3M8CA

Crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi) with equilenin bound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase D99N from Pseudomonas Testosteroni (tKSI) with Equilenin Bound
rcsb
source organism Comamonas testosteroni
total genus 37
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3m8cA00
4H3UA 2B1XB 3T8UA 2RCDA 1OPYA 4OUQA 1ASKA 3HZPA 1DMMA 3M8CA 3JUNA 3JUPA 4CDLA 3RGAA 1JN5A 3T8NA 5IF6A 1Z1SA 4R9LA 2W2CA 2Z77A 3F7SA 5FW5A 3S5CA 4FCJA 2HMMB 3I0YA 3FH1A 1E3RA 1Q40A 4XB5A 1GS3A 1JB2A 3LYGA 4ORLA 3B4PA 3ROBA 3G0KA 3F40A 2RFRA 2F98A 1OHOA 3NBRA 3NHXA 1E97A 2XSOB 3MG3A 3D9RA 2GEYA 4U13A 5IENA 4LMIA 3OV4A 1WQLB 3MG1A 4HM5B 1NU3A 4XDVA 4R1KA 3WMDA 2BMQB 4L8OA 3GWRA 5STDA 1SJWA 2INXA 1OH0A 3K7CA 5CLKA 3MSOA 2YFLB 8CHOA 1O7HB 3LZAA 2I9WA 2UX0A 5AEUB 5IERA 3F8HA 3MG2A 2HMLB 4HM8B 5IG4A 5KP4A 4HM0B 1JB4A 1OGZA 3EBTA 3HX8A 1HKXA 3MHEA 4I4KA 3JUOA 3STDA 5D81A 1JN5B 4XBXA 1U5OA 3EQQB 4R9KA 4K1VA 1OUNA 4PEJA 4LEHA 1GY6A 1Q40B 2F99A 1STDA 1K41A 2PZVA 3F8XA 1E3VA 3EBYA 3Q90A 1GYBA 3CNXA 2HMOB 2BMOB 1OGXA 4HKVB 1OF5A 2GXFA 4WP5A 2BMRB 3EHCA 3OWYA 2HMJB 3CU3A 3GRDA 3KKGA 5BXQA 5IG5A 3BB9A 2RGQA 2GBXB 3BLZA 4HZ9B 3HK4A 2GEXA 1AR0A 1A2KA 5TGNA 6STDA 2HMKB 1DMQA 1NWWA 4K1UA 3H3HA 5IG3A 3A76A 4XM4A 3FLJA 1O7MB 3EF8A 1UUWB 1W01A 3B4OA 5G2GA 1O7NB 5D82A 5D83A 4STDA 3F7XA 1W00A 4WYKB 3JUQA 2BNGA 1QMAA 4L8PA 4HM7B 5CF1A 4L7KA 1EA2A 4HVNA 1JB5A 1UUVB 3B7CA 2F86B 1W6YA 3SOYA 2R4IA 3EJVA 4WWUC 2CKFB 1GY7A 1OHPA 2XR8B 4X2HA 3NXJA 1ZO2A 3EN8A 4MJDA 1C7HA 1CQSA 3GZXB 3E99A 3MYTA 5JPUA 2XSHB 3SEDA 1JKGA 1QJGA 4LGQA 2XRXB 3IPTA 3FKAA 5HGRA 3OX9A 1OHSA 4Q53A 3FF0A 3DXOA 3G8ZA 3G16A 4XBTA 3JUMA 1DMNA 3KSPA 2K54A 3DZLA 1W02A 2HMNB 2YFJB 5IG0A 1OCVA 3OXAA 5AIHA 4HJLB 1BUQA 5JPPA 1S5AA 2STDA 4X2OA 3CPOA 3UNLA 4XDWA 1NDOB 3DUKA 3FZWA 4KVHA 1ULJB 4J9AA 4OVMA 5IEOA 3F9SA 2QGUA 3NV0A 4XBYA 3ER7A 5DREA 1TP6A 5KP1A 2IMJA 3ECFA 1ULIB 4HM4B 3DMCA 1VZZA 1GY5A 2Z76A 3NUVA 5CF2A 1TUHA 5AI1A 5AIFA 4IIAA 4FCMA 3H51A 3FGYA 4J8TA 2A15A 3FF2A 5AIGA 1JKGB 3CNMA 1IDPA 2QIYA 1O7PB 2CHCA 3OWSA 2B24B 2YFIB 4HM6B 3K0ZA 3SOAA 2OWPA 4HM1B 5CK6A 3NM2A 7STDA 1ZX2A 3RGRA 3MKIA 4N3VA 3GZBA 5DRVA 1OF5B 3EN1B 5IEPA 2Z7AA 3DM8A 3KZTA 3OWUA 3EX9A 1O7GB 3KE7A 4WYKA 3VSYA 1Q42A 1ISKA 2JQ5A 1O7WB 4GB5A 3FSDA 3B8LA 5BVBA 3VGNA 4HZBB 3GZRA 3NV0B 4HM3B 5KP3A 1EG9B 3EC9A 4RZMA 3UJMA 4HM2B 2GBWB 5CXOA 3F14A 5AIIA 5EVHA 5AEWB 3GZYB
chains in the Genus database with same CATH superfamily
4H3UA 4N6OB 3CC73 3HIGA 2B1XB 3WA3A 1RJOA 3T8UA 1DVCA 4EXRA 2RCDA 1BSCA 2W56A 2W6JH 1OPYA 3D5IA 1ASKA 1BNEA 3HZPA 4OUQA 2F5MA 1VQL3 1G0TA 1DMMA 2XGLA 1BU4A 3M8CA 4KZ1A 3JUNA 3JUPA 4CDLA 2YX9A 1B2SA 3FG3A 3RGAA 1JN5A 3T8NA 2FNQA 2XFTA 1Z1SA 4H61A 2BO9B 5IF6A 4R9LA 2ZHXB 2W2CA 1IT8A 2Z77A 2CK3H 3DGOA 3F7SA 5LC7A 1JBTA 3X41A 3MPHA 1BUJA 5FW5A 3S5CA 2RNTA 1C54A 2KF5A 4K61A 1K9M4 4FCZA 4FCJA 2HMMB 2CG0A 1J2BA 4BU4A 3I0YA 3FH1A 4MMXB 4BTWA 2CX1A 1E3RA 1YJN3 1Q40A 4CCVA 4XB5A 1UCJA 1GS3A 3DY5A 1JB2A 1FW7A 1IK3A 3LYGA 1FZUA 1RN4A 1MWRA 3B4PA 3PS8A 3G0KA 4ORLA 1B20A 1PYLA 3ROBA 1LOWA 4EV2A 2W9PA 7RNTA 3F40A 3WDGB 5BU4A 2RFRA 1LNHA 2F98A 1OHOA 3NBRA 3WR2A 1BRKA 1QAKA 3NHXA 1IVVA 1RGLA 1VQ73 3G713 2K0MA 2FGTA 1E97A 2XSOB 5IW9A 1T5YA 1QVF2 3MG3A 3D9RA 1Q7HA 2GEYA 4U13A 2WGQA 5IENA 1I70A 4LMIA 1PFPA 3OV4A 2Q07A 2JDIH 4EV5A 1HYFA 1WQLB 2H0GA 3GSPA 2RBIA 3MG1A 3X3YA 1NJI4 4HM5B 2OCTA 1NU3A 3D4AA 4XDVA 1QAFA 1V57A 3CCJ3 1LOXA 4R1KA 3WMDA 2BMQB 1SIIA 3SVAA 1I2EA 2HOHA 4N6MA 4L8OA 3GWRA 1NB5I 1Q814 3LTCA 5STDA 1ROVA 4O8SA 1SJWA 1UGHI 2INXA 1JNQA 1OH0A 2CWUA 1TIJA 3PXMA 3K7CA 5CLKA 1BRGA 1MOLA 3MSOA 1LNIA 2WGOA 2CWVA 2YFLB 3BNDA 3T0UA 8CHOA 5LC6A 3N54B 2C10A 3BNBA 4J5GA 1VQ93 1FYSA 1RCKA 1O7HB 1K8A4 3A5EA 2FXTA 3GAXA 3LZAA 1RTUA 2I9WA 2L4VA 3CCL3 1BRSA 1IV7A 3AHSA 2UX0A 3D3LA 3S28A 5AEUB 1WMPA 5IERA 3F8HA 3MG2A 2HMLB 2BU4A 4HM8B 1QVG2 2F56A 3VF1A 3BU4A 5IG4A 5KP4A 4HM0B 1JB4A 3D5GA 1OGZA 3EBTA 3HX8A 4FMDA 4HOHA 1JBSA 1HKXA 2CFLA 1B2MA 1I2GA 3MHEA 1W5ZA 2W56B 3BNEA 4I4KA 4FR9A 3JUOA 5JBSA 4G1MB 3STDA 1VQ43 4JF8A 4N6V0 5D81A 1PY3A 1YI23 1B2ZA 1JN5B 3QRDA 4XBXA 1RLSA 3SXXA 3CCE3 4EW5A 1BNSA 3DGYA 4IT7A 1B3SA 1U5OA 3EQQB 4R9KA 1A90A 4K1VA 1RCLA 1IQXA 2IY2A 2H0HA 1N5PA 2J8XB 1OUNA 3LTBA 4PEJA 4LEHA 1JV2B 1US1A 1LVNA 2IYJA 1GY6A 1Q40B 2F99A 3ZFZA 3TDGA 1STDA 1UI7A 1IVWA 1K41A 1TFOA 2E2TA 3AGOA 1R4CA 1BVIA 2PZVA 3AMOB 3PCSA 3F8XA 1E3VA 3EBYA 3DH2A 3Q90A 2KF4A 4DKIA 1GYBA 1QALA 5RNTA 3CNXA 1M1K4 2CC3A 2BHMA 2CW9A 2HMOB 2BMOB 1OGXA 1CYVA 2W0QA 3LT9A 1I3FA 4HKVB 3S27A 3PCRA 1OF5A 1FGRA 1N8QA 1UCKA 2GXFA 3IMAB 2AAEA 2PNCA 4WP5A 1VQ83 1AVKA 1T3BA 2BMRB 1Q864 4BL3A 1BSEA 2RSXA 2D42A 5EEOA 3EHCA 3OWYA 1YHQ3 1W6CA 2HMJB 3CU3A 3GRDA 3KKGA 5BXQA 4FMBA 3BB9A 3WOEB 5IG5A 1EQKA 2WOHA 2W9QA 2RGQA 4KFDA 3HIIA 2GBXB 3IJEB 3BLZA 3CCU3 4HZ9B 4IPBA 3HK4A 1X1UA 8RNTA 2IUJA 2GEXA 1AR0A 3KCHA 1A67A 1PU4A 4AKZA 1A2KA 5TGNA 6STDA 2ML5A 1DETA 2KAAA 1BNIA 1UI8A 2HMKB 3J7Yd 1DMQA 1NNVA 1NWWA 2Y73A 2OOVA 3CPW2 2QA43 4K1UA 3S29A 3H3HA 5IG3A 3A76A 4XM4A 3FLJA 1O7MB 3EF8A 4N6LA 1YIJ3 1FA3A 1BNGA 3WODG 1WMOA 1FGTA 1UUWB 1W01A 2P0MA 3B4OA 1GOVA 1GMRA 1MWUA 1RN7A 5G2GA 1G96A 1O7NB 3WOFB 1K734 5D82A 4FMCA 4J5KA 4QWTA 5D83A 2OTL3 4STDA 3WHOA 3F7XA 1DE3A 3O8YA 2LYXA 6GSPA 1LQMB 1RDSA 1RGFA 1W00A 3K63A 4WYKB 3S67A 4R4KA 6RNTA 3JUQA 2BNGA 4NREA 1QMAA 1IT7A 1RGEA 4L8PA 1T2HA 1RGGA 4HM7B 5CF1A 5M19A 1KSIA 3X3ZA 4L7KA 1EA2A 4HVNA 4WHAA 9RNTA 4BIRA 1RKYA 3V98A 1YVBI 1JB5A 1W2B2 1CYUA 3CCR3 1I0VA 1YNVX 4KFEA 3UB1A 1UUVB 2F86B 1LXEA 1RMSA 3B7CA 5I97A 3OW22 3ALAA 1IVXA 1EUIC 1UUGB 1GMQA 1ZS7A 1WNHA 1W6YA 2OQEC 3PYJA 2R4IA 3EJVA 3SOYA 4WWUC 1A2PA 3Q1CA 3LT8A 4RNYA 4GHOA 3KN4A 3PZWA 1WMNA 1BSAA 2OTJ3 1TRPA 1RRLA 2CKFB 2XF3A 1GY7A 1OHPA 4ILFA 3EE1A 3RDEA 2BT3A 4LSOA 4HAAA 2XR8B 1WTHA 4JRFA 3CC23 1BRJA 1X1WA 4X2HA 3SLUA 3NXJA 2SBLA 1YIT3 1SQWA 1GD4A 1VQ63 1ZO2A 3EN8A 5AYRB 1BRIA 1C7HA 4MJDA 1CQSA 1MGRA 3V99A 3GZXB 5BIRA 1D6YA 1AV4A 1HZ1A 3E99A 2XFSA 4ZM8A 1KWIA 2O9UX 1UW1A 3MYTA 2KCDA 1UCIA 5JPUA 4NPBA 2XSHB 1VQO3 3CMA3 3K5TA 3SEDA 1TFKA 1UDII 1ZGXA 1JKGA 4BTYA 1QJGA 1DYUA 4LGQA 3NBBA 3LTAA 1CH0A 2D1WA 2XRXB 3IPTA 3FKAA 3N9HA 5HGRA 3OX9A 1OHSA 3DGNA 1I2FA 4Q53A 3KIIA 3G6E3 1B27A 3FF0A 1MNLA 1M1XB 2WOFA 3DXOA 3G8ZA 1STFI 3V92A 2GU3A 3NBJA 4N6NB 3G16A 3X42A 2C4BA 2OOVC 1BNFA 4XBTA 2OQEA 3BNCA 3JUMA 3AHWA 1LRAA 1NO3A 2ZL8A 1DMNA 1N5HA 1TRQA 1TTOA 3KSPA 4N6TA 2K54A 1I3IA 2K3DA 2KF6A 1Q9EA 3ZG0A 1G02A 3DZLA 1LOYA 3HOHA 3D79A 1W02A 3LMLA 2WO0A 1ROAA 2C11A 2HMNB 3CCS3 1SIHA 2YFJB 5IG0A 4BTXA 4OK0A 1OCVA 3UL6A 3NX0A 1BGSA 3KFQC 3OXAA 1KQS2 5AIHA 4HJLB 2GSPA 4RNZA 3G4S3 2Z6BA 3CC43 3NQYA 3CD63 1BOXA 1GMPA 4KT3B 5JPPA 1S5AA 1BUQA 1FGOA 2STDA 3NM7A 3URPA 4X2OA 7GSPA 2UGIA 3CPOA 1VQN3 4GSPA 4I5QA 3UL5A 1LOVA 1YVSA 3UNLA 2CX0A 4XDWA 1AY7A 1B21A 1NDOB 2KXGA 4BL2A 1I8VA 3DUKA 2H0IA 4RBNA 3N8BA 5ELJA 1TJDA 3FZWA 4KVHA 3LTDA 1ULJB 3HI7A 4J9AA 1M9GA 4OVMA 1EEJA 1U8CB 2XGNA 4CPKA 2CH9A 3FCSB 1FGQA 5IEOA 3F9SA 2QEX3 2QGUA 2F5WA 1N9JA 1FGMA 4FMAA 5EQLA 3NV0A 1VQK3 3CCM3 4XBYA 4CJNA 1BRNL 4GL6A 3ER7A 4LYLB 4O3VA 3U97A 2F4YA 3DGMA 5DREA 1JJ22 2E2UA 1TP6A 1T2IA 2ML6A 1SARA 2LQVA 5KP1A 1BNJA 2IMJA 1N8R4 4MEIA 4R80A 1RRHA 2KRTA 3ZG5A 2CFWA 2XEPA 1Y4KA 2BIRA 1D6UA 3SYUA 1FUTA 3ECFA 1NB3I 5ELUA 2M7OA 1VQ53 3AMOA 1KD14 2UUGC 1MWTA 4HBRA 1JZOA 1ULIB 1V58A 1F8NA 3DMCA 1GSPA 4HM4B 2L1SA 1VZZA 4AKYA 1GY5A 2Z76A 4RNTA 1RGKA 1X1XA 3NUVA 4KFFA 1V74A 5CF2A 1W4NA 4HYZA 1UCLA 1VQM3 1RNBA 1TUHA 4MMYB 5AI1A 5AIFA 4IIAA 1RHLA 3BIRA 4FCMA 1RGAA 3H51A 4EC6A 3L0RA 3FGYA 3LH4A 1BSBA 1W6GA 1FUSA 1W7CA 4J8TA 2A15A 4LZIA 3QK9A 2W04A 4O2HA 3FF2A 1JKGB 1B2XA 3GZYB 5AIGA 1IQYA 3CNMA 1IDPA 1RSNA 2QIYA 5GSPA 1YJW3 1CEWI 4WFOA 5M1AA 3I563 1O7PB 1RGCA 2CHCA 3X40A 2KF3A 3OWSA 2MF7A 3SX1A 1MWSA 2B24B 1HU9A 4NHFA 3CME3 1UGIA 1IV9A 2YFIB 4HM6B 5M18A 3K0ZA 2CFKA 3SOAA 1RN1A 4HM1B 1AQZA 5CK6A 1BAOA 3NM2A 7STDA 1ZX2A 5HOHA 3EB8A 1GOYA 1FUWA 2CWTA 3RGRA 2XH9A 1BNRA 2ZA4A 3DGLA 3MKIA 4N3VA 1A2VA 4N6UA 4O02B 1KC84 1VQQA 1LQGC 2O3OA 1W2ZA 3NQZA 4K90B 1M904 1TU5A 4AEQA 2P38A 2P09A 3GZBA 3FG1A 1L5GB 1YJ93 4TX4A 5A0OB 3CCQ3 1GOUA 1YGEA 3CXC2 3RNTA 2V1LA 4MMZB 5DRVA 3X3XA 1OF5B 3EN1B 4EBGA 2SARA 5IEPA 2Z7AA 1S723 1AVLA 1BIRA 3DM8A 3CCV3 1MGWA 1BSDA 3KZTA 3OWUA 1B2UA 1JBRA 1K28A 1D6ZA 3EX9A 3Q2PA 2R41A 1O7GB 3KE7A 4WYKA 3Q3FA 1VQP3 3VSYA 1Q42A 1ISKA 1YGWA 2CFGA 1BANA 1OACA 3U1WA 2P05A 2JQ5A 2IA7A 1DVDA 3I553 3LXUX 3FG4A 1O7WB 4GB5A 2P0XA 3FSDA 3B8LA 1RNTA 5BVBA 1IYYA 5G1LA 2GU1A 3VGNA 2AADA 1IU7A 4HZBB 1GD3A 3GZRA 3NV0B 1EKMA 2ZDJA 1BRHA 2IUKA 1Q7Y4 4HM3B 2MC8A 2CIUA 1N9EA 5KP3A 3PGBA 2CG1A 1EG9B 3EC9A 5FGOA 5AYSC 4RZMA 3UJMA 4EYCA 3KSED 1JZDA 1SPUA 3JVCA 1IVUA 4HM2B 2W03A 1JRQA 2Y74A 1I0XA 2GBWB 5CXOA 3F14A 5AIIA 3WA2X 1Q824 5G1KA 5EVHA 1R4YA 2E2VA 3K9MC 1X1YA 3AGNA 1RGHA 1IQ8A 2CFDA 5AEWB 3LOYA 3MWZA 2OWPA
chains in the Genus database with same CATH topology
4H3UA 4N6OB 3CC73 3HIGA 2B1XB 3WA3A 1RJOA 3T8UA 1DVCA 4EXRA 2RCDA 2W56A 2W6JH 1OPYA 4OUQA 1ASKA 3HZPA 1VQL3 1DMMA 2XGLA 3M8CA 4KZ1A 3JUNA 3JUPA 4CDLA 2YX9A 3FG3A 3RGAA 1JN5A 3T8NA 2FNQA 2XFTA 1Z1SA 4H61A 2BO9B 5IF6A 4R9LA 2W2CA 1IT8A 2Z77A 2CK3H 3DGOA 3F7SA 5LC7A 3X41A 3MPHA 5FW5A 3S5CA 4K61A 1K9M4 4FCZA 4FCJA 2HMMB 2CG0A 1J2BA 3I0YA 3FH1A 4MMXB 4BTWA 1E3RA 1YJN3 1Q40A 4CCVA 4XB5A 1GS3A 3DY5A 1JB2A 1IK3A 3LYGA 4ORLA 3B4PA 3PS8A 3G0KA 3ROBA 4EV2A 2W9PA 3F40A 3WDGB 2RFRA 1LNHA 2F98A 1OHOA 3NBRA 1QAKA 3NHXA 1IVVA 1VQ73 3G713 2K0MA 2FGTA 1E97A 2XSOB 5IW9A 1T5YA 1QVF2 3MG3A 3D9RA 2GEYA 4U13A 2WGQA 5IENA 4LMIA 1PFPA 3OV4A 2Q07A 2JDIH 4EV5A 1WQLB 3MG1A 3X3YA 1NJI4 4HM5B 2OCTA 1NU3A 4XDVA 1QAFA 3CCJ3 1LOXA 4R1KA 3WMDA 2BMQB 1SIIA 3SVAA 4N6MA 4L8OA 3GWRA 1NB5I 1Q814 3LTCA 5STDA 1ROVA 4O8SA 1SJWA 2INXA 1JNQA 1OH0A 2CWUA 1TIJA 3PXMA 3K7CA 5CLKA 1MOLA 3MSOA 2WGOA 2CWVA 2YFLB 3BNDA 3T0UA 8CHOA 5LC6A 3N54B 2C10A 3BNBA 1VQ93 1O7HB 1K8A4 2FXTA 3GAXA 3LZAA 2I9WA 2L4VA 3CCL3 1IV7A 3D3LA 2UX0A 3S28A 5AEUB 1WMPA 5IERA 3F8HA 3MG2A 2HMLB 4HM8B 1QVG2 3VF1A 5IG4A 5KP4A 4HM0B 1JB4A 1OGZA 3EBTA 3HX8A 4FMDA 2CFLA 1HKXA 3MHEA 2W56B 1W5ZA 3BNEA 4I4KA 4FR9A 3JUOA 5JBSA 4G1MB 3STDA 1VQ43 4JF8A 4N6V0 5D81A 1YI23 1JN5B 3QRDA 4XBXA 3SXXA 3CCE3 4IT7A 1U5OA 3EQQB 4R9KA 1A90A 4K1VA 1IQXA 1N5PA 1OUNA 3LTBA 4PEJA 4LEHA 1JV2B 1US1A 1LVNA 1GY6A 1Q40B 2F99A 3TDGA 1STDA 1UI7A 1IVWA 1K41A 1TFOA 2E2TA 3AMOB 1R4CA 2PZVA 3PCSA 3F8XA 1E3VA 3EBYA 3Q90A 1GYBA 1QALA 3CNXA 1M1K4 2CC3A 2BHMA 2CW9A 2HMOB 2BMOB 1OGXA 1CYVA 2W0QA 3LT9A 4HKVB 3S27A 3PCRA 1OF5A 1FGRA 1N8QA 2GXFA 3IMAB 4WP5A 2PNCA 1VQ83 1AVKA 2BMRB 1Q864 2RSXA 2D42A 5EEOA 3EHCA 3OWYA 1YHQ3 1W6CA 2HMJB 3CU3A 3GRDA 3KKGA 5BXQA 4FMBA 3BB9A 3WOEB 5IG5A 1EQKA 2WOHA 2W9QA 2RGQA 4KFDA 3HIIA 2GBXB 3IJEB 3BLZA 3CCU3 4HZ9B 4IPBA 3HK4A 2IUJA 2GEXA 1AR0A 1A67A 1PU4A 4AKZA 1A2KA 5TGNA 6STDA 2ML5A 2HMKB 1UI8A 3J7Yd 1DMQA 2OOVA 1NWWA 2Y73A 3CPW2 2QA43 4K1UA 3S29A 3H3HA 5IG3A 3A76A 4XM4A 3FLJA 1O7MB 3EF8A 4N6LA 1YIJ3 1FA3A 3WODG 1WMOA 1FGTA 1UUWB 1W01A 2P0MA 3B4OA 1RN7A 5G2GA 1K734 1G96A 1O7NB 3WOFB 5D82A 4FMCA 4QWTA 5D83A 2OTL3 4STDA 3F7XA 3O8YA 2LYXA 1W00A 4WYKB 3K63A 3S67A 4R4KA 3JUQA 2BNGA 4NREA 1QMAA 1IT7A 4L8PA 4HM7B 5CF1A 1KSIA 3X3ZA 4L7KA 1EA2A 4HVNA 4WHAA 1RKYA 3V98A 1YVBI 1JB5A 1W2B2 1CYUA 3CCR3 4KFEA 3UB1A 1UUVB 2F86B 1LXEA 3B7CA 5I97A 3OW22 3ALAA 1IVXA 1WNHA 1W6YA 2OQEC 3PYJA 2R4IA 3EJVA 3SOYA 4WWUC 3Q1CA 4RNYA 3LT8A 3KN4A 3PZWA 1WMNA 2OTJ3 1RRLA 2CKFB 2XF3A 1GY7A 1OHPA 3EE1A 3RDEA 2BT3A 4LSOA 2XR8B 1WTHA 4JRFA 3CC23 4X2HA 3SLUA 3NXJA 2SBLA 1YIT3 1SQWA 1GD4A 1VQ63 1ZO2A 3EN8A 5AYRB 4MJDA 1C7HA 1CQSA 3V99A 3GZXB 1D6YA 1AV4A 3E99A 2XFSA 4ZM8A 1KWIA 2O9UX 1UW1A 3MYTA 2KCDA 5JPUA 3CMA3 1VQO3 2XSHB 3K5TA 3SEDA 1TFKA 1JKGA 4BTYA 1QJGA 1DYUA 4LGQA 3NBBA 3LTAA 2XRXB 2D1WA 3IPTA 3FKAA 3N9HA 5HGRA 3OX9A 1OHSA 3DGNA 4Q53A 3G6E3 3KIIA 3FF0A 1MNLA 1M1XB 2WOFA 3DXOA 3G8ZA 1STFI 3V92A 2GU3A 3NBJA 4N6NB 3G16A 3X42A 2OOVC 4XBTA 2OQEA 3BNCA 3JUMA 1NO3A 2ZL8A 1DMNA 1N5HA 3KSPA 4N6TA 2K54A 3DZLA 3LMLA 1W02A 2WO0A 1ROAA 2C11A 2HMNB 3CCS3 1SIHA 2YFJB 5IG0A 4BTXA 4OK0A 1OCVA 3UL6A 3NX0A 3KFQC 3OXAA 1KQS2 5AIHA 4HJLB 4RNZA 3G4S3 2Z6BA 3CC43 3NQYA 3CD63 1BUQA 5JPPA 1S5AA 1FGOA 2STDA 3NM7A 4X2OA 3CPOA 1VQN3 3UL5A 3UNLA 4XDWA 1NDOB 2KXGA 3DUKA 4RBNA 3N8BA 5ELJA 3FZWA 4KVHA 3LTDA 1ULJB 3HI7A 4J9AA 1M9GA 4OVMA 2XGNA 1U8CB 2CH9A 3FCSB 1FGQA 5IEOA 3F9SA 2QEX3 2QGUA 4FMAA 1N9JA 1FGMA 5EQLA 3NV0A 1VQK3 3CCM3 4XBYA 4GL6A 3ER7A 4O3VA 3U97A 3DGMA 5DREA 1JJ22 2E2UA 1TP6A 2ML6A 2LQVA 5KP1A 2IMJA 1N8R4 4MEIA 4R80A 1RRHA 2KRTA 2CFWA 2XEPA 1Y4KA 1D6UA 3ECFA 1NB3I 5ELUA 2M7OA 1VQ53 3AMOA 1KD14 4HBRA 1ULIB 4HM4B 1F8NA 3DMCA 4AKYA 1VZZA 1GY5A 2Z76A 3NUVA 4KFFA 1V74A 5CF2A 1W4NA 4HYZA 1VQM3 1TUHA 4MMYB 5AI1A 5AIFA 4IIAA 4FCMA 3H51A 4EC6A 3L0RA 3FGYA 3LH4A 1W7CA 1W6GA 4J8TA 2A15A 4LZIA 3QK9A 2W04A 4O2HA 3FF2A 1JKGB 5AIGA 3GZYB 1IQYA 3CNMA 1IDPA 2QIYA 1YJW3 1CEWI 4WFOA 3I563 1O7PB 2CHCA 3X40A 3OWSA 2MF7A 3SX1A 3CME3 2B24B 1HU9A 4NHFA 1IV9A 2YFIB 4HM6B 3K0ZA 2CFKA 3SOAA 4HM1B 5CK6A 3NM2A 7STDA 1ZX2A 3EB8A 1FUWA 2CWTA 3RGRA 2XH9A 3DGLA 3MKIA 4N3VA 1A2VA 4N6UA 4O02B 1KC84 2O3OA 1W2ZA 3NQZA 4K90B 1M904 1TU5A 4AEQA 2P38A 2P09A 3GZBA 3FG1A 1L5GB 1YJ93 4TX4A 5A0OB 3CCQ3 1YGEA 3CXC2 2V1LA 4MMZB 5DRVA 3X3XA 1OF5B 3EN1B 4EBGA 5IEPA 2Z7AA 1S723 1AVLA 3DM8A 3CCV3 3KZTA 3OWUA 1K28A 1D6ZA 3EX9A 3Q2PA 1O7GB 3KE7A 4WYKA 1VQP3 3VSYA 1Q42A 1ISKA 2CFGA 3U1WA 1OACA 2P05A 2JQ5A 2IA7A 1DVDA 3I553 3LXUX 3FG4A 1O7WB 4GB5A 2P0XA 3FSDA 3B8LA 5BVBA 2GU1A 3VGNA 1IU7A 4HZBB 1GD3A 3GZRA 3NV0B 1EKMA 2ZDJA 2IUKA 1Q7Y4 4HM3B 2MC8A 2CIUA 1N9EA 5KP3A 3PGBA 2CG1A 1EG9B 3EC9A 5FGOA 5AYSC 4RZMA 3UJMA 4EYCA 3KSED 1SPUA 3JVCA 1IVUA 4HM2B 2W03A 1JRQA 2Y74A 2GBWB 5CXOA 3F14A 5AIIA 3WA2X 1Q824 5EVHA 2E2VA 3K9MC 1IQ8A 2CFDA 5AEWB 3LOYA 3MWZA 2OWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H3U A;  2B1X B;  3T8U A;  2RCD A;  1OPY A;  4OUQ A;  1ASK A;  3HZP A;  1DMM A;  3M8C A;  3JUN A;  3JUP A;  4CDL A;  3RGA A;  1JN5 A;  3T8N A;  5IF6 A;  1Z1S A;  4R9L A;  2W2C A;  2Z77 A;  3F7S A;  5FW5 A;  3S5C A;  4FCJ A;  2HMM B;  3I0Y A;  3FH1 A;  1E3R A;  1Q40 A;  4XB5 A;  1GS3 A;  1JB2 A;  3LYG A;  4ORL A;  3B4P A;  3ROB A;  3G0K A;  3F40 A;  2RFR A;  2F98 A;  1OHO A;  3NBR A;  3NHX A;  1E97 A;  2XSO B;  3MG3 A;  3D9R A;  2GEY A;  4U13 A;  5IEN A;  4LMI A;  3OV4 A;  1WQL B;  3MG1 A;  4HM5 B;  1NU3 A;  4XDV A;  4R1K A;  3WMD A;  2BMQ B;  4L8O A;  3GWR A;  5STD A;  1SJW A;  2INX A;  1OH0 A;  3K7C A;  5CLK A;  3MSO A;  2YFL B;  8CHO A;  1O7H B;  3LZA A;  2I9W A;  2UX0 A;  5AEU B;  5IER A;  3F8H A;  3MG2 A;  2HML B;  4HM8 B;  5IG4 A;  5KP4 A;  4HM0 B;  1JB4 A;  1OGZ A;  3EBT A;  3HX8 A;  1HKX A;  3MHE A;  4I4K A;  3JUO A;  3STD A;  5D81 A;  1JN5 B;  4XBX A;  1U5O A;  3EQQ B;  4R9K A;  4K1V A;  1OUN A;  4PEJ A;  4LEH A;  1GY6 A;  1Q40 B;  2F99 A;  1STD A;  1K41 A;  2PZV A;  3F8X A;  1E3V A;  3EBY A;  3Q90 A;  1GYB A;  3CNX A;  2HMO B;  2BMO B;  1OGX A;  4HKV B;  1OF5 A;  2GXF A;  4WP5 A;  2BMR B;  3EHC A;  3OWY A;  2HMJ B;  3CU3 A;  3GRD A;  3KKG A;  5BXQ A;  5IG5 A;  3BB9 A;  2RGQ A;  2GBX B;  3BLZ A;  4HZ9 B;  3HK4 A;  2GEX A;  1AR0 A;  1A2K A;  5TGN A;  6STD A;  2HMK B;  1DMQ A;  1NWW A;  4K1U A;  3H3H A;  5IG3 A;  3A76 A;  4XM4 A;  3FLJ A;  1O7M B;  3EF8 A;  1UUW B;  1W01 A;  3B4O A;  5G2G A;  1O7N B;  5D82 A;  5D83 A;  4STD A;  3F7X A;  1W00 A;  4WYK B;  3JUQ A;  2BNG A;  1QMA A;  4L8P A;  4HM7 B;  5CF1 A;  4L7K A;  1EA2 A;  4HVN A;  1JB5 A;  1UUV B;  3B7C A;  2F86 B;  1W6Y A;  3SOY A;  2R4I A;  3EJV A;  4WWU C;  2CKF B;  1GY7 A;  1OHP A;  2XR8 B;  4X2H A;  3NXJ A;  1ZO2 A;  3EN8 A;  4MJD A;  1C7H A;  1CQS A;  3GZX B;  3E99 A;  3MYT A;  5JPU A;  2XSH B;  3SED A;  1JKG A;  1QJG A;  4LGQ A;  2XRX B;  3IPT A;  3FKA A;  5HGR A;  3OX9 A;  1OHS A;  4Q53 A;  3FF0 A;  3DXO A;  3G8Z A;  3G16 A;  4XBT A;  3JUM A;  1DMN A;  3KSP A;  2K54 A;  3DZL A;  1W02 A;  2HMN B;  2YFJ B;  5IG0 A;  1OCV A;  3OXA A;  5AIH A;  4HJL B;  1BUQ A;  5JPP A;  1S5A A;  2STD A;  4X2O A;  3CPO A;  3UNL A;  4XDW A;  1NDO B;  3DUK A;  3FZW A;  4KVH A;  1ULJ B;  4J9A A;  4OVM A;  5IEO A;  3F9S A;  2QGU A;  3NV0 A;  4XBY A;  3ER7 A;  5DRE A;  1TP6 A;  5KP1 A;  2IMJ A;  3ECF A;  1ULI B;  4HM4 B;  3DMC A;  1VZZ A;  1GY5 A;  2Z76 A;  3NUV A;  5CF2 A;  1TUH A;  5AI1 A;  5AIF A;  4IIA A;  4FCM A;  3H51 A;  3FGY A;  4J8T A;  2A15 A;  3FF2 A;  5AIG A;  1JKG B;  3CNM A;  1IDP A;  2QIY A;  1O7P B;  2CHC A;  3OWS A;  2B24 B;  2YFI B;  4HM6 B;  3K0Z A;  3SOA A;  2OWP A;  4HM1 B;  5CK6 A;  3NM2 A;  7STD A;  1ZX2 A;  3RGR A;  3MKI A;  4N3V A;  3GZB A;  5DRV A;  1OF5 B;  3EN1 B;  5IEP A;  2Z7A A;  3DM8 A;  3KZT A;  3OWU A;  3EX9 A;  1O7G B;  3KE7 A;  4WYK A;  3VSY A;  1Q42 A;  1ISK A;  2JQ5 A;  1O7W B;  4GB5 A;  3FSD A;  3B8L A;  5BVB A;  3VGN A;  4HZB B;  3GZR A;  3NV0 B;  4HM3 B;  5KP3 A;  1EG9 B;  3EC9 A;  4RZM A;  3UJM A;  4HM2 B;  2GBW B;  5CXO A;  3F14 A;  5AII A;  5EVH A;  5AEW B;  3GZY B; 
#chains in the Genus database with same CATH topology
 4H3U A;  4N6O B;  3CC7 3;  3HIG A;  2B1X B;  3WA3 A;  1RJO A;  3T8U A;  1DVC A;  4EXR A;  2RCD A;  1BSC A;  2W56 A;  2W6J H;  1OPY A;  3D5I A;  1ASK A;  1BNE A;  3HZP A;  4OUQ A;  2F5M A;  1VQL 3;  1G0T A;  1DMM A;  2XGL A;  1BU4 A;  3M8C A;  4KZ1 A;  3JUN A;  3JUP A;  4CDL A;  2YX9 A;  1B2S A;  3FG3 A;  3RGA A;  1JN5 A;  3T8N A;  2FNQ A;  2XFT A;  1Z1S A;  4H61 A;  2BO9 B;  5IF6 A;  4R9L A;  2ZHX B;  2W2C A;  1IT8 A;  2Z77 A;  2CK3 H;  3DGO A;  3F7S A;  5LC7 A;  1JBT A;  3X41 A;  3MPH A;  1BUJ A;  5FW5 A;  3S5C A;  2RNT A;  1C54 A;  2KF5 A;  4K61 A;  1K9M 4;  4FCZ A;  4FCJ A;  2HMM B;  2CG0 A;  1J2B A;  4BU4 A;  3I0Y A;  3FH1 A;  4MMX B;  4BTW A;  2CX1 A;  1E3R A;  1YJN 3;  1Q40 A;  4CCV A;  4XB5 A;  1UCJ A;  1GS3 A;  3DY5 A;  1JB2 A;  1FW7 A;  1IK3 A;  3LYG A;  1FZU A;  1RN4 A;  1MWR A;  3B4P A;  3PS8 A;  3G0K A;  4ORL A;  1B20 A;  1PYL A;  3ROB A;  1LOW A;  4EV2 A;  2W9P A;  7RNT A;  3F40 A;  3WDG B;  5BU4 A;  2RFR A;  1LNH A;  2F98 A;  1OHO A;  3NBR A;  3WR2 A;  1BRK A;  1QAK A;  3NHX A;  1IVV A;  1RGL A;  1VQ7 3;  3G71 3;  2K0M A;  2FGT A;  1E97 A;  2XSO B;  5IW9 A;  1T5Y A;  1QVF 2;  3MG3 A;  3D9R A;  1Q7H A;  2GEY A;  4U13 A;  2WGQ A;  5IEN A;  1I70 A;  4LMI A;  1PFP A;  3OV4 A;  2Q07 A;  2JDI H;  4EV5 A;  1HYF A;  1WQL B;  2H0G A;  3GSP A;  2RBI A;  3MG1 A;  3X3Y A;  1NJI 4;  4HM5 B;  2OCT A;  1NU3 A;  3D4A A;  4XDV A;  1QAF A;  1V57 A;  3CCJ 3;  1LOX A;  4R1K A;  3WMD A;  2BMQ B;  1SII A;  3SVA A;  1I2E A;  2HOH A;  4N6M A;  4L8O A;  3GWR A;  1NB5 I;  1Q81 4;  3LTC A;  5STD A;  1ROV A;  4O8S A;  1SJW A;  1UGH I;  2INX A;  1JNQ A;  1OH0 A;  2CWU A;  1TIJ A;  3PXM A;  3K7C A;  5CLK A;  1BRG A;  1MOL A;  3MSO A;  1LNI A;  2WGO A;  2CWV A;  2YFL B;  3BND A;  3T0U A;  8CHO A;  5LC6 A;  3N54 B;  2C10 A;  3BNB A;  4J5G A;  1VQ9 3;  1FYS A;  1RCK A;  1O7H B;  1K8A 4;  3A5E A;  2FXT A;  3GAX A;  3LZA A;  1RTU A;  2I9W A;  2L4V A;  3CCL 3;  1BRS A;  1IV7 A;  3AHS A;  2UX0 A;  3D3L A;  3S28 A;  5AEU B;  1WMP A;  5IER A;  3F8H A;  3MG2 A;  2HML B;  2BU4 A;  4HM8 B;  1QVG 2;  2F56 A;  3VF1 A;  3BU4 A;  5IG4 A;  5KP4 A;  4HM0 B;  1JB4 A;  3D5G A;  1OGZ A;  3EBT A;  3HX8 A;  4FMD A;  4HOH A;  1JBS A;  1HKX A;  2CFL A;  1B2M A;  1I2G A;  3MHE A;  1W5Z A;  2W56 B;  3BNE A;  4I4K A;  4FR9 A;  3JUO A;  5JBS A;  4G1M B;  3STD A;  1VQ4 3;  4JF8 A;  4N6V 0;  5D81 A;  1PY3 A;  1YI2 3;  1B2Z A;  1JN5 B;  3QRD A;  4XBX A;  1RLS A;  3SXX A;  3CCE 3;  4EW5 A;  1BNS A;  3DGY A;  4IT7 A;  1B3S A;  1U5O A;  3EQQ B;  4R9K A;  1A90 A;  4K1V A;  1RCL A;  1IQX A;  2IY2 A;  2H0H A;  1N5P A;  2J8X B;  1OUN A;  3LTB A;  4PEJ A;  4LEH A;  1JV2 B;  1US1 A;  1LVN A;  2IYJ A;  1GY6 A;  1Q40 B;  2F99 A;  3ZFZ A;  3TDG A;  1STD A;  1UI7 A;  1IVW A;  1K41 A;  1TFO A;  2E2T A;  3AGO A;  1R4C A;  1BVI A;  2PZV A;  3AMO B;  3PCS A;  3F8X A;  1E3V A;  3EBY A;  3DH2 A;  3Q90 A;  2KF4 A;  4DKI A;  1GYB A;  1QAL A;  5RNT A;  3CNX A;  1M1K 4;  2CC3 A;  2BHM A;  2CW9 A;  2HMO B;  2BMO B;  1OGX A;  1CYV A;  2W0Q A;  3LT9 A;  1I3F A;  4HKV B;  3S27 A;  3PCR A;  1OF5 A;  1FGR A;  1N8Q A;  1UCK A;  2GXF A;  3IMA B;  2AAE A;  2PNC A;  4WP5 A;  1VQ8 3;  1AVK A;  1T3B A;  2BMR B;  1Q86 4;  4BL3 A;  1BSE A;  2RSX A;  2D42 A;  5EEO A;  3EHC A;  3OWY A;  1YHQ 3;  1W6C A;  2HMJ B;  3CU3 A;  3GRD A;  3KKG A;  5BXQ A;  4FMB A;  3BB9 A;  3WOE B;  5IG5 A;  1EQK A;  2WOH A;  2W9Q A;  2RGQ A;  4KFD A;  3HII A;  2GBX B;  3IJE B;  3BLZ A;  3CCU 3;  4HZ9 B;  4IPB A;  3HK4 A;  1X1U A;  8RNT A;  2IUJ A;  2GEX A;  1AR0 A;  3KCH A;  1A67 A;  1PU4 A;  4AKZ A;  1A2K A;  5TGN A;  6STD A;  2ML5 A;  1DET A;  2KAA A;  1BNI A;  1UI8 A;  2HMK B;  3J7Y d;  1DMQ A;  1NNV A;  1NWW A;  2Y73 A;  2OOV A;  3CPW 2;  2QA4 3;  4K1U A;  3S29 A;  3H3H A;  5IG3 A;  3A76 A;  4XM4 A;  3FLJ A;  1O7M B;  3EF8 A;  4N6L A;  1YIJ 3;  1FA3 A;  1BNG A;  3WOD G;  1WMO A;  1FGT A;  1UUW B;  1W01 A;  2P0M A;  3B4O A;  1GOV A;  1GMR A;  1MWU A;  1RN7 A;  5G2G A;  1G96 A;  1O7N B;  3WOF B;  1K73 4;  5D82 A;  4FMC A;  4J5K A;  4QWT A;  5D83 A;  2OTL 3;  4STD A;  3WHO A;  3F7X A;  1DE3 A;  3O8Y A;  2LYX A;  6GSP A;  1LQM B;  1RDS A;  1RGF A;  1W00 A;  3K63 A;  4WYK B;  3S67 A;  4R4K A;  6RNT A;  3JUQ A;  2BNG A;  4NRE A;  1QMA A;  1IT7 A;  1RGE A;  4L8P A;  1T2H A;  1RGG A;  4HM7 B;  5CF1 A;  5M19 A;  1KSI A;  3X3Z A;  4L7K A;  1EA2 A;  4HVN A;  4WHA A;  9RNT A;  4BIR A;  1RKY A;  3V98 A;  1YVB I;  1JB5 A;  1W2B 2;  1CYU A;  3CCR 3;  1I0V A;  1YNV X;  4KFE A;  3UB1 A;  1UUV B;  2F86 B;  1LXE A;  1RMS A;  3B7C A;  5I97 A;  3OW2 2;  3ALA A;  1IVX A;  1EUI C;  1UUG B;  1GMQ A;  1ZS7 A;  1WNH A;  1W6Y A;  2OQE C;  3PYJ A;  2R4I A;  3EJV A;  3SOY A;  4WWU C;  1A2P A;  3Q1C A;  3LT8 A;  4RNY A;  4GHO A;  3KN4 A;  3PZW A;  1WMN A;  1BSA A;  2OTJ 3;  1TRP A;  1RRL A;  2CKF B;  2XF3 A;  1GY7 A;  1OHP A;  4ILF A;  3EE1 A;  3RDE A;  2BT3 A;  4LSO A;  4HAA A;  2XR8 B;  1WTH A;  4JRF A;  3CC2 3;  1BRJ A;  1X1W A;  4X2H A;  3SLU A;  3NXJ A;  2SBL A;  1YIT 3;  1SQW A;  1GD4 A;  1VQ6 3;  1ZO2 A;  3EN8 A;  5AYR B;  1BRI A;  1C7H A;  4MJD A;  1CQS A;  1MGR A;  3V99 A;  3GZX B;  5BIR A;  1D6Y A;  1AV4 A;  1HZ1 A;  3E99 A;  2XFS A;  4ZM8 A;  1KWI A;  2O9U X;  1UW1 A;  3MYT A;  2KCD A;  1UCI A;  5JPU A;  4NPB A;  2XSH B;  1VQO 3;  3CMA 3;  3K5T A;  3SED A;  1TFK A;  1UDI I;  1ZGX A;  1JKG A;  4BTY A;  1QJG A;  1DYU A;  4LGQ A;  3NBB A;  3LTA A;  1CH0 A;  2D1W A;  2XRX B;  3IPT A;  3FKA A;  3N9H A;  5HGR A;  3OX9 A;  1OHS A;  3DGN A;  1I2F A;  4Q53 A;  3KII A;  3G6E 3;  1B27 A;  3FF0 A;  1MNL A;  1M1X B;  2WOF A;  3DXO A;  3G8Z A;  1STF I;  3V92 A;  2GU3 A;  3NBJ A;  4N6N B;  3G16 A;  3X42 A;  2C4B A;  2OOV C;  1BNF A;  4XBT A;  2OQE A;  3BNC A;  3JUM A;  3AHW A;  1LRA A;  1NO3 A;  2ZL8 A;  1DMN A;  1N5H A;  1TRQ A;  1TTO A;  3KSP A;  4N6T A;  2K54 A;  1I3I A;  2K3D A;  2KF6 A;  1Q9E A;  3ZG0 A;  1G02 A;  3DZL A;  1LOY A;  3HOH A;  3D79 A;  1W02 A;  3LML A;  2WO0 A;  1ROA A;  2C11 A;  2HMN B;  3CCS 3;  1SIH A;  2YFJ B;  5IG0 A;  4BTX A;  4OK0 A;  1OCV A;  3UL6 A;  3NX0 A;  1BGS A;  3KFQ C;  3OXA A;  1KQS 2;  5AIH A;  4HJL B;  2GSP A;  4RNZ A;  3G4S 3;  2Z6B A;  3CC4 3;  3NQY A;  3CD6 3;  1BOX A;  1GMP A;  4KT3 B;  5JPP A;  1S5A A;  1BUQ A;  1FGO A;  2STD A;  3NM7 A;  3URP A;  4X2O A;  7GSP A;  2UGI A;  3CPO A;  1VQN 3;  4GSP A;  4I5Q A;  3UL5 A;  1LOV A;  1YVS A;  3UNL A;  2CX0 A;  4XDW A;  1AY7 A;  1B21 A;  1NDO B;  2KXG A;  4BL2 A;  1I8V A;  3DUK A;  2H0I A;  4RBN A;  3N8B A;  5ELJ A;  1TJD A;  3FZW A;  4KVH A;  3LTD A;  1ULJ B;  3HI7 A;  4J9A A;  1M9G A;  4OVM A;  1EEJ A;  1U8C B;  2XGN A;  4CPK A;  2CH9 A;  3FCS B;  1FGQ A;  5IEO A;  3F9S A;  2QEX 3;  2QGU A;  2F5W A;  1N9J A;  1FGM A;  4FMA A;  5EQL A;  3NV0 A;  1VQK 3;  3CCM 3;  4XBY A;  4CJN A;  1BRN L;  4GL6 A;  3ER7 A;  4LYL B;  4O3V A;  3U97 A;  2F4Y A;  3DGM A;  5DRE A;  1JJ2 2;  2E2U A;  1TP6 A;  1T2I A;  2ML6 A;  1SAR A;  2LQV A;  5KP1 A;  1BNJ A;  2IMJ A;  1N8R 4;  4MEI A;  4R80 A;  1RRH A;  2KRT A;  3ZG5 A;  2CFW A;  2XEP A;  1Y4K A;  2BIR A;  1D6U A;  3SYU A;  1FUT A;  3ECF A;  1NB3 I;  5ELU A;  2M7O A;  1VQ5 3;  3AMO A;  1KD1 4;  2UUG C;  1MWT A;  4HBR A;  1JZO A;  1ULI B;  1V58 A;  1F8N A;  3DMC A;  1GSP A;  4HM4 B;  2L1S A;  1VZZ A;  4AKY A;  1GY5 A;  2Z76 A;  4RNT A;  1RGK A;  1X1X A;  3NUV A;  4KFF A;  1V74 A;  5CF2 A;  1W4N A;  4HYZ A;  1UCL A;  1VQM 3;  1RNB A;  1TUH A;  4MMY B;  5AI1 A;  5AIF A;  4IIA A;  1RHL A;  3BIR A;  4FCM A;  1RGA A;  3H51 A;  4EC6 A;  3L0R A;  3FGY A;  3LH4 A;  1BSB A;  1W6G A;  1FUS A;  1W7C A;  4J8T A;  2A15 A;  4LZI A;  3QK9 A;  2W04 A;  4O2H A;  3FF2 A;  1JKG B;  1B2X A;  3GZY B;  5AIG A;  1IQY A;  3CNM A;  1IDP A;  1RSN A;  2QIY A;  5GSP A;  1YJW 3;  1CEW I;  4WFO A;  5M1A A;  3I56 3;  1O7P B;  1RGC A;  2CHC A;  3X40 A;  2KF3 A;  3OWS A;  2MF7 A;  3SX1 A;  1MWS A;  2B24 B;  1HU9 A;  4NHF A;  3CME 3;  1UGI A;  1IV9 A;  2YFI B;  4HM6 B;  5M18 A;  3K0Z A;  2CFK A;  3SOA A;  1RN1 A;  4HM1 B;  1AQZ A;  5CK6 A;  1BAO A;  3NM2 A;  7STD A;  1ZX2 A;  5HOH A;  3EB8 A;  1GOY A;  1FUW A;  2CWT A;  3RGR A;  2XH9 A;  1BNR A;  2ZA4 A;  3DGL A;  3MKI A;  4N3V A;  1A2V A;  4N6U A;  4O02 B;  1KC8 4;  1VQQ A;  1LQG C;  2O3O A;  1W2Z A;  3NQZ A;  4K90 B;  1M90 4;  1TU5 A;  4AEQ A;  2P38 A;  2P09 A;  3GZB A;  3FG1 A;  1L5G B;  1YJ9 3;  4TX4 A;  5A0O B;  3CCQ 3;  1GOU A;  1YGE A;  3CXC 2;  3RNT A;  2V1L A;  4MMZ B;  5DRV A;  3X3X A;  1OF5 B;  3EN1 B;  4EBG A;  2SAR A;  5IEP A;  2Z7A A;  1S72 3;  1AVL A;  1BIR A;  3DM8 A;  3CCV 3;  1MGW A;  1BSD A;  3KZT A;  3OWU A;  1B2U A;  1JBR A;  1K28 A;  1D6Z A;  3EX9 A;  3Q2P A;  2R41 A;  1O7G B;  3KE7 A;  4WYK A;  3Q3F A;  1VQP 3;  3VSY A;  1Q42 A;  1ISK A;  1YGW A;  2CFG A;  1BAN A;  1OAC A;  3U1W A;  2P05 A;  2JQ5 A;  2IA7 A;  1DVD A;  3I55 3;  3LXU X;  3FG4 A;  1O7W B;  4GB5 A;  2P0X A;  3FSD A;  3B8L A;  1RNT A;  5BVB A;  1IYY A;  5G1L A;  2GU1 A;  3VGN A;  2AAD A;  1IU7 A;  4HZB B;  1GD3 A;  3GZR A;  3NV0 B;  1EKM A;  2ZDJ A;  1BRH A;  2IUK A;  1Q7Y 4;  4HM3 B;  2MC8 A;  2CIU A;  1N9E A;  5KP3 A;  3PGB A;  2CG1 A;  1EG9 B;  3EC9 A;  5FGO A;  5AYS C;  4RZM A;  3UJM A;  4EYC A;  3KSE D;  1JZD A;  1SPU A;  3JVC A;  1IVU A;  4HM2 B;  2W03 A;  1JRQ A;  2Y74 A;  1I0X A;  2GBW B;  5CXO A;  3F14 A;  5AII A;  3WA2 X;  1Q82 4;  5G1K A;  5EVH A;  1R4Y A;  2E2V A;  3K9M C;  1X1Y A;  3AGN A;  1RGH A;  1IQ8 A;  2CFD A;  5AEW B;  3LOY A;  3MWZ A;  2OWP A; 
#chains in the Genus database with same CATH homology
 4H3U A;  4N6O B;  3CC7 3;  3HIG A;  2B1X B;  3WA3 A;  1RJO A;  3T8U A;  1DVC A;  4EXR A;  2RCD A;  2W56 A;  2W6J H;  1OPY A;  4OUQ A;  1ASK A;  3HZP A;  1VQL 3;  1DMM A;  2XGL A;  3M8C A;  4KZ1 A;  3JUN A;  3JUP A;  4CDL A;  2YX9 A;  3FG3 A;  3RGA A;  1JN5 A;  3T8N A;  2FNQ A;  2XFT A;  1Z1S A;  4H61 A;  2BO9 B;  5IF6 A;  4R9L A;  2W2C A;  1IT8 A;  2Z77 A;  2CK3 H;  3DGO A;  3F7S A;  5LC7 A;  3X41 A;  3MPH A;  5FW5 A;  3S5C A;  4K61 A;  1K9M 4;  4FCZ A;  4FCJ A;  2HMM B;  2CG0 A;  1J2B A;  3I0Y A;  3FH1 A;  4MMX B;  4BTW A;  1E3R A;  1YJN 3;  1Q40 A;  4CCV A;  4XB5 A;  1GS3 A;  3DY5 A;  1JB2 A;  1IK3 A;  3LYG A;  4ORL A;  3B4P A;  3PS8 A;  3G0K A;  3ROB A;  4EV2 A;  2W9P A;  3F40 A;  3WDG B;  2RFR A;  1LNH A;  2F98 A;  1OHO A;  3NBR A;  1QAK A;  3NHX A;  1IVV A;  1VQ7 3;  3G71 3;  2K0M A;  2FGT A;  1E97 A;  2XSO B;  5IW9 A;  1T5Y A;  1QVF 2;  3MG3 A;  3D9R A;  2GEY A;  4U13 A;  2WGQ A;  5IEN A;  4LMI A;  1PFP A;  3OV4 A;  2Q07 A;  2JDI H;  4EV5 A;  1WQL B;  3MG1 A;  3X3Y A;  1NJI 4;  4HM5 B;  2OCT A;  1NU3 A;  4XDV A;  1QAF A;  3CCJ 3;  1LOX A;  4R1K A;  3WMD A;  2BMQ B;  1SII A;  3SVA A;  4N6M A;  4L8O A;  3GWR A;  1NB5 I;  1Q81 4;  3LTC A;  5STD A;  1ROV A;  4O8S A;  1SJW A;  2INX A;  1JNQ A;  1OH0 A;  2CWU A;  1TIJ A;  3PXM A;  3K7C A;  5CLK A;  1MOL A;  3MSO A;  2WGO A;  2CWV A;  2YFL B;  3BND A;  3T0U A;  8CHO A;  5LC6 A;  3N54 B;  2C10 A;  3BNB A;  1VQ9 3;  1O7H B;  1K8A 4;  2FXT A;  3GAX A;  3LZA A;  2I9W A;  2L4V A;  3CCL 3;  1IV7 A;  3D3L A;  2UX0 A;  3S28 A;  5AEU B;  1WMP A;  5IER A;  3F8H A;  3MG2 A;  2HML B;  4HM8 B;  1QVG 2;  3VF1 A;  5IG4 A;  5KP4 A;  4HM0 B;  1JB4 A;  1OGZ A;  3EBT A;  3HX8 A;  4FMD A;  2CFL A;  1HKX A;  3MHE A;  2W56 B;  1W5Z A;  3BNE A;  4I4K A;  4FR9 A;  3JUO A;  5JBS A;  4G1M B;  3STD A;  1VQ4 3;  4JF8 A;  4N6V 0;  5D81 A;  1YI2 3;  1JN5 B;  3QRD A;  4XBX A;  3SXX A;  3CCE 3;  4IT7 A;  1U5O A;  3EQQ B;  4R9K A;  1A90 A;  4K1V A;  1IQX A;  1N5P A;  1OUN A;  3LTB A;  4PEJ A;  4LEH A;  1JV2 B;  1US1 A;  1LVN A;  1GY6 A;  1Q40 B;  2F99 A;  3TDG A;  1STD A;  1UI7 A;  1IVW A;  1K41 A;  1TFO A;  2E2T A;  3AMO B;  1R4C A;  2PZV A;  3PCS A;  3F8X A;  1E3V A;  3EBY A;  3Q90 A;  1GYB A;  1QAL A;  3CNX A;  1M1K 4;  2CC3 A;  2BHM A;  2CW9 A;  2HMO B;  2BMO B;  1OGX A;  1CYV A;  2W0Q A;  3LT9 A;  4HKV B;  3S27 A;  3PCR A;  1OF5 A;  1FGR A;  1N8Q A;  2GXF A;  3IMA B;  4WP5 A;  2PNC A;  1VQ8 3;  1AVK A;  2BMR B;  1Q86 4;  2RSX A;  2D42 A;  5EEO A;  3EHC A;  3OWY A;  1YHQ 3;  1W6C A;  2HMJ B;  3CU3 A;  3GRD A;  3KKG A;  5BXQ A;  4FMB A;  3BB9 A;  3WOE B;  5IG5 A;  1EQK A;  2WOH A;  2W9Q A;  2RGQ A;  4KFD A;  3HII A;  2GBX B;  3IJE B;  3BLZ A;  3CCU 3;  4HZ9 B;  4IPB A;  3HK4 A;  2IUJ A;  2GEX A;  1AR0 A;  1A67 A;  1PU4 A;  4AKZ A;  1A2K A;  5TGN A;  6STD A;  2ML5 A;  2HMK B;  1UI8 A;  3J7Y d;  1DMQ A;  2OOV A;  1NWW A;  2Y73 A;  3CPW 2;  2QA4 3;  4K1U A;  3S29 A;  3H3H A;  5IG3 A;  3A76 A;  4XM4 A;  3FLJ A;  1O7M B;  3EF8 A;  4N6L A;  1YIJ 3;  1FA3 A;  3WOD G;  1WMO A;  1FGT A;  1UUW B;  1W01 A;  2P0M A;  3B4O A;  1RN7 A;  5G2G A;  1K73 4;  1G96 A;  1O7N B;  3WOF B;  5D82 A;  4FMC A;  4QWT A;  5D83 A;  2OTL 3;  4STD A;  3F7X A;  3O8Y A;  2LYX A;  1W00 A;  4WYK B;  3K63 A;  3S67 A;  4R4K A;  3JUQ A;  2BNG A;  4NRE A;  1QMA A;  1IT7 A;  4L8P A;  4HM7 B;  5CF1 A;  1KSI A;  3X3Z A;  4L7K A;  1EA2 A;  4HVN A;  4WHA A;  1RKY A;  3V98 A;  1YVB I;  1JB5 A;  1W2B 2;  1CYU A;  3CCR 3;  4KFE A;  3UB1 A;  1UUV B;  2F86 B;  1LXE A;  3B7C A;  5I97 A;  3OW2 2;  3ALA A;  1IVX A;  1WNH A;  1W6Y A;  2OQE C;  3PYJ A;  2R4I A;  3EJV A;  3SOY A;  4WWU C;  3Q1C A;  4RNY A;  3LT8 A;  3KN4 A;  3PZW A;  1WMN A;  2OTJ 3;  1RRL A;  2CKF B;  2XF3 A;  1GY7 A;  1OHP A;  3EE1 A;  3RDE A;  2BT3 A;  4LSO A;  2XR8 B;  1WTH A;  4JRF A;  3CC2 3;  4X2H A;  3SLU A;  3NXJ A;  2SBL A;  1YIT 3;  1SQW A;  1GD4 A;  1VQ6 3;  1ZO2 A;  3EN8 A;  5AYR B;  4MJD A;  1C7H A;  1CQS A;  3V99 A;  3GZX B;  1D6Y A;  1AV4 A;  3E99 A;  2XFS A;  4ZM8 A;  1KWI A;  2O9U X;  1UW1 A;  3MYT A;  2KCD A;  5JPU A;  3CMA 3;  1VQO 3;  2XSH B;  3K5T A;  3SED A;  1TFK A;  1JKG A;  4BTY A;  1QJG A;  1DYU A;  4LGQ A;  3NBB A;  3LTA A;  2XRX B;  2D1W A;  3IPT A;  3FKA A;  3N9H A;  5HGR A;  3OX9 A;  1OHS A;  3DGN A;  4Q53 A;  3G6E 3;  3KII A;  3FF0 A;  1MNL A;  1M1X B;  2WOF A;  3DXO A;  3G8Z A;  1STF I;  3V92 A;  2GU3 A;  3NBJ A;  4N6N B;  3G16 A;  3X42 A;  2OOV C;  4XBT A;  2OQE A;  3BNC A;  3JUM A;  1NO3 A;  2ZL8 A;  1DMN A;  1N5H A;  3KSP A;  4N6T A;  2K54 A;  3DZL A;  3LML A;  1W02 A;  2WO0 A;  1ROA A;  2C11 A;  2HMN B;  3CCS 3;  1SIH A;  2YFJ B;  5IG0 A;  4BTX A;  4OK0 A;  1OCV A;  3UL6 A;  3NX0 A;  3KFQ C;  3OXA A;  1KQS 2;  5AIH A;  4HJL B;  4RNZ A;  3G4S 3;  2Z6B A;  3CC4 3;  3NQY A;  3CD6 3;  1BUQ A;  5JPP A;  1S5A A;  1FGO A;  2STD A;  3NM7 A;  4X2O A;  3CPO A;  1VQN 3;  3UL5 A;  3UNL A;  4XDW A;  1NDO B;  2KXG A;  3DUK A;  4RBN A;  3N8B A;  5ELJ A;  3FZW A;  4KVH A;  3LTD A;  1ULJ B;  3HI7 A;  4J9A A;  1M9G A;  4OVM A;  2XGN A;  1U8C B;  2CH9 A;  3FCS B;  1FGQ A;  5IEO A;  3F9S A;  2QEX 3;  2QGU A;  4FMA A;  1N9J A;  1FGM A;  5EQL A;  3NV0 A;  1VQK 3;  3CCM 3;  4XBY A;  4GL6 A;  3ER7 A;  4O3V A;  3U97 A;  3DGM A;  5DRE A;  1JJ2 2;  2E2U A;  1TP6 A;  2ML6 A;  2LQV A;  5KP1 A;  2IMJ A;  1N8R 4;  4MEI A;  4R80 A;  1RRH A;  2KRT A;  2CFW A;  2XEP A;  1Y4K A;  1D6U A;  3ECF A;  1NB3 I;  5ELU A;  2M7O A;  1VQ5 3;  3AMO A;  1KD1 4;  4HBR A;  1ULI B;  4HM4 B;  1F8N A;  3DMC A;  4AKY A;  1VZZ A;  1GY5 A;  2Z76 A;  3NUV A;  4KFF A;  1V74 A;  5CF2 A;  1W4N A;  4HYZ A;  1VQM 3;  1TUH A;  4MMY B;  5AI1 A;  5AIF A;  4IIA A;  4FCM A;  3H51 A;  4EC6 A;  3L0R A;  3FGY A;  3LH4 A;  1W7C A;  1W6G A;  4J8T A;  2A15 A;  4LZI A;  3QK9 A;  2W04 A;  4O2H A;  3FF2 A;  1JKG B;  5AIG A;  3GZY B;  1IQY A;  3CNM A;  1IDP A;  2QIY A;  1YJW 3;  1CEW I;  4WFO A;  3I56 3;  1O7P B;  2CHC A;  3X40 A;  3OWS A;  2MF7 A;  3SX1 A;  3CME 3;  2B24 B;  1HU9 A;  4NHF A;  1IV9 A;  2YFI B;  4HM6 B;  3K0Z A;  2CFK A;  3SOA A;  4HM1 B;  5CK6 A;  3NM2 A;  7STD A;  1ZX2 A;  3EB8 A;  1FUW A;  2CWT A;  3RGR A;  2XH9 A;  3DGL A;  3MKI A;  4N3V A;  1A2V A;  4N6U A;  4O02 B;  1KC8 4;  2O3O A;  1W2Z A;  3NQZ A;  4K90 B;  1M90 4;  1TU5 A;  4AEQ A;  2P38 A;  2P09 A;  3GZB A;  3FG1 A;  1L5G B;  1YJ9 3;  4TX4 A;  5A0O B;  3CCQ 3;  1YGE A;  3CXC 2;  2V1L A;  4MMZ B;  5DRV A;  3X3X A;  1OF5 B;  3EN1 B;  4EBG A;  5IEP A;  2Z7A A;  1S72 3;  1AVL A;  3DM8 A;  3CCV 3;  3KZT A;  3OWU A;  1K28 A;  1D6Z A;  3EX9 A;  3Q2P A;  1O7G B;  3KE7 A;  4WYK A;  1VQP 3;  3VSY A;  1Q42 A;  1ISK A;  2CFG A;  3U1W A;  1OAC A;  2P05 A;  2JQ5 A;  2IA7 A;  1DVD A;  3I55 3;  3LXU X;  3FG4 A;  1O7W B;  4GB5 A;  2P0X A;  3FSD A;  3B8L A;  5BVB A;  2GU1 A;  3VGN A;  1IU7 A;  4HZB B;  1GD3 A;  3GZR A;  3NV0 B;  1EKM A;  2ZDJ A;  2IUK A;  1Q7Y 4;  4HM3 B;  2MC8 A;  2CIU A;  1N9E A;  5KP3 A;  3PGB A;  2CG1 A;  1EG9 B;  3EC9 A;  5FGO A;  5AYS C;  4RZM A;  3UJM A;  4EYC A;  3KSE D;  1SPU A;  3JVC A;  1IVU A;  4HM2 B;  2W03 A;  1JRQ A;  2Y74 A;  2GBW B;  5CXO A;  3F14 A;  5AII A;  3WA2 X;  1Q82 4;  5EVH A;  2E2V A;  3K9M C;  1IQ8 A;  2CFD A;  5AEW B;  3LOY A;  3MWZ A;  2OWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...