5D81A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y57(cl-y)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
126
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta(5)-3-ketosteroid isomerase
publication title Dissecting Proton Delocalization in an Enzyme's Hydrogen Bond Network with Unnatural Amino Acids.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 126
sequence length 127
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2015-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5d81A00
4H3UA 2GEXA 3GZXB 2W2CA 2GBWB 4HM0B 2HMNB 5IERA 3DZLA 1W6YA 3FGYA 1EG9B 2QGUA 3JUMA 1UUVB 4IIAA 5CXOA 3G16A 4L8OA 3FKAA 4HM6B 4HZ9B 1GY5A 1GYBA 4I4KA 5FW5A 1O7GB 3EF8A 3KZTA 4HM1B 2CKFB 2OWPA 4J9AA 1ZO2A 2GBXB 3H3HA 3DXOA 4U13A 2HMKB 3DMCA 3ROBA 4WWUC 5AIHA 3MG2A 4XM4A 3STDA 3SOYA 1EA2A 4L7KA 3T8NA 1Q40B 2QIYA 1GY7A 1OHOA 3ER7A 3NV0B 3EHCA 4WP5A 1W02A 3FH1A 5KP3A 1BUQA 3OX9A 1SJWA 5AEWB 4CDLA 3GRDA 1O7HB 3G8ZA 2GEYA 1VZZA 4R9KA 3EJVA 2BNGA 3BB9A 3GWRA 2B24B 4RZMA 3IPTA 2F98A 1ULJB 5IG3A 3RGRA 4K1UA 4L8PA 3GZRA 3SEDA 3EBTA 5DRVA 4X2HA 4J8TA 4PEJA 5CF2A 3H51A 1TUHA 3WMDA 2BMOB 3FLJA 2HMMB 5JPPA 3EQQB 3B4PA 3NM2A 3F7XA 5IEOA 2INXA 1ZX2A 4HM3B 2YFLB 3UNLA 3FSDA 5KP1A 2GXFA 3MG3A 5CF1A 3NXJA 1U5OA 3NUVA 3VSYA 1O7MB 2RFRA 3HX8A 4HVNA 1W01A 3K7CA 2XSOB 1JN5A 3JUOA 1OH0A 1S5AA 2F86B 1JKGA 3HK4A 1DMNA 1OGZA 3FZWA 1JB5A 4XBXA 2R4IA 3DM8A 1UUWB 2XRXB 3M8CA 2BMQB 6STDA 5BXQA 1OHPA 4R9LA 3OXAA 5AIFA 3EN8A 3NBRA 3EC9A 1NWWA 3HZPA 1ASKA 7STDA 5AI1A 2B1XB 3G0KA 1E3VA 1STDA 4WYKA 3MKIA 4GB5A 1GS3A 3MHEA 2F99A 4STDA 1O7PB 4HM4B 1ULIB 2RGQA 3F7SA 4LMIA 2XR8B 1C7HA 5IG5A 3BLZA 4FCJA 5IEPA 3FF0A 4OVMA 2STDA 5STDA 1NU3A 1QMAA 5G2GA 4Q53A 3EBYA 2I9WA 2BMRB 1A2KA 1OF5A 1K41A 5BVBA 3E99A 3FF2A 3UJMA 3CNMA 4MJDA 1QJGA 1JN5B 3OWSA 5JPUA 5D82A 1NDOB 4FCMA 3LYGA 4HM8B 1JKGB 4KVHA 2Z77A 4LEHA 8CHOA 4XB5A 1GY6A 4X2OA 1OPYA 4HM2B 2JQ5A 1WQLB 3D9RA 3I0YA 4ORLA 3NHXA 1OUNA 3Q90A 1AR0A 4HKVB 3GZYB 5D81A 1Q42A 5AIIA 4LGQA 4WYKB 1HKXA 3F14A 3B7CA 3A76A 1DMQA 3LZAA 5IENA 3T8UA 3ECFA 5EVHA 2IMJA 5KP4A 3F8HA 4K1VA 2CHCA 5DREA 4HM5B 3CPOA 2Z7AA 3CU3A 1IDPA 3MG1A 3F40A 3JUPA 5CLKA 5D83A 1O7WB 5HGRA 1OHSA 3DUKA 4XBTA 3F9SA 3JUNA 2RCDA 1OCVA 1ISKA 4XBYA 1TP6A 1OF5B 2YFIB 4N3VA 3VGNA 1JB4A 2A15A 3OWUA 3S5CA 2YFJB 1DMMA 3SOAA 2Z76A 5AEUB 2UX0A 5AIGA 1E97A 3KSPA 3EN1B 4R1KA 2HMOB 4HJLB 4HM7B 3KKGA 2K54A 3EX9A 5CK6A 4OUQA 1O7NB 3OWYA 5IF6A 3OV4A 2HMLB 3F8XA 1OGXA 3MSOA 1E3RA 3K0ZA 1Q40A 3CNXA 3RGAA 4XDVA 1JB2A 4XDWA 1CQSA 1W00A 3NV0A 2HMJB 2PZVA 3MYTA 3JUQA 3GZBA 3KE7A 5IG0A 2XSHB 5TGNA 3B4OA 3B8LA 1Z1SA 5IG4A 4HZBB
chains in the Genus database with same CATH superfamily
4CJNA 4H3UA 2GEXA 2W56A 4OK0A 3GZXB 5JBSA 2W2CA 4KFFA 2IA7A 1TFOA 2GBWB 3IMAB 4RNTA 4HM0B 2HMNB 2CH9A 5IERA 3I563 3QRDA 3DZLA 3WA3A 1LOXA 1W6YA 2F56A 3U97A 3FGYA 1EG9B 1RGCA 2QGUA 1VQL3 1N5PA 3HOHA 4JRFA 2CC3A 1UUVB 3JUMA 4IIAA 4EW5A 1Q814 4FMAA 1TRQA 5CXOA 3G16A 5LC7A 4L8OA 1I3IA 2WOFA 3FKAA 4HM6B 1MNLA 4HZ9B 1GY5A 1GYBA 4BIRA 1B2ZA 1K9M4 3SX1A 4RBNA 3SLUA 2CX0A 1EEJA 1HU9A 4I4KA 1I2GA 1Q7HA 1BSAA 1WTHA 5FW5A 1O7GB 3BNBA 3EF8A 3KZTA 2BU4A 4TX4A 4HM1B 2CKFB 2OWPA 4J9AA 1TJDA 1ZO2A 1LNHA 1QAFA 2GBXB 3AGNA 3BNDA 3H3HA 4HBRA 4AKZA 3DXOA 1BUJA 1G96A 1NNVA 2HMKB 1IV9A 1MGRA 1MOLA 2C4BA 3DMCA 4U13A 4WWUC 5AIHA 2OTL3 1RTUA 3D5IA 3O8YA 1UI8A 3MG2A 4XM4A 2AAEA 3STDA 3SOYA 1IVUA 1I70A 3QK9A 1UI7A 1G0TA 1KSIA 1GOYA 4LSOA 1GD3A 1N5HA 1FW7A 1RGHA 1EA2A 1FGQA 4L7KA 1JV2B 1MGWA 1PYLA 1RGEA 1BNEA 2KAAA 2XFSA 3UL5A 1HYFA 2PNCA 1I0XA 4FMCA 3T8NA 1OACA 4BTYA 1AY7A 1Q40B 3T0UA 2QIYA 1I2EA 2J8XB 3WA2X 1YVBI 1GY7A 1M1XB 1GMQA 1OHOA 1R4CA 1IVVA 1GMRA 5EQLA 2CW9A 5IW9A 3VF1A 3LXUX 3ER7A 3NV0B 3EHCA 4WP5A 1IQ8A 1TU5A 1W02A 3KIIA 1EKMA 3FH1A 5KP3A 1IU7A 2UGIA 1BUQA 1LXEA 1JJ22 3DGLA 2UUGC 3OX9A 4O8SA 3D5GA 3Q3FA 1SJWA 4N6UA 1VQM3 1YIJ3 1RLSA 2IUKA 5AEWB 3HIGA 9RNTA 4CDLA 3GRDA 3KCHA 3URPA 1O7HB 2CWVA 4ILFA 1RSNA 3SXXA 3G8ZA 1D6YA 5BU4A 3NM7A 1BNFA 2GEYA 1VZZA 1M9GA 4WHAA 5RNTA 1SIHA 1BRIA 4R9KA 1I8VA 4I5QA 2FGTA 3EJVA 2KCDA 2K0MA 1K734 2BNGA 3AMOA 3N54B 1RN7A 3PZWA 2WO0A 1MWRA 3BB9A 3CCS3 3GWRA 1VQ53 1RDSA 2GU1A 3DH2A 1LQMB 2Q07A 1D6UA 5ELJA 3DGYA 2B24B 4QWTA 3CCU3 1FUSA 4RZMA 3IPTA 2F98A 2OOVC 1STFI 1ROVA 1ULJB 1VQ83 5IG3A 3RGRA 6GSPA 2ZL8A 4KFDA 1N9JA 2C11A 4K1UA 4L8PA 3GZRA 1BNSA 1IVWA 1UGIA 3DGMA 3FCSB 3SEDA 4MMXB 3EBTA 5DRVA 7RNTA 1JBRA 1W7CA 1N8QA 1RRLA 4X2HA 4HYZA 1AVLA 4J8TA 4PEJA 1RNBA 5CF2A 3S29A 1FGRA 1NO3A 1AV4A 2BT3A 1ROAA 3H51A 1Q824 1TUHA 3WMDA 1IQXA 2BMOB 3FLJA 3CCV3 5G1KA 2HMMB 4KFEA 1SPUA 1A2VA 3NBBA 5JPPA 4HAAA 1ZS7A 3EQQB 4O3VA 3WOEB 1S723 3X3ZA 2KRTA 3B4PA 2ML6A 3LOYA 3NM2A 3F7XA 5IEOA 2INXA 3ZG0A 2CFKA 1BNRA 4FMBA 3X42A 3LT9A 1ZX2A 4HM3B 2JDIH 2F4YA 2H0IA 2YFLB 3UNLA 1FA3A 3FSDA 3KFQC 3CC23 5KP1A 1YJ93 1NJI4 2RNTA 3D4AA 2GXFA 1A67A 3MG3A 3WDGB 2CK3H 4HOHA 5CF1A 3NXJA 5EEOA 2ML5A 1U5OA 3A5EA 5LC6A 1D6ZA 1AQZA 8RNTA 1N8R4 3NUVA 3VSYA 1O7MB 1RNTA 2RFRA 1VQ73 1Q864 1V74A 1TRPA 3HX8A 4NHFA 4EV5A 4HVNA 1FUWA 4LYLB 1B20A 1W01A 1K8A4 2KF4A 3K7CA 1BGSA 2XSOB 1JN5A 5G1LA 3JUOA 1OH0A 1B2UA 4WFOA 4EBGA 3K5TA 3G4S3 1QVF2 2ZA4A 2CFGA 1S5AA 2ZHXB 1US1A 2F86B 4GHOA 3HIIA 4MMYB 2OQEA 3CPW2 3CCR3 1FGOA 1JKGA 1YHQ3 3N9HA 3HK4A 1DMNA 1VQ43 1OGZA 4BTWA 1RN4A 3BU4A 1CEWI 1UDII 2GU3A 3AHSA 3LTAA 2HOHA 1LQGC 3FZWA 1JB5A 3Q2PA 4XBXA 3PGBA 2R4IA 3DM8A 1N9EA 4G1MB 1UUWB 2WGQA 3RNTA 1UCLA 4NREA 7GSPA 1VQ63 2XRXB 3M8CA 1BRGA 2IY2A 5FGOA 1A90A 2BMQB 6STDA 3AMOB 1RGKA 5BXQA 1OHPA 1BSDA 4R9LA 1BSCA 1LNIA 1RHLA 1RN1A 1FZUA 3OXAA 1JBTA 3K9MC 5AIFA 3EN8A 3NBRA 4BL2A 6RNTA 3EC9A 1NWWA 2KF6A 3BNEA 3HZPA 5A0OB 1SQWA 2P38A 1EUIC 1ASKA 1T2IA 5AI1A 7STDA 2B1XB 3G0KA 1E3VA 1STDA 4WYKA 3X40A 3MKIA 3V99A 4GB5A 1GS3A 4GSPA 3WHOA 3MHEA 1GD4A 2F99A 2P05A 3S67A 1GSPA 4STDA 3PXMA 3D3LA 2XH9A 2MC8A 1O7PB 2O9UX 1VQ93 1YNVX 4HM4B 1RMSA 1ULIB 1IT8A 1WNHA 3CME3 2RGQA 2XGNA 1X1UA 3F7SA 1BNIA 2XR8B 4LMIA 1FYSA 2E2VA 5AYSC 2CFWA 1V58A 4BL3A 1I2FA 3L0RA 4N6TA 1CYUA 3JVCA 1C7HA 5IG5A 3BLZA 2V1LA 4J5GA 4EV2A 1SARA 3FG3A 5BIRA 4IPBA 3SVAA 2WOHA 4FCJA 2LYXA 4EXRA 1RRHA 1I3FA 1CYVA 2CX1A 3FF0A 5IEPA 1M904 2FXTA 2P0MA 4AKYA 3DGNA 2QA43 1W2ZA 1R4YA 4OVMA 2STDA 1T3BA 1B3SA 5STDA 3LT8A 4ZM8A 1NU3A 2W04A 1QMAA 5G2GA 4Q53A 3CCL3 3EBYA 2F5MA 5AYRB 3ROBA 1RGAA 3CC43 2I9WA 3TDGA 2QEX3 2BMRB 2CG0A 1A2KA 4LZIA 4N6OB 3SYUA 1BNGA 1SIIA 1OF5A 4O2HA 1BNJA 1K41A 1UCKA 5BVBA 4DKIA 1DVCA 1DE3A 4RNZA 1VQQA 2KXGA 3E99A 1AVKA 3FF2A 4RNYA 3UJMA 3CNMA 3GAXA 4MJDA 1QJGA 1YGWA 1JN5B 3OWSA 3NBJA 3CC73 1YJW3 5JPUA 4FMDA 5D82A 1NDOB 1FUTA 2Y74A 4FCMA 3LYGA 1BRNL 4HM8B 1JKGB 1CH0A 1TFKA 2Y73A 1RCLA 2Z77A 1I0VA 1T2HA 3EE1A 4KVHA 3HI7A 2IUJA 4LEHA 2MF7A 1BRSA 8CHOA 1NB5I 1HZ1A 2W03A 5M1AA 4XB5A 1B27A 1GY6A 2CIUA 3DGOA 1UGHI 4X2OA 1YIT3 2CG1A 4K90B 1OPYA 1T5YA 3Q1CA 4HM2B 1VQP3 1FGTA 2JQ5A 4KT3B 1WQLB 3PS8A 1PU4A 1BRKA 1ZGXA 3I553 3D9RA 1DVDA 4O02B 1B2MA 3I0YA 3X41A 4ORLA 3MWZA 1RKYA 1WMPA 1DYUA 3NHXA 1BSBA 1BVIA 1OUNA 1AR0A 1FGMA 1KWIA 1UUGB 3LTCA 2Z6BA 3GZYB 3Q90A 4HKVB 5D81A 1Q42A 2XF3A 1UW1A 3UL6A 1LRAA 2K3DA 5AIIA 3V98A 4LGQA 4WYKB 3AGOA 1LOWA 1HKXA 3F14A 2FNQA 1TTOA 4N6NB 1RCKA 1GOUA 2KF3A 1BAOA 3ALAA 3NQZA 4MEIA 3B7CA 3A76A 1DMQA 3LZAA 3WOFB 4J5KA 3T8UA 1W5ZA 5IENA 2CFLA 1JBSA 1U8CB 3ECFA 1BOXA 3AHWA 3KN4A 1L5GB 5EVHA 1GOVA 1BANA 2IMJA 3NQYA 3J7Yd 5KP4A 1JRQA 1BIRA 2BIRA 2ZDJA 2CHCA 3F8HA 2O3OA 4K1VA 1X1XA 5DREA 4HM5B 3CPOA 2E2UA 1Q9EA 2XEPA 4K61A 1B2SA 2Z7AA 4R4KA 2KF5A 1RGFA 2H0HA 3CU3A 1IDPA 1BRJA 3MG1A 1Y4KA 3DY5A 4N6LA 1VQN3 3F40A 3ZG5A 3JUPA 5CLKA 1KC84 1G02A 1K28A 2BHMA 5D83A 1YVSA 2OQEC 3KSED 3CCM3 2CWUA 1O7WB 1JZOA 1UCIA 3LH4A 5HGRA 1OHSA 4N6MA 3DUKA 3CCE3 3WR2A 3X3XA 2CFDA 4XBTA 3F9SA 3JUNA 2RCDA 1OCVA 2M7OA 1IT7A 1PY3A 1ISKA 5HOHA 1IQYA 4XBYA 1QVG2 1BU4A 1TP6A 1X1WA 4KZ1A 1OF5B 1B2XA 2YFIB 4N3VA 3VGNA 1M1K4 1RGLA 5GSPA 2OCTA 3CD63 1JB4A 2A15A 3PCSA 4FCZA 3OWUA 3S5CA 3RDEA 2YFJB 1WMOA 2P09A 1YI23 3LTDA 1KD14 1W6CA 2SARA 3PCRA 1DMMA 1TIJA 3OW22 3FG1A 3D79A 3SOAA 2Z76A 2GSPA 1QAKA 5AEUB 1Q7Y4 2UX0A 2WGOA 5AIGA 5ELUA 1VQK3 1E97A 2E2TA 2W0QA 3BIRA 3KSPA 3EN1B 2BO9B 3G713 1MWTA 2D1WA 2R41A 4R1KA 3G6E3 2OOVA 1C54A 1W6GA 2HMOB 1F8NA 4AEQA 1KQS2 1IV7A 2XFTA 1JNQA 2AADA 4HJLB 3NX0A 4HM7B 1IK3A 1V57A 2D42A 1RGGA 3IJEB 2K54A 3KKGA 1JZDA 3CMA3 4H61A 3UB1A 3EX9A 1UCJA 1RJOA 2W6JH 1LOVA 5CK6A 4OUQA 1O7NB 1BSEA 3BNCA 3EB8A 3OWYA 3CXC2 3LTBA 3CCJ3 3ZFZA 4CPKA 5IF6A 1W4NA 1YGEA 3OV4A 2HMLB 1QALA 3F8XA 3MPHA 4FR9A 2W56B 1OGXA 1WMNA 1X1YA 2L4VA 4JF8A 3MSOA 1MWUA 1NB3I 1PFPA 1B21A 2IYJA 2RSXA 1E3RA 2W9QA 3K0ZA 4IT7A 1Q40A 4N6V0 4EC6A 3CNXA 3RGAA 1J2BA 2OTJ3 4XDVA 2P0XA 1JB2A 4XDWA 3U1WA 1CQSA 1W00A 1DETA 1GMPA 3NV0A 1YJN3 1LOYA 2HMJB 1EQKA 2W9PA 3V92A 3S28A 3WODG 1IYYA 5M18A 3N8BA 3FG4A 4BU4A 2L1SA 2XGLA 4GL6A 1A2PA 2PZVA 1MWSA 3CCQ3 5M19A 2CWTA 2LQVA 1W2B2 3MYTA 4BTXA 2F5WA 2SBLA 3JUQA 1BRHA 1IVXA 1LVNA 4R80A 4EYCA 3GZBA 3GSPA 5I97A 2H0GA 3LMLA 3KE7A 4NPBA 4CCVA 3PYJA 2YX9A 2C10A 3X3YA 5IG0A 2XSHB 5TGNA 2RBIA 1VQO3 3B4OA 4MMZB 3B8LA 1Z1SA 5IG4A 3S27A 3K63A 4HZBB
chains in the Genus database with same CATH topology
4H3UA 2GEXA 2W56A 4OK0A 3GZXB 5JBSA 2W2CA 4KFFA 2IA7A 1TFOA 2GBWB 3IMAB 4HM0B 2HMNB 2CH9A 5IERA 3I563 3QRDA 3DZLA 3WA3A 1LOXA 1W6YA 3U97A 3FGYA 1EG9B 2QGUA 1VQL3 1N5PA 4JRFA 2CC3A 1UUVB 3JUMA 4IIAA 1Q814 4FMAA 5CXOA 3G16A 5LC7A 4L8OA 2WOFA 3FKAA 4HM6B 1MNLA 4HZ9B 1GY5A 1GYBA 1K9M4 3SX1A 4RBNA 3SLUA 1HU9A 4I4KA 3S28A 5FW5A 1WTHA 1O7GB 3BNBA 3EF8A 3KZTA 4HM1B 2CKFB 2OWPA 4J9AA 1ZO2A 1LNHA 1QAFA 2GBXB 3BNDA 3H3HA 4HBRA 4AKZA 3DXOA 1G96A 2HMKB 3DMCA 1MOLA 1IV9A 4U13A 4WWUC 3ROBA 5AIHA 2OTL3 3O8YA 1UI8A 3MG2A 4XM4A 3STDA 3SOYA 1IVUA 3QK9A 1UI7A 1KSIA 4LSOA 1GD3A 1N5HA 1FGQA 1EA2A 4L7KA 1JV2B 2XFSA 3UL5A 2PNCA 3T8NA 4FMCA 1OACA 4BTYA 1Q40B 3T0UA 2QIYA 3WA2X 1YVBI 1GY7A 1M1XB 1OHOA 1R4CA 1IVVA 5EQLA 2CW9A 5IW9A 3VF1A 3LXUX 3ER7A 3NV0B 3EHCA 4WP5A 1IQ8A 1TU5A 1W02A 3KIIA 1EKMA 3FH1A 5KP3A 1IU7A 1BUQA 1LXEA 1JJ22 3DGLA 3OX9A 4O8SA 1SJWA 4N6UA 1VQM3 1YIJ3 2IUKA 5AEWB 3HIGA 4CDLA 3GRDA 1O7HB 2CWVA 3SXXA 3G8ZA 1D6YA 3NM7A 2GEYA 1VZZA 1M9GA 4WHAA 1SIHA 4R9KA 2FGTA 3EJVA 2KCDA 2K0MA 1K734 2BNGA 3AMOA 3N54B 1RN7A 3PZWA 2WO0A 3BB9A 3CCS3 3GWRA 1VQ53 2GU1A 5ELJA 2Q07A 1D6UA 2B24B 4QWTA 3CCU3 4RZMA 3IPTA 2F98A 2OOVC 1STFI 1ROVA 1ULJB 1VQ83 5IG3A 3RGRA 2ZL8A 4KFDA 1N9JA 2C11A 4K1UA 4L8PA 3GZRA 1IVWA 3DGMA 3FCSB 3SEDA 4MMXB 3EBTA 5DRVA 1W7CA 1N8QA 1RRLA 4X2HA 4HYZA 1AVLA 4J8TA 4PEJA 5CF2A 3S29A 1FGRA 1NO3A 1AV4A 2BT3A 1ROAA 3H51A 1TUHA 3WMDA 1IQXA 2BMOB 3FLJA 3CCV3 2HMMB 4KFEA 1SPUA 1A2VA 3NBBA 5JPPA 4O3VA 1S723 3EQQB 3WOEB 3X3ZA 2KRTA 3B4PA 2ML6A 3LOYA 3NM2A 3F7XA 5IEOA 2INXA 2CFKA 4FMBA 3X42A 3LT9A 1ZX2A 4HM3B 2JDIH 2YFLB 3UNLA 1FA3A 3FSDA 3KFQC 3CC23 5KP1A 1YJ93 1NJI4 2GXFA 1A67A 3MG3A 3WDGB 2CK3H 5CF1A 3NXJA 5EEOA 2ML5A 1U5OA 5LC6A 1D6ZA 1N8R4 3NUVA 3VSYA 1O7MB 2RFRA 1VQ73 1Q864 1V74A 3HX8A 4NHFA 4EV5A 4HVNA 1FUWA 1W01A 1K8A4 3K7CA 4EBGA 2XSOB 1JN5A 3JUOA 1OH0A 4WFOA 3K5TA 3G4S3 1QVF2 2CFGA 1S5AA 1US1A 2F86B 4MMYB 3HIIA 2OQEA 3CPW2 3CCR3 1FGOA 1JKGA 1YHQ3 3N9HA 3HK4A 1DMNA 1VQ43 1OGZA 4BTWA 1CEWI 2GU3A 3LTAA 3FZWA 1JB5A 3Q2PA 4XBXA 3PGBA 2R4IA 3DM8A 1N9EA 4G1MB 1UUWB 2WGQA 4NREA 1VQ63 2XRXB 3M8CA 5FGOA 1A90A 2BMQB 6STDA 3AMOB 5BXQA 1OHPA 4R9LA 3OXAA 3K9MC 5AIFA 3EN8A 3NBRA 3EC9A 1NWWA 3BNEA 3HZPA 5A0OB 1SQWA 2P38A 1ASKA 7STDA 5AI1A 2B1XB 3G0KA 1E3VA 1STDA 4WYKA 3X40A 3MKIA 3V99A 4GB5A 1GS3A 3MHEA 1GD4A 2F99A 2P05A 3S67A 4STDA 3PXMA 3D3LA 2XH9A 2MC8A 1O7PB 2O9UX 1VQ93 4HM4B 1ULIB 1IT8A 1WNHA 2RGQA 2XGNA 3F7SA 4LMIA 2XR8B 5AYSC 2E2VA 2CFWA 3L0RA 4N6TA 1CYUA 3JVCA 1C7HA 5IG5A 3BLZA 2V1LA 4EV2A 3FG3A 4IPBA 3SVAA 2WOHA 4FCJA 2LYXA 4EXRA 1RRHA 5IEPA 1CYVA 3FF0A 1M904 2FXTA 2P0MA 4AKYA 3DGNA 2QA43 1W2ZA 4OVMA 2STDA 5STDA 3LT8A 4ZM8A 1NU3A 2W04A 1QMAA 5G2GA 4Q53A 3CCL3 3EBYA 5AYRB 3CC43 2I9WA 3TDGA 2QEX3 2BMRB 2CG0A 1A2KA 4LZIA 4N6OB 1SIIA 1OF5A 4O2HA 1K41A 5BVBA 1DVCA 4RNZA 2KXGA 3E99A 1AVKA 3FF2A 4RNYA 3UJMA 3CNMA 3GAXA 4MJDA 1QJGA 1JN5B 3OWSA 3NBJA 3CC73 1YJW3 5JPUA 4FMDA 5D82A 1NDOB 2Y74A 4FCMA 3LYGA 4HM8B 1JKGB 1TFKA 2Y73A 4KVHA 2Z77A 4TX4A 2IUJA 3EE1A 3HI7A 4LEHA 2MF7A 8CHOA 1NB5I 2W03A 4XB5A 1GY6A 2CIUA 3DGOA 4X2OA 1YIT3 2CG1A 4K90B 1OPYA 1T5YA 3Q1CA 4HM2B 1VQP3 1FGTA 2JQ5A 1WQLB 3PS8A 1PU4A 3I553 3D9RA 4O02B 3I0YA 3X41A 4ORLA 3MWZA 1RKYA 1WMPA 1DYUA 3NHXA 1OUNA 3Q90A 1KWIA 1AR0A 1FGMA 3LTCA 4HKVB 2Z6BA 3GZYB 5D81A 1Q42A 2XF3A 1UW1A 3UL6A 5AIIA 3V98A 4LGQA 4WYKB 1HKXA 3F14A 2FNQA 4N6NB 3ALAA 3NQZA 4MEIA 3B7CA 3A76A 1DMQA 3LZAA 3WOFB 5IENA 3T8UA 1W5ZA 2CFLA 1U8CB 3ECFA 3KN4A 1L5GB 5EVHA 2IMJA 3NQYA 3J7Yd 5KP4A 1JRQA 3F8HA 2ZDJA 4K1VA 2CHCA 2O3OA 5DREA 4HM5B 3CPOA 2E2UA 2XEPA 4K61A 2Z7AA 4R4KA 3CU3A 1IDPA 3MG1A 4N6LA 1Y4KA 3DY5A 1VQN3 3F40A 3JUPA 5CLKA 1KC84 1K28A 2BHMA 5D83A 2OQEC 3KSED 3CCM3 2CWUA 1O7WB 3LH4A 5HGRA 1OHSA 4N6MA 3DUKA 3CCE3 3X3XA 2CFDA 4XBTA 3F9SA 3JUNA 2RCDA 1OCVA 2M7OA 1IT7A 1ISKA 1IQYA 4XBYA 1QVG2 1TP6A 4KZ1A 1OF5B 2YFIB 4N3VA 3VGNA 1M1K4 2OCTA 3CD63 1JB4A 2A15A 3PCSA 4FCZA 3OWUA 3S5CA 3RDEA 2YFJB 1WMOA 2P09A 1YI23 3LTDA 1KD14 1W6CA 3PCRA 1DMMA 1TIJA 3OW22 3FG1A 3SOAA 2Z76A 1QAKA 5AEUB 1Q7Y4 2UX0A 2WGOA 5AIGA 5ELUA 1VQK3 1E97A 2E2TA 2W0QA 3KSPA 3EN1B 2BO9B 3G713 4R1KA 2D1WA 3G6E3 2OOVA 1W6GA 2HMOB 1F8NA 4AEQA 1KQS2 1IV7A 2XFTA 1JNQA 1Q824 4HJLB 3NX0A 4HM7B 1IK3A 3IJEB 2D42A 3KKGA 3CMA3 2K54A 4H61A 3UB1A 3EX9A 1RJOA 2W6JH 5CK6A 4OUQA 1O7NB 3BNCA 3EB8A 3OWYA 3CXC2 3LTBA 3CCJ3 5IF6A 1W4NA 1YGEA 3OV4A 2HMLB 1QALA 3F8XA 3MPHA 4FR9A 2W56B 1OGXA 1WMNA 3CME3 2L4VA 4JF8A 3MSOA 2RSXA 1NB3I 1PFPA 1DVDA 1E3RA 2W9QA 3K0ZA 4IT7A 1Q40A 4N6V0 4EC6A 3CNXA 3RGAA 1J2BA 2OTJ3 4XDVA 2P0XA 1JB2A 4XDWA 3U1WA 1CQSA 1W00A 3NV0A 1YJN3 2HMJB 1EQKA 2W9PA 3V92A 3WODG 3N8BA 3FG4A 2XGLA 4GL6A 2PZVA 3CCQ3 2CWTA 2LQVA 1W2B2 3MYTA 4BTXA 2SBLA 3JUQA 4R80A 1IVXA 1LVNA 4EYCA 5I97A 3GZBA 3LMLA 3KE7A 4CCVA 3PYJA 2YX9A 2C10A 3X3YA 5IG0A 2XSHB 5TGNA 1VQO3 3B4OA 4MMZB 3B8LA 1Z1SA 5IG4A 3S27A 3K63A 4HZBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H3U A;  2GEX A;  3GZX B;  2W2C A;  2GBW B;  4HM0 B;  2HMN B;  5IER A;  3DZL A;  1W6Y A;  3FGY A;  1EG9 B;  2QGU A;  3JUM A;  1UUV B;  4IIA A;  5CXO A;  3G16 A;  4L8O A;  3FKA A;  4HM6 B;  4HZ9 B;  1GY5 A;  1GYB A;  4I4K A;  5FW5 A;  1O7G B;  3EF8 A;  3KZT A;  4HM1 B;  2CKF B;  2OWP A;  4J9A A;  1ZO2 A;  2GBX B;  3H3H A;  3DXO A;  4U13 A;  2HMK B;  3DMC A;  3ROB A;  4WWU C;  5AIH A;  3MG2 A;  4XM4 A;  3STD A;  3SOY A;  1EA2 A;  4L7K A;  3T8N A;  1Q40 B;  2QIY A;  1GY7 A;  1OHO A;  3ER7 A;  3NV0 B;  3EHC A;  4WP5 A;  1W02 A;  3FH1 A;  5KP3 A;  1BUQ A;  3OX9 A;  1SJW A;  5AEW B;  4CDL A;  3GRD A;  1O7H B;  3G8Z A;  2GEY A;  1VZZ A;  4R9K A;  3EJV A;  2BNG A;  3BB9 A;  3GWR A;  2B24 B;  4RZM A;  3IPT A;  2F98 A;  1ULJ B;  5IG3 A;  3RGR A;  4K1U A;  4L8P A;  3GZR A;  3SED A;  3EBT A;  5DRV A;  4X2H A;  4J8T A;  4PEJ A;  5CF2 A;  3H51 A;  1TUH A;  3WMD A;  2BMO B;  3FLJ A;  2HMM B;  5JPP A;  3EQQ B;  3B4P A;  3NM2 A;  3F7X A;  5IEO A;  2INX A;  1ZX2 A;  4HM3 B;  2YFL B;  3UNL A;  3FSD A;  5KP1 A;  2GXF A;  3MG3 A;  5CF1 A;  3NXJ A;  1U5O A;  3NUV A;  3VSY A;  1O7M B;  2RFR A;  3HX8 A;  4HVN A;  1W01 A;  3K7C A;  2XSO B;  1JN5 A;  3JUO A;  1OH0 A;  1S5A A;  2F86 B;  1JKG A;  3HK4 A;  1DMN A;  1OGZ A;  3FZW A;  1JB5 A;  4XBX A;  2R4I A;  3DM8 A;  1UUW B;  2XRX B;  3M8C A;  2BMQ B;  6STD A;  5BXQ A;  1OHP A;  4R9L A;  3OXA A;  5AIF A;  3EN8 A;  3NBR A;  3EC9 A;  1NWW A;  3HZP A;  1ASK A;  7STD A;  5AI1 A;  2B1X B;  3G0K A;  1E3V A;  1STD A;  4WYK A;  3MKI A;  4GB5 A;  1GS3 A;  3MHE A;  2F99 A;  4STD A;  1O7P B;  4HM4 B;  1ULI B;  2RGQ A;  3F7S A;  4LMI A;  2XR8 B;  1C7H A;  5IG5 A;  3BLZ A;  4FCJ A;  5IEP A;  3FF0 A;  4OVM A;  2STD A;  5STD A;  1NU3 A;  1QMA A;  5G2G A;  4Q53 A;  3EBY A;  2I9W A;  2BMR B;  1A2K A;  1OF5 A;  1K41 A;  5BVB A;  3E99 A;  3FF2 A;  3UJM A;  3CNM A;  4MJD A;  1QJG A;  1JN5 B;  3OWS A;  5JPU A;  5D82 A;  1NDO B;  4FCM A;  3LYG A;  4HM8 B;  1JKG B;  4KVH A;  2Z77 A;  4LEH A;  8CHO A;  4XB5 A;  1GY6 A;  4X2O A;  1OPY A;  4HM2 B;  2JQ5 A;  1WQL B;  3D9R A;  3I0Y A;  4ORL A;  3NHX A;  1OUN A;  3Q90 A;  1AR0 A;  4HKV B;  3GZY B;  5D81 A;  1Q42 A;  5AII A;  4LGQ A;  4WYK B;  1HKX A;  3F14 A;  3B7C A;  3A76 A;  1DMQ A;  3LZA A;  5IEN A;  3T8U A;  3ECF A;  5EVH A;  2IMJ A;  5KP4 A;  3F8H A;  4K1V A;  2CHC A;  5DRE A;  4HM5 B;  3CPO A;  2Z7A A;  3CU3 A;  1IDP A;  3MG1 A;  3F40 A;  3JUP A;  5CLK A;  5D83 A;  1O7W B;  5HGR A;  1OHS A;  3DUK A;  4XBT A;  3F9S A;  3JUN A;  2RCD A;  1OCV A;  1ISK A;  4XBY A;  1TP6 A;  1OF5 B;  2YFI B;  4N3V A;  3VGN A;  1JB4 A;  2A15 A;  3OWU A;  3S5C A;  2YFJ B;  1DMM A;  3SOA A;  2Z76 A;  5AEU B;  2UX0 A;  5AIG A;  1E97 A;  3KSP A;  3EN1 B;  4R1K A;  2HMO B;  4HJL B;  4HM7 B;  3KKG A;  2K54 A;  3EX9 A;  5CK6 A;  4OUQ A;  1O7N B;  3OWY A;  5IF6 A;  3OV4 A;  2HML B;  3F8X A;  1OGX A;  3MSO A;  1E3R A;  3K0Z A;  1Q40 A;  3CNX A;  3RGA A;  4XDV A;  1JB2 A;  4XDW A;  1CQS A;  1W00 A;  3NV0 A;  2HMJ B;  2PZV A;  3MYT A;  3JUQ A;  3GZB A;  3KE7 A;  5IG0 A;  2XSH B;  5TGN A;  3B4O A;  3B8L A;  1Z1S A;  5IG4 A;  4HZB B; 
#chains in the Genus database with same CATH topology
 4CJN A;  4H3U A;  2GEX A;  2W56 A;  4OK0 A;  3GZX B;  5JBS A;  2W2C A;  4KFF A;  2IA7 A;  1TFO A;  2GBW B;  3IMA B;  4RNT A;  4HM0 B;  2HMN B;  2CH9 A;  5IER A;  3I56 3;  3QRD A;  3DZL A;  3WA3 A;  1LOX A;  1W6Y A;  2F56 A;  3U97 A;  3FGY A;  1EG9 B;  1RGC A;  2QGU A;  1VQL 3;  1N5P A;  3HOH A;  4JRF A;  2CC3 A;  1UUV B;  3JUM A;  4IIA A;  4EW5 A;  1Q81 4;  4FMA A;  1TRQ A;  5CXO A;  3G16 A;  5LC7 A;  4L8O A;  1I3I A;  2WOF A;  3FKA A;  4HM6 B;  1MNL A;  4HZ9 B;  1GY5 A;  1GYB A;  4BIR A;  1B2Z A;  1K9M 4;  3SX1 A;  4RBN A;  3SLU A;  2CX0 A;  1EEJ A;  1HU9 A;  4I4K A;  1I2G A;  1Q7H A;  1BSA A;  1WTH A;  5FW5 A;  1O7G B;  3BNB A;  3EF8 A;  3KZT A;  2BU4 A;  4TX4 A;  4HM1 B;  2CKF B;  2OWP A;  4J9A A;  1TJD A;  1ZO2 A;  1LNH A;  1QAF A;  2GBX B;  3AGN A;  3BND A;  3H3H A;  4HBR A;  4AKZ A;  3DXO A;  1BUJ A;  1G96 A;  1NNV A;  2HMK B;  1IV9 A;  1MGR A;  1MOL A;  2C4B A;  3DMC A;  4U13 A;  4WWU C;  5AIH A;  2OTL 3;  1RTU A;  3D5I A;  3O8Y A;  1UI8 A;  3MG2 A;  4XM4 A;  2AAE A;  3STD A;  3SOY A;  1IVU A;  1I70 A;  3QK9 A;  1UI7 A;  1G0T A;  1KSI A;  1GOY A;  4LSO A;  1GD3 A;  1N5H A;  1FW7 A;  1RGH A;  1EA2 A;  1FGQ A;  4L7K A;  1JV2 B;  1MGW A;  1PYL A;  1RGE A;  1BNE A;  2KAA A;  2XFS A;  3UL5 A;  1HYF A;  2PNC A;  1I0X A;  4FMC A;  3T8N A;  1OAC A;  4BTY A;  1AY7 A;  1Q40 B;  3T0U A;  2QIY A;  1I2E A;  2J8X B;  3WA2 X;  1YVB I;  1GY7 A;  1M1X B;  1GMQ A;  1OHO A;  1R4C A;  1IVV A;  1GMR A;  5EQL A;  2CW9 A;  5IW9 A;  3VF1 A;  3LXU X;  3ER7 A;  3NV0 B;  3EHC A;  4WP5 A;  1IQ8 A;  1TU5 A;  1W02 A;  3KII A;  1EKM A;  3FH1 A;  5KP3 A;  1IU7 A;  2UGI A;  1BUQ A;  1LXE A;  1JJ2 2;  3DGL A;  2UUG C;  3OX9 A;  4O8S A;  3D5G A;  3Q3F A;  1SJW A;  4N6U A;  1VQM 3;  1YIJ 3;  1RLS A;  2IUK A;  5AEW B;  3HIG A;  9RNT A;  4CDL A;  3GRD A;  3KCH A;  3URP A;  1O7H B;  2CWV A;  4ILF A;  1RSN A;  3SXX A;  3G8Z A;  1D6Y A;  5BU4 A;  3NM7 A;  1BNF A;  2GEY A;  1VZZ A;  1M9G A;  4WHA A;  5RNT A;  1SIH A;  1BRI A;  4R9K A;  1I8V A;  4I5Q A;  2FGT A;  3EJV A;  2KCD A;  2K0M A;  1K73 4;  2BNG A;  3AMO A;  3N54 B;  1RN7 A;  3PZW A;  2WO0 A;  1MWR A;  3BB9 A;  3CCS 3;  3GWR A;  1VQ5 3;  1RDS A;  2GU1 A;  3DH2 A;  1LQM B;  2Q07 A;  1D6U A;  5ELJ A;  3DGY A;  2B24 B;  4QWT A;  3CCU 3;  1FUS A;  4RZM A;  3IPT A;  2F98 A;  2OOV C;  1STF I;  1ROV A;  1ULJ B;  1VQ8 3;  5IG3 A;  3RGR A;  6GSP A;  2ZL8 A;  4KFD A;  1N9J A;  2C11 A;  4K1U A;  4L8P A;  3GZR A;  1BNS A;  1IVW A;  1UGI A;  3DGM A;  3FCS B;  3SED A;  4MMX B;  3EBT A;  5DRV A;  7RNT A;  1JBR A;  1W7C A;  1N8Q A;  1RRL A;  4X2H A;  4HYZ A;  1AVL A;  4J8T A;  4PEJ A;  1RNB A;  5CF2 A;  3S29 A;  1FGR A;  1NO3 A;  1AV4 A;  2BT3 A;  1ROA A;  3H51 A;  1Q82 4;  1TUH A;  3WMD A;  1IQX A;  2BMO B;  3FLJ A;  3CCV 3;  5G1K A;  2HMM B;  4KFE A;  1SPU A;  1A2V A;  3NBB A;  5JPP A;  4HAA A;  1ZS7 A;  3EQQ B;  4O3V A;  3WOE B;  1S72 3;  3X3Z A;  2KRT A;  3B4P A;  2ML6 A;  3LOY A;  3NM2 A;  3F7X A;  5IEO A;  2INX A;  3ZG0 A;  2CFK A;  1BNR A;  4FMB A;  3X42 A;  3LT9 A;  1ZX2 A;  4HM3 B;  2JDI H;  2F4Y A;  2H0I A;  2YFL B;  3UNL A;  1FA3 A;  3FSD A;  3KFQ C;  3CC2 3;  5KP1 A;  1YJ9 3;  1NJI 4;  2RNT A;  3D4A A;  2GXF A;  1A67 A;  3MG3 A;  3WDG B;  2CK3 H;  4HOH A;  5CF1 A;  3NXJ A;  5EEO A;  2ML5 A;  1U5O A;  3A5E A;  5LC6 A;  1D6Z A;  1AQZ A;  8RNT A;  1N8R 4;  3NUV A;  3VSY A;  1O7M B;  1RNT A;  2RFR A;  1VQ7 3;  1Q86 4;  1V74 A;  1TRP A;  3HX8 A;  4NHF A;  4EV5 A;  4HVN A;  1FUW A;  4LYL B;  1B20 A;  1W01 A;  1K8A 4;  2KF4 A;  3K7C A;  1BGS A;  2XSO B;  1JN5 A;  5G1L A;  3JUO A;  1OH0 A;  1B2U A;  4WFO A;  4EBG A;  3K5T A;  3G4S 3;  1QVF 2;  2ZA4 A;  2CFG A;  1S5A A;  2ZHX B;  1US1 A;  2F86 B;  4GHO A;  3HII A;  4MMY B;  2OQE A;  3CPW 2;  3CCR 3;  1FGO A;  1JKG A;  1YHQ 3;  3N9H A;  3HK4 A;  1DMN A;  1VQ4 3;  1OGZ A;  4BTW A;  1RN4 A;  3BU4 A;  1CEW I;  1UDI I;  2GU3 A;  3AHS A;  3LTA A;  2HOH A;  1LQG C;  3FZW A;  1JB5 A;  3Q2P A;  4XBX A;  3PGB A;  2R4I A;  3DM8 A;  1N9E A;  4G1M B;  1UUW B;  2WGQ A;  3RNT A;  1UCL A;  4NRE A;  7GSP A;  1VQ6 3;  2XRX B;  3M8C A;  1BRG A;  2IY2 A;  5FGO A;  1A90 A;  2BMQ B;  6STD A;  3AMO B;  1RGK A;  5BXQ A;  1OHP A;  1BSD A;  4R9L A;  1BSC A;  1LNI A;  1RHL A;  1RN1 A;  1FZU A;  3OXA A;  1JBT A;  3K9M C;  5AIF A;  3EN8 A;  3NBR A;  4BL2 A;  6RNT A;  3EC9 A;  1NWW A;  2KF6 A;  3BNE A;  3HZP A;  5A0O B;  1SQW A;  2P38 A;  1EUI C;  1ASK A;  1T2I A;  5AI1 A;  7STD A;  2B1X B;  3G0K A;  1E3V A;  1STD A;  4WYK A;  3X40 A;  3MKI A;  3V99 A;  4GB5 A;  1GS3 A;  4GSP A;  3WHO A;  3MHE A;  1GD4 A;  2F99 A;  2P05 A;  3S67 A;  1GSP A;  4STD A;  3PXM A;  3D3L A;  2XH9 A;  2MC8 A;  1O7P B;  2O9U X;  1VQ9 3;  1YNV X;  4HM4 B;  1RMS A;  1ULI B;  1IT8 A;  1WNH A;  3CME 3;  2RGQ A;  2XGN A;  1X1U A;  3F7S A;  1BNI A;  2XR8 B;  4LMI A;  1FYS A;  2E2V A;  5AYS C;  2CFW A;  1V58 A;  4BL3 A;  1I2F A;  3L0R A;  4N6T A;  1CYU A;  3JVC A;  1C7H A;  5IG5 A;  3BLZ A;  2V1L A;  4J5G A;  4EV2 A;  1SAR A;  3FG3 A;  5BIR A;  4IPB A;  3SVA A;  2WOH A;  4FCJ A;  2LYX A;  4EXR A;  1RRH A;  1I3F A;  1CYV A;  2CX1 A;  3FF0 A;  5IEP A;  1M90 4;  2FXT A;  2P0M A;  4AKY A;  3DGN A;  2QA4 3;  1W2Z A;  1R4Y A;  4OVM A;  2STD A;  1T3B A;  1B3S A;  5STD A;  3LT8 A;  4ZM8 A;  1NU3 A;  2W04 A;  1QMA A;  5G2G A;  4Q53 A;  3CCL 3;  3EBY A;  2F5M A;  5AYR B;  3ROB A;  1RGA A;  3CC4 3;  2I9W A;  3TDG A;  2QEX 3;  2BMR B;  2CG0 A;  1A2K A;  4LZI A;  4N6O B;  3SYU A;  1BNG A;  1SII A;  1OF5 A;  4O2H A;  1BNJ A;  1K41 A;  1UCK A;  5BVB A;  4DKI A;  1DVC A;  1DE3 A;  4RNZ A;  1VQQ A;  2KXG A;  3E99 A;  1AVK A;  3FF2 A;  4RNY A;  3UJM A;  3CNM A;  3GAX A;  4MJD A;  1QJG A;  1YGW A;  1JN5 B;  3OWS A;  3NBJ A;  3CC7 3;  1YJW 3;  5JPU A;  4FMD A;  5D82 A;  1NDO B;  1FUT A;  2Y74 A;  4FCM A;  3LYG A;  1BRN L;  4HM8 B;  1JKG B;  1CH0 A;  1TFK A;  2Y73 A;  1RCL A;  2Z77 A;  1I0V A;  1T2H A;  3EE1 A;  4KVH A;  3HI7 A;  2IUJ A;  4LEH A;  2MF7 A;  1BRS A;  8CHO A;  1NB5 I;  1HZ1 A;  2W03 A;  5M1A A;  4XB5 A;  1B27 A;  1GY6 A;  2CIU A;  3DGO A;  1UGH I;  4X2O A;  1YIT 3;  2CG1 A;  4K90 B;  1OPY A;  1T5Y A;  3Q1C A;  4HM2 B;  1VQP 3;  1FGT A;  2JQ5 A;  4KT3 B;  1WQL B;  3PS8 A;  1PU4 A;  1BRK A;  1ZGX A;  3I55 3;  3D9R A;  1DVD A;  4O02 B;  1B2M A;  3I0Y A;  3X41 A;  4ORL A;  3MWZ A;  1RKY A;  1WMP A;  1DYU A;  3NHX A;  1BSB A;  1BVI A;  1OUN A;  1AR0 A;  1FGM A;  1KWI A;  1UUG B;  3LTC A;  2Z6B A;  3GZY B;  3Q90 A;  4HKV B;  5D81 A;  1Q42 A;  2XF3 A;  1UW1 A;  3UL6 A;  1LRA A;  2K3D A;  5AII A;  3V98 A;  4LGQ A;  4WYK B;  3AGO A;  1LOW A;  1HKX A;  3F14 A;  2FNQ A;  1TTO A;  4N6N B;  1RCK A;  1GOU A;  2KF3 A;  1BAO A;  3ALA A;  3NQZ A;  4MEI A;  3B7C A;  3A76 A;  1DMQ A;  3LZA A;  3WOF B;  4J5K A;  3T8U A;  1W5Z A;  5IEN A;  2CFL A;  1JBS A;  1U8C B;  3ECF A;  1BOX A;  3AHW A;  3KN4 A;  1L5G B;  5EVH A;  1GOV A;  1BAN A;  2IMJ A;  3NQY A;  3J7Y d;  5KP4 A;  1JRQ A;  1BIR A;  2BIR A;  2ZDJ A;  2CHC A;  3F8H A;  2O3O A;  4K1V A;  1X1X A;  5DRE A;  4HM5 B;  3CPO A;  2E2U A;  1Q9E A;  2XEP A;  4K61 A;  1B2S A;  2Z7A A;  4R4K A;  2KF5 A;  1RGF A;  2H0H A;  3CU3 A;  1IDP A;  1BRJ A;  3MG1 A;  1Y4K A;  3DY5 A;  4N6L A;  1VQN 3;  3F40 A;  3ZG5 A;  3JUP A;  5CLK A;  1KC8 4;  1G02 A;  1K28 A;  2BHM A;  5D83 A;  1YVS A;  2OQE C;  3KSE D;  3CCM 3;  2CWU A;  1O7W B;  1JZO A;  1UCI A;  3LH4 A;  5HGR A;  1OHS A;  4N6M A;  3DUK A;  3CCE 3;  3WR2 A;  3X3X A;  2CFD A;  4XBT A;  3F9S A;  3JUN A;  2RCD A;  1OCV A;  2M7O A;  1IT7 A;  1PY3 A;  1ISK A;  5HOH A;  1IQY A;  4XBY A;  1QVG 2;  1BU4 A;  1TP6 A;  1X1W A;  4KZ1 A;  1OF5 B;  1B2X A;  2YFI B;  4N3V A;  3VGN A;  1M1K 4;  1RGL A;  5GSP A;  2OCT A;  3CD6 3;  1JB4 A;  2A15 A;  3PCS A;  4FCZ A;  3OWU A;  3S5C A;  3RDE A;  2YFJ B;  1WMO A;  2P09 A;  1YI2 3;  3LTD A;  1KD1 4;  1W6C A;  2SAR A;  3PCR A;  1DMM A;  1TIJ A;  3OW2 2;  3FG1 A;  3D79 A;  3SOA A;  2Z76 A;  2GSP A;  1QAK A;  5AEU B;  1Q7Y 4;  2UX0 A;  2WGO A;  5AIG A;  5ELU A;  1VQK 3;  1E97 A;  2E2T A;  2W0Q A;  3BIR A;  3KSP A;  3EN1 B;  2BO9 B;  3G71 3;  1MWT A;  2D1W A;  2R41 A;  4R1K A;  3G6E 3;  2OOV A;  1C54 A;  1W6G A;  2HMO B;  1F8N A;  4AEQ A;  1KQS 2;  1IV7 A;  2XFT A;  1JNQ A;  2AAD A;  4HJL B;  3NX0 A;  4HM7 B;  1IK3 A;  1V57 A;  2D42 A;  1RGG A;  3IJE B;  2K54 A;  3KKG A;  1JZD A;  3CMA 3;  4H61 A;  3UB1 A;  3EX9 A;  1UCJ A;  1RJO A;  2W6J H;  1LOV A;  5CK6 A;  4OUQ A;  1O7N B;  1BSE A;  3BNC A;  3EB8 A;  3OWY A;  3CXC 2;  3LTB A;  3CCJ 3;  3ZFZ A;  4CPK A;  5IF6 A;  1W4N A;  1YGE A;  3OV4 A;  2HML B;  1QAL A;  3F8X A;  3MPH A;  4FR9 A;  2W56 B;  1OGX A;  1WMN A;  1X1Y A;  2L4V A;  4JF8 A;  3MSO A;  1MWU A;  1NB3 I;  1PFP A;  1B21 A;  2IYJ A;  2RSX A;  1E3R A;  2W9Q A;  3K0Z A;  4IT7 A;  1Q40 A;  4N6V 0;  4EC6 A;  3CNX A;  3RGA A;  1J2B A;  2OTJ 3;  4XDV A;  2P0X A;  1JB2 A;  4XDW A;  3U1W A;  1CQS A;  1W00 A;  1DET A;  1GMP A;  3NV0 A;  1YJN 3;  1LOY A;  2HMJ B;  1EQK A;  2W9P A;  3V92 A;  3S28 A;  3WOD G;  1IYY A;  5M18 A;  3N8B A;  3FG4 A;  4BU4 A;  2L1S A;  2XGL A;  4GL6 A;  1A2P A;  2PZV A;  1MWS A;  3CCQ 3;  5M19 A;  2CWT A;  2LQV A;  1W2B 2;  3MYT A;  4BTX A;  2F5W A;  2SBL A;  3JUQ A;  1BRH A;  1IVX A;  1LVN A;  4R80 A;  4EYC A;  3GZB A;  3GSP A;  5I97 A;  2H0G A;  3LML A;  3KE7 A;  4NPB A;  4CCV A;  3PYJ A;  2YX9 A;  2C10 A;  3X3Y A;  5IG0 A;  2XSH B;  5TGN A;  2RBI A;  1VQO 3;  3B4O A;  4MMZ B;  3B8L A;  1Z1S A;  5IG4 A;  3S27 A;  3K63 A;  4HZB B; 
#chains in the Genus database with same CATH homology
 4H3U A;  2GEX A;  2W56 A;  4OK0 A;  3GZX B;  5JBS A;  2W2C A;  4KFF A;  2IA7 A;  1TFO A;  2GBW B;  3IMA B;  4HM0 B;  2HMN B;  2CH9 A;  5IER A;  3I56 3;  3QRD A;  3DZL A;  3WA3 A;  1LOX A;  1W6Y A;  3U97 A;  3FGY A;  1EG9 B;  2QGU A;  1VQL 3;  1N5P A;  4JRF A;  2CC3 A;  1UUV B;  3JUM A;  4IIA A;  1Q81 4;  4FMA A;  5CXO A;  3G16 A;  5LC7 A;  4L8O A;  2WOF A;  3FKA A;  4HM6 B;  1MNL A;  4HZ9 B;  1GY5 A;  1GYB A;  1K9M 4;  3SX1 A;  4RBN A;  3SLU A;  1HU9 A;  4I4K A;  3S28 A;  5FW5 A;  1WTH A;  1O7G B;  3BNB A;  3EF8 A;  3KZT A;  4HM1 B;  2CKF B;  2OWP A;  4J9A A;  1ZO2 A;  1LNH A;  1QAF A;  2GBX B;  3BND A;  3H3H A;  4HBR A;  4AKZ A;  3DXO A;  1G96 A;  2HMK B;  3DMC A;  1MOL A;  1IV9 A;  4U13 A;  4WWU C;  3ROB A;  5AIH A;  2OTL 3;  3O8Y A;  1UI8 A;  3MG2 A;  4XM4 A;  3STD A;  3SOY A;  1IVU A;  3QK9 A;  1UI7 A;  1KSI A;  4LSO A;  1GD3 A;  1N5H A;  1FGQ A;  1EA2 A;  4L7K A;  1JV2 B;  2XFS A;  3UL5 A;  2PNC A;  3T8N A;  4FMC A;  1OAC A;  4BTY A;  1Q40 B;  3T0U A;  2QIY A;  3WA2 X;  1YVB I;  1GY7 A;  1M1X B;  1OHO A;  1R4C A;  1IVV A;  5EQL A;  2CW9 A;  5IW9 A;  3VF1 A;  3LXU X;  3ER7 A;  3NV0 B;  3EHC A;  4WP5 A;  1IQ8 A;  1TU5 A;  1W02 A;  3KII A;  1EKM A;  3FH1 A;  5KP3 A;  1IU7 A;  1BUQ A;  1LXE A;  1JJ2 2;  3DGL A;  3OX9 A;  4O8S A;  1SJW A;  4N6U A;  1VQM 3;  1YIJ 3;  2IUK A;  5AEW B;  3HIG A;  4CDL A;  3GRD A;  1O7H B;  2CWV A;  3SXX A;  3G8Z A;  1D6Y A;  3NM7 A;  2GEY A;  1VZZ A;  1M9G A;  4WHA A;  1SIH A;  4R9K A;  2FGT A;  3EJV A;  2KCD A;  2K0M A;  1K73 4;  2BNG A;  3AMO A;  3N54 B;  1RN7 A;  3PZW A;  2WO0 A;  3BB9 A;  3CCS 3;  3GWR A;  1VQ5 3;  2GU1 A;  5ELJ A;  2Q07 A;  1D6U A;  2B24 B;  4QWT A;  3CCU 3;  4RZM A;  3IPT A;  2F98 A;  2OOV C;  1STF I;  1ROV A;  1ULJ B;  1VQ8 3;  5IG3 A;  3RGR A;  2ZL8 A;  4KFD A;  1N9J A;  2C11 A;  4K1U A;  4L8P A;  3GZR A;  1IVW A;  3DGM A;  3FCS B;  3SED A;  4MMX B;  3EBT A;  5DRV A;  1W7C A;  1N8Q A;  1RRL A;  4X2H A;  4HYZ A;  1AVL A;  4J8T A;  4PEJ A;  5CF2 A;  3S29 A;  1FGR A;  1NO3 A;  1AV4 A;  2BT3 A;  1ROA A;  3H51 A;  1TUH A;  3WMD A;  1IQX A;  2BMO B;  3FLJ A;  3CCV 3;  2HMM B;  4KFE A;  1SPU A;  1A2V A;  3NBB A;  5JPP A;  4O3V A;  1S72 3;  3EQQ B;  3WOE B;  3X3Z A;  2KRT A;  3B4P A;  2ML6 A;  3LOY A;  3NM2 A;  3F7X A;  5IEO A;  2INX A;  2CFK A;  4FMB A;  3X42 A;  3LT9 A;  1ZX2 A;  4HM3 B;  2JDI H;  2YFL B;  3UNL A;  1FA3 A;  3FSD A;  3KFQ C;  3CC2 3;  5KP1 A;  1YJ9 3;  1NJI 4;  2GXF A;  1A67 A;  3MG3 A;  3WDG B;  2CK3 H;  5CF1 A;  3NXJ A;  5EEO A;  2ML5 A;  1U5O A;  5LC6 A;  1D6Z A;  1N8R 4;  3NUV A;  3VSY A;  1O7M B;  2RFR A;  1VQ7 3;  1Q86 4;  1V74 A;  3HX8 A;  4NHF A;  4EV5 A;  4HVN A;  1FUW A;  1W01 A;  1K8A 4;  3K7C A;  4EBG A;  2XSO B;  1JN5 A;  3JUO A;  1OH0 A;  4WFO A;  3K5T A;  3G4S 3;  1QVF 2;  2CFG A;  1S5A A;  1US1 A;  2F86 B;  4MMY B;  3HII A;  2OQE A;  3CPW 2;  3CCR 3;  1FGO A;  1JKG A;  1YHQ 3;  3N9H A;  3HK4 A;  1DMN A;  1VQ4 3;  1OGZ A;  4BTW A;  1CEW I;  2GU3 A;  3LTA A;  3FZW A;  1JB5 A;  3Q2P A;  4XBX A;  3PGB A;  2R4I A;  3DM8 A;  1N9E A;  4G1M B;  1UUW B;  2WGQ A;  4NRE A;  1VQ6 3;  2XRX B;  3M8C A;  5FGO A;  1A90 A;  2BMQ B;  6STD A;  3AMO B;  5BXQ A;  1OHP A;  4R9L A;  3OXA A;  3K9M C;  5AIF A;  3EN8 A;  3NBR A;  3EC9 A;  1NWW A;  3BNE A;  3HZP A;  5A0O B;  1SQW A;  2P38 A;  1ASK A;  7STD A;  5AI1 A;  2B1X B;  3G0K A;  1E3V A;  1STD A;  4WYK A;  3X40 A;  3MKI A;  3V99 A;  4GB5 A;  1GS3 A;  3MHE A;  1GD4 A;  2F99 A;  2P05 A;  3S67 A;  4STD A;  3PXM A;  3D3L A;  2XH9 A;  2MC8 A;  1O7P B;  2O9U X;  1VQ9 3;  4HM4 B;  1ULI B;  1IT8 A;  1WNH A;  2RGQ A;  2XGN A;  3F7S A;  4LMI A;  2XR8 B;  5AYS C;  2E2V A;  2CFW A;  3L0R A;  4N6T A;  1CYU A;  3JVC A;  1C7H A;  5IG5 A;  3BLZ A;  2V1L A;  4EV2 A;  3FG3 A;  4IPB A;  3SVA A;  2WOH A;  4FCJ A;  2LYX A;  4EXR A;  1RRH A;  5IEP A;  1CYV A;  3FF0 A;  1M90 4;  2FXT A;  2P0M A;  4AKY A;  3DGN A;  2QA4 3;  1W2Z A;  4OVM A;  2STD A;  5STD A;  3LT8 A;  4ZM8 A;  1NU3 A;  2W04 A;  1QMA A;  5G2G A;  4Q53 A;  3CCL 3;  3EBY A;  5AYR B;  3CC4 3;  2I9W A;  3TDG A;  2QEX 3;  2BMR B;  2CG0 A;  1A2K A;  4LZI A;  4N6O B;  1SII A;  1OF5 A;  4O2H A;  1K41 A;  5BVB A;  1DVC A;  4RNZ A;  2KXG A;  3E99 A;  1AVK A;  3FF2 A;  4RNY A;  3UJM A;  3CNM A;  3GAX A;  4MJD A;  1QJG A;  1JN5 B;  3OWS A;  3NBJ A;  3CC7 3;  1YJW 3;  5JPU A;  4FMD A;  5D82 A;  1NDO B;  2Y74 A;  4FCM A;  3LYG A;  4HM8 B;  1JKG B;  1TFK A;  2Y73 A;  4KVH A;  2Z77 A;  4TX4 A;  2IUJ A;  3EE1 A;  3HI7 A;  4LEH A;  2MF7 A;  8CHO A;  1NB5 I;  2W03 A;  4XB5 A;  1GY6 A;  2CIU A;  3DGO A;  4X2O A;  1YIT 3;  2CG1 A;  4K90 B;  1OPY A;  1T5Y A;  3Q1C A;  4HM2 B;  1VQP 3;  1FGT A;  2JQ5 A;  1WQL B;  3PS8 A;  1PU4 A;  3I55 3;  3D9R A;  4O02 B;  3I0Y A;  3X41 A;  4ORL A;  3MWZ A;  1RKY A;  1WMP A;  1DYU A;  3NHX A;  1OUN A;  3Q90 A;  1KWI A;  1AR0 A;  1FGM A;  3LTC A;  4HKV B;  2Z6B A;  3GZY B;  5D81 A;  1Q42 A;  2XF3 A;  1UW1 A;  3UL6 A;  5AII A;  3V98 A;  4LGQ A;  4WYK B;  1HKX A;  3F14 A;  2FNQ A;  4N6N B;  3ALA A;  3NQZ A;  4MEI A;  3B7C A;  3A76 A;  1DMQ A;  3LZA A;  3WOF B;  5IEN A;  3T8U A;  1W5Z A;  2CFL A;  1U8C B;  3ECF A;  3KN4 A;  1L5G B;  5EVH A;  2IMJ A;  3NQY A;  3J7Y d;  5KP4 A;  1JRQ A;  3F8H A;  2ZDJ A;  4K1V A;  2CHC A;  2O3O A;  5DRE A;  4HM5 B;  3CPO A;  2E2U A;  2XEP A;  4K61 A;  2Z7A A;  4R4K A;  3CU3 A;  1IDP A;  3MG1 A;  4N6L A;  1Y4K A;  3DY5 A;  1VQN 3;  3F40 A;  3JUP A;  5CLK A;  1KC8 4;  1K28 A;  2BHM A;  5D83 A;  2OQE C;  3KSE D;  3CCM 3;  2CWU A;  1O7W B;  3LH4 A;  5HGR A;  1OHS A;  4N6M A;  3DUK A;  3CCE 3;  3X3X A;  2CFD A;  4XBT A;  3F9S A;  3JUN A;  2RCD A;  1OCV A;  2M7O A;  1IT7 A;  1ISK A;  1IQY A;  4XBY A;  1QVG 2;  1TP6 A;  4KZ1 A;  1OF5 B;  2YFI B;  4N3V A;  3VGN A;  1M1K 4;  2OCT A;  3CD6 3;  1JB4 A;  2A15 A;  3PCS A;  4FCZ A;  3OWU A;  3S5C A;  3RDE A;  2YFJ B;  1WMO A;  2P09 A;  1YI2 3;  3LTD A;  1KD1 4;  1W6C A;  3PCR A;  1DMM A;  1TIJ A;  3OW2 2;  3FG1 A;  3SOA A;  2Z76 A;  1QAK A;  5AEU B;  1Q7Y 4;  2UX0 A;  2WGO A;  5AIG A;  5ELU A;  1VQK 3;  1E97 A;  2E2T A;  2W0Q A;  3KSP A;  3EN1 B;  2BO9 B;  3G71 3;  4R1K A;  2D1W A;  3G6E 3;  2OOV A;  1W6G A;  2HMO B;  1F8N A;  4AEQ A;  1KQS 2;  1IV7 A;  2XFT A;  1JNQ A;  1Q82 4;  4HJL B;  3NX0 A;  4HM7 B;  1IK3 A;  3IJE B;  2D42 A;  3KKG A;  3CMA 3;  2K54 A;  4H61 A;  3UB1 A;  3EX9 A;  1RJO A;  2W6J H;  5CK6 A;  4OUQ A;  1O7N B;  3BNC A;  3EB8 A;  3OWY A;  3CXC 2;  3LTB A;  3CCJ 3;  5IF6 A;  1W4N A;  1YGE A;  3OV4 A;  2HML B;  1QAL A;  3F8X A;  3MPH A;  4FR9 A;  2W56 B;  1OGX A;  1WMN A;  3CME 3;  2L4V A;  4JF8 A;  3MSO A;  2RSX A;  1NB3 I;  1PFP A;  1DVD A;  1E3R A;  2W9Q A;  3K0Z A;  4IT7 A;  1Q40 A;  4N6V 0;  4EC6 A;  3CNX A;  3RGA A;  1J2B A;  2OTJ 3;  4XDV A;  2P0X A;  1JB2 A;  4XDW A;  3U1W A;  1CQS A;  1W00 A;  3NV0 A;  1YJN 3;  2HMJ B;  1EQK A;  2W9P A;  3V92 A;  3WOD G;  3N8B A;  3FG4 A;  2XGL A;  4GL6 A;  2PZV A;  3CCQ 3;  2CWT A;  2LQV A;  1W2B 2;  3MYT A;  4BTX A;  2SBL A;  3JUQ A;  4R80 A;  1IVX A;  1LVN A;  4EYC A;  5I97 A;  3GZB A;  3LML A;  3KE7 A;  4CCV A;  3PYJ A;  2YX9 A;  2C10 A;  3X3Y A;  5IG0 A;  2XSH B;  5TGN A;  1VQO 3;  3B4O A;  4MMZ B;  3B8L A;  1Z1S A;  5IG4 A;  3S27 A;  3K63 A;  4HZB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...