM6B 2OTJ3 1B2XA 4KZ1A 4EW5A 3OWYA 1BVIA 2AADA 1FGTA 4O3VA 5AYSC 3WOFB 1IVWA 4Q53A 3FZWA 1T3BA 2IYJA 1UUWB 3EC9A 5AYRB 4BTWA 5JPUA 1PY3A 1VQO3 3FLJA 4JF8A 1MWSA 3WDGB 1VQ43 2INXA 4FR9A 1QAFA 2QIYA 3AMOA 8RNTA 3K63A 4IIAA 1X1XA 1R4YA 4AKYA 4N6NB 1RJOA 1NJI4 1WQLB 2BU4A 1YHQ3 1MWTA 4OUQA 4XDVA 1W00A 1RKYA 1RGHA 1DE3A 3HIIA 1JRQA 1GMPA 1BNEA 2E2VA 1A67A 2E2UA 2OQEC 4J9AA 5AI1A 2WO0A 1VQ83 2IA7A 3FG1A 3RGRA 5DREA 4ZM8A 3TDGA 3O8YA 1RNTA 1UCKA 1JN5A 4L8PA 3KZTA 3EE1A 3EBTA 1YJ93 1Q40A 1QJGA 1W5ZA 3B7CA 2Y73A 1LOWA 2F5WA 2JDIH 2GBWB 2KRTA 2PZVA 3GZXB 4AEQA 1DMMA 2BNGA 3IJEB 1SQWA 2K3DA 2SARA 4K1UA 4MMZB 1SIIA 1RGLA 2KXGA 4X2OA 1TTOA 4XBTA 3EQQB 3MG2A 1EUIC 1LOXA 2P0XA 4NHFA 5RNTA 3Q3FA 7RNTA 1RRLA 3DXOA 3GRDA 3ROBA 4N3VA 5EVHA 1VQ63 2IY2A 2HMLB 3NBJA 2Z77A 1OHPA 3AGNA 1CH0A 1BANA 2BIRA 3KKGA 1YGWA 3K0ZA 3BNCA 1IV7A 1B2ZA 2B24B 1AQZA 3M8CA 1LNIA 3L0RA 2XFTA 2ZA4A 3MKIA 1UCLA 3HOHA 5IG5A 2UGIA 2XGNA 7STDA 2ZDJA 3AHWA 1L5GB 2W03A 3N9HA 3BNBA 4BL2A 3F8XA 2OTL3 1VQP3 2GU1A 2L4VA 2W0QA 2Z76A 4HM3B 1HZ1A 3DM8A 3GZRA 1PYLA 5M1AA 3BIRA 2CC3A 1NNVA 3F7XA 4HVNA 4R4KA 3D5GA 2WOHA 3OXAA 4NPBA 1W6CA 1R4CA 1UI8A 1A2PA 4XM4A 4U13A 2F86B 5FW5A 2GSPA 4N6UA 4IPBA 1M904 1VQ53 1W6GA 1PFPA 1UI7A 3LT9A 3X3XA 1IVUA 4KFFA 1BNGA 1US1A 3NM7A 1HU9A 2CFGA 3NUVA 1OF5B 3NV0B 1RGGA 2OCTA 3DUKA 5D83A 3NHXA 3MG1A 1IYYA 4X2HA 5D81A 4EYCA 3CCQ3 2C11A 3N54B 1DVCA 1A2KA 2ML5A 3G4S3 3CCM3 5M18A 1I70A 4K1VA 1VQK3 5BVBA 1F8NA 1C7HA 2W56B 1FYSA 4RNYA 2CG1A 2XSOB 1I2FA 3B4OA 1B3SA 1PU4A 4GL6A 2XF3A 1O7GB 3X3ZA 1GSPA 1FGQA 1DETA 4BL3A 1VQL3 3S28A 3ZG5A 1NB3I 1JNQA 1NWWA 3LOYA 5IERA 3F14A 1BRGA 1EA2A 1WTHA 2YX9A 1ZX2A 2IMJA 2QGUA 1X1YA 3QRDA 3WA2X 3G16A 3I563 5IG0A 3SOAA 1NB5I 3WMDA 5G1KA 5A0OB 2FNQA 1YJW3 2XGLA 3BLZA 1RRHA 2CFLA 1I3IA 4KT3B 4IT7A 3WODG 3WA3A 1MNLA 2CX1A 3K9MC 4FCMA 4FMAA 4CPKA 4DKIA 3CCE3 1B2MA 3FF2A 1WMPA 1MWUA 2H0GA 3KFQC 3MG3A 1C54A 3UL6A 3LTBA 1O7PB 1EG9B 2H0IA 4BTXA 2L1SA 1RGCA 4FMCA 1K9M4 1G96A 1N5HA 1G02A 1M1XB 2PNCA 1UCIA 3D3LA 3LTCA 3DGLA 3PGBA 3FGYA 1IK3A 4O02B 3V92A 4QWTA 4STDA 1O7NB 2BMRB 3T8NA 4EC6A 1OACA 3CC73 1B2UA 3NBBA 3PYJA 1HYFA 1Q42A 4FCJA 3LTDA 2C10A 1NU3A 3DGMA 6GSPA 1DVDA 2KF6A 1B20A 1JB2A 1WMNA 1RN7A 1LXEA 1TP6A 2WGQA 1BNIA 3Q90A 1FGRA 4RZMA 3WHOA 1D6ZA 1W01A 1ULJB 3D9RA 1Q7HA 1V57A 3ECFA 3NV0A 3NX0A 1OF5A 4R9LA 2F5MA 4OK0A 1ROVA 5KP1A 1QMAA 1YVBI 1BRHA 1G0TA 1W6YA 2BMQB 2RBIA 4HZBB 3SX1A 1A90A 1Z1SA 1O7MB 2CIUA 4O8SA 1BOXA 1QALA 1W4NA 2W56A 3X41A 3FSDA 4R1KA 3B8LA 3RDEA 1IQYA 1TU5A 4LSOA 1IV9A 3J7Yd 4NREA 2XFSA 1VQM3
chains in the Genus database with same CATH topology
1D6UA 3FG3A 2CFWA 1W2ZA 2BT3A 4AKZA 3MHEA 1YIT3 3KN4A 2K0MA 3NXJA 3I0YA 3MPHA 2OWPA 1YJN3 3V98A 1TIJA 1VQN3 2YFLB 3NQYA 3PZWA 3SLUA 4H61A 3KE7A 3NM2A 3LXUX 4RBNA 1CYUA 1ISKA 4LZIA 2CW9A 4FMDA 2GBXB 4N6V0 2IUJA 2RFRA 2RCDA 5IW9A 1EKMA 5JPPA 4WFOA 1IT8A 4HJLB 3CCL3 1CEWI 3UJMA 3DGOA 1U8CB 1Q7Y4 5KP3A 3PS8A 5LC7A 4MMYB 3BNDA 4ORLA 1W7CA 1AV4A 1UW1A 3X40A 4HYZA 3LH4A 4R9KA 2LYXA 3HX8A 3G713 3LTAA 1Q814 8CHOA 1GY5A 3F7SA 2CWUA 2RGQA 2F98A 3FG4A 3N8BA 3UB1A 1ZO2A 2Q07A 4HM4B 4K61A 5D82A 2XH9A 3UNLA 1FA3A 2CHCA 2HMNB 1O7HB 3E99A 5G2GA 1T5YA 2RSXA 4FMBA 4HKVB 4HM1B 3CC23 1CQSA 4CDLA 2D42A 2UX0A 3OX9A 4WYKB 3SVAA 1KQS2 3K5TA 4R80A 3T8UA 2K54A 2MF7A 1IQ8A 3PXMA 2GEYA 3LYGA 2CKFB 1WNHA 1J2BA 1GY7A 4H3UA 2P09A 2W9QA 4XBYA 4LGQA 1FGMA 1U5OA 4O2HA 2CFKA 3EF8A 5ELUA 1M9GA 1FUWA 1IQXA 3CD63 1GS3A 3SEDA 3PCSA 3EN1B 4KFDA 4MJDA 5CK6A 3JUMA 3OWUA 3CPOA 2CFDA 3A76A 4I4KA 3Q2PA 5IF6A 2BO9B 1GY6A 5STDA 1GD4A 1IDPA 1K28A 3LZAA 5TGNA 2BMOB 3FH1A 1N9JA 1KD14 1O7WB 2A15A 1AR0A 2W2CA 3G0KA 5AIGA 1YIJ3 3CNMA 3CMA3 1IT7A 3IMAB 1VQ73 2HMMB 2ZL8A 2GXFA 1BUQA 3BNEA 3OWSA 1DMNA 5CF2A 1MOLA 4WWUC 3QK9A 3IPTA 4G1MB 3CCV3 2XEPA 1WMOA 5IEPA 1S5AA 3GZYB 3BB9A 3EBYA 2JQ5A 3HZPA 4HM2B 3VSYA 2CWVA 2P05A 5I97A 3OW22 4K90B 1M1K4 1OHOA 3U97A 1ASKA 1GD3A 2XRXB 5DRVA 5AIIA 4L8OA 3T0UA 3S67A 5JBSA 1OGXA 4PEJA 2Z7AA 3FCSB 2IUKA 1JV2B 4L7KA 1N5PA 2P0MA 2O3OA 5IG3A 2XSHB 4MEIA 2F99A 1SJWA 3LT8A 4WYKA 4KFEA 1SIHA 3S5CA 1OGZA 4CCVA 4KVHA 3NQZA 3FF0A 2ML6A 5LC6A 3OV4A 5AEUB 1V74A 2W6JH 2W9PA 1QVG2 1JJ22 1IVVA 1TFOA 5EQLA 3DY5A 1DMQA 1JKGB 4HM7B 1A2VA 3HK4A 3V99A 1E3RA 1NO3A 4BTYA 3LMLA 1LNHA 1JB4A 1N9EA 4N6LA 6STDA 1OCVA 1OPYA 1OHSA 3HIGA 1OUNA 2R4IA 1GYBA 2Z6BA 4EXRA 3CCR3 2CK3H 1KC84 2B1XB 3F8HA 5CLKA 1K8A4 3UL5A 2I9WA 2XR8B 3ALAA 1ROAA 3JUPA 2M7OA 5IG4A 3JUOA 2OOVA 4HM0B 1YGEA 4HZ9B 3EX9A 3JUNA 1K41A 3DZLA 4MMXB 1AVLA 4XDWA 4RNZA 5IENA 4N6MA 2O9UX 1CYVA 1Q864 3S27A 3STDA 1STDA 3X42A 4LEHA 2W04A 3EJVA 1N8QA 1IVXA 2YFIB 3GAXA 3VGNA 1S723 1K734 3GZBA 1QAKA 3CPW2 1TUHA 3X3YA 3KSPA 1N8R4 4WP5A 3VF1A 3FKAA 3CC43 3JUQA 2CG0A 3K7CA 2HMOB 3ER7A 3WOEB 3PCRA 2Y74A 5AIHA 1E97A 3H51A 1JB5A 2V1LA 3G8ZA 3H3HA 4J8TA 4TX4A 2MC8A 2SBLA 3SXXA 5AEWB 3CCS3 1D6YA 4EV5A 2E2TA 3F9SA 4N6OB 2KCDA 2OQEA 3Q1CA 3DMCA 5HGRA 3B4PA 1OH0A 2GEXA 5CXOA 5CF1A 1DYUA 1FGOA 3AMOB 4N6TA 2QA43 3NBRA 1KWIA 4EV2A 2CWTA 1JKGA 4GB5A 3EHCA 2WOFA 3HI7A 1NDOB 3MSOA 1QVF2 3SOYA 2WGOA 3RGAA 4JRFA 5AIFA 1YI23 1EQKA 1Y4KA 1LVNA 1Q824 2GU3A 4HM5B 1JN5B 2FXTA 3EN8A 3CME3 3CCU3 1Q40B 3KSED 1HKXA 5FGOA 3GWRA 2FGTA 3MWZA 4OVMA 2QEX3 1VQ93 3F40A 5EEOA 3MYTA 5IEOA 1IU7A 1STFI 3CCJ3 3G6E3 1W2B2 1E3VA 4XBXA 4HBRA 2HMKB 2STDA 3U1WA 5ELJA 2P38A 5KP4A 3CNXA 1AVKA 2HMJB 3KIIA 1ULIB 1KSIA 1UUVB 3CU3A 1VZZA 4LMIA 3JVCA 5BXQA 1SPUA 1W02A 4FCZA 4WHAA 3S29A 3DGNA 3EB8A 2BHMA 2D1WA 2OOVC 4HM8B 1TFKA 3I553 2LQVA 4EBGA 3CXC2 2YFJB 4XB5A 2CH9A 4HM6B 2OTJ3 4KZ1A 3OWYA 1FGTA 4O3VA 5AYSC 3WOFB 1IVWA 4Q53A 3FZWA 5JPUA 1VQO3 1UUWB 3EC9A 5AYRB 4BTWA 3FLJA 4JF8A 3WDGB 1VQ43 2INXA 4FR9A 1QAFA 2QIYA 3AMOA 3K63A 4IIAA 4AKYA 4N6NB 1RJOA 1NJI4 1WQLB 1YHQ3 4OUQA 4XDVA 1W00A 1RKYA 3HIIA 1JRQA 2E2VA 1A67A 2E2UA 2OQEC 4J9AA 5AI1A 2WO0A 1VQ83 2IA7A 3FG1A 3RGRA 5DREA 4ZM8A 3TDGA 3O8YA 1JN5A 4L8PA 3KZTA 3EE1A 3EBTA 1YJ93 1Q40A 1QJGA 1W5ZA 3B7CA 2Y73A 4AEQA 2JDIH 2PZVA 2GBWB 2KRTA 3GZXB 1DMMA 2BNGA 3IJEB 1SQWA 4K1UA 4MMZB 1SIIA 2KXGA 4X2OA 4XBTA 3EQQB 3MG2A 1LOXA 2P0XA 4NHFA 1RRLA 3DXOA 3GRDA 3ROBA 4N3VA 5EVHA 1VQ63 2HMLB 3NBJA 2Z77A 1OHPA 3KKGA 3K0ZA 3BNCA 1IV7A 3M8CA 2B24B 3L0RA 3MKIA 2XFTA 5IG5A 2XGNA 7STDA 2ZDJA 1L5GB 2W03A 3N9HA 3BNBA 3F8XA 2OTL3 1VQP3 2GU1A 2L4VA 2W0QA 2Z76A 4HM3B 3DM8A 3GZRA 2CC3A 3F7XA 4HVNA 4R4KA 2WOHA 3OXAA 1W6CA 1R4CA 1UI8A 4XM4A 4U13A 2F86B 5FW5A 4N6UA 4IPBA 1M904 1VQ53 1W6GA 1PFPA 1UI7A 3LT9A 3X3XA 1IVUA 4KFFA 1US1A 3NM7A 1HU9A 2CFGA 3NUVA 1OF5B 3NV0B 3DUKA 2OCTA 5D83A 3NHXA 3MG1A 4X2HA 5D81A 4EYCA 3CCQ3 2C11A 3N54B 1DVCA 1A2KA 2ML5A 3G4S3 3CCM3 1VQK3 4K1VA 5BVBA 1F8NA 1C7HA 2W56B 4RNYA 2CG1A 2XSOB 3B4OA 1PU4A 4GL6A 2XF3A 1O7GB 3X3ZA 1FGQA 1VQL3 3S28A 1NB3I 1JNQA 1NWWA 3LOYA 5IERA 3F14A 1EA2A 1WTHA 2YX9A 1ZX2A 2IMJA 2QGUA 3QRDA 3WA2X 3I563 3G16A 5IG0A 3SOAA 1NB5I 3WMDA 5A0OB 2FNQA 1YJW3 2XGLA 3BLZA 1RRHA 2CFLA 3WODG 4IT7A 3WA3A 1MNLA 3K9MC 4FCMA 4FMAA 3CCE3 3FF2A 1WMPA 3KFQC 3MG3A 3UL6A 3LTBA 1O7PB 1EG9B 4BTXA 4FMCA 1K9M4 1G96A 1N5HA 2PNCA 1M1XB 3D3LA 3LTCA 3PGBA 3DGLA 3FGYA 1IK3A 4O02B 3V92A 4QWTA 4STDA 1O7NB 2BMRB 3T8NA 4EC6A 1OACA 3CC73 3NBBA 3PYJA 1Q42A 4FCJA 3LTDA 2C10A 1NU3A 3DGMA 1DVDA 1JB2A 1WMNA 1RN7A 1LXEA 1TP6A 2WGQA 3Q90A 1FGRA 4RZMA 1D6ZA 1W01A 1ULJB 3D9RA 3ECFA 3NV0A 3NX0A 1OF5A 4R9LA 4OK0A 1ROVA 5KP1A 1QMAA 1YVBI 1W6YA 3SX1A 2BMQB 4HZBB 1A90A 1Z1SA 1O7MB 2CIUA 4O8SA 1QALA 1W4NA 2W56A 3X41A 3FSDA 4R1KA 3B8LA 3RDEA 1IQYA 1TU5A 4LSOA 1IV9A 3J7Yd 4NREA 2XFSA 1VQM3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFO A;  1V74 A;  1TFK A; 
#chains in the Genus database with same CATH topology
 1D6U A;  1BRS A;  3FG3 A;  2CFW A;  3DH2 A;  1W2Z A;  2BT3 A;  4AKZ A;  3MHE A;  1YIT 3;  1I0X A;  3KN4 A;  2K0M A;  1UUG B;  3NXJ A;  3I0Y A;  3MPH A;  1UCJ A;  2OWP A;  1YJN 3;  3V98 A;  1TIJ A;  1VQN 3;  1LQG C;  2YFL B;  3NQY A;  3PZW A;  3SLU A;  4H61 A;  3KE7 A;  3NM2 A;  3LXU X;  4RBN A;  1CYU A;  1ISK A;  4LZI A;  2CW9 A;  4FMD A;  2GBX B;  4N6V 0;  2IUJ A;  2RFR A;  2RCD A;  5IW9 A;  1EKM A;  5JPP A;  1RSN A;  1I2G A;  1I0V A;  4HOH A;  2F56 A;  1LOV A;  2H0H A;  4WFO A;  1LOY A;  1IT8 A;  4HJL B;  3CCL 3;  1CEW I;  3UJM A;  3DGO A;  1U8C B;  1Q7Y 4;  5KP3 A;  3PS8 A;  5LC7 A;  1GOU A;  4MMY B;  3BND A;  1SAR A;  4ORL A;  5GSP A;  1W7C A;  1AV4 A;  1UW1 A;  3X40 A;  4HYZ A;  3LH4 A;  4R9K A;  1FW7 A;  4I5Q A;  2LYX A;  3HX8 A;  1BNF A;  3G71 3;  3LTA A;  1ZGX A;  1RMS A;  3D79 A;  1Q81 4;  8CHO A;  1YVS A;  3ZFZ A;  1GY5 A;  2CX0 A;  2CWU A;  3F7S A;  1JBR A;  2RGQ A;  1EEJ A;  2F98 A;  1BRI A;  1X1W A;  3FG4 A;  3N8B A;  1Q9E A;  1RLS A;  1ZO2 A;  2Q07 A;  4HM4 B;  2XH9 A;  4K61 A;  5D82 A;  3URP A;  3UNL A;  1RNB A;  1FA3 A;  1MGW A;  1BNR A;  1T2I A;  2CHC A;  2HMN B;  1O7H B;  3E99 A;  5G2G A;  1T5Y A;  2RSX A;  4FMB A;  4HKV B;  1LRA A;  4HM1 B;  3CC2 3;  1CQS A;  4CDL A;  2D42 A;  2UX0 A;  5BIR A;  3OX9 A;  4WYK B;  1FUS A;  3SVA A;  2KF3 A;  3AGO A;  3K5T A;  1KQS 2;  4R80 A;  3T8U A;  2K54 A;  2MF7 A;  1IQ8 A;  3PXM A;  2GEY A;  3LYG A;  2CKF B;  1BUJ A;  1WNH A;  1J2B A;  1GY7 A;  4H3U A;  2P09 A;  2W9Q A;  1RDS A;  4XBY A;  4LGQ A;  1I8V A;  1FGM A;  1GOV A;  1U5O A;  4O2H A;  2CFK A;  3EF8 A;  1BSA A;  1BSD A;  1M9G A;  1IQX A;  2HOH A;  5ELU A;  3CD6 3;  1GS3 A;  3D4A A;  3SED A;  3PCS A;  3EN1 B;  4KFD A;  4MJD A;  5CK6 A;  3JUM A;  3OWU A;  3CPO A;  2CFD A;  3A76 A;  4I4K A;  3Q2P A;  5IF6 A;  1YNV X;  1RGE A;  2BO9 B;  1BSE A;  1GY6 A;  5STD A;  1GD4 A;  1B27 A;  1IDP A;  1K28 A;  1LQM B;  3LZA A;  5TGN A;  2BMO B;  3FH1 A;  1BAO A;  2KF5 A;  1N9J A;  1KD1 4;  1O7W B;  2A15 A;  1AR0 A;  2W2C A;  3G0K A;  5AIG A;  1YIJ 3;  3CNM A;  3CMA 3;  1IT7 A;  3IMA B;  4BIR A;  1VQ7 3;  2HMM B;  2ZL8 A;  2GXF A;  1BUQ A;  3BNE A;  3OWS A;  1DMN A;  5CF2 A;  1MOL A;  4WWU C;  3QK9 A;  3IPT A;  4G1M B;  3CCV 3;  2XEP A;  1TRP A;  1WMO A;  1FUW A;  1JZO A;  5IEP A;  1S5A A;  3DGY A;  3GZY B;  3BB9 A;  3EBY A;  2JQ5 A;  3HZP A;  1I2E A;  2R41 A;  1TJD A;  4HM2 B;  3VSY A;  2CWV A;  2P05 A;  5HOH A;  5I97 A;  3OW2 2;  4K90 B;  1M1K 4;  1OHO A;  3U97 A;  4GSP A;  1ASK A;  1GD3 A;  2XRX B;  5DRV A;  1UGH I;  1GOY A;  5AII A;  4L8O A;  3T0U A;  3S67 A;  5JBS A;  1VQQ A;  1OGX A;  4PEJ A;  2Z7A A;  3FCS B;  2IUK A;  4LYL B;  1JV2 B;  4L7K A;  1N5P A;  2P0M A;  3KCH A;  2O3O A;  3GSP A;  7GSP A;  5IG3 A;  2XSH B;  2UUG C;  4MEI A;  1V58 A;  2F99 A;  1SJW A;  3LT8 A;  4WYK A;  4KFE A;  1SIH A;  3S5C A;  1OGZ A;  1BU4 A;  4CCV A;  4KVH A;  3NQZ A;  3FF0 A;  2ML6 A;  4J5K A;  5LC6 A;  1JBS A;  3OV4 A;  6RNT A;  1RCK A;  5AEU B;  1V74 A;  2W6J H;  2W9P A;  1QVG 2;  1JJ2 2;  1IVV A;  1TFO A;  5EQL A;  3DY5 A;  1DMQ A;  1JKG B;  4HM7 B;  1A2V A;  1UGI A;  3HK4 A;  3V99 A;  1E3R A;  1ZS7 A;  1NO3 A;  2J8X B;  4BTY A;  5M19 A;  3LML A;  1LNH A;  1JB4 A;  1N9E A;  4N6L A;  6STD A;  1OCV A;  1OPY A;  1OHS A;  3HIG A;  1OUN A;  3ZG0 A;  2R4I A;  1GYB A;  2Z6B A;  4EXR A;  3CCR 3;  2CK3 H;  1KC8 4;  2B1X B;  3F8H A;  1RHL A;  3UB1 A;  3SYU A;  5CLK A;  1K8A 4;  1RN1 A;  1BSC A;  1T2H A;  3UL5 A;  9RNT A;  1MWR A;  2I9W A;  2XR8 B;  3ALA A;  1GMQ A;  1ROA A;  3JUP A;  2M7O A;  3AHS A;  5IG4 A;  3JUO A;  2OOV A;  4HM0 B;  1YGE A;  4HZ9 B;  3EX9 A;  3JUN A;  1BRK A;  1K41 A;  3DZL A;  3RNT A;  1I3F A;  4MMX B;  1AVL A;  2KAA A;  4XDW A;  2F4Y A;  4RNZ A;  5IEN A;  4N6M A;  2O9U X;  1CYV A;  1Q86 4;  1BNS A;  3S27 A;  3STD A;  1STD A;  4RNT A;  3X42 A;  4LEH A;  2W04 A;  3EJV A;  1N8Q A;  1IVX A;  2YFI B;  1RGF A;  3GAX A;  3VGN A;  1S72 3;  1K73 4;  3GZB A;  1QAK A;  2RNT A;  3CPW 2;  1TUH A;  3X3Y A;  1BGS A;  3KSP A;  1N8R 4;  4WP5 A;  4J5G A;  4ILF A;  2KF4 A;  3VF1 A;  3FKA A;  1MGR A;  3CC4 3;  3JUQ A;  2CG0 A;  3K7C A;  2HMO B;  1TRQ A;  3ER7 A;  3WOE B;  3PCR A;  5G1L A;  2Y74 A;  5AIH A;  1E97 A;  3D5I A;  3H51 A;  1JB5 A;  2V1L A;  3G8Z A;  3H3H A;  4J8T A;  4TX4 A;  2MC8 A;  2SBL A;  3SXX A;  5AEW B;  3CCS 3;  1D6Y A;  4GHO A;  4EV5 A;  2E2T A;  2C4B A;  3F9S A;  4N6O B;  2KCD A;  1UDI I;  2OQE A;  3Q1C A;  3DMC A;  5HGR A;  3B4P A;  4HAA A;  1BNJ A;  1X1U A;  1OH0 A;  2GEX A;  5CXO A;  5CF1 A;  1DYU A;  1FGO A;  3AMO B;  4N6T A;  1FZU A;  2QA4 3;  3NBR A;  1KWI A;  4EV2 A;  2CWT A;  1JKG A;  1RGK A;  4GB5 A;  3EHC A;  2WOF A;  3HI7 A;  1NDO B;  3MSO A;  1QVF 2;  3BU4 A;  3WR2 A;  3SOY A;  2WGO A;  3RGA A;  4JRF A;  5AIF A;  1YI2 3;  2ZHX B;  1EQK A;  1Y4K A;  1LVN A;  1BIR A;  5BU4 A;  1Q82 4;  1JBT A;  2GU3 A;  4HM5 B;  1JN5 B;  2FXT A;  3EN8 A;  1B2S A;  3CME 3;  3CCU 3;  1Q40 B;  3KSE D;  1HKX A;  5FGO A;  3GWR A;  2FGT A;  1RCL A;  3MWZ A;  1RGA A;  4OVM A;  2QEX 3;  1VQ9 3;  3F40 A;  5EEO A;  3MYT A;  1FUT A;  1IU7 A;  1STF I;  5IEO A;  3CCJ 3;  3G6E 3;  1W2B 2;  1E3V A;  1BRJ A;  4XBX A;  4HBR A;  4BU4 A;  2HMK B;  2STD A;  3U1W A;  5ELJ A;  2P38 A;  5KP4 A;  3CNX A;  1AVK A;  2HMJ B;  3KII A;  1ULI B;  1KSI A;  1UUV B;  1BRN L;  3CU3 A;  1VZZ A;  4LMI A;  3JVC A;  1AY7 A;  4CJN A;  5BXQ A;  1SPU A;  1W02 A;  4FCZ A;  4WHA A;  3S29 A;  1GMR A;  3DGN A;  3EB8 A;  2BHM A;  1BSB A;  2D1W A;  2OOV C;  4HM8 B;  1RTU A;  1TFK A;  3I55 3;  2LQV A;  1RN4 A;  3A5E A;  4EBG A;  3CXC 2;  1B21 A;  1JZD A;  2YFJ B;  4XB5 A;  2AAE A;  2CH9 A;  4HM6 B;  2OTJ 3;  1B2X A;  4KZ1 A;  4EW5 A;  3OWY A;  1BVI A;  2AAD A;  1FGT A;  4O3V A;  5AYS C;  3WOF B;  1IVW A;  4Q53 A;  3FZW A;  1T3B A;  2IYJ A;  1UUW B;  3EC9 A;  5AYR B;  4BTW A;  5JPU A;  1PY3 A;  1VQO 3;  3FLJ A;  4JF8 A;  1MWS A;  3WDG B;  1VQ4 3;  2INX A;  4FR9 A;  1QAF A;  2QIY A;  3AMO A;  8RNT A;  3K63 A;  4IIA A;  1X1X A;  1R4Y A;  4AKY A;  4N6N B;  1RJO A;  1NJI 4;  1WQL B;  2BU4 A;  1YHQ 3;  1MWT A;  4OUQ A;  4XDV A;  1W00 A;  1RKY A;  1RGH A;  1DE3 A;  3HII A;  1JRQ A;  1GMP A;  1BNE A;  2E2V A;  1A67 A;  2E2U A;  2OQE C;  4J9A A;  5AI1 A;  2WO0 A;  1VQ8 3;  2IA7 A;  3FG1 A;  3RGR A;  5DRE A;  4ZM8 A;  3TDG A;  3O8Y A;  1RNT A;  1UCK A;  1JN5 A;  4L8P A;  3KZT A;  3EE1 A;  3EBT A;  1YJ9 3;  1Q40 A;  1QJG A;  1W5Z A;  3B7C A;  2Y73 A;  1LOW A;  2F5W A;  2JDI H;  2GBW B;  2KRT A;  2PZV A;  3GZX B;  4AEQ A;  1DMM A;  2BNG A;  3IJE B;  1SQW A;  2K3D A;  2SAR A;  4K1U A;  4MMZ B;  1SII A;  1RGL A;  2KXG A;  4X2O A;  1TTO A;  4XBT A;  3EQQ B;  3MG2 A;  1EUI C;  1LOX A;  2P0X A;  4NHF A;  5RNT A;  3Q3F A;  7RNT A;  1RRL A;  3DXO A;  3GRD A;  3ROB A;  4N3V A;  5EVH A;  1VQ6 3;  2IY2 A;  2HML B;  3NBJ A;  2Z77 A;  1OHP A;  3AGN A;  1CH0 A;  1BAN A;  2BIR A;  3KKG A;  1YGW A;  3K0Z A;  3BNC A;  1IV7 A;  1B2Z A;  2B24 B;  1AQZ A;  3M8C A;  1LNI A;  3L0R A;  2XFT A;  2ZA4 A;  3MKI A;  1UCL A;  3HOH A;  5IG5 A;  2UGI A;  2XGN A;  7STD A;  2ZDJ A;  3AHW A;  1L5G B;  2W03 A;  3N9H A;  3BNB A;  4BL2 A;  3F8X A;  2OTL 3;  1VQP 3;  2GU1 A;  2L4V A;  2W0Q A;  2Z76 A;  4HM3 B;  1HZ1 A;  3DM8 A;  3GZR A;  1PYL A;  5M1A A;  3BIR A;  2CC3 A;  1NNV A;  3F7X A;  4HVN A;  4R4K A;  3D5G A;  2WOH A;  3OXA A;  4NPB A;  1W6C A;  1R4C A;  1UI8 A;  1A2P A;  4XM4 A;  4U13 A;  2F86 B;  5FW5 A;  2GSP A;  4N6U A;  4IPB A;  1M90 4;  1VQ5 3;  1W6G A;  1PFP A;  1UI7 A;  3LT9 A;  3X3X A;  1IVU A;  4KFF A;  1BNG A;  1US1 A;  3NM7 A;  1HU9 A;  2CFG A;  3NUV A;  1OF5 B;  3NV0 B;  1RGG A;  2OCT A;  3DUK A;  5D83 A;  3NHX A;  3MG1 A;  1IYY A;  4X2H A;  5D81 A;  4EYC A;  3CCQ 3;  2C11 A;  3N54 B;  1DVC A;  1A2K A;  2ML5 A;  3G4S 3;  3CCM 3;  5M18 A;  1I70 A;  4K1V A;  1VQK 3;  5BVB A;  1F8N A;  1C7H A;  2W56 B;  1FYS A;  4RNY A;  2CG1 A;  2XSO B;  1I2F A;  3B4O A;  1B3S A;  1PU4 A;  4GL6 A;  2XF3 A;  1O7G B;  3X3Z A;  1GSP A;  1FGQ A;  1DET A;  4BL3 A;  1VQL 3;  3S28 A;  3ZG5 A;  1NB3 I;  1JNQ A;  1NWW A;  3LOY A;  5IER A;  3F14 A;  1BRG A;  1EA2 A;  1WTH A;  2YX9 A;  1ZX2 A;  2IMJ A;  2QGU A;  1X1Y A;  3QRD A;  3WA2 X;  3G16 A;  3I56 3;  5IG0 A;  3SOA A;  1NB5 I;  3WMD A;  5G1K A;  5A0O B;  2FNQ A;  1YJW 3;  2XGL A;  3BLZ A;  1RRH A;  2CFL A;  1I3I A;  4KT3 B;  4IT7 A;  3WOD G;  3WA3 A;  1MNL A;  2CX1 A;  3K9M C;  4FCM A;  4FMA A;  4CPK A;  4DKI A;  3CCE 3;  1B2M A;  3FF2 A;  1WMP A;  1MWU A;  2H0G A;  3KFQ C;  3MG3 A;  1C54 A;  3UL6 A;  3LTB A;  1O7P B;  1EG9 B;  2H0I A;  4BTX A;  2L1S A;  1RGC A;  4FMC A;  1K9M 4;  1G96 A;  1N5H A;  1G02 A;  1M1X B;  2PNC A;  1UCI A;  3D3L A;  3LTC A;  3DGL A;  3PGB A;  3FGY A;  1IK3 A;  4O02 B;  3V92 A;  4QWT A;  4STD A;  1O7N B;  2BMR B;  3T8N A;  4EC6 A;  1OAC A;  3CC7 3;  1B2U A;  3NBB A;  3PYJ A;  1HYF A;  1Q42 A;  4FCJ A;  3LTD A;  2C10 A;  1NU3 A;  3DGM A;  6GSP A;  1DVD A;  2KF6 A;  1B20 A;  1JB2 A;  1WMN A;  1RN7 A;  1LXE A;  1TP6 A;  2WGQ A;  1BNI A;  3Q90 A;  1FGR A;  4RZM A;  3WHO A;  1D6Z A;  1W01 A;  1ULJ B;  3D9R A;  1Q7H A;  1V57 A;  3ECF A;  3NV0 A;  3NX0 A;  1OF5 A;  4R9L A;  2F5M A;  4OK0 A;  1ROV A;  5KP1 A;  1QMA A;  1YVB I;  1BRH A;  1G0T A;  1W6Y A;  2BMQ B;  2RBI A;  4HZB B;  3SX1 A;  1A90 A;  1Z1S A;  1O7M B;  2CIU A;  4O8S A;  1BOX A;  1QAL A;  1W4N A;  2W56 A;  3X41 A;  3FSD A;  4R1K A;  3B8L A;  3RDE A;  1IQY A;  1TU5 A;  4LSO A;  1IV9 A;  3J7Y d;  4NRE A;  2XFS A;  1VQM 3; 
#chains in the Genus database with same CATH homology
 1D6U A;  3FG3 A;  2CFW A;  1W2Z A;  2BT3 A;  4AKZ A;  3MHE A;  1YIT 3;  3KN4 A;  2K0M A;  3NXJ A;  3I0Y A;  3MPH A;  2OWP A;  1YJN 3;  3V98 A;  1TIJ A;  1VQN 3;  2YFL B;  3NQY A;  3PZW A;  3SLU A;  4H61 A;  3KE7 A;  3NM2 A;  3LXU X;  4RBN A;  1CYU A;  1ISK A;  4LZI A;  2CW9 A;  4FMD A;  2GBX B;  4N6V 0;  2IUJ A;  2RFR A;  2RCD A;  5IW9 A;  1EKM A;  5JPP A;  4WFO A;  1IT8 A;  4HJL B;  3CCL 3;  1CEW I;  3UJM A;  3DGO A;  1U8C B;  1Q7Y 4;  5KP3 A;  3PS8 A;  5LC7 A;  4MMY B;  3BND A;  4ORL A;  1W7C A;  1AV4 A;  1UW1 A;  3X40 A;  4HYZ A;  3LH4 A;  4R9K A;  2LYX A;  3HX8 A;  3G71 3;  3LTA A;  1Q81 4;  8CHO A;  1GY5 A;  3F7S A;  2CWU A;  2RGQ A;  2F98 A;  3FG4 A;  3N8B A;  3UB1 A;  1ZO2 A;  2Q07 A;  4HM4 B;  4K61 A;  5D82 A;  2XH9 A;  3UNL A;  1FA3 A;  2CHC A;  2HMN B;  1O7H B;  3E99 A;  5G2G A;  1T5Y A;  2RSX A;  4FMB A;  4HKV B;  4HM1 B;  3CC2 3;  1CQS A;  4CDL A;  2D42 A;  2UX0 A;  3OX9 A;  4WYK B;  3SVA A;  1KQS 2;  3K5T A;  4R80 A;  3T8U A;  2K54 A;  2MF7 A;  1IQ8 A;  3PXM A;  2GEY A;  3LYG A;  2CKF B;  1WNH A;  1J2B A;  1GY7 A;  4H3U A;  2P09 A;  2W9Q A;  4XBY A;  4LGQ A;  1FGM A;  1U5O A;  4O2H A;  2CFK A;  3EF8 A;  5ELU A;  1M9G A;  1FUW A;  1IQX A;  3CD6 3;  1GS3 A;  3SED A;  3PCS A;  3EN1 B;  4KFD A;  4MJD A;  5CK6 A;  3JUM A;  3OWU A;  3CPO A;  2CFD A;  3A76 A;  4I4K A;  3Q2P A;  5IF6 A;  2BO9 B;  1GY6 A;  5STD A;  1GD4 A;  1IDP A;  1K28 A;  3LZA A;  5TGN A;  2BMO B;  3FH1 A;  1N9J A;  1KD1 4;  1O7W B;  2A15 A;  1AR0 A;  2W2C A;  3G0K A;  5AIG A;  1YIJ 3;  3CNM A;  3CMA 3;  1IT7 A;  3IMA B;  1VQ7 3;  2HMM B;  2ZL8 A;  2GXF A;  1BUQ A;  3BNE A;  3OWS A;  1DMN A;  5CF2 A;  1MOL A;  4WWU C;  3QK9 A;  3IPT A;  4G1M B;  3CCV 3;  2XEP A;  1WMO A;  5IEP A;  1S5A A;  3GZY B;  3BB9 A;  3EBY A;  2JQ5 A;  3HZP A;  4HM2 B;  3VSY A;  2CWV A;  2P05 A;  5I97 A;  3OW2 2;  4K90 B;  1M1K 4;  1OHO A;  3U97 A;  1ASK A;  1GD3 A;  2XRX B;  5DRV A;  5AII A;  4L8O A;  3T0U A;  3S67 A;  5JBS A;  1OGX A;  4PEJ A;  2Z7A A;  3FCS B;  2IUK A;  1JV2 B;  4L7K A;  1N5P A;  2P0M A;  2O3O A;  5IG3 A;  2XSH B;  4MEI A;  2F99 A;  1SJW A;  3LT8 A;  4WYK A;  4KFE A;  1SIH A;  3S5C A;  1OGZ A;  4CCV A;  4KVH A;  3NQZ A;  3FF0 A;  2ML6 A;  5LC6 A;  3OV4 A;  5AEU B;  1V74 A;  2W6J H;  2W9P A;  1QVG 2;  1JJ2 2;  1IVV A;  1TFO A;  5EQL A;  3DY5 A;  1DMQ A;  1JKG B;  4HM7 B;  1A2V A;  3HK4 A;  3V99 A;  1E3R A;  1NO3 A;  4BTY A;  3LML A;  1LNH A;  1JB4 A;  1N9E A;  4N6L A;  6STD A;  1OCV A;  1OPY A;  1OHS A;  3HIG A;  1OUN A;  2R4I A;  1GYB A;  2Z6B A;  4EXR A;  3CCR 3;  2CK3 H;  1KC8 4;  2B1X B;  3F8H A;  5CLK A;  1K8A 4;  3UL5 A;  2I9W A;  2XR8 B;  3ALA A;  1ROA A;  3JUP A;  2M7O A;  5IG4 A;  3JUO A;  2OOV A;  4HM0 B;  1YGE A;  4HZ9 B;  3EX9 A;  3JUN A;  1K41 A;  3DZL A;  4MMX B;  1AVL A;  4XDW A;  4RNZ A;  5IEN A;  4N6M A;  2O9U X;  1CYV A;  1Q86 4;  3S27 A;  3STD A;  1STD A;  3X42 A;  4LEH A;  2W04 A;  3EJV A;  1N8Q A;  1IVX A;  2YFI B;  3GAX A;  3VGN A;  1S72 3;  1K73 4;  3GZB A;  1QAK A;  3CPW 2;  1TUH A;  3X3Y A;  3KSP A;  1N8R 4;  4WP5 A;  3VF1 A;  3FKA A;  3CC4 3;  3JUQ A;  2CG0 A;  3K7C A;  2HMO B;  3ER7 A;  3WOE B;  3PCR A;  2Y74 A;  5AIH A;  1E97 A;  3H51 A;  1JB5 A;  2V1L A;  3G8Z A;  3H3H A;  4J8T A;  4TX4 A;  2MC8 A;  2SBL A;  3SXX A;  5AEW B;  3CCS 3;  1D6Y A;  4EV5 A;  2E2T A;  3F9S A;  4N6O B;  2KCD A;  2OQE A;  3Q1C A;  3DMC A;  5HGR A;  3B4P A;  1OH0 A;  2GEX A;  5CXO A;  5CF1 A;  1DYU A;  1FGO A;  3AMO B;  4N6T A;  2QA4 3;  3NBR A;  1KWI A;  4EV2 A;  2CWT A;  1JKG A;  4GB5 A;  3EHC A;  2WOF A;  3HI7 A;  1NDO B;  3MSO A;  1QVF 2;  3SOY A;  2WGO A;  3RGA A;  4JRF A;  5AIF A;  1YI2 3;  1EQK A;  1Y4K A;  1LVN A;  1Q82 4;  2GU3 A;  4HM5 B;  1JN5 B;  2FXT A;  3EN8 A;  3CME 3;  3CCU 3;  1Q40 B;  3KSE D;  1HKX A;  5FGO A;  3GWR A;  2FGT A;  3MWZ A;  4OVM A;  2QEX 3;  1VQ9 3;  3F40 A;  5EEO A;  3MYT A;  5IEO A;  1IU7 A;  1STF I;  3CCJ 3;  3G6E 3;  1W2B 2;  1E3V A;  4XBX A;  4HBR A;  2HMK B;  2STD A;  3U1W A;  5ELJ A;  2P38 A;  5KP4 A;  3CNX A;  1AVK A;  2HMJ B;  3KII A;  1ULI B;  1KSI A;  1UUV B;  3CU3 A;  1VZZ A;  4LMI A;  3JVC A;  5BXQ A;  1SPU A;  1W02 A;  4FCZ A;  4WHA A;  3S29 A;  3DGN A;  3EB8 A;  2BHM A;  2D1W A;  2OOV C;  4HM8 B;  1TFK A;  3I55 3;  2LQV A;  4EBG A;  3CXC 2;  2YFJ B;  4XB5 A;  2CH9 A;  4HM6 B;  2OTJ 3;  4KZ1 A;  3OWY A;  1FGT A;  4O3V A;  5AYS C;  3WOF B;  1IVW A;  4Q53 A;  3FZW A;  5JPU A;  1VQO 3;  1UUW B;  3EC9 A;  5AYR B;  4BTW A;  3FLJ A;  4JF8 A;  3WDG B;  1VQ4 3;  2INX A;  4FR9 A;  1QAF A;  2QIY A;  3AMO A;  3K63 A;  4IIA A;  4AKY A;  4N6N B;  1RJO A;  1NJI 4;  1WQL B;  1YHQ 3;  4OUQ A;  4XDV A;  1W00 A;  1RKY A;  3HII A;  1JRQ A;  2E2V A;  1A67 A;  2E2U A;  2OQE C;  4J9A A;  5AI1 A;  2WO0 A;  1VQ8 3;  2IA7 A;  3FG1 A;  3RGR A;  5DRE A;  4ZM8 A;  3TDG A;  3O8Y A;  1JN5 A;  4L8P A;  3KZT A;  3EE1 A;  3EBT A;  1YJ9 3;  1Q40 A;  1QJG A;  1W5Z A;  3B7C A;  2Y73 A;  4AEQ A;  2JDI H;  2PZV A;  2GBW B;  2KRT A;  3GZX B;  1DMM A;  2BNG A;  3IJE B;  1SQW A;  4K1U A;  4MMZ B;  1SII A;  2KXG A;  4X2O A;  4XBT A;  3EQQ B;  3MG2 A;  1LOX A;  2P0X A;  4NHF A;  1RRL A;  3DXO A;  3GRD A;  3ROB A;  4N3V A;  5EVH A;  1VQ6 3;  2HML B;  3NBJ A;  2Z77 A;  1OHP A;  3KKG A;  3K0Z A;  3BNC A;  1IV7 A;  3M8C A;  2B24 B;  3L0R A;  3MKI A;  2XFT A;  5IG5 A;  2XGN A;  7STD A;  2ZDJ A;  1L5G B;  2W03 A;  3N9H A;  3BNB A;  3F8X A;  2OTL 3;  1VQP 3;  2GU1 A;  2L4V A;  2W0Q A;  2Z76 A;  4HM3 B;  3DM8 A;  3GZR A;  2CC3 A;  3F7X A;  4HVN A;  4R4K A;  2WOH A;  3OXA A;  1W6C A;  1R4C A;  1UI8 A;  4XM4 A;  4U13 A;  2F86 B;  5FW5 A;  4N6U A;  4IPB A;  1M90 4;  1VQ5 3;  1W6G A;  1PFP A;  1UI7 A;  3LT9 A;  3X3X A;  1IVU A;  4KFF A;  1US1 A;  3NM7 A;  1HU9 A;  2CFG A;  3NUV A;  1OF5 B;  3NV0 B;  3DUK A;  2OCT A;  5D83 A;  3NHX A;  3MG1 A;  4X2H A;  5D81 A;  4EYC A;  3CCQ 3;  2C11 A;  3N54 B;  1DVC A;  1A2K A;  2ML5 A;  3G4S 3;  3CCM 3;  1VQK 3;  4K1V A;  5BVB A;  1F8N A;  1C7H A;  2W56 B;  4RNY A;  2CG1 A;  2XSO B;  3B4O A;  1PU4 A;  4GL6 A;  2XF3 A;  1O7G B;  3X3Z A;  1FGQ A;  1VQL 3;  3S28 A;  1NB3 I;  1JNQ A;  1NWW A;  3LOY A;  5IER A;  3F14 A;  1EA2 A;  1WTH A;  2YX9 A;  1ZX2 A;  2IMJ A;  2QGU A;  3QRD A;  3WA2 X;  3I56 3;  3G16 A;  5IG0 A;  3SOA A;  1NB5 I;  3WMD A;  5A0O B;  2FNQ A;  1YJW 3;  2XGL A;  3BLZ A;  1RRH A;  2CFL A;  3WOD G;  4IT7 A;  3WA3 A;  1MNL A;  3K9M C;  4FCM A;  4FMA A;  3CCE 3;  3FF2 A;  1WMP A;  3KFQ C;  3MG3 A;  3UL6 A;  3LTB A;  1O7P B;  1EG9 B;  4BTX A;  4FMC A;  1K9M 4;  1G96 A;  1N5H A;  2PNC A;  1M1X B;  3D3L A;  3LTC A;  3PGB A;  3DGL A;  3FGY A;  1IK3 A;  4O02 B;  3V92 A;  4QWT A;  4STD A;  1O7N B;  2BMR B;  3T8N A;  4EC6 A;  1OAC A;  3CC7 3;  3NBB A;  3PYJ A;  1Q42 A;  4FCJ A;  3LTD A;  2C10 A;  1NU3 A;  3DGM A;  1DVD A;  1JB2 A;  1WMN A;  1RN7 A;  1LXE A;  1TP6 A;  2WGQ A;  3Q90 A;  1FGR A;  4RZM A;  1D6Z A;  1W01 A;  1ULJ B;  3D9R A;  3ECF A;  3NV0 A;  3NX0 A;  1OF5 A;  4R9L A;  4OK0 A;  1ROV A;  5KP1 A;  1QMA A;  1YVB I;  1W6Y A;  3SX1 A;  2BMQ B;  4HZB B;  1A90 A;  1Z1S A;  1O7M B;  2CIU A;  4O8S A;  1QAL A;  1W4N A;  2W56 A;  3X41 A;  3FSD A;  4R1K A;  3B8L A;  3RDE A;  1IQY A;  1TU5 A;  4LSO A;  1IV9 A;  3J7Y d;  4NRE A;  2XFS A;  1VQM 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...