3M8CA

Crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi) with equilenin bound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase D99N from Pseudomonas Testosteroni (tKSI) with Equilenin Bound
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 37
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3m8cA00
1OCVA 3SOAA 3OWYA 5FW5A 3K7CA 1JB4A 2W2CA 3A76A 1OHOA 1NWWA 3ER7A 3NV0B 1JKGA 1GY6A 1S5AA 4X2OA 3EF8A 1GY5A 4XM4A 5CK6A 6STDA 2XR8B 4R9KA 4CDLA 3GZXB 1OF5B 3EN8A 2QIYA 2F98A 1QMAA 2K54A 4LMIA 5CXOA 5AIGA 3LYGA 1Z1SA 1WQLB 2RCDA 5G2GA 1OH0A 3DMCA 3NUVA 5KP4A 5IEPA 2PZVA 4LEHA 2HMLB 3CU3A 3DM8A 4XDVA 3MG2A 4HZBB 1O7NB 3BLZA 1ULJB 5BVBA 1O7HB 3SEDA 3EHCA 4WP5A 1VZZA 4N3VA 4XDWA 4K1UA 1ISKA 4FCMA 4ORLA 3D9RA 5EVHA 4Q53A 4OUQA 2XSHB 1A2KA 4L7KA 4HM4B 1NDOB 4KVHA 3RGRA 3OWSA 3BB9A 3FGYA 3JUPA 1BUQA 1C7HA 3HK4A 4WWUC 3CPOA 3OX9A 3EJVA 1DMQA 7STDA 4XB5A 2RGQA 1OUNA 3FSDA 5IENA 3MKIA 3NBRA 1W6YA 2STDA 3Q90A 3WMDA 3FH1A 3STDA 2R4IA 1IDPA 3LZAA 1W00A 5IERA 1K41A 5D82A 2CKFB 3T8NA 1O7MB 2YFLB 5DRVA 5KP3A 1OHSA 2GEYA 1OGZA 5CF2A 4X2HA 1Q40A 2HMJB 3DZLA 4HZ9B 3K0ZA 4HM8B 2RFRA 1O7GB 2A15A 5AIHA 3GZRA 2GEXA 2YFJB 4GB5A 5TGNA 3F8HA 4XBTA 3GRDA 3M8CA 3OV4A 5AIFA 3CNXA 3I0YA 2F99A 5HGRA 1OHPA 2GXFA 2OWPA 3F7XA 3EQQB 3JUOA 3DXOA 1E3VA 3MHEA 3KZTA 2INXA 3KKGA 1Q42A 3NV0A 1STDA 3F8XA 3FZWA 2YFIB 4PEJA 5IG0A 2Z7AA 1JN5A 3EBYA 3EBTA 1QJGA 2F86B 3MYTA 4WYKB 1OF5A 2BNGA 5AI1A 5IF6A 4LGQA 3B8LA 1NU3A 3T8UA 1EA2A 4R9LA 5JPUA 3B4OA 3G16A 1JKGB 1U5OA 3FKAA 3F40A 2CHCA 1Q40B 3FLJA 2JQ5A 4RZMA 5STDA 1TUHA 3ROBA 1JB5A 5CLKA 2HMMB 5KP1A 3E99A 5IG4A 2GBXB 5AIIA 3S5CA 1ULIB 3IPTA 2HMKB 3ECFA 2QGUA 4HJLB 1TP6A 1W02A 1DMMA 3H3HA 1SJWA 1E97A 1UUVB 4XBYA 4HM2B 3HX8A 3HZPA 1E3RA 4HM5B 5CF1A 1DMNA 3MG3A 3JUQA 3G8ZA 1JN5B 2HMNB 1JB2A 4OVMA 2HMOB 1CQSA 1GY7A 1OPYA 3VSYA 4HM7B 3GZBA 2BMOB 3FF2A 1O7WB 1HKXA 3CNMA 2B24B 3UJMA 3B7CA 4HKVB 5D83A 4HM0B 3EX9A 3NXJA 8CHOA 3DUKA 3EN1B 2UX0A 4HM1B 2B1XB 5JPPA 1AR0A 3EC9A 5D81A 1EG9B 1W01A 3KE7A 5IG5A 4HM6B 4STDA 5IG3A 4XBXA 4J8TA 3F7SA 1O7PB 5DREA 4HVNA 4I4KA 3GWRA 3B4PA 4H3UA 4J9AA 1GS3A 3OXAA 3RGAA 1GYBA 4L8PA 3KSPA 3MSOA 3H51A 3JUNA 4FCJA 1ASKA 2I9WA 3GZYB 3OWUA 3NM2A 2XSOB 1ZO2A 4L8OA 3UNLA 3F9SA 3MG1A 3JUMA 2BMRB 5AEUB 2GBWB 1ZX2A 3SOYA 4U13A 3F14A 3FF0A 2Z76A 2IMJA 2Z77A 4IIAA 4R1KA 5BXQA 4MJDA 5AEWB 1OGXA 4K1VA 5IEOA 4WYKA 1UUWB 3VGNA 2XRXB 4HM3B 2BMQB 3G0KA 3NHXA
chains in the Genus database with same CATH superfamily
1I0VA 1OCVA 3SOAA 3OWYA 1I3FA 1WMPA 4RNZA 1TFOA 1DETA 1Y4KA 5FW5A 1BOXA 3K7CA 1JB4A 2W2CA 3A76A 1NB3I 2O3OA 1OHOA 1NWWA 1IT8A 3UL5A 1JBRA 3D79A 1FGOA 1B2XA 3ER7A 1Q7Y4 3NV0B 2P0MA 1DVCA 2CW9A 1I8VA 1JKGA 1UGHI 5GSPA 3UB1A 1GY6A 1IYYA 2W9PA 3G4S3 4NPBA 1GMRA 1TU5A 1TRPA 1S5AA 4X2OA 3EF8A 3IMAB 3NQYA 3LT8A 1FUWA 3HOHA 1IT7A 1GY5A 4XM4A 1Q864 5CK6A 1L5GB 1LOYA 1BRSA 5ELUA 2XR8B 2XF3A 6STDA 4R9KA 4CDLA 3GZXB 1OF5B 3EN8A 4MMYB 1RGKA 2QIYA 3LT9A 1IK3A 4O3VA 1I3IA 2F98A 1UW1A 1QMAA 2K54A 4LMIA 2CG0A 2PNCA 1K28A 4BU4A 1WTHA 1MWTA 2CFWA 4O8SA 2P05A 5CXOA 1TJDA 3X42A 1UCKA 5AIGA 3LYGA 4N6UA 2OTJ3 1RMSA 1NO3A 1RDSA 1Z1SA 1WQLB 2CWVA 3N8BA 2RCDA 1FGTA 4FR9A 5G2GA 4BTWA 1OH0A 1ROVA 3DMCA 2F5MA 2CFGA 3NUVA 3CME3 1MWRA 4HOHA 5KP4A 2M7OA 2KAAA 5IEPA 2PZVA 3ZG0A 1WNHA 1VQL3 5EEOA 2D1WA 4LEHA 2HMLB 3EE1A 3CU3A 3DM8A 4XDVA 1BNSA 5IW9A 3CCJ3 1JBSA 3MG2A 3S27A 4HZBB 4FMBA 1A90A 1O7NB 3BLZA 1BSAA 1ULJB 1US1A 2H0HA 4IPBA 4RNTA 1I2FA 5BVBA 3BNBA 3LOYA 1FZUA 1O7HB 2CH9A 3SEDA 3EHCA 1BNEA 4WP5A 1IVVA 1PYLA 1VZZA 2IUKA 4N3VA 2QEX3 4AKZA 4QWTA 1RN7A 4K1UA 4XDWA 1ISKA 1Q7HA 4FCMA 1BANA 2C10A 2E2VA 2RNTA 4ORLA 7GSPA 1VQ63 5M19A 3KCHA 3KIIA 3D9RA 1JNQA 3NBBA 1VQ83 1B20A 3FG3A 1N9EA 3GAXA 5EVHA 1VQP3 2P38A 3DGNA 1Q814 1MGRA 4EC6A 3DGOA 1HYFA 1M904 3ZFZA 2W56A 2OCTA 4HBRA 1GMQA 2ML6A 4Q53A 5M1AA 2IUJA 4RNYA 4OUQA 1PFPA 2XSHB 1A2KA 4L7KA 1AQZA 2BHMA 3PZWA 1V74A 1NDOB 4HM4B 1B21A 1YGWA 1UI7A 4KVHA 3RGRA 3OWSA 4KT3B 3BB9A 1LNHA 5AYSC 3FGYA 1YNVX 3JUPA 5JBSA 1N5PA 2K0MA 2KF5A 2XH9A 1BUQA 1C7HA 3HK4A 4WWUC 3CPOA 3OX9A 2CWTA 3EJVA 3MWZA 1RGHA 1DMQA 2QA43 4OK0A 1YIJ3 3V98A 2WO0A 7STDA 2AAEA 1B2ZA 3WOFB 2CIUA 4XB5A 2RGQA 5AYRB 1T2IA 3X40A 1OUNA 1I2EA 3FSDA 1QVG2 2AADA 5IENA 4LYLB 3CCM3 3CMA3 1YJW3 3MKIA 3MPHA 3NBRA 3KFQC 3DGMA 3DH2A 3JVCA 4NHFA 1W6YA 1LOXA 2STDA 3LTDA 1TFKA 3V92A 3Q90A 2KF3A 3SYUA 3PXMA 3WMDA 1GD4A 3FH1A 1TRQA 3STDA 2R4IA 1LQMB 2SARA 3TDGA 2ZA4A 1N8R4 1JRQA 2LYXA 1BSCA 1IDPA 4KFFA 1B2SA 3LZAA 1W00A 4BL3A 2ZDJA 4FCZA 3CD63 2FXTA 3K63A 3EB8A 5IERA 1K41A 1CYUA 2BO9B 5D82A 1FGQA 1F8NA 2CKFB 1EQKA 1IQXA 3PCRA 3T8NA 1YGEA 3ALAA 1D6UA 3AGOA 1O7MB 2YFLB 3NX0A 1FYSA 5LC6A 1AY7A 5DRVA 1KWIA 1LOVA 1NB5I 5KP3A 3WHOA 5FGOA 1OHSA 3WDGB 2GEYA 4BL2A 3A5EA 1OACA 1OGZA 4KFEA 2LQVA 5CF2A 3CXC2 4X2HA 1BRGA 3BNCA 4MEIA 1YI23 1R4CA 1VQN3 4H61A 4GSPA 3RNTA 2Q07A 1Q40A 2HMJB 1X1YA 1HZ1A 2XGNA 3AMOB 3DZLA 1W4NA 1W6CA 3D5IA 2KXGA 3SVAA 2YX9A 4HZ9B 3LMLA 4CJNA 3K0ZA 3CCQ3 3CPW2 1GOUA 2RSXA 2C11A 4HM8B 1RNBA 1IVWA 1BAOA 1O7GB 1RN4A 1ROAA 2RFRA 4MMZB 1NJI4 2ZL8A 4JF8A 2A15A 3GZRA 2GEXA 1BU4A 2YFJB 4GB5A 5AIHA 2XGLA 5TGNA 2W9QA 3KSED 1MWSA 2L4VA 5G1LA 1KC84 1RN1A 2W56B 2WOHA 1WMNA 3F8HA 4LZIA 4N6MA 2GU3A 1QALA 4XBTA 1RJOA 1CH0A 4EV2A 1N5HA 1NNVA 4DKIA 5HOHA 3HI7A 2RBIA 1D6YA 3GRDA 3M8CA 1FGRA 3OV4A 1JV2B 1BSEA 5AIFA 3CNXA 3LTBA 2MF7A 4WFOA 1YJN3 2E2TA 2R41A 3I0YA 1BNFA 1FUSA 2CFLA 3AHSA 2F99A 5HGRA 4HYZA 1Q824 1OHPA 1PY3A 1SIHA 2GXFA 2OWPA 1T5YA 1X1WA 1EUIC 3F7XA 3EQQB 3JUOA 4MMXB 3DXOA 1E3VA 3SXXA 3MHEA 3KZTA 1LVNA 2INXA 3KKGA 4R80A 2F4YA 2IA7A 1Q42A 3NV0A 2W0QA 1STDA 3F8XA 3FZWA 4BTYA 2YFIB 3PGBA 4PEJA 3PCSA 5IG0A 2Z7AA 3LTCA 1JN5A 2W03A 3BIRA 3EBYA 2WOFA 1SPUA 2BIRA 3EBTA 4GHOA 1K9M4 2CX1A 4ZM8A 2OOVC 3IJEB 3G6E3 1FA3A 4WHAA 1N9JA 3CC73 1QJGA 1BVIA 1ZS7A 3DGLA 2F86B 3MYTA 1A2PA 1BSBA 4WYKB 1BNRA 2C4BA 2ML5A 1OF5A 3G713 1RGAA 1SQWA 2BNGA 5AI1A 5IF6A 1EEJA 1BIRA 3CC23 4EXRA 1B3SA 2O9UX 3V99A 2XFTA 2P09A 4LGQA 3B8LA 1B2MA 1MNLA 1NU3A 3T8UA 1FUTA 1EA2A 4R9LA 1EKMA 3S28A 1R4YA 2IY2A 3QK9A 3CCV3 1BNGA 1UGIA 5JPUA 1N8QA 2GU1A 4KFDA 3X3YA 1IQ8A 9RNTA 3B4OA 3S67A 4N6OB 1BSDA 3K5TA 3G16A 3OW22 1JKGB 4AEQA 1U5OA 1FGMA 2L1SA 3FKAA 1D6ZA 1KQS2 1V58A 3F40A 1K734 1BRNL 3T0UA 2CHCA 1Q40B 1BUJA 2CFDA 3FLJA 1DVDA 1G02A 4JRFA 2SBLA 1VQO3 1LOWA 1S723 2JQ5A 3BU4A 4RZMA 1QAFA 3D5GA 3FG1A 4RBNA 3URPA 5STDA 3NQZA 3Q2PA 1TUHA 3HIIA 2CG1A 1IU7A 3ROBA 1JB5A 3U97A 5CLKA 2HMMB 3WODG 4BTXA 5KP1A 1BNJA 1U8CB 4CPKA 1RHLA 3E99A 5IG4A 2GBXB 5AIIA 1V57A 4O02B 3S5CA 1RGEA 1ULIB 1VQ73 2CFKA 1BNIA 3IPTA 1B2UA 1IV9A 1UUGB 2HMKB 1AVKA 1QVF2 4BIRA 3X3ZA 3CCS3 1PU4A 1GSPA 3ECFA 3NM7A 3D3LA 4N6V0 2H0IA 4EYCA 2UGIA 2J8XB 2QGUA 1AV4A 4HJLB 1TP6A 4GL6A 4LSOA 1W02A 1MOLA 5RNTA 1B27A 1C54A 2OQEA 3Q1CA 3BNEA 1W5ZA 1DMMA 1VQK3 1W2B2 5M18A 3H3HA 1SJWA 1E97A 4N6TA 1UUVB 5I97A 4XBYA 4HM2B 1J2BA 2WGQA 3PS8A 3HX8A 3HZPA 1E3RA 1W2ZA 3SLUA 1M1K4 1RTUA 1RCLA 4TX4A 3RDEA 4HM5B 5CF1A 3KN4A 1DMNA 3MG3A 3JUQA 1BRKA 3G8ZA 3FG4A 1GD3A 3LXUX 1HU9A 3S29A 1UI8A 5ELJA 1VQQA 2MC8A 1JN5B 1I70A 1VQ53 2HMNB 2OOVA 1RKYA 4CCVA 3CCL3 1JB2A 4OVMA 2HMOB 1CQSA 1GY7A 1OPYA 1RGLA 3O8YA 3K9MC 3VSYA 1BRIA 5BU4A 4HM7B 1RRLA 1G0TA 3NBJA 4K61A 1RGCA 4NREA 4N6LA 1JJ22 1T2HA 2CX0A 2HOHA 4FMCA 4HAAA 1K8A4 3GZBA 2BMOB 3FF2A 3AHWA 3UL6A 6RNTA 3CCR3 1O7WB 4EW5A 1HKXA 3CNMA 1YVBI 1GOYA 2KRTA 3D4AA 1UCIA 4K90B 2BT3A 2XEPA 1SIIA 2B24B 1LQGC 3UJMA 5A0OB 3B7CA 3QRDA 4EBGA 3I563 4HKVB 2KF4A 1TIJA 5D83A 4HM0B 2OQEC 3EX9A 2CC3A 1CYVA 3NXJA 4O2HA 8CHOA 3DUKA 1IV7A 3EN1B 1VQ43 2UX0A 3N54B 3VF1A 4HM1B 1RLSA 2B1XB 5JPPA 1AR0A 3EC9A 5D81A 1EG9B 1W01A 2UUGC 3KE7A 3WOEB 1YHQ3 4IT7A 5IG5A 1MWUA 1BRJA 2OTL3 1UCJA 1JZDA 1LNIA 2E2UA 3L0RA 1JZOA 1BGSA 2F5WA 3AMOA 4HM6B 1RGFA 3ZG5A 2KCDA 2W04A 4STDA 5IG3A 1W7CA 4XBXA 4J8TA 1RSNA 2CK3H 1KD14 3F7SA 2P0XA 1O7PB 3CCU3 5DREA 3LH4A 4HVNA 1GMPA 3BNDA 4I4KA 1AVLA 3GWRA 4KZ1A 3B4PA 4H3UA 4J9AA 1GS3A 3SX1A 5G1KA 3OXAA 1X1UA 3RGAA 1GYBA 4ILFA 1LXEA 4L8PA 4FMAA 3X3XA 1Q9EA 1YVSA 3KSPA 2V1LA 3MSOA 1WMOA 2Z6BA 5LC7A 3H51A 4I5QA 1RCKA 1JBTA 3WA2X 3FCSB 2F56A 3JUNA 2H0GA 4FCJA 1ASKA 2I9WA 1ZGXA 2Y74A 3GZYB 3OWUA 6GSPA 1M9GA 3NM2A 3AGNA 1X1XA 1VQM3 2XSOB 1ZO2A 4L8OA 2Y73A 3LTAA 3UNLA 3Q3FA 1YIT3 3GSPA 3F9SA 3MG1A 5EQLA 3JUMA 1DYUA 3N9HA 2BMRB 2BU4A 5AEUB 2WGOA 2GBWB 4N6NB 3U1WA 2GSPA 3CC43 1M1XB 1ZX2A 1TTOA 2IYJA 1MGWA 3SOYA 4FMDA 1RGGA 4U13A 1SARA 3F14A 3FF0A 1IVUA 1BRHA 1G96A 1GOVA 2ZHXB 1LRAA 1T3BA 2Z76A 2W6JH 2IMJA 1KSIA 2Z77A 4IIAA 4R1KA 4AKYA 5BXQA 1UCLA 4J5KA 3DY5A 4J5GA 1RNTA 4MJDA 8RNTA 3WA3A 2D42A 5AEWB 1STFI 1DE3A 3HIGA 1OGXA 2CWUA 1RRHA 4K1VA 3CCE3 7RNTA 1UDII 1YJ93 1A2VA 1CEWI 3I553 5BIRA 4G1MB 5IEOA 3WR2A 2KF6A 4R4KA 1IQYA 1I0XA 1UUWB 2JDIH 4WYKA 3VGNA 1A67A 1I2GA 1IVXA 2XFSA 2XRXB 1FW7A 2FGTA 1QAKA 4HM3B 3X41A 3PYJA 4EV5A 3J7Yd 2BMQB 1W6GA 2FNQA 1VQ93 3G0KA 3DGYA 3NHXA 2K3DA
chains in the Genus database with same CATH topology
1OCVA 3SOAA 3OWYA 1WMPA 4RNZA 1TFOA 1Y4KA 5FW5A 3K7CA 1JB4A 2W2CA 3A76A 1NB3I 2O3OA 1OHOA 1NWWA 1IT8A 3UL5A 1FGOA 3ER7A 1Q7Y4 3NV0B 2P0MA 1DVCA 2CW9A 3UB1A 1JKGA 1GY6A 2W9PA 3G4S3 1TU5A 1S5AA 4X2OA 3EF8A 3IMAB 3NQYA 3LT8A 1FUWA 1IT7A 1GY5A 4XM4A 1Q864 5CK6A 1L5GB 6STDA 5ELUA 2XR8B 2XF3A 4R9KA 4CDLA 3GZXB 1OF5B 3EN8A 4MMYB 2QIYA 3LT9A 1IK3A 4O3VA 2F98A 1UW1A 1QMAA 2K54A 4LMIA 2CG0A 2PNCA 1K28A 1WTHA 2CFWA 4O8SA 2P05A 5CXOA 3X42A 5AIGA 3LYGA 4N6UA 2OTJ3 1NO3A 1Z1SA 1WQLB 2CWVA 3N8BA 2RCDA 1FGTA 4FR9A 5G2GA 4BTWA 1OH0A 1ROVA 3DMCA 3CME3 2CFGA 3NUVA 5KP4A 2M7OA 5IEPA 2PZVA 1WNHA 1VQL3 2D1WA 4LEHA 2HMLB 3EE1A 3CU3A 3DM8A 4XDVA 5IW9A 3CCJ3 3MG2A 3S27A 4HZBB 4FMBA 1A90A 1O7NB 3BLZA 1ULJB 1US1A 4IPBA 5BVBA 3BNBA 3LOYA 2CH9A 1O7HB 3SEDA 3EHCA 4WP5A 1IVVA 1VZZA 2IUKA 4N3VA 2QEX3 4AKZA 4QWTA 1RN7A 4K1UA 4XDWA 1ISKA 4FCMA 2C10A 2E2VA 4ORLA 1VQ63 3KIIA 3D9RA 1JNQA 3NBBA 1VQ83 3FG3A 1N9EA 3GAXA 5EVHA 1VQP3 2P38A 3DGNA 1Q814 4EC6A 3DGOA 1M904 2W56A 2OCTA 4HBRA 2ML6A 4Q53A 2IUJA 4RNYA 4OUQA 1PFPA 2XSHB 1A2KA 4L7KA 2BHMA 3PZWA 1V74A 1NDOB 4HM4B 4KVHA 3RGRA 1UI7A 3OWSA 3BB9A 1LNHA 5AYSC 3FGYA 3JUPA 5JBSA 1N5PA 2K0MA 2XH9A 1BUQA 1C7HA 3HK4A 4WWUC 3CPOA 3OX9A 2CWTA 3EJVA 3MWZA 1YIJ3 1DMQA 2QA43 4OK0A 3V98A 2WO0A 7STDA 3WOFB 2CIUA 4XB5A 2RGQA 5AYRB 3X40A 1OUNA 3FSDA 1QVG2 5IENA 3CCM3 3CMA3 1YJW3 3MKIA 3MPHA 3NBRA 3KFQC 3DGMA 3JVCA 4NHFA 1W6YA 1LOXA 2STDA 3LTDA 1TFKA 3V92A 3Q90A 3WMDA 3PXMA 1GD4A 3FH1A 3STDA 2R4IA 3TDGA 1N8R4 1JRQA 2LYXA 1IDPA 4KFFA 3LZAA 1W00A 2ZDJA 4FCZA 3CD63 2FXTA 3K63A 3EB8A 5IERA 1K41A 1CYUA 2BO9B 5D82A 1FGQA 1F8NA 2CKFB 1EQKA 1IQXA 3PCRA 3T8NA 1YGEA 3ALAA 1D6UA 1O7MB 2YFLB 3NX0A 5LC6A 5DRVA 1KWIA 1NB5I 5KP3A 5FGOA 1OHSA 3WDGB 2GEYA 1OACA 1OGZA 4KFEA 2LQVA 5CF2A 3CXC2 4X2HA 3BNCA 4MEIA 1YI23 1R4CA 1VQN3 4H61A 2Q07A 1Q40A 2HMJB 2XGNA 3AMOB 3DZLA 1W4NA 1W6CA 3SVAA 2KXGA 2YX9A 4HZ9B 3LMLA 3K0ZA 3CCQ3 3CPW2 2RSXA 2C11A 4HM8B 1IVWA 2RFRA 1O7GB 1ROAA 4MMZB 1NJI4 2ZL8A 4JF8A 2A15A 3GZRA 2GEXA 4GB5A 2YFJB 5AIHA 2XGLA 5TGNA 2W9QA 3KSED 2L4VA 1KC84 2W56B 2WOHA 1WMNA 3F8HA 4LZIA 4N6MA 2GU3A 1QALA 4XBTA 1RJOA 4EV2A 1N5HA 3HI7A 1D6YA 3GRDA 3M8CA 1FGRA 3OV4A 1JV2B 5AIFA 3CNXA 3LTBA 2MF7A 4WFOA 1YJN3 2E2TA 3I0YA 2CFLA 2F99A 5HGRA 4HYZA 1Q824 1OHPA 2GXFA 1SIHA 2OWPA 1T5YA 3F7XA 3EQQB 3JUOA 4MMXB 3DXOA 1E3VA 3SXXA 3MHEA 3KZTA 1LVNA 2INXA 3KKGA 4R80A 2IA7A 1Q42A 3NV0A 2W0QA 1STDA 3F8XA 3FZWA 4BTYA 2YFIB 3PGBA 4PEJA 3PCSA 5IG0A 2Z7AA 3LTCA 1JN5A 2W03A 3EBYA 2WOFA 1SPUA 3EBTA 1K9M4 4ZM8A 2OOVC 3IJEB 3G6E3 1FA3A 4WHAA 1N9JA 3CC73 1QJGA 3DGLA 2F86B 3MYTA 4WYKB 2ML5A 1OF5A 3G713 1SQWA 2BNGA 5AI1A 5IF6A 3CC23 4EXRA 3V99A 2O9UX 2XFTA 2P09A 4LGQA 3B8LA 1MNLA 1NU3A 3T8UA 1EA2A 4R9LA 1EKMA 3S28A 3QK9A 3CCV3 5JPUA 1N8QA 2GU1A 4KFDA 3X3YA 1IQ8A 3B4OA 3S67A 4N6OB 3K5TA 3G16A 3OW22 1JKGB 4AEQA 1U5OA 1FGMA 3FKAA 1D6ZA 1KQS2 3F40A 1K734 3T0UA 2CHCA 1Q40B 2CFDA 3FLJA 1DVDA 4JRFA 2SBLA 1VQO3 1S723 2JQ5A 4RZMA 1QAFA 4RBNA 3FG1A 5STDA 3NQZA 3Q2PA 1TUHA 3HIIA 2CG1A 1IU7A 3ROBA 1JB5A 3U97A 5CLKA 2HMMB 3WODG 4BTXA 5KP1A 1U8CB 3E99A 5IG4A 2GBXB 5AIIA 4O02B 3S5CA 1ULIB 1VQ73 2CFKA 3IPTA 1IV9A 2HMKB 1AVKA 1QVF2 3X3ZA 3CCS3 1PU4A 3ECFA 3NM7A 3D3LA 4N6V0 4EYCA 2QGUA 1AV4A 4HJLB 1TP6A 4GL6A 4LSOA 1W02A 1MOLA 2OQEA 3Q1CA 3BNEA 1W5ZA 1DMMA 1VQK3 1W2B2 3H3HA 1SJWA 1E97A 4N6TA 1UUVB 5I97A 4XBYA 4HM2B 1J2BA 2WGQA 3PS8A 3HX8A 3HZPA 1E3RA 1W2ZA 3SLUA 1M1K4 4TX4A 3RDEA 4HM5B 5CF1A 3KN4A 1DMNA 3MG3A 3JUQA 3G8ZA 3FG4A 1GD3A 3LXUX 1HU9A 3S29A 1UI8A 5ELJA 2MC8A 1JN5B 1VQ53 2HMNB 2OOVA 1RKYA 4CCVA 3CCL3 1JB2A 4OVMA 2HMOB 1CQSA 1GY7A 1OPYA 3VSYA 3O8YA 3K9MC 4HM7B 1RRLA 3NBJA 4K61A 1JJ22 4NREA 4N6LA 4FMCA 1K8A4 3GZBA 2BMOB 3FF2A 3UL6A 3CCR3 1O7WB 1HKXA 3CNMA 1YVBI 2KRTA 4K90B 2BT3A 2XEPA 1SIIA 2B24B 5A0OB 3UJMA 3I563 3B7CA 3QRDA 4EBGA 4HKVB 1TIJA 5D83A 4HM0B 2OQEC 3EX9A 2CC3A 1CYVA 3NXJA 4O2HA 8CHOA 3DUKA 1IV7A 3EN1B 1VQ43 2UX0A 3N54B 3VF1A 4HM1B 2B1XB 5JPPA 1AR0A 3EC9A 5D81A 1EG9B 1W01A 1YHQ3 3KE7A 3WOEB 4IT7A 5IG5A 2OTL3 2E2UA 3L0RA 3AMOA 4HM6B 2KCDA 2W04A 4STDA 5IG3A 1W7CA 4XBXA 4J8TA 2CK3H 1KD14 3F7SA 2P0XA 1O7PB 3CCU3 5DREA 3LH4A 4HVNA 3BNDA 4I4KA 1AVLA 3GWRA 4KZ1A 3B4PA 4H3UA 4J9AA 1GS3A 3SX1A 3OXAA 3RGAA 1GYBA 1LXEA 4L8PA 4FMAA 3X3XA 3KSPA 3MSOA 2V1LA 5LC7A 1WMOA 2Z6BA 3H51A 3WA2X 3FCSB 3JUNA 4FCJA 1ASKA 2I9WA 2Y74A 3GZYB 3OWUA 1M9GA 3NM2A 1VQM3 2XSOB 1ZO2A 4L8OA 2Y73A 3LTAA 3UNLA 1YIT3 3F9SA 3MG1A 5EQLA 3JUMA 1DYUA 3N9HA 2BMRB 5AEUB 2WGOA 2GBWB 4N6NB 3U1WA 3CC43 1M1XB 1ZX2A 3SOYA 4FMDA 4U13A 3F14A 3FF0A 1IVUA 1G96A 2Z76A 2W6JH 2IMJA 1KSIA 2Z77A 4IIAA 4R1KA 4AKYA 5BXQA 3DY5A 4MJDA 3WA3A 2D42A 5AEWB 1STFI 3HIGA 1OGXA 2CWUA 1RRHA 4K1VA 3CCE3 1YJ93 1A2VA 1CEWI 3I553 4G1MB 5IEOA 4R4KA 1IQYA 4WYKA 1UUWB 2JDIH 1A67A 3VGNA 1IVXA 2XFSA 2XRXB 2FGTA 1QAKA 4HM3B 3X41A 3PYJA 4EV5A 3J7Yd 2BMQB 1W6GA 2FNQA 1VQ93 3G0KA 3NHXA 5EEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCV A;  3SOA A;  3OWY A;  5FW5 A;  3K7C A;  1JB4 A;  2W2C A;  3A76 A;  1OHO A;  1NWW A;  3ER7 A;  3NV0 B;  1JKG A;  1GY6 A;  1S5A A;  4X2O A;  3EF8 A;  1GY5 A;  4XM4 A;  5CK6 A;  6STD A;  2XR8 B;  4R9K A;  4CDL A;  3GZX B;  1OF5 B;  3EN8 A;  2QIY A;  2F98 A;  1QMA A;  2K54 A;  4LMI A;  5CXO A;  5AIG A;  3LYG A;  1Z1S A;  1WQL B;  2RCD A;  5G2G A;  1OH0 A;  3DMC A;  3NUV A;  5KP4 A;  5IEP A;  2PZV A;  4LEH A;  2HML B;  3CU3 A;  3DM8 A;  4XDV A;  3MG2 A;  4HZB B;  1O7N B;  3BLZ A;  1ULJ B;  5BVB A;  1O7H B;  3SED A;  3EHC A;  4WP5 A;  1VZZ A;  4N3V A;  4XDW A;  4K1U A;  1ISK A;  4FCM A;  4ORL A;  3D9R A;  5EVH A;  4Q53 A;  4OUQ A;  2XSH B;  1A2K A;  4L7K A;  4HM4 B;  1NDO B;  4KVH A;  3RGR A;  3OWS A;  3BB9 A;  3FGY A;  3JUP A;  1BUQ A;  1C7H A;  3HK4 A;  4WWU C;  3CPO A;  3OX9 A;  3EJV A;  1DMQ A;  7STD A;  4XB5 A;  2RGQ A;  1OUN A;  3FSD A;  5IEN A;  3MKI A;  3NBR A;  1W6Y A;  2STD A;  3Q90 A;  3WMD A;  3FH1 A;  3STD A;  2R4I A;  1IDP A;  3LZA A;  1W00 A;  5IER A;  1K41 A;  5D82 A;  2CKF B;  3T8N A;  1O7M B;  2YFL B;  5DRV A;  5KP3 A;  1OHS A;  2GEY A;  1OGZ A;  5CF2 A;  4X2H A;  1Q40 A;  2HMJ B;  3DZL A;  4HZ9 B;  3K0Z A;  4HM8 B;  2RFR A;  1O7G B;  2A15 A;  5AIH A;  3GZR A;  2GEX A;  2YFJ B;  4GB5 A;  5TGN A;  3F8H A;  4XBT A;  3GRD A;  3M8C A;  3OV4 A;  5AIF A;  3CNX A;  3I0Y A;  2F99 A;  5HGR A;  1OHP A;  2GXF A;  2OWP A;  3F7X A;  3EQQ B;  3JUO A;  3DXO A;  1E3V A;  3MHE A;  3KZT A;  2INX A;  3KKG A;  1Q42 A;  3NV0 A;  1STD A;  3F8X A;  3FZW A;  2YFI B;  4PEJ A;  5IG0 A;  2Z7A A;  1JN5 A;  3EBY A;  3EBT A;  1QJG A;  2F86 B;  3MYT A;  4WYK B;  1OF5 A;  2BNG A;  5AI1 A;  5IF6 A;  4LGQ A;  3B8L A;  1NU3 A;  3T8U A;  1EA2 A;  4R9L A;  5JPU A;  3B4O A;  3G16 A;  1JKG B;  1U5O A;  3FKA A;  3F40 A;  2CHC A;  1Q40 B;  3FLJ A;  2JQ5 A;  4RZM A;  5STD A;  1TUH A;  3ROB A;  1JB5 A;  5CLK A;  2HMM B;  5KP1 A;  3E99 A;  5IG4 A;  2GBX B;  5AII A;  3S5C A;  1ULI B;  3IPT A;  2HMK B;  3ECF A;  2QGU A;  4HJL B;  1TP6 A;  1W02 A;  1DMM A;  3H3H A;  1SJW A;  1E97 A;  1UUV B;  4XBY A;  4HM2 B;  3HX8 A;  3HZP A;  1E3R A;  4HM5 B;  5CF1 A;  1DMN A;  3MG3 A;  3JUQ A;  3G8Z A;  1JN5 B;  2HMN B;  1JB2 A;  4OVM A;  2HMO B;  1CQS A;  1GY7 A;  1OPY A;  3VSY A;  4HM7 B;  3GZB A;  2BMO B;  3FF2 A;  1O7W B;  1HKX A;  3CNM A;  2B24 B;  3UJM A;  3B7C A;  4HKV B;  5D83 A;  4HM0 B;  3EX9 A;  3NXJ A;  8CHO A;  3DUK A;  3EN1 B;  2UX0 A;  4HM1 B;  2B1X B;  5JPP A;  1AR0 A;  3EC9 A;  5D81 A;  1EG9 B;  1W01 A;  3KE7 A;  5IG5 A;  4HM6 B;  4STD A;  5IG3 A;  4XBX A;  4J8T A;  3F7S A;  1O7P B;  5DRE A;  4HVN A;  4I4K A;  3GWR A;  3B4P A;  4H3U A;  4J9A A;  1GS3 A;  3OXA A;  3RGA A;  1GYB A;  4L8P A;  3KSP A;  3MSO A;  3H51 A;  3JUN A;  4FCJ A;  1ASK A;  2I9W A;  3GZY B;  3OWU A;  3NM2 A;  2XSO B;  1ZO2 A;  4L8O A;  3UNL A;  3F9S A;  3MG1 A;  3JUM A;  2BMR B;  5AEU B;  2GBW B;  1ZX2 A;  3SOY A;  4U13 A;  3F14 A;  3FF0 A;  2Z76 A;  2IMJ A;  2Z77 A;  4IIA A;  4R1K A;  5BXQ A;  4MJD A;  5AEW B;  1OGX A;  4K1V A;  5IEO A;  4WYK A;  1UUW B;  3VGN A;  2XRX B;  4HM3 B;  2BMQ B;  3G0K A;  3NHX A; 
#chains in the Genus database with same CATH topology
 1I0V A;  1OCV A;  3SOA A;  3OWY A;  1I3F A;  1WMP A;  4RNZ A;  1TFO A;  1DET A;  1Y4K A;  5FW5 A;  1BOX A;  3K7C A;  1JB4 A;  2W2C A;  3A76 A;  1NB3 I;  2O3O A;  1OHO A;  1NWW A;  1IT8 A;  3UL5 A;  1JBR A;  3D79 A;  1FGO A;  1B2X A;  3ER7 A;  1Q7Y 4;  3NV0 B;  2P0M A;  1DVC A;  2CW9 A;  1I8V A;  1JKG A;  1UGH I;  5GSP A;  3UB1 A;  1GY6 A;  1IYY A;  2W9P A;  3G4S 3;  4NPB A;  1GMR A;  1TU5 A;  1TRP A;  1S5A A;  4X2O A;  3EF8 A;  3IMA B;  3NQY A;  3LT8 A;  1FUW A;  3HOH A;  1IT7 A;  1GY5 A;  4XM4 A;  1Q86 4;  5CK6 A;  1L5G B;  1LOY A;  1BRS A;  5ELU A;  2XR8 B;  2XF3 A;  6STD A;  4R9K A;  4CDL A;  3GZX B;  1OF5 B;  3EN8 A;  4MMY B;  1RGK A;  2QIY A;  3LT9 A;  1IK3 A;  4O3V A;  1I3I A;  2F98 A;  1UW1 A;  1QMA A;  2K54 A;  4LMI A;  2CG0 A;  2PNC A;  1K28 A;  4BU4 A;  1WTH A;  1MWT A;  2CFW A;  4O8S A;  2P05 A;  5CXO A;  1TJD A;  3X42 A;  1UCK A;  5AIG A;  3LYG A;  4N6U A;  2OTJ 3;  1RMS A;  1NO3 A;  1RDS A;  1Z1S A;  1WQL B;  2CWV A;  3N8B A;  2RCD A;  1FGT A;  4FR9 A;  5G2G A;  4BTW A;  1OH0 A;  1ROV A;  3DMC A;  2F5M A;  2CFG A;  3NUV A;  3CME 3;  1MWR A;  4HOH A;  5KP4 A;  2M7O A;  2KAA A;  5IEP A;  2PZV A;  3ZG0 A;  1WNH A;  1VQL 3;  5EEO A;  2D1W A;  4LEH A;  2HML B;  3EE1 A;  3CU3 A;  3DM8 A;  4XDV A;  1BNS A;  5IW9 A;  3CCJ 3;  1JBS A;  3MG2 A;  3S27 A;  4HZB B;  4FMB A;  1A90 A;  1O7N B;  3BLZ A;  1BSA A;  1ULJ B;  1US1 A;  2H0H A;  4IPB A;  4RNT A;  1I2F A;  5BVB A;  3BNB A;  3LOY A;  1FZU A;  1O7H B;  2CH9 A;  3SED A;  3EHC A;  1BNE A;  4WP5 A;  1IVV A;  1PYL A;  1VZZ A;  2IUK A;  4N3V A;  2QEX 3;  4AKZ A;  4QWT A;  1RN7 A;  4K1U A;  4XDW A;  1ISK A;  1Q7H A;  4FCM A;  1BAN A;  2C10 A;  2E2V A;  2RNT A;  4ORL A;  7GSP A;  1VQ6 3;  5M19 A;  3KCH A;  3KII A;  3D9R A;  1JNQ A;  3NBB A;  1VQ8 3;  1B20 A;  3FG3 A;  1N9E A;  3GAX A;  5EVH A;  1VQP 3;  2P38 A;  3DGN A;  1Q81 4;  1MGR A;  4EC6 A;  3DGO A;  1HYF A;  1M90 4;  3ZFZ A;  2W56 A;  2OCT A;  4HBR A;  1GMQ A;  2ML6 A;  4Q53 A;  5M1A A;  2IUJ A;  4RNY A;  4OUQ A;  1PFP A;  2XSH B;  1A2K A;  4L7K A;  1AQZ A;  2BHM A;  3PZW A;  1V74 A;  1NDO B;  4HM4 B;  1B21 A;  1YGW A;  1UI7 A;  4KVH A;  3RGR A;  3OWS A;  4KT3 B;  3BB9 A;  1LNH A;  5AYS C;  3FGY A;  1YNV X;  3JUP A;  5JBS A;  1N5P A;  2K0M A;  2KF5 A;  2XH9 A;  1BUQ A;  1C7H A;  3HK4 A;  4WWU C;  3CPO A;  3OX9 A;  2CWT A;  3EJV A;  3MWZ A;  1RGH A;  1DMQ A;  2QA4 3;  4OK0 A;  1YIJ 3;  3V98 A;  2WO0 A;  7STD A;  2AAE A;  1B2Z A;  3WOF B;  2CIU A;  4XB5 A;  2RGQ A;  5AYR B;  1T2I A;  3X40 A;  1OUN A;  1I2E A;  3FSD A;  1QVG 2;  2AAD A;  5IEN A;  4LYL B;  3CCM 3;  3CMA 3;  1YJW 3;  3MKI A;  3MPH A;  3NBR A;  3KFQ C;  3DGM A;  3DH2 A;  3JVC A;  4NHF A;  1W6Y A;  1LOX A;  2STD A;  3LTD A;  1TFK A;  3V92 A;  3Q90 A;  2KF3 A;  3SYU A;  3PXM A;  3WMD A;  1GD4 A;  3FH1 A;  1TRQ A;  3STD A;  2R4I A;  1LQM B;  2SAR A;  3TDG A;  2ZA4 A;  1N8R 4;  1JRQ A;  2LYX A;  1BSC A;  1IDP A;  4KFF A;  1B2S A;  3LZA A;  1W00 A;  4BL3 A;  2ZDJ A;  4FCZ A;  3CD6 3;  2FXT A;  3K63 A;  3EB8 A;  5IER A;  1K41 A;  1CYU A;  2BO9 B;  5D82 A;  1FGQ A;  1F8N A;  2CKF B;  1EQK A;  1IQX A;  3PCR A;  3T8N A;  1YGE A;  3ALA A;  1D6U A;  3AGO A;  1O7M B;  2YFL B;  3NX0 A;  1FYS A;  5LC6 A;  1AY7 A;  5DRV A;  1KWI A;  1LOV A;  1NB5 I;  5KP3 A;  3WHO A;  5FGO A;  1OHS A;  3WDG B;  2GEY A;  4BL2 A;  3A5E A;  1OAC A;  1OGZ A;  4KFE A;  2LQV A;  5CF2 A;  3CXC 2;  4X2H A;  1BRG A;  3BNC A;  4MEI A;  1YI2 3;  1R4C A;  1VQN 3;  4H61 A;  4GSP A;  3RNT A;  2Q07 A;  1Q40 A;  2HMJ B;  1X1Y A;  1HZ1 A;  2XGN A;  3AMO B;  3DZL A;  1W4N A;  1W6C A;  3D5I A;  2KXG A;  3SVA A;  2YX9 A;  4HZ9 B;  3LML A;  4CJN A;  3K0Z A;  3CCQ 3;  3CPW 2;  1GOU A;  2RSX A;  2C11 A;  4HM8 B;  1RNB A;  1IVW A;  1BAO A;  1O7G B;  1RN4 A;  1ROA A;  2RFR A;  4MMZ B;  1NJI 4;  2ZL8 A;  4JF8 A;  2A15 A;  3GZR A;  2GEX A;  1BU4 A;  2YFJ B;  4GB5 A;  5AIH A;  2XGL A;  5TGN A;  2W9Q A;  3KSE D;  1MWS A;  2L4V A;  5G1L A;  1KC8 4;  1RN1 A;  2W56 B;  2WOH A;  1WMN A;  3F8H A;  4LZI A;  4N6M A;  2GU3 A;  1QAL A;  4XBT A;  1RJO A;  1CH0 A;  4EV2 A;  1N5H A;  1NNV A;  4DKI A;  5HOH A;  3HI7 A;  2RBI A;  1D6Y A;  3GRD A;  3M8C A;  1FGR A;  3OV4 A;  1JV2 B;  1BSE A;  5AIF A;  3CNX A;  3LTB A;  2MF7 A;  4WFO A;  1YJN 3;  2E2T A;  2R41 A;  3I0Y A;  1BNF A;  1FUS A;  2CFL A;  3AHS A;  2F99 A;  5HGR A;  4HYZ A;  1Q82 4;  1OHP A;  1PY3 A;  1SIH A;  2GXF A;  2OWP A;  1T5Y A;  1X1W A;  1EUI C;  3F7X A;  3EQQ B;  3JUO A;  4MMX B;  3DXO A;  1E3V A;  3SXX A;  3MHE A;  3KZT A;  1LVN A;  2INX A;  3KKG A;  4R80 A;  2F4Y A;  2IA7 A;  1Q42 A;  3NV0 A;  2W0Q A;  1STD A;  3F8X A;  3FZW A;  4BTY A;  2YFI B;  3PGB A;  4PEJ A;  3PCS A;  5IG0 A;  2Z7A A;  3LTC A;  1JN5 A;  2W03 A;  3BIR A;  3EBY A;  2WOF A;  1SPU A;  2BIR A;  3EBT A;  4GHO A;  1K9M 4;  2CX1 A;  4ZM8 A;  2OOV C;  3IJE B;  3G6E 3;  1FA3 A;  4WHA A;  1N9J A;  3CC7 3;  1QJG A;  1BVI A;  1ZS7 A;  3DGL A;  2F86 B;  3MYT A;  1A2P A;  1BSB A;  4WYK B;  1BNR A;  2C4B A;  2ML5 A;  1OF5 A;  3G71 3;  1RGA A;  1SQW A;  2BNG A;  5AI1 A;  5IF6 A;  1EEJ A;  1BIR A;  3CC2 3;  4EXR A;  1B3S A;  2O9U X;  3V99 A;  2XFT A;  2P09 A;  4LGQ A;  3B8L A;  1B2M A;  1MNL A;  1NU3 A;  3T8U A;  1FUT A;  1EA2 A;  4R9L A;  1EKM A;  3S28 A;  1R4Y A;  2IY2 A;  3QK9 A;  3CCV 3;  1BNG A;  1UGI A;  5JPU A;  1N8Q A;  2GU1 A;  4KFD A;  3X3Y A;  1IQ8 A;  9RNT A;  3B4O A;  3S67 A;  4N6O B;  1BSD A;  3K5T A;  3G16 A;  3OW2 2;  1JKG B;  4AEQ A;  1U5O A;  1FGM A;  2L1S A;  3FKA A;  1D6Z A;  1KQS 2;  1V58 A;  3F40 A;  1K73 4;  1BRN L;  3T0U A;  2CHC A;  1Q40 B;  1BUJ A;  2CFD A;  3FLJ A;  1DVD A;  1G02 A;  4JRF A;  2SBL A;  1VQO 3;  1LOW A;  1S72 3;  2JQ5 A;  3BU4 A;  4RZM A;  1QAF A;  3D5G A;  3FG1 A;  4RBN A;  3URP A;  5STD A;  3NQZ A;  3Q2P A;  1TUH A;  3HII A;  2CG1 A;  1IU7 A;  3ROB A;  1JB5 A;  3U97 A;  5CLK A;  2HMM B;  3WOD G;  4BTX A;  5KP1 A;  1BNJ A;  1U8C B;  4CPK A;  1RHL A;  3E99 A;  5IG4 A;  2GBX B;  5AII A;  1V57 A;  4O02 B;  3S5C A;  1RGE A;  1ULI B;  1VQ7 3;  2CFK A;  1BNI A;  3IPT A;  1B2U A;  1IV9 A;  1UUG B;  2HMK B;  1AVK A;  1QVF 2;  4BIR A;  3X3Z A;  3CCS 3;  1PU4 A;  1GSP A;  3ECF A;  3NM7 A;  3D3L A;  4N6V 0;  2H0I A;  4EYC A;  2UGI A;  2J8X B;  2QGU A;  1AV4 A;  4HJL B;  1TP6 A;  4GL6 A;  4LSO A;  1W02 A;  1MOL A;  5RNT A;  1B27 A;  1C54 A;  2OQE A;  3Q1C A;  3BNE A;  1W5Z A;  1DMM A;  1VQK 3;  1W2B 2;  5M18 A;  3H3H A;  1SJW A;  1E97 A;  4N6T A;  1UUV B;  5I97 A;  4XBY A;  4HM2 B;  1J2B A;  2WGQ A;  3PS8 A;  3HX8 A;  3HZP A;  1E3R A;  1W2Z A;  3SLU A;  1M1K 4;  1RTU A;  1RCL A;  4TX4 A;  3RDE A;  4HM5 B;  5CF1 A;  3KN4 A;  1DMN A;  3MG3 A;  3JUQ A;  1BRK A;  3G8Z A;  3FG4 A;  1GD3 A;  3LXU X;  1HU9 A;  3S29 A;  1UI8 A;  5ELJ A;  1VQQ A;  2MC8 A;  1JN5 B;  1I70 A;  1VQ5 3;  2HMN B;  2OOV A;  1RKY A;  4CCV A;  3CCL 3;  1JB2 A;  4OVM A;  2HMO B;  1CQS A;  1GY7 A;  1OPY A;  1RGL A;  3O8Y A;  3K9M C;  3VSY A;  1BRI A;  5BU4 A;  4HM7 B;  1RRL A;  1G0T A;  3NBJ A;  4K61 A;  1RGC A;  4NRE A;  4N6L A;  1JJ2 2;  1T2H A;  2CX0 A;  2HOH A;  4FMC A;  4HAA A;  1K8A 4;  3GZB A;  2BMO B;  3FF2 A;  3AHW A;  3UL6 A;  6RNT A;  3CCR 3;  1O7W B;  4EW5 A;  1HKX A;  3CNM A;  1YVB I;  1GOY A;  2KRT A;  3D4A A;  1UCI A;  4K90 B;  2BT3 A;  2XEP A;  1SII A;  2B24 B;  1LQG C;  3UJM A;  5A0O B;  3B7C A;  3QRD A;  4EBG A;  3I56 3;  4HKV B;  2KF4 A;  1TIJ A;  5D83 A;  4HM0 B;  2OQE C;  3EX9 A;  2CC3 A;  1CYV A;  3NXJ A;  4O2H A;  8CHO A;  3DUK A;  1IV7 A;  3EN1 B;  1VQ4 3;  2UX0 A;  3N54 B;  3VF1 A;  4HM1 B;  1RLS A;  2B1X B;  5JPP A;  1AR0 A;  3EC9 A;  5D81 A;  1EG9 B;  1W01 A;  2UUG C;  3KE7 A;  3WOE B;  1YHQ 3;  4IT7 A;  5IG5 A;  1MWU A;  1BRJ A;  2OTL 3;  1UCJ A;  1JZD A;  1LNI A;  2E2U A;  3L0R A;  1JZO A;  1BGS A;  2F5W A;  3AMO A;  4HM6 B;  1RGF A;  3ZG5 A;  2KCD A;  2W04 A;  4STD A;  5IG3 A;  1W7C A;  4XBX A;  4J8T A;  1RSN A;  2CK3 H;  1KD1 4;  3F7S A;  2P0X A;  1O7P B;  3CCU 3;  5DRE A;  3LH4 A;  4HVN A;  1GMP A;  3BND A;  4I4K A;  1AVL A;  3GWR A;  4KZ1 A;  3B4P A;  4H3U A;  4J9A A;  1GS3 A;  3SX1 A;  5G1K A;  3OXA A;  1X1U A;  3RGA A;  1GYB A;  4ILF A;  1LXE A;  4L8P A;  4FMA A;  3X3X A;  1Q9E A;  1YVS A;  3KSP A;  2V1L A;  3MSO A;  1WMO A;  2Z6B A;  5LC7 A;  3H51 A;  4I5Q A;  1RCK A;  1JBT A;  3WA2 X;  3FCS B;  2F56 A;  3JUN A;  2H0G A;  4FCJ A;  1ASK A;  2I9W A;  1ZGX A;  2Y74 A;  3GZY B;  3OWU A;  6GSP A;  1M9G A;  3NM2 A;  3AGN A;  1X1X A;  1VQM 3;  2XSO B;  1ZO2 A;  4L8O A;  2Y73 A;  3LTA A;  3UNL A;  3Q3F A;  1YIT 3;  3GSP A;  3F9S A;  3MG1 A;  5EQL A;  3JUM A;  1DYU A;  3N9H A;  2BMR B;  2BU4 A;  5AEU B;  2WGO A;  2GBW B;  4N6N B;  3U1W A;  2GSP A;  3CC4 3;  1M1X B;  1ZX2 A;  1TTO A;  2IYJ A;  1MGW A;  3SOY A;  4FMD A;  1RGG A;  4U13 A;  1SAR A;  3F14 A;  3FF0 A;  1IVU A;  1BRH A;  1G96 A;  1GOV A;  2ZHX B;  1LRA A;  1T3B A;  2Z76 A;  2W6J H;  2IMJ A;  1KSI A;  2Z77 A;  4IIA A;  4R1K A;  4AKY A;  5BXQ A;  1UCL A;  4J5K A;  3DY5 A;  4J5G A;  1RNT A;  4MJD A;  8RNT A;  3WA3 A;  2D42 A;  5AEW B;  1STF I;  1DE3 A;  3HIG A;  1OGX A;  2CWU A;  1RRH A;  4K1V A;  3CCE 3;  7RNT A;  1UDI I;  1YJ9 3;  1A2V A;  1CEW I;  3I55 3;  5BIR A;  4G1M B;  5IEO A;  3WR2 A;  2KF6 A;  4R4K A;  1IQY A;  1I0X A;  1UUW B;  2JDI H;  4WYK A;  3VGN A;  1A67 A;  1I2G A;  1IVX A;  2XFS A;  2XRX B;  1FW7 A;  2FGT A;  1QAK A;  4HM3 B;  3X41 A;  3PYJ A;  4EV5 A;  3J7Y d;  2BMQ B;  1W6G A;  2FNQ A;  1VQ9 3;  3G0K A;  3DGY A;  3NHX A;  2K3D A; 
#chains in the Genus database with same CATH homology
 1OCV A;  3SOA A;  3OWY A;  1WMP A;  4RNZ A;  1TFO A;  1Y4K A;  5FW5 A;  3K7C A;  1JB4 A;  2W2C A;  3A76 A;  1NB3 I;  2O3O A;  1OHO A;  1NWW A;  1IT8 A;  3UL5 A;  1FGO A;  3ER7 A;  1Q7Y 4;  3NV0 B;  2P0M A;  1DVC A;  2CW9 A;  3UB1 A;  1JKG A;  1GY6 A;  2W9P A;  3G4S 3;  1TU5 A;  1S5A A;  4X2O A;  3EF8 A;  3IMA B;  3NQY A;  3LT8 A;  1FUW A;  1IT7 A;  1GY5 A;  4XM4 A;  1Q86 4;  5CK6 A;  1L5G B;  6STD A;  5ELU A;  2XR8 B;  2XF3 A;  4R9K A;  4CDL A;  3GZX B;  1OF5 B;  3EN8 A;  4MMY B;  2QIY A;  3LT9 A;  1IK3 A;  4O3V A;  2F98 A;  1UW1 A;  1QMA A;  2K54 A;  4LMI A;  2CG0 A;  2PNC A;  1K28 A;  1WTH A;  2CFW A;  4O8S A;  2P05 A;  5CXO A;  3X42 A;  5AIG A;  3LYG A;  4N6U A;  2OTJ 3;  1NO3 A;  1Z1S A;  1WQL B;  2CWV A;  3N8B A;  2RCD A;  1FGT A;  4FR9 A;  5G2G A;  4BTW A;  1OH0 A;  1ROV A;  3DMC A;  3CME 3;  2CFG A;  3NUV A;  5KP4 A;  2M7O A;  5IEP A;  2PZV A;  1WNH A;  1VQL 3;  2D1W A;  4LEH A;  2HML B;  3EE1 A;  3CU3 A;  3DM8 A;  4XDV A;  5IW9 A;  3CCJ 3;  3MG2 A;  3S27 A;  4HZB B;  4FMB A;  1A90 A;  1O7N B;  3BLZ A;  1ULJ B;  1US1 A;  4IPB A;  5BVB A;  3BNB A;  3LOY A;  2CH9 A;  1O7H B;  3SED A;  3EHC A;  4WP5 A;  1IVV A;  1VZZ A;  2IUK A;  4N3V A;  2QEX 3;  4AKZ A;  4QWT A;  1RN7 A;  4K1U A;  4XDW A;  1ISK A;  4FCM A;  2C10 A;  2E2V A;  4ORL A;  1VQ6 3;  3KII A;  3D9R A;  1JNQ A;  3NBB A;  1VQ8 3;  3FG3 A;  1N9E A;  3GAX A;  5EVH A;  1VQP 3;  2P38 A;  3DGN A;  1Q81 4;  4EC6 A;  3DGO A;  1M90 4;  2W56 A;  2OCT A;  4HBR A;  2ML6 A;  4Q53 A;  2IUJ A;  4RNY A;  4OUQ A;  1PFP A;  2XSH B;  1A2K A;  4L7K A;  2BHM A;  3PZW A;  1V74 A;  1NDO B;  4HM4 B;  4KVH A;  3RGR A;  1UI7 A;  3OWS A;  3BB9 A;  1LNH A;  5AYS C;  3FGY A;  3JUP A;  5JBS A;  1N5P A;  2K0M A;  2XH9 A;  1BUQ A;  1C7H A;  3HK4 A;  4WWU C;  3CPO A;  3OX9 A;  2CWT A;  3EJV A;  3MWZ A;  1YIJ 3;  1DMQ A;  2QA4 3;  4OK0 A;  3V98 A;  2WO0 A;  7STD A;  3WOF B;  2CIU A;  4XB5 A;  2RGQ A;  5AYR B;  3X40 A;  1OUN A;  3FSD A;  1QVG 2;  5IEN A;  3CCM 3;  3CMA 3;  1YJW 3;  3MKI A;  3MPH A;  3NBR A;  3KFQ C;  3DGM A;  3JVC A;  4NHF A;  1W6Y A;  1LOX A;  2STD A;  3LTD A;  1TFK A;  3V92 A;  3Q90 A;  3WMD A;  3PXM A;  1GD4 A;  3FH1 A;  3STD A;  2R4I A;  3TDG A;  1N8R 4;  1JRQ A;  2LYX A;  1IDP A;  4KFF A;  3LZA A;  1W00 A;  2ZDJ A;  4FCZ A;  3CD6 3;  2FXT A;  3K63 A;  3EB8 A;  5IER A;  1K41 A;  1CYU A;  2BO9 B;  5D82 A;  1FGQ A;  1F8N A;  2CKF B;  1EQK A;  1IQX A;  3PCR A;  3T8N A;  1YGE A;  3ALA A;  1D6U A;  1O7M B;  2YFL B;  3NX0 A;  5LC6 A;  5DRV A;  1KWI A;  1NB5 I;  5KP3 A;  5FGO A;  1OHS A;  3WDG B;  2GEY A;  1OAC A;  1OGZ A;  4KFE A;  2LQV A;  5CF2 A;  3CXC 2;  4X2H A;  3BNC A;  4MEI A;  1YI2 3;  1R4C A;  1VQN 3;  4H61 A;  2Q07 A;  1Q40 A;  2HMJ B;  2XGN A;  3AMO B;  3DZL A;  1W4N A;  1W6C A;  3SVA A;  2KXG A;  2YX9 A;  4HZ9 B;  3LML A;  3K0Z A;  3CCQ 3;  3CPW 2;  2RSX A;  2C11 A;  4HM8 B;  1IVW A;  2RFR A;  1O7G B;  1ROA A;  4MMZ B;  1NJI 4;  2ZL8 A;  4JF8 A;  2A15 A;  3GZR A;  2GEX A;  4GB5 A;  2YFJ B;  5AIH A;  2XGL A;  5TGN A;  2W9Q A;  3KSE D;  2L4V A;  1KC8 4;  2W56 B;  2WOH A;  1WMN A;  3F8H A;  4LZI A;  4N6M A;  2GU3 A;  1QAL A;  4XBT A;  1RJO A;  4EV2 A;  1N5H A;  3HI7 A;  1D6Y A;  3GRD A;  3M8C A;  1FGR A;  3OV4 A;  1JV2 B;  5AIF A;  3CNX A;  3LTB A;  2MF7 A;  4WFO A;  1YJN 3;  2E2T A;  3I0Y A;  2CFL A;  2F99 A;  5HGR A;  4HYZ A;  1Q82 4;  1OHP A;  2GXF A;  1SIH A;  2OWP A;  1T5Y A;  3F7X A;  3EQQ B;  3JUO A;  4MMX B;  3DXO A;  1E3V A;  3SXX A;  3MHE A;  3KZT A;  1LVN A;  2INX A;  3KKG A;  4R80 A;  2IA7 A;  1Q42 A;  3NV0 A;  2W0Q A;  1STD A;  3F8X A;  3FZW A;  4BTY A;  2YFI B;  3PGB A;  4PEJ A;  3PCS A;  5IG0 A;  2Z7A A;  3LTC A;  1JN5 A;  2W03 A;  3EBY A;  2WOF A;  1SPU A;  3EBT A;  1K9M 4;  4ZM8 A;  2OOV C;  3IJE B;  3G6E 3;  1FA3 A;  4WHA A;  1N9J A;  3CC7 3;  1QJG A;  3DGL A;  2F86 B;  3MYT A;  4WYK B;  2ML5 A;  1OF5 A;  3G71 3;  1SQW A;  2BNG A;  5AI1 A;  5IF6 A;  3CC2 3;  4EXR A;  3V99 A;  2O9U X;  2XFT A;  2P09 A;  4LGQ A;  3B8L A;  1MNL A;  1NU3 A;  3T8U A;  1EA2 A;  4R9L A;  1EKM A;  3S28 A;  3QK9 A;  3CCV 3;  5JPU A;  1N8Q A;  2GU1 A;  4KFD A;  3X3Y A;  1IQ8 A;  3B4O A;  3S67 A;  4N6O B;  3K5T A;  3G16 A;  3OW2 2;  1JKG B;  4AEQ A;  1U5O A;  1FGM A;  3FKA A;  1D6Z A;  1KQS 2;  3F40 A;  1K73 4;  3T0U A;  2CHC A;  1Q40 B;  2CFD A;  3FLJ A;  1DVD A;  4JRF A;  2SBL A;  1VQO 3;  1S72 3;  2JQ5 A;  4RZM A;  1QAF A;  4RBN A;  3FG1 A;  5STD A;  3NQZ A;  3Q2P A;  1TUH A;  3HII A;  2CG1 A;  1IU7 A;  3ROB A;  1JB5 A;  3U97 A;  5CLK A;  2HMM B;  3WOD G;  4BTX A;  5KP1 A;  1U8C B;  3E99 A;  5IG4 A;  2GBX B;  5AII A;  4O02 B;  3S5C A;  1ULI B;  1VQ7 3;  2CFK A;  3IPT A;  1IV9 A;  2HMK B;  1AVK A;  1QVF 2;  3X3Z A;  3CCS 3;  1PU4 A;  3ECF A;  3NM7 A;  3D3L A;  4N6V 0;  4EYC A;  2QGU A;  1AV4 A;  4HJL B;  1TP6 A;  4GL6 A;  4LSO A;  1W02 A;  1MOL A;  2OQE A;  3Q1C A;  3BNE A;  1W5Z A;  1DMM A;  1VQK 3;  1W2B 2;  3H3H A;  1SJW A;  1E97 A;  4N6T A;  1UUV B;  5I97 A;  4XBY A;  4HM2 B;  1J2B A;  2WGQ A;  3PS8 A;  3HX8 A;  3HZP A;  1E3R A;  1W2Z A;  3SLU A;  1M1K 4;  4TX4 A;  3RDE A;  4HM5 B;  5CF1 A;  3KN4 A;  1DMN A;  3MG3 A;  3JUQ A;  3G8Z A;  3FG4 A;  1GD3 A;  3LXU X;  1HU9 A;  3S29 A;  1UI8 A;  5ELJ A;  2MC8 A;  1JN5 B;  1VQ5 3;  2HMN B;  2OOV A;  1RKY A;  4CCV A;  3CCL 3;  1JB2 A;  4OVM A;  2HMO B;  1CQS A;  1GY7 A;  1OPY A;  3VSY A;  3O8Y A;  3K9M C;  4HM7 B;  1RRL A;  3NBJ A;  4K61 A;  1JJ2 2;  4NRE A;  4N6L A;  4FMC A;  1K8A 4;  3GZB A;  2BMO B;  3FF2 A;  3UL6 A;  3CCR 3;  1O7W B;  1HKX A;  3CNM A;  1YVB I;  2KRT A;  4K90 B;  2BT3 A;  2XEP A;  1SII A;  2B24 B;  5A0O B;  3UJM A;  3I56 3;  3B7C A;  3QRD A;  4EBG A;  4HKV B;  1TIJ A;  5D83 A;  4HM0 B;  2OQE C;  3EX9 A;  2CC3 A;  1CYV A;  3NXJ A;  4O2H A;  8CHO A;  3DUK A;  1IV7 A;  3EN1 B;  1VQ4 3;  2UX0 A;  3N54 B;  3VF1 A;  4HM1 B;  2B1X B;  5JPP A;  1AR0 A;  3EC9 A;  5D81 A;  1EG9 B;  1W01 A;  1YHQ 3;  3KE7 A;  3WOE B;  4IT7 A;  5IG5 A;  2OTL 3;  2E2U A;  3L0R A;  3AMO A;  4HM6 B;  2KCD A;  2W04 A;  4STD A;  5IG3 A;  1W7C A;  4XBX A;  4J8T A;  2CK3 H;  1KD1 4;  3F7S A;  2P0X A;  1O7P B;  3CCU 3;  5DRE A;  3LH4 A;  4HVN A;  3BND A;  4I4K A;  1AVL A;  3GWR A;  4KZ1 A;  3B4P A;  4H3U A;  4J9A A;  1GS3 A;  3SX1 A;  3OXA A;  3RGA A;  1GYB A;  1LXE A;  4L8P A;  4FMA A;  3X3X A;  3KSP A;  3MSO A;  2V1L A;  5LC7 A;  1WMO A;  2Z6B A;  3H51 A;  3WA2 X;  3FCS B;  3JUN A;  4FCJ A;  1ASK A;  2I9W A;  2Y74 A;  3GZY B;  3OWU A;  1M9G A;  3NM2 A;  1VQM 3;  2XSO B;  1ZO2 A;  4L8O A;  2Y73 A;  3LTA A;  3UNL A;  1YIT 3;  3F9S A;  3MG1 A;  5EQL A;  3JUM A;  1DYU A;  3N9H A;  2BMR B;  5AEU B;  2WGO A;  2GBW B;  4N6N B;  3U1W A;  3CC4 3;  1M1X B;  1ZX2 A;  3SOY A;  4FMD A;  4U13 A;  3F14 A;  3FF0 A;  1IVU A;  1G96 A;  2Z76 A;  2W6J H;  2IMJ A;  1KSI A;  2Z77 A;  4IIA A;  4R1K A;  4AKY A;  5BXQ A;  3DY5 A;  4MJD A;  3WA3 A;  2D42 A;  5AEW B;  1STF I;  3HIG A;  1OGX A;  2CWU A;  1RRH A;  4K1V A;  3CCE 3;  1YJ9 3;  1A2V A;  1CEW I;  3I55 3;  4G1M B;  5IEO A;  4R4K A;  1IQY A;  4WYK A;  1UUW B;  2JDI H;  1A67 A;  3VGN A;  1IVX A;  2XFS A;  2XRX B;  2FGT A;  1QAK A;  4HM3 B;  3X41 A;  3PYJ A;  4EV5 A;  3J7Y d;  2BMQ B;  1W6G A;  2FNQ A;  1VQ9 3;  3G0K A;  3NHX A;  5EEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...