4XM4A

Structure of chaetomium mex67:mtr2 subunits
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
176
Chain Sequence
NVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSVVFATDSPQDPASSSCSKFSRNLNILSPRHPSTLQRLFVGSNLIADLWKVLPATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADISQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mex67
publication title Structural characterization of the principal mRNA-export factor Mex67-Mtr2 from Chaetomium thermophilum.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transport protein
total genus 39
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4xm4A00
4XDWA 2F86B 1W01A 4XBXA 3EC9A 1S5AA 1O7HB 2CKFB 5G2GA 3NM2A 1W6YA 5IG4A 3GZRA 5JPUA 1STDA 1JKGA 3D9RA 3JUNA 4HVNA 4XM4A 3H51A 2XSOB 1JN5A 3NBRA 3SOAA 4KVHA 2K54A 3MYTA 3LYGA 5AI1A 5D82A 4L8OA 4IIAA 1EA2A 3B4PA 1IDPA 3MKIA 4R1KA 4WYKA 1AR0A 2BMOB 1WQLB 3S5CA 3ECFA 1ISKA 4R9LA 2RFRA 1JKGB 3OWUA 3VGNA 4XBYA 3EN1B 4WWUC 3EBYA 3MG2A 3KZTA 3OX9A 2YFJB 3DMCA 3H3HA 2CHCA 4HM6B 2B24B 1JN5B 1ULIB 1GY6A 3B8LA 5JPPA 3JUMA 4MJDA 8CHOA 4OVMA 4HM1B 3GZYB 3F8XA 5BXQA 4WYKB 1U5OA 1GY5A 1OF5A 1W00A 1VZZA 3B4OA 1NDOB 2RCDA 2JQ5A 3A76A 2XR8B 3DZLA 2OWPA 3FSDA 3F7SA 1OHSA 5CF1A 1QMAA 3FGYA 3RGRA 3GZXB 7STDA 4K1UA 2F98A 3FLJA 1E97A 3M8CA 2UX0A 1DMNA 2HMKB 3OWYA 3NXJA 1OHOA 1HKXA 4XDVA 1SJWA 1OF5B 4L8PA 1UUWB 3KE7A 5DRVA 1Z1SA 3K7CA 3T8UA 4STDA 1C7HA 5EVHA 2QGUA 2HMJB 2Z76A 3BLZA 1O7PB 3G0KA 1O7WB 1GYBA 5AIHA 4N3VA 3DM8A 5CF2A 3STDA 1QJGA 1O7MB 3UNLA 3T8NA 4HM7B 3EX9A 2BMRB 4HM2B 5FW5A 2PZVA 2A15A 5IEPA 1O7GB 3SEDA 4OUQA 3F7XA 2R4IA 1JB4A 1OCVA 3GRDA 5KP1A 1EG9B 1OUNA 2HMMB 1Q42A 3Q90A 4U13A 4I4KA 4PEJA 3EN8A 4R9KA 1JB5A 1OPYA 1K41A 4HM0B 3EHCA 6STDA 3JUOA 3MSOA 3FF2A 5IF6A 3WMDA 4L7KA 4HJLB 3MHEA 4LEHA 3FZWA 1E3RA 2XRXB 3IPTA 2GEYA 4J8TA 4HM3B 1TUHA 4GB5A 4Q53A 1DMQA 3HZPA 1ULJB 3NV0A 3SOYA 4LMIA 3ROBA 1OGZA 1ZX2A 3FKAA 5D81A 1JB2A 3ER7A 2Z77A 5AIGA 1OHPA 4FCJA 4HM4B 4RZMA 4ORLA 5KP3A 2BMQB 3MG1A 3CNXA 4HZ9B 4H3UA 3EQQB 5CLKA 2INXA 4X2HA 3F14A 1NU3A 2STDA 3BB9A 5IG0A 3NHXA 3GWRA 1BUQA 5CK6A 2W2CA 5KP4A 1UUVB 3B7CA 1GY7A 1DMMA 3HK4A 3OWSA 4LGQA 3RGAA 2YFIB 1GS3A 1Q40A 5AIIA 1O7NB 2XSHB 3NV0B 3MG3A 2F99A 3G8ZA 5IERA 4FCMA 5HGRA 3HX8A 3KSPA 5IENA 1NWWA 3DXOA 2IMJA 2Z7AA 5CXOA 1A2KA 1OGXA 3JUPA 1W02A 3CU3A 5AEWB 1E3VA 2HMNB 4HKVB 3EF8A 5IEOA 3CPOA 3FH1A 5IG3A 5D83A 3VSYA 1TP6A 2YFLB 4WP5A 2BNGA 1Q40B 4K1VA 4HZBB 4CDLA 1CQSA 3OXAA 3NUVA 3UJMA 2GBWB 2I9WA 3DUKA 3F8HA 2RGQA 5BVBA 2GEXA 3G16A 5AIFA 3LZAA 3EBTA 5IG5A 4X2OA 2GBXB 4XBTA 3F40A 5STDA 3GZBA 3E99A 1ZO2A 2QIYA 3OV4A 3FF0A 4HM8B 2GXFA 4XB5A 5TGNA 2B1XB 3F9SA 3CNMA 4J9AA 1OH0A 4HM5B 1ASKA 3KKGA 2HMOB 2HMLB 5DREA 3EJVA 3K0ZA 3JUQA 5AEUB 3I0YA
chains in the Genus database with same CATH superfamily
4XDWA 2F86B 1W01A 4XBXA 3G6E3 3EC9A 3CPW2 1VQ53 1LVNA 1S5AA 1VQ93 3LMLA 1O7HB 2P05A 3X3XA 3ZG5A 2CKFB 1RGKA 1BNRA 5G2GA 1GOVA 2ZHXB 4FMDA 3NM2A 5G1KA 1W6YA 5HOHA 3WA3A 1EQKA 5IG4A 1GOYA 1GMQA 1IVWA 1FGQA 1VQQA 2MC8A 3GZRA 1B2XA 5M19A 4EV5A 2W03A 1JV2B 3A5EA 5JPUA 3PCRA 1VQK3 3MPHA 1STDA 2RNTA 1BANA 4FR9A 3NBBA 1IQXA 1LXEA 1W4NA 4HAAA 3FG3A 3FCSB 1X1YA 1JKGA 1VQN3 1VQ73 3AHSA 3D9RA 2Q07A 3CCM3 3JUNA 3AGOA 4HVNA 1NB5I 1W2B2 1AVLA 4XM4A 1FGRA 2OTL3 1V74A 3H51A 1BNGA 1QVG2 2XSOB 1JN5A 1BIRA 3NBRA 3X3ZA 3SOAA 3V92A 4KVHA 2K54A 3MYTA 5EEOA 3LYGA 2CG0A 5AI1A 1BOXA 1ZS7A 1RN1A 5D82A 3U97A 4L8OA 1RKYA 5IW9A 4IIAA 3U1WA 4EXRA 3CCE3 1S723 1EA2A 3B4PA 1IDPA 2FNQA 3S29A 1CYUA 1J2BA 2P0XA 2XH9A 3MKIA 1SARA 4KFDA 1BNJA 1N9JA 2UGIA 4R1KA 4WYKA 1M1K4 1RDSA 3AMOA 1VQM3 1FA3A 1AR0A 1DVCA 1M1XB 1BNIA 3DY5A 1B21A 1IQ8A 1V57A 2BMOB 1WQLB 3ALAA 3S5CA 4ILFA 1N8R4 3UB1A 1YJ93 2UUGC 1K28A 3Q3FA 1TJDA 4RNZA 2K3DA 1QVF2 1MWTA 3ECFA 1ISKA 3CD63 4R9LA 2RFRA 1JKGB 3L0RA 3OWUA 2BU4A 4XBYA 3VGNA 3EN1B 4WWUC 1DETA 2RSXA 2KCDA 2D1WA 3DH2A 3EBYA 1B27A 3MG2A 1K8A4 2RBIA 1FGMA 3KZTA 3OX9A 1MGRA 2BO9B 1I3IA 2XF3A 2CW9A 2YFJB 3DMCA 4BIRA 1B3SA 1BSBA 3H3HA 3S27A 4EW5A 2CHCA 4WFOA 4HM6B 3WOEB 1RMSA 1JN5B 2B24B 2QEX3 1ULIB 3K5TA 1GY6A 3LTBA 1B2SA 1B20A 1JZDA 3B8LA 3JUMA 1L5GB 5JPPA 2CX1A 4MJDA 1B2UA 8CHOA 2W56A 4OVMA 2W0QA 4HM1B 3GZYB 3F8XA 2IUJA 1YNVX 5BXQA 1IU7A 2WOFA 1W5ZA 1UCKA 4IPBA 4WYKB 1U5OA 3AMOB 2KXGA 1W6CA 3EB8A 1GY5A 3O8YA 3Q2PA 2CWTA 3WA2X 1OF5A 1AVKA 4RBNA 1VZZA 1W00A 3BU4A 3B4OA 1IVVA 1LNHA 3DGYA 1UCIA 4BU4A 4MMZB 1R4CA 4K61A 1FUTA 1NDOB 2RCDA 2JQ5A 2CIUA 2XR8B 3A76A 3DZLA 1A90A 3CCJ3 2OWPA 3K63A 4BTXA 3SXXA 3FSDA 2FGTA 1PFPA 1UI7A 1RGAA 1X1WA 3F7SA 5A0OB 1OHSA 1RTUA 2CC3A 5CF1A 1QMAA 4CPKA 2XGNA 2XEPA 3BNDA 3FGYA 5ELJA 3RGRA 3GZXB 1LRAA 2IYJA 7STDA 4K90B 4K1UA 2F98A 2Z6BA 1A67A 2BHMA 2CFKA 3NBJA 3FLJA 1IT8A 3X41A 1M904 1E97A 1FGTA 1R4YA 1RN4A 2W9PA 3M8CA 2W56B 1DE3A 2UX0A 2IY2A 1T2HA 3D79A 3SVAA 1DMNA 3WODG 2HMKB 3OWYA 2GU1A 1RCLA 3NXJA 1YJN3 1LQMB 3WDGB 1OHOA 1WTHA 5LC6A 1N8QA 1HKXA 1KSIA 3PCSA 4XDVA 1SJWA 1EKMA 4GSPA 1YHQ3 5FGOA 1N5PA 1TFOA 1OF5B 4L8PA 2R41A 1D6YA 1GD3A 4KFEA 1UUWB 2P0MA 1IV9A 3KE7A 2BT3A 2YX9A 5ELUA 1FGOA 1CEWI 1Z1SA 5DRVA 3S28A 3K7CA 1NO3A 1X1XA 3T8UA 1RRHA 4STDA 1JBTA 2CFGA 1C7HA 5EVHA 3KIIA 2QGUA 2HMJB 2Z76A 1A2VA 1JJ22 3BLZA 3T0UA 1O7PB 3G0KA 1FW7A 1LOYA 1SIHA 3NM7A 1SIIA 1GSPA 4AEQA 2KF6A 1O7WB 2WO0A 2OOVA 1YI23 2W9QA 1GYBA 1IVXA 4J5GA 5AIHA 1VQO3 3CCL3 4N3VA 1JNQA 3DM8A 3TDGA 5CF2A 1Y4KA 1MWRA 3URPA 4N6TA 1I2EA 4I5QA 1RN7A 3STDA 1RRLA 5M18A 1QJGA 1O7MB 3UNLA 3RDEA 3T8NA 9RNTA 4HM7B 3EX9A 3CC23 4HYZA 3MWZA 4OK0A 2BMRB 1STFI 4HM2B 2P38A 2CK3H 1RJOA 1BSCA 4RNYA 2PZVA 5FW5A 2O3OA 1LQGC 1JBRA 1N5HA 2A15A 4BTYA 2BIRA 5IEPA 3EE1A 1O7GB 1RGFA 1UCLA 3DGMA 1I0XA 3UL6A 5BIRA 4CCVA 3N9HA 4N6NB 3RNTA 3WR2A 2O9UX 3SEDA 2OOVC 4OUQA 4LYLB 4J5KA 3I563 1YJW3 3F7XA 2GSPA 1PY3A 2WOHA 1B2ZA 1GOUA 3LOYA 3KCHA 4QWTA 2R4IA 4WHAA 3NQYA 1I0VA 1JB4A 1W7CA 1BNEA 1N9EA 3KN4A 2H0GA 3PXMA 2CWVA 1G96A 1OCVA 3GRDA 5KP1A 1KD14 3G713 3X3YA 3PS8A 1RGGA 1EG9B 1OUNA 2HMMB 4HBRA 2CFWA 3CCV3 1Q42A 2E2UA 3Q90A 2ML6A 4HOHA 3V99A 1RGHA 4KZ1A 3CCR3 3X42A 3FG4A 3CXC2 1AQZA 4U13A 4NREA 4I4KA 4PEJA 1BAOA 3EN8A 1BU4A 4NHFA 1BSEA 1BVIA 2Y74A 4R9KA 2C11A 1US1A 1JB5A 3PGBA 1OPYA 1Q9EA 4O02B 1K41A 2LYXA 1MOLA 3EHCA 4HM0B 6STDA 3N8BA 3JUOA 1VQ83 3GSPA 3MSOA 1HU9A 3CCQ3 1TU5A 3FF2A 5IF6A 3WMDA 4L7KA 3CC43 2HOHA 3LT8A 3DGNA 3MHEA 4HJLB 4LEHA 1Q824 3FZWA 1RCKA 2F4YA 4N6V0 1E3RA 2XRXB 3LH4A 3PZWA 2L4VA 3IPTA 1BGSA 4MEIA 2GEYA 1KQS2 3HI7A 4J8TA 4EBGA 4HM3B 5RNTA 1TUHA 4EV2A 4ZM8A 1D6UA 2D42A 4G1MB 2SBLA 3ZG0A 4TX4A 1G0TA 3NQZA 4LSOA 1UW1A 1TTOA 2CFDA 4GB5A 4Q53A 1DMQA 3HZPA 1ULJB 3G4S3 3NV0A 3SOYA 1FYSA 2JDIH 3CC73 4LMIA 3K9MC 3ROBA 5LC7A 1NJI4 1T5YA 1OGZA 1ZX2A 2C4BA 3FKAA 5D81A 1BUJA 1BSAA 1JB2A 1AV4A 1NNVA 3ER7A 1I2GA 2W6JH 3D5GA 2CFLA 2Z77A 1KC84 5AIGA 1OHPA 4FCJA 4HM4B 2E2VA 2KF3A 1Q864 2FXTA 1LOWA 3LTAA 1UI8A 4ORLA 4RZMA 5KP3A 2F56A 4KT3B 6GSPA 1HZ1A 2BMQB 2KF4A 2OCTA 5AYRB 1ROVA 3MG1A 1LNIA 1Q7HA 3HIGA 1MGWA 4GHOA 2WGQA 4N6MA 2OQEA 1RGCA 3CNXA 1RGEA 1V58A 1WMPA 1BRGA 4H3UA 4HZ9B 1VQP3 3EQQB 3JVCA 2INXA 5CLKA 4X2HA 1QAKA 3F14A 3KFQC 3Q1CA 1NB3I 4O2HA 4N6OB 1MWSA 1NU3A 2STDA 3BB9A 1D6ZA 1RNTA 1IV7A 3BNEA 3N54B 4FMCA 3CME3 5IG0A 3NHXA 1RNBA 2ZA4A 4H61A 3GWRA 1A2PA 2V1LA 3PYJA 3SYUA 2GU3A 1BUQA 5CK6A 2W2CA 3HIIA 5KP4A 1RHLA 1UUVB 3B7CA 1W6GA 4FCZA 3UL5A 1CH0A 1GY7A 1GMRA 1DMMA 3HK4A 1RSNA 3OWSA 1BRSA 4MMXB 4LGQA 3RGAA 2YFIB 3FG1A 2SARA 1ZGXA 1GS3A 1Q40A 2MF7A 3KSED 1BRNL 5AIIA 3HOHA 4O3VA 1U8CB 5BU4A 1MWUA 1O7NB 4AKZA 2AAEA 5JBSA 2XSHB 3NV0B 1W2ZA 3SLUA 3CCU3 4R80A 4RNTA 4MMYB 1GD4A 3MG3A 2F99A 1T2IA 2OQEC 4O8SA 3G8ZA 1UCJA 5IERA 1I70A 1UUGB 3ZFZA 5I97A 4FCMA 1PYLA 1B2MA 1FZUA 4JRFA 5HGRA 4FMBA 1RLSA 2W04A 3HX8A 3LTDA 1YGEA 3SX1A 3IJEB 3KSPA 3V98A 5IENA 1I2FA 1NWWA 2P09A 5EQLA 3DXOA 1ROAA 2IMJA 2Y73A 4R4KA 4BL2A 3D3LA 4N6LA 7RNTA 1SPUA 1I3FA 1LOXA 1FUSA 2XFSA 2Z7AA 1CYVA 1JZOA 5CXOA 2K0MA 1A2KA 1OGXA 2H0HA 1W02A 3CU3A 3JUPA 5AEWB 1WMOA 1IYYA 1E3VA 2HMNB 2IA7A 1TIJA 4IT7A 3S67A 2F5WA 1BRIA 3QK9A 1WNHA 4HKVB 3EF8A 4N6UA 2ML5A 2ZL8A 5IEOA 5M1AA 4NPBA 3CPOA 3FH1A 3X40A 5IG3A 5D83A 3VSYA 4DKIA 1IK3A 3LT9A 4BL3A 1BNFA 1TP6A 2E2TA 3DGLA 1AY7A 2YFLB 2LQVA 4GL6A 1TRPA 4WP5A 2BNGA 1KWIA 2KRTA 1Q40B 1UGIA 4HZBB 4K1VA 3WHOA 1CQSA 4CDLA 1M9GA 5AYSC 2CH9A 3OXAA 7GSPA 1MNLA 3NUVA 1WMNA 2WGOA 3UJMA 2GBWB 1IVUA 2C10A 3CCS3 3AHWA 2I9WA 3J7Yd 1DVDA 2H0IA 1FUWA 3DUKA 1I8VA 1F8NA 3F8HA 5GSPA 2IUKA 4BTWA 1OACA 2RGQA 1K9M4 2AADA 3GAXA 1C54A 5BVBA 1DYUA 1JRQA 1G02A 1EUIC 3WOFB 3D5IA 3I553 2CG1A 2GEXA 3G16A 5AIFA 2PNCA 3LZAA 3DGOA 3EBTA 3QRDA 5IG5A 2KF5A 3AGNA 4X2OA 4EYCA 4AKYA 1EEJA 1LOVA 2GBXB 4XBTA 6RNTA 1GMPA 3F40A 5STDA 1JBSA 4FMAA 1YIJ3 2ZDJA 4LZIA 3GZBA 2KAAA 1BRHA 1TFKA 1BRJA 2XGLA 3E99A 1PU4A 1YVBI 1ZO2A 2QIYA 2QA43 5G1LA 3VF1A 3OV4A 2XFTA 3FF0A 4HM8B 3BIRA 2GXFA 1QAFA 4JF8A 4XB5A 3LTCA 3CMA3 1BSDA 5TGNA 2B1XB 1VQL3 1T3BA 1X1UA 3F9SA 8RNTA 1UDII 3CNMA 4J9AA 3BNBA 1TRQA 2CWUA 1OH0A 1SQWA 1BNSA 4HM5B 1ASKA 1YGWA 1HYFA 3KKGA 1QALA 2F5MA 3D4AA 3IMAB 3BNCA 3NX0A 1VQ63 2OTJ3 1Q7Y4 3LXUX 2HMOB 2HMLB 2L1SA 5DREA 1YVSA 3OW22 2M7OA 3EJVA 1K734 1YIT3 1BRKA 3K0ZA 4CJNA 3JUQA 1VQ43 5AEUB 1Q814 1IT7A 4KFFA 2J8XB 1UGHI 1IQYA 1RGLA 4EC6A 2CX0A 3I0YA
chains in the Genus database with same CATH topology
4XDWA 2F86B 1W01A 4XBXA 3G6E3 3EC9A 3CPW2 1VQ53 1LVNA 1S5AA 1VQ93 3LMLA 1O7HB 2P05A 3X3XA 2CKFB 5G2GA 1EQKA 4FMDA 3NM2A 1W6YA 3WA3A 5IG4A 1IVWA 1FGQA 2MC8A 3GZRA 4EV5A 2W03A 1JV2B 5JPUA 3PCRA 1VQK3 3MPHA 1STDA 4FR9A 3NBBA 1IQXA 1LXEA 1W4NA 3FG3A 3FCSB 1JKGA 1VQN3 1VQ73 3D9RA 2Q07A 3CCM3 3JUNA 4HVNA 1NB5I 1W2B2 1AVLA 4XM4A 1FGRA 2OTL3 1V74A 3H51A 1QVG2 2XSOB 1JN5A 3NBRA 3X3ZA 3SOAA 3V92A 4KVHA 2K54A 3MYTA 5EEOA 3LYGA 2CG0A 5AI1A 5D82A 3U97A 1RKYA 4L8OA 5IW9A 4IIAA 3U1WA 4EXRA 3CCE3 1S723 1EA2A 3B4PA 1IDPA 2FNQA 3S29A 1CYUA 1J2BA 2P0XA 2XH9A 3MKIA 4KFDA 1N9JA 4R1KA 4WYKA 1M1K4 3AMOA 1VQM3 1FA3A 1AR0A 1DVCA 1M1XB 3DY5A 1IQ8A 2BMOB 1WQLB 3ALAA 3S5CA 1N8R4 3UB1A 1YJ93 1K28A 4RNZA 1QVF2 3ECFA 1ISKA 3CD63 4R9LA 2RFRA 1JKGB 3L0RA 3OWUA 3VGNA 4XBYA 3EN1B 4WWUC 2RSXA 2KCDA 2D1WA 3EBYA 3MG2A 1K8A4 1FGMA 3KZTA 3OX9A 2YFJB 2BO9B 2XF3A 3DMCA 2CW9A 3H3HA 3S27A 2CHCA 4WFOA 4HM6B 3WOEB 2B24B 1JN5B 2QEX3 1ULIB 3K5TA 1GY6A 3LTBA 1L5GB 3B8LA 5JPPA 3JUMA 4MJDA 8CHOA 2W56A 4OVMA 2W0QA 4HM1B 3GZYB 3F8XA 2IUJA 5BXQA 1IU7A 2WOFA 1W5ZA 4IPBA 4WYKB 1U5OA 3AMOB 2KXGA 1W6CA 3EB8A 1GY5A 3O8YA 3Q2PA 2CWTA 3WA2X 1OF5A 1AVKA 4RBNA 1VZZA 1W00A 3B4OA 1IVVA 1LNHA 4MMZB 1R4CA 4K61A 1NDOB 2RCDA 2JQ5A 2CIUA 2XR8B 3A76A 3DZLA 1A90A 3CCJ3 2OWPA 3K63A 4BTXA 3SXXA 3FSDA 2FGTA 1PFPA 1UI7A 3F7SA 5A0OB 1OHSA 5CF1A 2CC3A 1QMAA 2XGNA 2XEPA 3BNDA 3FGYA 5ELJA 3RGRA 3GZXB 7STDA 4K90B 4K1UA 2F98A 2Z6BA 1A67A 2BHMA 2CFKA 3NBJA 3FLJA 1IT8A 3X41A 1M904 1E97A 1FGTA 3M8CA 2W9PA 2W56B 2UX0A 3SVAA 1DMNA 3WODG 2HMKB 3OWYA 2GU1A 1YJN3 3NXJA 3WDGB 1OHOA 1WTHA 5LC6A 1N8QA 1HKXA 1KSIA 3PCSA 4XDVA 1SJWA 1EKMA 1YHQ3 5FGOA 1N5PA 1TFOA 1OF5B 4L8PA 1D6YA 1GD3A 4KFEA 1UUWB 2P0MA 1IV9A 3KE7A 2BT3A 2YX9A 5ELUA 1FGOA 1CEWI 1Z1SA 5DRVA 3S28A 3K7CA 1NO3A 3T8UA 1RRHA 4STDA 2CFGA 1C7HA 5EVHA 3KIIA 2QGUA 2HMJB 2Z76A 1A2VA 1JJ22 3BLZA 3T0UA 1O7PB 3G0KA 1SIHA 3NM7A 1SIIA 4AEQA 1O7WB 2WO0A 2OOVA 1YI23 2W9QA 1GYBA 1IVXA 5AIHA 1VQO3 3CCL3 4N3VA 1JNQA 3DM8A 3TDGA 5CF2A 1Y4KA 4N6TA 3STDA 1RN7A 1RRLA 1QJGA 1O7MB 3UNLA 3RDEA 3T8NA 4HM7B 3EX9A 3CC23 4HYZA 3MWZA 4OK0A 2BMRB 1STFI 4HM2B 2P38A 2CK3H 1RJOA 4RNYA 5FW5A 2PZVA 2O3OA 1N5HA 2A15A 4BTYA 5IEPA 3EE1A 1O7GB 3DGMA 3UL6A 4CCVA 3N9HA 4N6NB 2O9UX 3SEDA 2OOVC 4OUQA 3I563 1YJW3 3F7XA 2WOHA 3LOYA 4QWTA 2R4IA 4WHAA 3NQYA 1JB4A 1W7CA 1N9EA 3KN4A 3PXMA 2CWVA 1G96A 1OCVA 3GRDA 5KP1A 1KD14 3G713 3X3YA 3PS8A 1EG9B 1OUNA 2HMMB 4HBRA 2CFWA 3CCV3 1Q42A 2E2UA 3Q90A 2ML6A 3V99A 4KZ1A 3CCR3 3X42A 3FG4A 3CXC2 4U13A 4NREA 4I4KA 4PEJA 3EN8A 4NHFA 2Y74A 4R9KA 2C11A 1US1A 1JB5A 3PGBA 1OPYA 4O02B 1K41A 2LYXA 1MOLA 3EHCA 4HM0B 6STDA 3N8BA 3JUOA 1VQ83 3MSOA 1HU9A 3CCQ3 1TU5A 3FF2A 5IF6A 3WMDA 4L7KA 3CC43 3LT8A 3DGNA 3MHEA 4HJLB 4LEHA 1Q824 3FZWA 4N6V0 1E3RA 2XRXB 3LH4A 3PZWA 2L4VA 3IPTA 1KQS2 4MEIA 2GEYA 3HI7A 4J8TA 4EBGA 4HM3B 1TUHA 4EV2A 4ZM8A 1D6UA 2D42A 4G1MB 2SBLA 4TX4A 3NQZA 4LSOA 1UW1A 2CFDA 4GB5A 4Q53A 1DMQA 3HZPA 1ULJB 3G4S3 3NV0A 3SOYA 2JDIH 3CC73 4LMIA 3K9MC 3ROBA 5LC7A 1NJI4 1T5YA 1OGZA 1ZX2A 3FKAA 5D81A 1JB2A 1AV4A 3ER7A 2W6JH 2CFLA 2Z77A 1KC84 5AIGA 1OHPA 4FCJA 4HM4B 2E2VA 1Q864 2FXTA 3LTAA 1UI8A 4ORLA 4RZMA 5KP3A 2BMQB 2OCTA 5AYRB 1ROVA 3MG1A 3HIGA 4N6MA 2WGQA 2OQEA 3CNXA 1WMPA 4HZ9B 1VQP3 4H3UA 3EQQB 3JVCA 2INXA 5CLKA 4X2HA 1QAKA 3F14A 3KFQC 3Q1CA 1NB3I 4O2HA 4N6OB 1NU3A 2STDA 3BB9A 1D6ZA 3N54B 1IV7A 3BNEA 4FMCA 3CME3 5IG0A 3NHXA 4H61A 3GWRA 3PYJA 2V1LA 2GU3A 1BUQA 5CK6A 2W2CA 3HIIA 5KP4A 1UUVB 3B7CA 1W6GA 4FCZA 3UL5A 1GY7A 1DMMA 3HK4A 3OWSA 4MMXB 4LGQA 3RGAA 2YFIB 3FG1A 3KSED 1GS3A 1Q40A 2MF7A 5AIIA 4O3VA 1U8CB 1O7NB 4AKZA 5JBSA 2XSHB 3NV0B 1W2ZA 3SLUA 3CCU3 4R80A 4MMYB 1GD4A 3MG3A 2F99A 2OQEC 4O8SA 3G8ZA 5IERA 5I97A 4FCMA 4JRFA 5HGRA 4FMBA 2W04A 3HX8A 3LTDA 1YGEA 3SX1A 3IJEB 3KSPA 3V98A 5IENA 1NWWA 2P09A 5EQLA 3DXOA 1ROAA 2IMJA 2Y73A 4R4KA 3D3LA 4N6LA 1SPUA 1LOXA 2XFSA 2Z7AA 1CYVA 5CXOA 2K0MA 1A2KA 1OGXA 3JUPA 1W02A 3CU3A 5AEWB 1WMOA 1E3VA 2HMNB 2IA7A 1TIJA 4IT7A 3S67A 3QK9A 1WNHA 4HKVB 3EF8A 4N6UA 2ML5A 2ZL8A 5IEOA 3CPOA 3FH1A 3X40A 5IG3A 5D83A 3VSYA 1IK3A 3LT9A 2E2TA 1TP6A 3DGLA 2YFLB 2LQVA 4GL6A 4WP5A 2BNGA 1KWIA 2KRTA 1Q40B 4HZBB 4K1VA 4CDLA 1CQSA 1M9GA 5AYSC 2CH9A 3OXAA 1MNLA 3NUVA 1WMNA 2WGOA 3UJMA 2GBWB 1IVUA 2C10A 3CCS3 1FUWA 2I9WA 3J7Yd 1DVDA 3DUKA 3F8HA 1F8NA 4BTWA 2IUKA 1OACA 2RGQA 1K9M4 3GAXA 5BVBA 1DYUA 1JRQA 3WOFB 3I553 2CG1A 2GEXA 3G16A 5AIFA 2PNCA 3LZAA 3DGOA 3EBTA 3QRDA 5IG5A 4X2OA 4EYCA 4AKYA 2GBXB 4XBTA 3F40A 5STDA 4FMAA 1YIJ3 2ZDJA 4LZIA 3GZBA 1TFKA 2XGLA 1PU4A 3E99A 1YVBI 1ZO2A 2QIYA 2QA43 3VF1A 3OV4A 2XFTA 3FF0A 4HM8B 2GXFA 1QAFA 4JF8A 4XB5A 3LTCA 3CMA3 5TGNA 2B1XB 1VQL3 3F9SA 3CNMA 4J9AA 3BNBA 2CWUA 1OH0A 1SQWA 4HM5B 1ASKA 3KKGA 1QALA 3IMAB 3NX0A 1VQ63 3BNCA 2OTJ3 1Q7Y4 3LXUX 2HMOB 2HMLB 1K734 5DREA 3OW22 2M7OA 3EJVA 1YIT3 3K0ZA 3JUQA 1VQ43 5AEUB 1Q814 1IT7A 4KFFA 1IQYA 4EC6A 3I0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDW A;  2F86 B;  1W01 A;  4XBX A;  3EC9 A;  1S5A A;  1O7H B;  2CKF B;  5G2G A;  3NM2 A;  1W6Y A;  5IG4 A;  3GZR A;  5JPU A;  1STD A;  1JKG A;  3D9R A;  3JUN A;  4HVN A;  4XM4 A;  3H51 A;  2XSO B;  1JN5 A;  3NBR A;  3SOA A;  4KVH A;  2K54 A;  3MYT A;  3LYG A;  5AI1 A;  5D82 A;  4L8O A;  4IIA A;  1EA2 A;  3B4P A;  1IDP A;  3MKI A;  4R1K A;  4WYK A;  1AR0 A;  2BMO B;  1WQL B;  3S5C A;  3ECF A;  1ISK A;  4R9L A;  2RFR A;  1JKG B;  3OWU A;  3VGN A;  4XBY A;  3EN1 B;  4WWU C;  3EBY A;  3MG2 A;  3KZT A;  3OX9 A;  2YFJ B;  3DMC A;  3H3H A;  2CHC A;  4HM6 B;  2B24 B;  1JN5 B;  1ULI B;  1GY6 A;  3B8L A;  5JPP A;  3JUM A;  4MJD A;  8CHO A;  4OVM A;  4HM1 B;  3GZY B;  3F8X A;  5BXQ A;  4WYK B;  1U5O A;  1GY5 A;  1OF5 A;  1W00 A;  1VZZ A;  3B4O A;  1NDO B;  2RCD A;  2JQ5 A;  3A76 A;  2XR8 B;  3DZL A;  2OWP A;  3FSD A;  3F7S A;  1OHS A;  5CF1 A;  1QMA A;  3FGY A;  3RGR A;  3GZX B;  7STD A;  4K1U A;  2F98 A;  3FLJ A;  1E97 A;  3M8C A;  2UX0 A;  1DMN A;  2HMK B;  3OWY A;  3NXJ A;  1OHO A;  1HKX A;  4XDV A;  1SJW A;  1OF5 B;  4L8P A;  1UUW B;  3KE7 A;  5DRV A;  1Z1S A;  3K7C A;  3T8U A;  4STD A;  1C7H A;  5EVH A;  2QGU A;  2HMJ B;  2Z76 A;  3BLZ A;  1O7P B;  3G0K A;  1O7W B;  1GYB A;  5AIH A;  4N3V A;  3DM8 A;  5CF2 A;  3STD A;  1QJG A;  1O7M B;  3UNL A;  3T8N A;  4HM7 B;  3EX9 A;  2BMR B;  4HM2 B;  5FW5 A;  2PZV A;  2A15 A;  5IEP A;  1O7G B;  3SED A;  4OUQ A;  3F7X A;  2R4I A;  1JB4 A;  1OCV A;  3GRD A;  5KP1 A;  1EG9 B;  1OUN A;  2HMM B;  1Q42 A;  3Q90 A;  4U13 A;  4I4K A;  4PEJ A;  3EN8 A;  4R9K A;  1JB5 A;  1OPY A;  1K41 A;  4HM0 B;  3EHC A;  6STD A;  3JUO A;  3MSO A;  3FF2 A;  5IF6 A;  3WMD A;  4L7K A;  4HJL B;  3MHE A;  4LEH A;  3FZW A;  1E3R A;  2XRX B;  3IPT A;  2GEY A;  4J8T A;  4HM3 B;  1TUH A;  4GB5 A;  4Q53 A;  1DMQ A;  3HZP A;  1ULJ B;  3NV0 A;  3SOY A;  4LMI A;  3ROB A;  1OGZ A;  1ZX2 A;  3FKA A;  5D81 A;  1JB2 A;  3ER7 A;  2Z77 A;  5AIG A;  1OHP A;  4FCJ A;  4HM4 B;  4RZM A;  4ORL A;  5KP3 A;  2BMQ B;  3MG1 A;  3CNX A;  4HZ9 B;  4H3U A;  3EQQ B;  5CLK A;  2INX A;  4X2H A;  3F14 A;  1NU3 A;  2STD A;  3BB9 A;  5IG0 A;  3NHX A;  3GWR A;  1BUQ A;  5CK6 A;  2W2C A;  5KP4 A;  1UUV B;  3B7C A;  1GY7 A;  1DMM A;  3HK4 A;  3OWS A;  4LGQ A;  3RGA A;  2YFI B;  1GS3 A;  1Q40 A;  5AII A;  1O7N B;  2XSH B;  3NV0 B;  3MG3 A;  2F99 A;  3G8Z A;  5IER A;  4FCM A;  5HGR A;  3HX8 A;  3KSP A;  5IEN A;  1NWW A;  3DXO A;  2IMJ A;  2Z7A A;  5CXO A;  1A2K A;  1OGX A;  3JUP A;  1W02 A;  3CU3 A;  5AEW B;  1E3V A;  2HMN B;  4HKV B;  3EF8 A;  5IEO A;  3CPO A;  3FH1 A;  5IG3 A;  5D83 A;  3VSY A;  1TP6 A;  2YFL B;  4WP5 A;  2BNG A;  1Q40 B;  4K1V A;  4HZB B;  4CDL A;  1CQS A;  3OXA A;  3NUV A;  3UJM A;  2GBW B;  2I9W A;  3DUK A;  3F8H A;  2RGQ A;  5BVB A;  2GEX A;  3G16 A;  5AIF A;  3LZA A;  3EBT A;  5IG5 A;  4X2O A;  2GBX B;  4XBT A;  3F40 A;  5STD A;  3GZB A;  3E99 A;  1ZO2 A;  2QIY A;  3OV4 A;  3FF0 A;  4HM8 B;  2GXF A;  4XB5 A;  5TGN A;  2B1X B;  3F9S A;  3CNM A;  4J9A A;  1OH0 A;  4HM5 B;  1ASK A;  3KKG A;  2HMO B;  2HML B;  5DRE A;  3EJV A;  3K0Z A;  3JUQ A;  5AEU B;  3I0Y A; 
#chains in the Genus database with same CATH topology
 4XDW A;  2F86 B;  1W01 A;  4XBX A;  3G6E 3;  3EC9 A;  3CPW 2;  1VQ5 3;  1LVN A;  1S5A A;  1VQ9 3;  3LML A;  1O7H B;  2P05 A;  3X3X A;  3ZG5 A;  2CKF B;  1RGK A;  1BNR A;  5G2G A;  1GOV A;  2ZHX B;  4FMD A;  3NM2 A;  5G1K A;  1W6Y A;  5HOH A;  3WA3 A;  1EQK A;  5IG4 A;  1GOY A;  1GMQ A;  1IVW A;  1FGQ A;  1VQQ A;  2MC8 A;  3GZR A;  1B2X A;  5M19 A;  4EV5 A;  2W03 A;  1JV2 B;  3A5E A;  5JPU A;  3PCR A;  1VQK 3;  3MPH A;  1STD A;  2RNT A;  1BAN A;  4FR9 A;  3NBB A;  1IQX A;  1LXE A;  1W4N A;  4HAA A;  3FG3 A;  3FCS B;  1X1Y A;  1JKG A;  1VQN 3;  1VQ7 3;  3AHS A;  3D9R A;  2Q07 A;  3CCM 3;  3JUN A;  3AGO A;  4HVN A;  1NB5 I;  1W2B 2;  1AVL A;  4XM4 A;  1FGR A;  2OTL 3;  1V74 A;  3H51 A;  1BNG A;  1QVG 2;  2XSO B;  1JN5 A;  1BIR A;  3NBR A;  3X3Z A;  3SOA A;  3V92 A;  4KVH A;  2K54 A;  3MYT A;  5EEO A;  3LYG A;  2CG0 A;  5AI1 A;  1BOX A;  1ZS7 A;  1RN1 A;  5D82 A;  3U97 A;  4L8O A;  1RKY A;  5IW9 A;  4IIA A;  3U1W A;  4EXR A;  3CCE 3;  1S72 3;  1EA2 A;  3B4P A;  1IDP A;  2FNQ A;  3S29 A;  1CYU A;  1J2B A;  2P0X A;  2XH9 A;  3MKI A;  1SAR A;  4KFD A;  1BNJ A;  1N9J A;  2UGI A;  4R1K A;  4WYK A;  1M1K 4;  1RDS A;  3AMO A;  1VQM 3;  1FA3 A;  1AR0 A;  1DVC A;  1M1X B;  1BNI A;  3DY5 A;  1B21 A;  1IQ8 A;  1V57 A;  2BMO B;  1WQL B;  3ALA A;  3S5C A;  4ILF A;  1N8R 4;  3UB1 A;  1YJ9 3;  2UUG C;  1K28 A;  3Q3F A;  1TJD A;  4RNZ A;  2K3D A;  1QVF 2;  1MWT A;  3ECF A;  1ISK A;  3CD6 3;  4R9L A;  2RFR A;  1JKG B;  3L0R A;  3OWU A;  2BU4 A;  4XBY A;  3VGN A;  3EN1 B;  4WWU C;  1DET A;  2RSX A;  2KCD A;  2D1W A;  3DH2 A;  3EBY A;  1B27 A;  3MG2 A;  1K8A 4;  2RBI A;  1FGM A;  3KZT A;  3OX9 A;  1MGR A;  2BO9 B;  1I3I A;  2XF3 A;  2CW9 A;  2YFJ B;  3DMC A;  4BIR A;  1B3S A;  1BSB A;  3H3H A;  3S27 A;  4EW5 A;  2CHC A;  4WFO A;  4HM6 B;  3WOE B;  1RMS A;  1JN5 B;  2B24 B;  2QEX 3;  1ULI B;  3K5T A;  1GY6 A;  3LTB A;  1B2S A;  1B20 A;  1JZD A;  3B8L A;  3JUM A;  1L5G B;  5JPP A;  2CX1 A;  4MJD A;  1B2U A;  8CHO A;  2W56 A;  4OVM A;  2W0Q A;  4HM1 B;  3GZY B;  3F8X A;  2IUJ A;  1YNV X;  5BXQ A;  1IU7 A;  2WOF A;  1W5Z A;  1UCK A;  4IPB A;  4WYK B;  1U5O A;  3AMO B;  2KXG A;  1W6C A;  3EB8 A;  1GY5 A;  3O8Y A;  3Q2P A;  2CWT A;  3WA2 X;  1OF5 A;  1AVK A;  4RBN A;  1VZZ A;  1W00 A;  3BU4 A;  3B4O A;  1IVV A;  1LNH A;  3DGY A;  1UCI A;  4BU4 A;  4MMZ B;  1R4C A;  4K61 A;  1FUT A;  1NDO B;  2RCD A;  2JQ5 A;  2CIU A;  2XR8 B;  3A76 A;  3DZL A;  1A90 A;  3CCJ 3;  2OWP A;  3K63 A;  4BTX A;  3SXX A;  3FSD A;  2FGT A;  1PFP A;  1UI7 A;  1RGA A;  1X1W A;  3F7S A;  5A0O B;  1OHS A;  1RTU A;  2CC3 A;  5CF1 A;  1QMA A;  4CPK A;  2XGN A;  2XEP A;  3BND A;  3FGY A;  5ELJ A;  3RGR A;  3GZX B;  1LRA A;  2IYJ A;  7STD A;  4K90 B;  4K1U A;  2F98 A;  2Z6B A;  1A67 A;  2BHM A;  2CFK A;  3NBJ A;  3FLJ A;  1IT8 A;  3X41 A;  1M90 4;  1E97 A;  1FGT A;  1R4Y A;  1RN4 A;  2W9P A;  3M8C A;  2W56 B;  1DE3 A;  2UX0 A;  2IY2 A;  1T2H A;  3D79 A;  3SVA A;  1DMN A;  3WOD G;  2HMK B;  3OWY A;  2GU1 A;  1RCL A;  3NXJ A;  1YJN 3;  1LQM B;  3WDG B;  1OHO A;  1WTH A;  5LC6 A;  1N8Q A;  1HKX A;  1KSI A;  3PCS A;  4XDV A;  1SJW A;  1EKM A;  4GSP A;  1YHQ 3;  5FGO A;  1N5P A;  1TFO A;  1OF5 B;  4L8P A;  2R41 A;  1D6Y A;  1GD3 A;  4KFE A;  1UUW B;  2P0M A;  1IV9 A;  3KE7 A;  2BT3 A;  2YX9 A;  5ELU A;  1FGO A;  1CEW I;  1Z1S A;  5DRV A;  3S28 A;  3K7C A;  1NO3 A;  1X1X A;  3T8U A;  1RRH A;  4STD A;  1JBT A;  2CFG A;  1C7H A;  5EVH A;  3KII A;  2QGU A;  2HMJ B;  2Z76 A;  1A2V A;  1JJ2 2;  3BLZ A;  3T0U A;  1O7P B;  3G0K A;  1FW7 A;  1LOY A;  1SIH A;  3NM7 A;  1SII A;  1GSP A;  4AEQ A;  2KF6 A;  1O7W B;  2WO0 A;  2OOV A;  1YI2 3;  2W9Q A;  1GYB A;  1IVX A;  4J5G A;  5AIH A;  1VQO 3;  3CCL 3;  4N3V A;  1JNQ A;  3DM8 A;  3TDG A;  5CF2 A;  1Y4K A;  1MWR A;  3URP A;  4N6T A;  1I2E A;  4I5Q A;  1RN7 A;  3STD A;  1RRL A;  5M18 A;  1QJG A;  1O7M B;  3UNL A;  3RDE A;  3T8N A;  9RNT A;  4HM7 B;  3EX9 A;  3CC2 3;  4HYZ A;  3MWZ A;  4OK0 A;  2BMR B;  1STF I;  4HM2 B;  2P38 A;  2CK3 H;  1RJO A;  1BSC A;  4RNY A;  2PZV A;  5FW5 A;  2O3O A;  1LQG C;  1JBR A;  1N5H A;  2A15 A;  4BTY A;  2BIR A;  5IEP A;  3EE1 A;  1O7G B;  1RGF A;  1UCL A;  3DGM A;  1I0X A;  3UL6 A;  5BIR A;  4CCV A;  3N9H A;  4N6N B;  3RNT A;  3WR2 A;  2O9U X;  3SED A;  2OOV C;  4OUQ A;  4LYL B;  4J5K A;  3I56 3;  1YJW 3;  3F7X A;  2GSP A;  1PY3 A;  2WOH A;  1B2Z A;  1GOU A;  3LOY A;  3KCH A;  4QWT A;  2R4I A;  4WHA A;  3NQY A;  1I0V A;  1JB4 A;  1W7C A;  1BNE A;  1N9E A;  3KN4 A;  2H0G A;  3PXM A;  2CWV A;  1G96 A;  1OCV A;  3GRD A;  5KP1 A;  1KD1 4;  3G71 3;  3X3Y A;  3PS8 A;  1RGG A;  1EG9 B;  1OUN A;  2HMM B;  4HBR A;  2CFW A;  3CCV 3;  1Q42 A;  2E2U A;  3Q90 A;  2ML6 A;  4HOH A;  3V99 A;  1RGH A;  4KZ1 A;  3CCR 3;  3X42 A;  3FG4 A;  3CXC 2;  1AQZ A;  4U13 A;  4NRE A;  4I4K A;  4PEJ A;  1BAO A;  3EN8 A;  1BU4 A;  4NHF A;  1BSE A;  1BVI A;  2Y74 A;  4R9K A;  2C11 A;  1US1 A;  1JB5 A;  3PGB A;  1OPY A;  1Q9E A;  4O02 B;  1K41 A;  2LYX A;  1MOL A;  3EHC A;  4HM0 B;  6STD A;  3N8B A;  3JUO A;  1VQ8 3;  3GSP A;  3MSO A;  1HU9 A;  3CCQ 3;  1TU5 A;  3FF2 A;  5IF6 A;  3WMD A;  4L7K A;  3CC4 3;  2HOH A;  3LT8 A;  3DGN A;  3MHE A;  4HJL B;  4LEH A;  1Q82 4;  3FZW A;  1RCK A;  2F4Y A;  4N6V 0;  1E3R A;  2XRX B;  3LH4 A;  3PZW A;  2L4V A;  3IPT A;  1BGS A;  4MEI A;  2GEY A;  1KQS 2;  3HI7 A;  4J8T A;  4EBG A;  4HM3 B;  5RNT A;  1TUH A;  4EV2 A;  4ZM8 A;  1D6U A;  2D42 A;  4G1M B;  2SBL A;  3ZG0 A;  4TX4 A;  1G0T A;  3NQZ A;  4LSO A;  1UW1 A;  1TTO A;  2CFD A;  4GB5 A;  4Q53 A;  1DMQ A;  3HZP A;  1ULJ B;  3G4S 3;  3NV0 A;  3SOY A;  1FYS A;  2JDI H;  3CC7 3;  4LMI A;  3K9M C;  3ROB A;  5LC7 A;  1NJI 4;  1T5Y A;  1OGZ A;  1ZX2 A;  2C4B A;  3FKA A;  5D81 A;  1BUJ A;  1BSA A;  1JB2 A;  1AV4 A;  1NNV A;  3ER7 A;  1I2G A;  2W6J H;  3D5G A;  2CFL A;  2Z77 A;  1KC8 4;  5AIG A;  1OHP A;  4FCJ A;  4HM4 B;  2E2V A;  2KF3 A;  1Q86 4;  2FXT A;  1LOW A;  3LTA A;  1UI8 A;  4ORL A;  4RZM A;  5KP3 A;  2F56 A;  4KT3 B;  6GSP A;  1HZ1 A;  2BMQ B;  2KF4 A;  2OCT A;  5AYR B;  1ROV A;  3MG1 A;  1LNI A;  1Q7H A;  3HIG A;  1MGW A;  4GHO A;  2WGQ A;  4N6M A;  2OQE A;  1RGC A;  3CNX A;  1RGE A;  1V58 A;  1WMP A;  1BRG A;  4H3U A;  4HZ9 B;  1VQP 3;  3EQQ B;  3JVC A;  2INX A;  5CLK A;  4X2H A;  1QAK A;  3F14 A;  3KFQ C;  3Q1C A;  1NB3 I;  4O2H A;  4N6O B;  1MWS A;  1NU3 A;  2STD A;  3BB9 A;  1D6Z A;  1RNT A;  1IV7 A;  3BNE A;  3N54 B;  4FMC A;  3CME 3;  5IG0 A;  3NHX A;  1RNB A;  2ZA4 A;  4H61 A;  3GWR A;  1A2P A;  2V1L A;  3PYJ A;  3SYU A;  2GU3 A;  1BUQ A;  5CK6 A;  2W2C A;  3HII A;  5KP4 A;  1RHL A;  1UUV B;  3B7C A;  1W6G A;  4FCZ A;  3UL5 A;  1CH0 A;  1GY7 A;  1GMR A;  1DMM A;  3HK4 A;  1RSN A;  3OWS A;  1BRS A;  4MMX B;  4LGQ A;  3RGA A;  2YFI B;  3FG1 A;  2SAR A;  1ZGX A;  1GS3 A;  1Q40 A;  2MF7 A;  3KSE D;  1BRN L;  5AII A;  3HOH A;  4O3V A;  1U8C B;  5BU4 A;  1MWU A;  1O7N B;  4AKZ A;  2AAE A;  5JBS A;  2XSH B;  3NV0 B;  1W2Z A;  3SLU A;  3CCU 3;  4R80 A;  4RNT A;  4MMY B;  1GD4 A;  3MG3 A;  2F99 A;  1T2I A;  2OQE C;  4O8S A;  3G8Z A;  1UCJ A;  5IER A;  1I70 A;  1UUG B;  3ZFZ A;  5I97 A;  4FCM A;  1PYL A;  1B2M A;  1FZU A;  4JRF A;  5HGR A;  4FMB A;  1RLS A;  2W04 A;  3HX8 A;  3LTD A;  1YGE A;  3SX1 A;  3IJE B;  3KSP A;  3V98 A;  5IEN A;  1I2F A;  1NWW A;  2P09 A;  5EQL A;  3DXO A;  1ROA A;  2IMJ A;  2Y73 A;  4R4K A;  4BL2 A;  3D3L A;  4N6L A;  7RNT A;  1SPU A;  1I3F A;  1LOX A;  1FUS A;  2XFS A;  2Z7A A;  1CYV A;  1JZO A;  5CXO A;  2K0M A;  1A2K A;  1OGX A;  2H0H A;  1W02 A;  3CU3 A;  3JUP A;  5AEW B;  1WMO A;  1IYY A;  1E3V A;  2HMN B;  2IA7 A;  1TIJ A;  4IT7 A;  3S67 A;  2F5W A;  1BRI A;  3QK9 A;  1WNH A;  4HKV B;  3EF8 A;  4N6U A;  2ML5 A;  2ZL8 A;  5IEO A;  5M1A A;  4NPB A;  3CPO A;  3FH1 A;  3X40 A;  5IG3 A;  5D83 A;  3VSY A;  4DKI A;  1IK3 A;  3LT9 A;  4BL3 A;  1BNF A;  1TP6 A;  2E2T A;  3DGL A;  1AY7 A;  2YFL B;  2LQV A;  4GL6 A;  1TRP A;  4WP5 A;  2BNG A;  1KWI A;  2KRT A;  1Q40 B;  1UGI A;  4HZB B;  4K1V A;  3WHO A;  1CQS A;  4CDL A;  1M9G A;  5AYS C;  2CH9 A;  3OXA A;  7GSP A;  1MNL A;  3NUV A;  1WMN A;  2WGO A;  3UJM A;  2GBW B;  1IVU A;  2C10 A;  3CCS 3;  3AHW A;  2I9W A;  3J7Y d;  1DVD A;  2H0I A;  1FUW A;  3DUK A;  1I8V A;  1F8N A;  3F8H A;  5GSP A;  2IUK A;  4BTW A;  1OAC A;  2RGQ A;  1K9M 4;  2AAD A;  3GAX A;  1C54 A;  5BVB A;  1DYU A;  1JRQ A;  1G02 A;  1EUI C;  3WOF B;  3D5I A;  3I55 3;  2CG1 A;  2GEX A;  3G16 A;  5AIF A;  2PNC A;  3LZA A;  3DGO A;  3EBT A;  3QRD A;  5IG5 A;  2KF5 A;  3AGN A;  4X2O A;  4EYC A;  4AKY A;  1EEJ A;  1LOV A;  2GBX B;  4XBT A;  6RNT A;  1GMP A;  3F40 A;  5STD A;  1JBS A;  4FMA A;  1YIJ 3;  2ZDJ A;  4LZI A;  3GZB A;  2KAA A;  1BRH A;  1TFK A;  1BRJ A;  2XGL A;  3E99 A;  1PU4 A;  1YVB I;  1ZO2 A;  2QIY A;  2QA4 3;  5G1L A;  3VF1 A;  3OV4 A;  2XFT A;  3FF0 A;  4HM8 B;  3BIR A;  2GXF A;  1QAF A;  4JF8 A;  4XB5 A;  3LTC A;  3CMA 3;  1BSD A;  5TGN A;  2B1X B;  1VQL 3;  1T3B A;  1X1U A;  3F9S A;  8RNT A;  1UDI I;  3CNM A;  4J9A A;  3BNB A;  1TRQ A;  2CWU A;  1OH0 A;  1SQW A;  1BNS A;  4HM5 B;  1ASK A;  1YGW A;  1HYF A;  3KKG A;  1QAL A;  2F5M A;  3D4A A;  3IMA B;  3BNC A;  3NX0 A;  1VQ6 3;  2OTJ 3;  1Q7Y 4;  3LXU X;  2HMO B;  2HML B;  2L1S A;  5DRE A;  1YVS A;  3OW2 2;  2M7O A;  3EJV A;  1K73 4;  1YIT 3;  1BRK A;  3K0Z A;  4CJN A;  3JUQ A;  1VQ4 3;  5AEU B;  1Q81 4;  1IT7 A;  4KFF A;  2J8X B;  1UGH I;  1IQY A;  1RGL A;  4EC6 A;  2CX0 A;  3I0Y A; 
#chains in the Genus database with same CATH homology
 4XDW A;  2F86 B;  1W01 A;  4XBX A;  3G6E 3;  3EC9 A;  3CPW 2;  1VQ5 3;  1LVN A;  1S5A A;  1VQ9 3;  3LML A;  1O7H B;  2P05 A;  3X3X A;  2CKF B;  5G2G A;  1EQK A;  4FMD A;  3NM2 A;  1W6Y A;  3WA3 A;  5IG4 A;  1IVW A;  1FGQ A;  2MC8 A;  3GZR A;  4EV5 A;  2W03 A;  1JV2 B;  5JPU A;  3PCR A;  1VQK 3;  3MPH A;  1STD A;  4FR9 A;  3NBB A;  1IQX A;  1LXE A;  1W4N A;  3FG3 A;  3FCS B;  1JKG A;  1VQN 3;  1VQ7 3;  3D9R A;  2Q07 A;  3CCM 3;  3JUN A;  4HVN A;  1NB5 I;  1W2B 2;  1AVL A;  4XM4 A;  1FGR A;  2OTL 3;  1V74 A;  3H51 A;  1QVG 2;  2XSO B;  1JN5 A;  3NBR A;  3X3Z A;  3SOA A;  3V92 A;  4KVH A;  2K54 A;  3MYT A;  5EEO A;  3LYG A;  2CG0 A;  5AI1 A;  5D82 A;  3U97 A;  1RKY A;  4L8O A;  5IW9 A;  4IIA A;  3U1W A;  4EXR A;  3CCE 3;  1S72 3;  1EA2 A;  3B4P A;  1IDP A;  2FNQ A;  3S29 A;  1CYU A;  1J2B A;  2P0X A;  2XH9 A;  3MKI A;  4KFD A;  1N9J A;  4R1K A;  4WYK A;  1M1K 4;  3AMO A;  1VQM 3;  1FA3 A;  1AR0 A;  1DVC A;  1M1X B;  3DY5 A;  1IQ8 A;  2BMO B;  1WQL B;  3ALA A;  3S5C A;  1N8R 4;  3UB1 A;  1YJ9 3;  1K28 A;  4RNZ A;  1QVF 2;  3ECF A;  1ISK A;  3CD6 3;  4R9L A;  2RFR A;  1JKG B;  3L0R A;  3OWU A;  3VGN A;  4XBY A;  3EN1 B;  4WWU C;  2RSX A;  2KCD A;  2D1W A;  3EBY A;  3MG2 A;  1K8A 4;  1FGM A;  3KZT A;  3OX9 A;  2YFJ B;  2BO9 B;  2XF3 A;  3DMC A;  2CW9 A;  3H3H A;  3S27 A;  2CHC A;  4WFO A;  4HM6 B;  3WOE B;  2B24 B;  1JN5 B;  2QEX 3;  1ULI B;  3K5T A;  1GY6 A;  3LTB A;  1L5G B;  3B8L A;  5JPP A;  3JUM A;  4MJD A;  8CHO A;  2W56 A;  4OVM A;  2W0Q A;  4HM1 B;  3GZY B;  3F8X A;  2IUJ A;  5BXQ A;  1IU7 A;  2WOF A;  1W5Z A;  4IPB A;  4WYK B;  1U5O A;  3AMO B;  2KXG A;  1W6C A;  3EB8 A;  1GY5 A;  3O8Y A;  3Q2P A;  2CWT A;  3WA2 X;  1OF5 A;  1AVK A;  4RBN A;  1VZZ A;  1W00 A;  3B4O A;  1IVV A;  1LNH A;  4MMZ B;  1R4C A;  4K61 A;  1NDO B;  2RCD A;  2JQ5 A;  2CIU A;  2XR8 B;  3A76 A;  3DZL A;  1A90 A;  3CCJ 3;  2OWP A;  3K63 A;  4BTX A;  3SXX A;  3FSD A;  2FGT A;  1PFP A;  1UI7 A;  3F7S A;  5A0O B;  1OHS A;  5CF1 A;  2CC3 A;  1QMA A;  2XGN A;  2XEP A;  3BND A;  3FGY A;  5ELJ A;  3RGR A;  3GZX B;  7STD A;  4K90 B;  4K1U A;  2F98 A;  2Z6B A;  1A67 A;  2BHM A;  2CFK A;  3NBJ A;  3FLJ A;  1IT8 A;  3X41 A;  1M90 4;  1E97 A;  1FGT A;  3M8C A;  2W9P A;  2W56 B;  2UX0 A;  3SVA A;  1DMN A;  3WOD G;  2HMK B;  3OWY A;  2GU1 A;  1YJN 3;  3NXJ A;  3WDG B;  1OHO A;  1WTH A;  5LC6 A;  1N8Q A;  1HKX A;  1KSI A;  3PCS A;  4XDV A;  1SJW A;  1EKM A;  1YHQ 3;  5FGO A;  1N5P A;  1TFO A;  1OF5 B;  4L8P A;  1D6Y A;  1GD3 A;  4KFE A;  1UUW B;  2P0M A;  1IV9 A;  3KE7 A;  2BT3 A;  2YX9 A;  5ELU A;  1FGO A;  1CEW I;  1Z1S A;  5DRV A;  3S28 A;  3K7C A;  1NO3 A;  3T8U A;  1RRH A;  4STD A;  2CFG A;  1C7H A;  5EVH A;  3KII A;  2QGU A;  2HMJ B;  2Z76 A;  1A2V A;  1JJ2 2;  3BLZ A;  3T0U A;  1O7P B;  3G0K A;  1SIH A;  3NM7 A;  1SII A;  4AEQ A;  1O7W B;  2WO0 A;  2OOV A;  1YI2 3;  2W9Q A;  1GYB A;  1IVX A;  5AIH A;  1VQO 3;  3CCL 3;  4N3V A;  1JNQ A;  3DM8 A;  3TDG A;  5CF2 A;  1Y4K A;  4N6T A;  3STD A;  1RN7 A;  1RRL A;  1QJG A;  1O7M B;  3UNL A;  3RDE A;  3T8N A;  4HM7 B;  3EX9 A;  3CC2 3;  4HYZ A;  3MWZ A;  4OK0 A;  2BMR B;  1STF I;  4HM2 B;  2P38 A;  2CK3 H;  1RJO A;  4RNY A;  5FW5 A;  2PZV A;  2O3O A;  1N5H A;  2A15 A;  4BTY A;  5IEP A;  3EE1 A;  1O7G B;  3DGM A;  3UL6 A;  4CCV A;  3N9H A;  4N6N B;  2O9U X;  3SED A;  2OOV C;  4OUQ A;  3I56 3;  1YJW 3;  3F7X A;  2WOH A;  3LOY A;  4QWT A;  2R4I A;  4WHA A;  3NQY A;  1JB4 A;  1W7C A;  1N9E A;  3KN4 A;  3PXM A;  2CWV A;  1G96 A;  1OCV A;  3GRD A;  5KP1 A;  1KD1 4;  3G71 3;  3X3Y A;  3PS8 A;  1EG9 B;  1OUN A;  2HMM B;  4HBR A;  2CFW A;  3CCV 3;  1Q42 A;  2E2U A;  3Q90 A;  2ML6 A;  3V99 A;  4KZ1 A;  3CCR 3;  3X42 A;  3FG4 A;  3CXC 2;  4U13 A;  4NRE A;  4I4K A;  4PEJ A;  3EN8 A;  4NHF A;  2Y74 A;  4R9K A;  2C11 A;  1US1 A;  1JB5 A;  3PGB A;  1OPY A;  4O02 B;  1K41 A;  2LYX A;  1MOL A;  3EHC A;  4HM0 B;  6STD A;  3N8B A;  3JUO A;  1VQ8 3;  3MSO A;  1HU9 A;  3CCQ 3;  1TU5 A;  3FF2 A;  5IF6 A;  3WMD A;  4L7K A;  3CC4 3;  3LT8 A;  3DGN A;  3MHE A;  4HJL B;  4LEH A;  1Q82 4;  3FZW A;  4N6V 0;  1E3R A;  2XRX B;  3LH4 A;  3PZW A;  2L4V A;  3IPT A;  1KQS 2;  4MEI A;  2GEY A;  3HI7 A;  4J8T A;  4EBG A;  4HM3 B;  1TUH A;  4EV2 A;  4ZM8 A;  1D6U A;  2D42 A;  4G1M B;  2SBL A;  4TX4 A;  3NQZ A;  4LSO A;  1UW1 A;  2CFD A;  4GB5 A;  4Q53 A;  1DMQ A;  3HZP A;  1ULJ B;  3G4S 3;  3NV0 A;  3SOY A;  2JDI H;  3CC7 3;  4LMI A;  3K9M C;  3ROB A;  5LC7 A;  1NJI 4;  1T5Y A;  1OGZ A;  1ZX2 A;  3FKA A;  5D81 A;  1JB2 A;  1AV4 A;  3ER7 A;  2W6J H;  2CFL A;  2Z77 A;  1KC8 4;  5AIG A;  1OHP A;  4FCJ A;  4HM4 B;  2E2V A;  1Q86 4;  2FXT A;  3LTA A;  1UI8 A;  4ORL A;  4RZM A;  5KP3 A;  2BMQ B;  2OCT A;  5AYR B;  1ROV A;  3MG1 A;  3HIG A;  4N6M A;  2WGQ A;  2OQE A;  3CNX A;  1WMP A;  4HZ9 B;  1VQP 3;  4H3U A;  3EQQ B;  3JVC A;  2INX A;  5CLK A;  4X2H A;  1QAK A;  3F14 A;  3KFQ C;  3Q1C A;  1NB3 I;  4O2H A;  4N6O B;  1NU3 A;  2STD A;  3BB9 A;  1D6Z A;  3N54 B;  1IV7 A;  3BNE A;  4FMC A;  3CME 3;  5IG0 A;  3NHX A;  4H61 A;  3GWR A;  3PYJ A;  2V1L A;  2GU3 A;  1BUQ A;  5CK6 A;  2W2C A;  3HII A;  5KP4 A;  1UUV B;  3B7C A;  1W6G A;  4FCZ A;  3UL5 A;  1GY7 A;  1DMM A;  3HK4 A;  3OWS A;  4MMX B;  4LGQ A;  3RGA A;  2YFI B;  3FG1 A;  3KSE D;  1GS3 A;  1Q40 A;  2MF7 A;  5AII A;  4O3V A;  1U8C B;  1O7N B;  4AKZ A;  5JBS A;  2XSH B;  3NV0 B;  1W2Z A;  3SLU A;  3CCU 3;  4R80 A;  4MMY B;  1GD4 A;  3MG3 A;  2F99 A;  2OQE C;  4O8S A;  3G8Z A;  5IER A;  5I97 A;  4FCM A;  4JRF A;  5HGR A;  4FMB A;  2W04 A;  3HX8 A;  3LTD A;  1YGE A;  3SX1 A;  3IJE B;  3KSP A;  3V98 A;  5IEN A;  1NWW A;  2P09 A;  5EQL A;  3DXO A;  1ROA A;  2IMJ A;  2Y73 A;  4R4K A;  3D3L A;  4N6L A;  1SPU A;  1LOX A;  2XFS A;  2Z7A A;  1CYV A;  5CXO A;  2K0M A;  1A2K A;  1OGX A;  3JUP A;  1W02 A;  3CU3 A;  5AEW B;  1WMO A;  1E3V A;  2HMN B;  2IA7 A;  1TIJ A;  4IT7 A;  3S67 A;  3QK9 A;  1WNH A;  4HKV B;  3EF8 A;  4N6U A;  2ML5 A;  2ZL8 A;  5IEO A;  3CPO A;  3FH1 A;  3X40 A;  5IG3 A;  5D83 A;  3VSY A;  1IK3 A;  3LT9 A;  2E2T A;  1TP6 A;  3DGL A;  2YFL B;  2LQV A;  4GL6 A;  4WP5 A;  2BNG A;  1KWI A;  2KRT A;  1Q40 B;  4HZB B;  4K1V A;  4CDL A;  1CQS A;  1M9G A;  5AYS C;  2CH9 A;  3OXA A;  1MNL A;  3NUV A;  1WMN A;  2WGO A;  3UJM A;  2GBW B;  1IVU A;  2C10 A;  3CCS 3;  1FUW A;  2I9W A;  3J7Y d;  1DVD A;  3DUK A;  3F8H A;  1F8N A;  4BTW A;  2IUK A;  1OAC A;  2RGQ A;  1K9M 4;  3GAX A;  5BVB A;  1DYU A;  1JRQ A;  3WOF B;  3I55 3;  2CG1 A;  2GEX A;  3G16 A;  5AIF A;  2PNC A;  3LZA A;  3DGO A;  3EBT A;  3QRD A;  5IG5 A;  4X2O A;  4EYC A;  4AKY A;  2GBX B;  4XBT A;  3F40 A;  5STD A;  4FMA A;  1YIJ 3;  2ZDJ A;  4LZI A;  3GZB A;  1TFK A;  2XGL A;  1PU4 A;  3E99 A;  1YVB I;  1ZO2 A;  2QIY A;  2QA4 3;  3VF1 A;  3OV4 A;  2XFT A;  3FF0 A;  4HM8 B;  2GXF A;  1QAF A;  4JF8 A;  4XB5 A;  3LTC A;  3CMA 3;  5TGN A;  2B1X B;  1VQL 3;  3F9S A;  3CNM A;  4J9A A;  3BNB A;  2CWU A;  1OH0 A;  1SQW A;  4HM5 B;  1ASK A;  3KKG A;  1QAL A;  3IMA B;  3NX0 A;  1VQ6 3;  3BNC A;  2OTJ 3;  1Q7Y 4;  3LXU X;  2HMO B;  2HML B;  1K73 4;  5DRE A;  3OW2 2;  2M7O A;  3EJV A;  1YIT 3;  3K0Z A;  3JUQ A;  1VQ4 3;  5AEU B;  1Q81 4;  1IT7 A;  4KFF A;  1IQY A;  4EC6 A;  3I0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...