5D81A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y57(cl-y)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
126
Chain Sequence
b'MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta(5)-3-ketosteroid isomerase
publication title Dissecting Proton Delocalization in an Enzyme's Hydrogen Bond Network with Unnatural Amino Acids.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 126
sequence length 127
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2015-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5d81A00
3DMCA 2F98A 4HZ9B 3OWSA 4K1UA 3OWUA 1ISKA 3RGAA 2B1XB 3STDA 1DMQA 3K7CA 3DM8A 3B4OA 1EG9B 5AIGA 2HMKB 1K41A 4FCJA 4HKVB 5STDA 3OV4A 3F7XA 5IF6A 3S5CA 2GXFA 2BMOB 5AIHA 3NUVA 3SOYA 1QMAA 3MKIA 1OF5B 1JKGB 5FW5A 2XR8B 4IIAA 4XBTA 1JB2A 4XDWA 1S5AA 4H3UA 2IMJA 1JN5A 1ZX2A 3GRDA 3F40A 2GEYA 4OUQA 2F99A 2OWPA 2INXA 1IDPA 3EBTA 4HM7B 1OHSA 1E3RA 1Q40A 5D83A 2XSHB 4KVHA 3KE7A 5JPUA 2UX0A 1QJGA 5BXQA 3ECFA 3LZAA 5AI1A 2RGQA 3FF0A 4HM2B 4R9LA 4HVNA 3F9SA 2YFJB 1UUWB 3GZXB 3NBRA 3KSPA 3NV0B 4WYKB 1ZO2A 3NM2A 4XBYA 3G16A 3OWYA 4X2OA 1GY6A 4X2HA 1W01A 1GS3A 2BNGA 3FSDA 3H3HA 6STDA 3ER7A 4LGQA 5JPPA 4WWUC 3FKAA 1E97A 3JUOA 1O7WB 2R4IA 2YFLB 3MG3A 2RCDA 3EX9A 5IEPA 4PEJA 3FGYA 3FH1A 5IG0A 3JUMA 1OCVA 2B24B 2XRXB 2I9WA 1O7NB 4HM8B 2Z77A 1W6YA 2GEXA 3Q90A 5IERA 4LEHA 4HJLB 2QGUA 1OH0A 1W02A 4HM6B 4CDLA 1HKXA 1OUNA 2GBWB 3DUKA 3FF2A 1TUHA 4XM4A 3EQQB 5BVBA 2XSOB 7STDA 3KKGA 1O7MB 2CHCA 4Q53A 4LMIA 1JN5B 4R9KA 5CK6A 2HMMB 3UJMA 3UNLA 1ULIB 5CF1A 1DMNA 4K1VA 3I0YA 2HMJB 5G2GA 3EHCA 3JUQA 1O7GB 3CPOA 3EN8A 4OVMA 4RZMA 3KZTA 3F8HA 5AEUB 3GWRA 1O7PB 3EF8A 3B4PA 3M8CA 2A15A 1GY5A 3VSYA 3MYTA 3HX8A 3MG2A 3MG1A 5KP1A 3SOAA 1Z1SA 4FCMA 3EN1B 3HK4A 2K54A 4HM4B 4WP5A 5IEOA 2GBXB 5KP4A 1OGZA 1TP6A 4R1KA 3NHXA 1AR0A 5CLKA 5AEWB 5CF2A 3BLZA 3H51A 3F14A 3CU3A 1SJWA 1STDA 3A76A 3BB9A 4WYKA 4XDVA 4HM3B 4XB5A 3WMDA 3G8ZA 3OX9A 3MSOA 3MHEA 3F7SA 5DRVA 1DMMA 3LYGA 2Z76A 3FZWA 2W2CA 3EC9A 3VGNA 3DZLA 1ASKA 5IG5A 3GZRA 1WQLB 2QIYA 2Z7AA 5D81A 2HMOB 3CNMA 1C7HA 2BMRB 5IG3A 3IPTA 3T8NA 3SEDA 3JUNA 3EJVA 4L8PA 3E99A 2F86B 3B7CA 3HZPA 1GY7A 1A2KA 2HMNB 4HZBB 5HGRA 1CQSA 1OHPA 3CNXA 1NWWA 1BUQA 3B8LA 8CHOA 4HM0B 1E3VA 1OF5A 1JKGA 2PZVA 3EBYA 5IG4A 3RGRA 2BMQB 1ULJB 5AIFA 1Q42A 2RFRA 1Q40B 4J8TA 1JB4A 1W00A 2HMLB 5IENA 4L7KA 5AIIA 4J9AA 4ORLA 3ROBA 3FLJA 3DXOA 3OXAA 1EA2A 3G0KA 5EVHA 2CKFB 1VZZA 2STDA 1NDOB 1JB5A 3K0ZA 3T8UA 5DREA 3NXJA 4I4KA 2YFIB 5CXOA 3D9RA 3GZBA 4XBXA 4U13A 3NV0A 1OHOA 4GB5A 1UUVB 5D82A 1OPYA 4HM5B 3GZYB 5TGNA 4STDA 2JQ5A 1GYBA 1O7HB 1U5OA 4MJDA 1NU3A 5KP3A 4L8OA 1OGXA 4N3VA 4HM1B 3JUPA 3F8XA
chains in the Genus database with same CATH superfamily
1GD4A 1M1XB 2D42A 1GSPA 3DMCA 3LT9A 1K8A4 3WODG 1Q814 2HOHA 2OCTA 2F98A 4HZ9B 3OWSA 4K1UA 3OWUA 5GSPA 1I0XA 4FMBA 1RSNA 1FGMA 1FGRA 1A2PA 3X40A 1PY3A 3D79A 2BT3A 1RNBA 1ISKA 2ML6A 3BNCA 1BRKA 3FG3A 3LH4A 3RGAA 2W6JH 5IW9A 2B1XB 4RNTA 3STDA 4NHFA 1BRIA 4RBNA 1Q9EA 1W7CA 1BRGA 1DMQA 2CIUA 2FNQA 2JDIH 3DM8A 3B4OA 3K7CA 1EG9B 1MWSA 1W5ZA 2SARA 5AIGA 3V92A 3ZFZA 4O3VA 2HMKB 3URPA 1K41A 4FCJA 3WHOA 1VQ73 4N6NB 3PYJA 4HKVB 2XFTA 5STDA 3OV4A 1PFPA 2W03A 2P0MA 3F7XA 1ZGXA 5IF6A 1FYSA 1BRHA 3S5CA 4EYCA 2GXFA 8RNTA 1B3SA 1C54A 2BMOB 3EB8A 4RNZA 4LSOA 3U1WA 3WA3A 1TJDA 2CC3A 2BO9B 3NUVA 4JRFA 5AIHA 2CG1A 1TU5A 4HBRA 2CFKA 3SOYA 3VF1A 1QMAA 2RBIA 2IY2A 3MKIA 1OF5B 1JKGB 1BNIA 3NX0A 5FW5A 2XR8B 5AYSC 3KSED 3BU4A 4IIAA 1BRSA 1I70A 4XBTA 3KFQC 3X3ZA 1JB2A 2KF4A 1JJ22 1ROVA 2GSPA 1X1YA 1RGFA 4XDWA 3HOHA 1YVBI 1S5AA 4AKYA 4H3UA 1R4YA 1LXEA 1HZ1A 1MWRA 2C4BA 2IMJA 1M904 4KFEA 1JN5A 2IYJA 1ZX2A 3PCRA 3GRDA 3PGBA 3F40A 5JBSA 1FUTA 3CCR3 1QALA 1CH0A 2GEYA 3L0RA 1LNIA 4OUQA 3N8BA 1RLSA 2F99A 3S67A 2OWPA 3HIGA 2INXA 1IDPA 1WMOA 4K90B 3K9MC 1GD3A 3EBTA 2H0IA 2XEPA 4HM7B 1DVDA 1OHSA 1E3RA 3RNTA 2KF5A 1Q40A 1T2IA 5D83A 1YJN3 3TDGA 2XSHB 4KVHA 3PXMA 3CC43 3KE7A 1T2HA 4HYZA 1LRAA 3K5TA 5LC7A 5JPUA 2UX0A 1QJGA 2CFDA 4KFDA 5BXQA 3ECFA 3LZAA 1WMNA 1BU4A 4RNYA 5AI1A 4R80A 2BHMA 1SARA 1IK3A 2BIRA 1BAOA 3CC73 1X1WA 4HAAA 2RGQA 2W04A 1QVG2 3RDEA 3FF0A 3DGOA 3WOFB 4HM2B 3BNDA 4R9LA 1N5HA 2D1WA 4HVNA 3UL6A 1VQ63 2IUKA 3F9SA 4N6MA 2YFJB 1UUWB 3ZG5A 1N8R4 3S28A 3GZXB 2WOHA 3D5GA 3HIIA 3S29A 5AYRB 5ELJA 2PNCA 1Y4KA 1N9EA 3NBRA 3KSPA 1RGHA 1YVSA 3NV0B 4R4KA 1A2VA 1ZO2A 1UCJA 4WYKB 3NM2A 2ZHXB 1LOXA 2CWVA 2L1SA 4XBYA 3N54B 3G16A 3OWYA 2K0MA 1BVIA 4X2OA 1GY6A 3LTAA 1V58A 3Q2PA 1KC84 3SVAA 4X2HA 3CCJ3 3OW22 4IT7A 1RTUA 1W01A 4DKIA 1GS3A 1N5PA 3QRDA 4LYLB 3QK9A 2BNGA 2H0GA 1NB3I 3FSDA 1I3IA 3H3HA 1YHQ3 4I5QA 2R41A 2RNTA 2UGIA 6STDA 3ER7A 4LGQA 1IT8A 5JPPA 4WWUC 3FKAA 1E97A 3JUOA 4HOHA 1FZUA 3ZG0A 1LQGC 1O7WB 3CCQ3 2R4IA 1JRQA 3AGNA 1D6ZA 1QAKA 1MWTA 2GU1A 2YFLB 1RGLA 1EQKA 3AGOA 2CX0A 3DGYA 2W0QA 2E2UA 3MG3A 2RCDA 3CCV3 1IU7A 3EX9A 5IEPA 1BSAA 4PEJA 3FGYA 4KZ1A 3MWZA 1BNSA 2ZA4A 3FH1A 5IG0A 3JUMA 1OCVA 2B24B 1V57A 2XRXB 1RN4A 1LQMB 1VQ43 2I9WA 1DYUA 1O7NB 1VQN3 4HM8B 2Z77A 1IVVA 1IQ8A 4O2HA 1LNHA 1W6YA 2GEXA 3AHSA 2IUJA 3Q90A 5IERA 4LEHA 1R4CA 3G4S3 4J5GA 1RN7A 2QGUA 4HJLB 3LTDA 2OTL3 2IA7A 1OH0A 2H0HA 1W02A 4HM6B 4KT3B 3S27A 4CDLA 1UDII 1HKXA 1OUNA 5FGOA 4BTYA 1B2MA 1D6UA 2P09A 2GBWB 1G0TA 3DUKA 1BSEA 1QAFA 3FF2A 1K734 1BRJA 3GAXA 1TUHA 1NB5I 2FXTA 3KN4A 2F5MA 1RJOA 1SQWA 1WMPA 4XM4A 3J7Yd 1LOVA 3CMA3 5HOHA 2AADA 3EQQB 5BVBA 1GMRA 2BU4A 2XSOB 7STDA 2XGLA 3KKGA 1UW1A 1O7MB 1YIT3 1BNFA 2V1LA 1AVLA 1YNVX 2CW9A 3LTCA 3T0UA 2RSXA 2O3OA 1MGRA 2L4VA 3BIRA 2KCDA 2CHCA 5I97A 3FG1A 2KRTA 4LMIA 4Q53A 1RNTA 3UL5A 4EXRA 1JN5B 3NQZA 4R9KA 3CCM3 4N6UA 5CK6A 1VQM3 4N6TA 2HMMB 4WFOA 3HI7A 2C10A 3UJMA 1X1UA 3UNLA 3CCE3 1ULIB 5CF1A 1FW7A 1DMNA 1IT7A 1IVXA 1I3FA 4K1VA 3I0YA 3O8YA 2HMJB 5G2GA 3EHCA 1JZOA 2F5WA 2KAAA 3JUQA 4N6LA 1BSCA 5EEOA 2CK3H 1VQ53 1AY7A 1NJI4 1W2B2 1TRPA 1IQXA 1O7GB 3CPOA 3EN8A 2WO0A 5M1AA 3V98A 1VQO3 1B21A 1I2GA 4OVMA 3X42A 1IQYA 6GSPA 4RZMA 2E2VA 1NNVA 3KZTA 1JZDA 3F8HA 1STFI 3MPHA 4BL2A 5AEUB 2F4YA 3GWRA 1D6YA 2QA43 1MWUA 1O7PB 1US1A 3EF8A 4IPBA 3WR2A 1YI23 2ZL8A 3FG4A 3ALAA 3IJEB 3B4PA 3SYUA 1SIIA 3M8CA 2A15A 1FGTA 1RCKA 1G96A 1I0VA 3KIIA 2CWUA 1GY5A 3VSYA 1U8CB 3HX8A 2AAEA 3MYTA 3MG2A 3D5IA 3MG1A 5KP1A 3SOAA 1Z1SA 4FCMA 2OOVA 1Q824 1B20A 3EN1B 3HK4A 3KCHA 1T3BA 1CYUA 1BNJA 2K54A 4HM4B 4WP5A 4FMDA 5IEOA 1WTHA 1UI8A 2GBXB 4JF8A 1DETA 2SBLA 5KP4A 4N6OB 1VQP3 1BNEA 1OGZA 3D3LA 4O02B 1TP6A 1S723 1RN1A 2XFSA 3BNEA 4R1KA 3NHXA 2P05A 1AR0A 5CLKA 4LZIA 3CCL3 5AEWB 3N9HA 5CF2A 3PS8A 1AVKA 1VQQA 4K61A 3CCS3 3BLZA 1KWIA 3NBJA 1B2ZA 3H51A 5M18A 3AMOB 3A5EA 3F14A 3CU3A 2OQEA 1TFKA 1AV4A 4MMXB 3I553 1B27A 2K3DA 1SJWA 1RRLA 1STDA 3FCSB 3CXC2 1K9M4 2P0XA 3A76A 1QVF2 1UGIA 2GU3A 3BB9A 1RGEA 1HYFA 4WYKA 1ROAA 1HU9A 3UB1A 4XDVA 4HM3B 1F8NA 1TTOA 2XH9A 4FR9A 4XB5A 3G8ZA 3WMDA 1EEJA 3OX9A 3DGNA 3MSOA 3G6E3 4O8SA 3MHEA 3F7SA 5DRVA 1DMMA 1L5GB 3X3XA 3LYGA 2OTJ3 4BIRA 1W2ZA 2Z76A 4EC6A 3FZWA 2W2CA 3EC9A 3I563 1ZS7A 2XGNA 3DZLA 1ASKA 3VGNA 1W6CA 4N6V0 1KD14 1FUSA 2W56A 3LMLA 1VQK3 2WOFA 2ZDJA 5A0OB 1BOXA 1YGEA 1T5YA 5IG5A 5BIRA 5LC6A 2W9PA 3GZRA 1WQLB 1VQ93 1IVWA 2QIYA 2Z7AA 5D81A 4BTXA 2QEX3 4EW5A 1TFOA 2HMOB 3CNMA 1C7HA 1Q7HA 2BMRB 1UI7A 3IPTA 5IG3A 5ELUA 4FMCA 3T8NA 3SEDA 3JUNA 1RDSA 2KXGA 3EJVA 3CPW2 4CJNA 4L8PA 1FUWA 1BIRA 3E99A 1FA3A 2WGQA 3SX1A 4MMZB 2F86B 2E2TA 3B7CA 1TIJA 3HZPA 1DE3A 1VQL3 3CCU3 1GY7A 1LVNA 2ML5A 1A2KA 2LYXA 4FCZA 2HMNB 5RNTA 4HZBB 5HGRA 1GOVA 4GHOA 3WOEB 4CCVA 1M9GA 2CX1A 1G02A 1N9JA 1CQSA 1SPUA 2UUGC 1IV9A 1I8VA 1BNGA 2YX9A 1JNQA 1RCLA 1OHPA 3CNXA 1Q7Y4 1IYYA 2M7OA 1NWWA 7GSPA 1I2EA 1RGGA 1BUQA 3PCSA 7RNTA 1M1K4 1UCIA 1UCKA 3B8LA 1RRHA 2Y73A 1KSIA 1BSDA 1IVUA 4HM0B 8CHOA 1E3VA 1DVCA 1JKGA 1OF5A 2CWTA 2MC8A 2PZVA 3DY5A 6RNTA 1WNHA 3BNBA 1UUGB 4BU4A 3NM7A 3PZWA 3EBYA 3SLUA 3WA2X 5IG4A 3LTBA 4BTWA 3RGRA 2BMQB 1GOUA 4BL3A 1ULJB 4GSPA 4FMAA 5AIFA 1Q42A 4AEQA 3D4AA 2F56A 2RFRA 1FGOA 1LOWA 2O9UX 1V74A 1MOLA 1Q40B 4KFFA 2OOVC 3AHWA 3X3YA 3NQYA 1JB4A 4J8TA 4EV2A 4AKZA 9RNTA 1W00A 4G1MB 2HMLB 1BSBA 1JV2B 2CH9A 2Y74A 3GSPA 5BU4A 5IENA 2P38A 5G1KA 1NO3A 2CFLA 3Q3FA 4H61A 1TRQA 5M19A 4L7KA 1RKYA 1FGQA 3V99A 5AIIA 4MEIA 1A90A 4J9AA 4ORLA 3CC23 1PYLA 3CME3 2Z6BA 3ROBA 1JBRA 4EV5A 3FLJA 3DXOA 1RGKA 2OQEC 3K63A 1GMPA 1EKMA 3OXAA 3Q1CA 4J5KA 4CPKA 1EA2A 2XF3A 4MMYB 2KF6A 3G0KA 5EVHA 1B2XA 3LOYA 1BRNL 2C11A 1LOYA 4OK0A 2CFGA 5EQLA 2CKFB 1VZZA 3LXUX 3WDGB 3CD63 1RMSA 2WGOA 3G713 1UGHI 1BUJA 2STDA 1IV7A 1NDOB 1JB5A 1N8QA 1BGSA 3K0ZA 3T8UA 1YGWA 1A67A 4TX4A 3X41A 4ILFA 1X1XA 3DGMA 1KQS2 3DH2A 3JVCA 5DREA 3NXJA 1BNRA 2CFWA 2FGTA 1UCLA 1W4NA 4I4KA 1W6GA 2KF3A 2YFIB 5CXOA 3D9RA 2Q07A 1RGAA 1CYVA 3DGLA 2LQVA 1MNLA 3GZBA 1CEWI 3NBBA 1OACA 4NPBA 1YJW3 1RGCA 1VQ83 1Q864 2W9QA 4EBGA 3NV0A 1OHOA 4U13A 4GB5A 4XBXA 1JBSA 1K28A 1UUVB 2J8XB 1OPYA 4WHAA 5D82A 1B2UA 2MF7A 3GZYB 1AQZA 4HM5B 4STDA 2JQ5A 1GYBA 4GL6A 5TGNA 3U97A 1GOYA 1O7HB 1MGWA 1U5OA 4MJDA 2CG0A 5G1LA 1NU3A 1SIHA 5KP3A 3IMAB 3SXXA 4ZM8A 1B2SA 3LT8A 1RHLA 3AMOA 1GMQA 1EUIC 1PU4A 1YIJ3 1JBTA 4L8OA 1OGXA 1I2FA 1BANA 4NREA 2W56B 1J2BA 4N3VA 4HM1B 3EE1A 3JUPA 3F8XA 4QWTA 1YJ93
chains in the Genus database with same CATH topology
1GD4A 1M1XB 2D42A 3DMCA 3LT9A 1K8A4 3WODG 1Q814 2OCTA 2F98A 4HZ9B 3OWSA 4K1UA 3OWUA 4FMBA 1FGMA 1FGRA 3X40A 2BT3A 1ISKA 2ML6A 3BNCA 3FG3A 3LH4A 3RGAA 5IW9A 2W6JH 2B1XB 3STDA 4NHFA 4RBNA 1W7CA 1DMQA 2FNQA 2CIUA 3K7CA 2JDIH 3DM8A 3B4OA 3X3YA 1EG9B 1W5ZA 3V92A 5AIGA 4O3VA 2HMKB 1K41A 4FCJA 1VQ73 4N6NB 3PYJA 4HKVB 2XFTA 5STDA 3OV4A 1PFPA 2W03A 2P0MA 3F7XA 5IF6A 3S5CA 4EYCA 2GXFA 2BMOB 3EB8A 4RNZA 4LSOA 3U1WA 3WA3A 2CC3A 2BO9B 3NUVA 4JRFA 5AIHA 2CG1A 1TU5A 4HBRA 2CFKA 3SOYA 3VF1A 1QMAA 3MKIA 1OF5B 1JKGB 3NX0A 5FW5A 2XR8B 5AYSC 3KSED 4IIAA 4XBTA 3KFQC 3X3ZA 1JB2A 1JJ22 1ROVA 4XDWA 1YVBI 1S5AA 4AKYA 4H3UA 1LXEA 2IMJA 1M904 4KFEA 1JN5A 1ZX2A 3PCRA 3GRDA 3PGBA 3F40A 5JBSA 3CCR3 1QALA 2GEYA 3L0RA 4OUQA 3N8BA 2F99A 3S67A 2OWPA 3HIGA 2INXA 1IDPA 1WMOA 4K90B 3K9MC 1GD3A 3EBTA 2XEPA 4HM7B 1DVDA 1OHSA 1E3RA 1Q40A 5D83A 1YJN3 3TDGA 2XSHB 4KVHA 3PXMA 3CC43 3KE7A 4HYZA 3K5TA 5LC7A 5JPUA 2UX0A 1QJGA 2CFDA 4KFDA 5BXQA 3ECFA 3LZAA 1WMNA 4RNYA 5AI1A 4R80A 2BHMA 1IK3A 3CC73 2RGQA 2W04A 1QVG2 3RDEA 3FF0A 3DGOA 4HM2B 3BNDA 4R9LA 1N5HA 2D1WA 4HVNA 3UL6A 1VQ63 2IUKA 3F9SA 4N6MA 2YFJB 1UUWB 1N8R4 3S28A 3GZXB 2WOHA 3HIIA 3S29A 5AYRB 5ELJA 2PNCA 1Y4KA 1N9EA 3NBRA 3KSPA 3NV0B 4R4KA 1A2VA 1ZO2A 4WYKB 3NM2A 1LOXA 2CWVA 4XBYA 3N54B 3G16A 3OWYA 2K0MA 4X2OA 1GY6A 3LTAA 3Q2PA 1KC84 3SVAA 4X2HA 3CCJ3 3OW22 4IT7A 1W01A 1GS3A 1N5PA 3QRDA 3QK9A 2BNGA 1NB3I 3FSDA 3H3HA 1YHQ3 6STDA 3ER7A 4LGQA 1IT8A 5JPPA 4WWUC 3FKAA 1E97A 3JUOA 3CCQ3 1O7WB 2R4IA 1JRQA 1D6ZA 1QAKA 2GU1A 2YFLB 1EQKA 2W0QA 2E2UA 3MG3A 2RCDA 3CCV3 1IU7A 3EX9A 5IEPA 4PEJA 3FGYA 4KZ1A 3MWZA 3FH1A 5IG0A 3JUMA 1OCVA 2B24B 2XRXB 1VQ43 2I9WA 1DYUA 1O7NB 1VQN3 4HM8B 2Z77A 1IVVA 1IQ8A 4O2HA 1LNHA 1W6YA 2GEXA 2IUJA 3G4S3 3Q90A 5IERA 4LEHA 1R4CA 1RN7A 2QGUA 4HJLB 3LTDA 2OTL3 2IA7A 1OH0A 1W02A 4HM6B 4CDLA 3S27A 1HKXA 1OUNA 5FGOA 4BTYA 1D6UA 2P09A 2GBWB 3DUKA 3FF2A 1QAFA 1K734 3GAXA 1TUHA 1NB5I 2FXTA 3KN4A 3J7Yd 1RJOA 1SQWA 1WMPA 4XM4A 3CMA3 3EQQB 5BVBA 2XSOB 7STDA 2XGLA 3KKGA 1UW1A 1O7MB 1YIT3 2V1LA 1AVLA 2CW9A 3LTCA 3T0UA 2RSXA 2O3OA 2L4VA 2KCDA 2CHCA 5I97A 3FG1A 2KRTA 4LMIA 4Q53A 3UL5A 4EXRA 1JN5B 3NQZA 4R9KA 3CCM3 4N6UA 5CK6A 1VQM3 4N6TA 2HMMB 4WFOA 3HI7A 2C10A 3UJMA 3CCE3 3UNLA 1ULIB 5CF1A 1DMNA 1IVXA 1IT7A 4K1VA 3I0YA 3O8YA 2HMJB 5G2GA 3EHCA 3JUQA 4N6LA 5EEOA 1VQ53 2CK3H 1NJI4 1W2B2 1IQXA 1O7GB 3CPOA 3EN8A 2WO0A 3V98A 1VQO3 4OVMA 3X42A 1IQYA 4RZMA 2E2VA 3KZTA 3F8HA 1STFI 3MPHA 5AEUB 3GWRA 1D6YA 2QA43 1O7PB 1US1A 3EF8A 4IPBA 1YI23 2ZL8A 3FG4A 3ALAA 3IJEB 3B4PA 1SIIA 3M8CA 2A15A 1FGTA 1G96A 3KIIA 2CWUA 1GY5A 3VSYA 1U8CB 3HX8A 3MYTA 3MG2A 3MG1A 5KP1A 3SOAA 1Z1SA 4FCMA 2OOVA 1Q824 3EN1B 3HK4A 1CYUA 2K54A 4HM4B 4WP5A 4FMDA 5IEOA 1WTHA 1UI8A 2GBXB 4JF8A 2SBLA 5KP4A 4N6OB 1VQP3 1OGZA 3D3LA 4O02B 1TP6A 1S723 2XFSA 3BNEA 4R1KA 3NHXA 2P05A 1AR0A 5CLKA 4LZIA 3CCL3 5AEWB 3N9HA 5CF2A 3PS8A 1AVKA 4K61A 3CCS3 3BLZA 1KWIA 3NBJA 3H51A 3AMOB 3F14A 3CU3A 2OQEA 1TFKA 1AV4A 4MMXB 3I553 1SJWA 1RRLA 1STDA 3FCSB 3CXC2 1K9M4 3A76A 2P0XA 1QVF2 2GU3A 3BB9A 4WYKA 1ROAA 1HU9A 3UB1A 4XDVA 4HM3B 1F8NA 2XH9A 4FR9A 4XB5A 3WMDA 3G8ZA 3OX9A 3DGNA 3MSOA 3G6E3 4O8SA 3MHEA 3F7SA 5DRVA 1DMMA 1L5GB 3X3XA 3LYGA 2OTJ3 1W2ZA 2Z76A 4EC6A 3FZWA 2W2CA 3EC9A 3I563 3VGNA 2XGNA 3DZLA 1ASKA 1KD14 1W6CA 4N6V0 3LMLA 2W56A 1VQK3 2WOFA 2ZDJA 5A0OB 1YGEA 1T5YA 5IG5A 5LC6A 2W9PA 3GZRA 1WQLB 1VQ93 1IVWA 2QIYA 2Z7AA 5D81A 4BTXA 2QEX3 1TFOA 2HMOB 3CNMA 1C7HA 2BMRB 5IG3A 1UI7A 3IPTA 5ELUA 4FMCA 3T8NA 3SEDA 3JUNA 2KXGA 3EJVA 3CPW2 4L8PA 1FUWA 3E99A 1FA3A 2WGQA 3SX1A 4MMZB 2F86B 2E2TA 3B7CA 1TIJA 3HZPA 1VQL3 3CCU3 1GY7A 1LVNA 2ML5A 1A2KA 2LYXA 4FCZA 2HMNB 4HZBB 5HGRA 3WOEB 4CCVA 1M9GA 1N9JA 1CQSA 1SPUA 1IV9A 2YX9A 1JNQA 1OHPA 3CNXA 1Q7Y4 2M7OA 1NWWA 1BUQA 3PCSA 1M1K4 3B8LA 1RRHA 2Y73A 1KSIA 1IVUA 8CHOA 4HM0B 1E3VA 1DVCA 1JKGA 1OF5A 2CWTA 2MC8A 2PZVA 3DY5A 1WNHA 3BNBA 3NM7A 3PZWA 3EBYA 3SLUA 3WA2X 5IG4A 3LTBA 4BTWA 3RGRA 2BMQB 1ULJB 4FMAA 5AIFA 1Q42A 4AEQA 2RFRA 1FGOA 2O9UX 1V74A 1MOLA 1Q40B 4KFFA 2OOVC 3NQYA 1JB4A 4J8TA 4EV2A 4AKZA 1W00A 4G1MB 2HMLB 1JV2B 2CH9A 2Y74A 5IENA 2P38A 1NO3A 2CFLA 4H61A 4L7KA 1RKYA 1FGQA 3V99A 5AIIA 4MEIA 1A90A 4J9AA 4ORLA 3CC23 3CME3 2Z6BA 3ROBA 4EV5A 3FLJA 3DXOA 2OQEC 3K63A 1EKMA 3OXAA 3Q1CA 1EA2A 2XF3A 4MMYB 3G0KA 5EVHA 3LOYA 2C11A 4OK0A 2CFGA 5EQLA 2CKFB 1VZZA 3LXUX 3WDGB 3CD63 2WGOA 3G713 2STDA 1IV7A 1NDOB 1JB5A 1N8QA 3K0ZA 3T8UA 1A67A 4TX4A 3X41A 3DGMA 1KQS2 5DREA 3JVCA 3NXJA 2CFWA 2FGTA 1W4NA 4I4KA 1W6GA 2YFIB 5CXOA 3D9RA 2Q07A 1CYVA 3DGLA 2LQVA 1MNLA 3GZBA 1CEWI 3NBBA 1OACA 1YJW3 1VQ83 1Q864 2W9QA 4EBGA 3NV0A 1OHOA 4U13A 4GB5A 4XBXA 1K28A 1UUVB 5D82A 1OPYA 4WHAA 3WOFB 2MF7A 4HM5B 3GZYB 5TGNA 4STDA 2JQ5A 1GYBA 4GL6A 3U97A 1O7HB 1U5OA 4MJDA 2CG0A 1NU3A 1SIHA 5KP3A 3IMAB 3SXXA 4ZM8A 3LT8A 3AMOA 1PU4A 1YIJ3 4L8OA 1OGXA 4NREA 2W56B 1J2BA 4N3VA 4HM1B 3EE1A 3JUPA 3F8XA 4QWTA 1YJ93
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMC A;  2F98 A;  4HZ9 B;  3OWS A;  4K1U A;  3OWU A;  1ISK A;  3RGA A;  2B1X B;  3STD A;  1DMQ A;  3K7C A;  3DM8 A;  3B4O A;  1EG9 B;  5AIG A;  2HMK B;  1K41 A;  4FCJ A;  4HKV B;  5STD A;  3OV4 A;  3F7X A;  5IF6 A;  3S5C A;  2GXF A;  2BMO B;  5AIH A;  3NUV A;  3SOY A;  1QMA A;  3MKI A;  1OF5 B;  1JKG B;  5FW5 A;  2XR8 B;  4IIA A;  4XBT A;  1JB2 A;  4XDW A;  1S5A A;  4H3U A;  2IMJ A;  1JN5 A;  1ZX2 A;  3GRD A;  3F40 A;  2GEY A;  4OUQ A;  2F99 A;  2OWP A;  2INX A;  1IDP A;  3EBT A;  4HM7 B;  1OHS A;  1E3R A;  1Q40 A;  5D83 A;  2XSH B;  4KVH A;  3KE7 A;  5JPU A;  2UX0 A;  1QJG A;  5BXQ A;  3ECF A;  3LZA A;  5AI1 A;  2RGQ A;  3FF0 A;  4HM2 B;  4R9L A;  4HVN A;  3F9S A;  2YFJ B;  1UUW B;  3GZX B;  3NBR A;  3KSP A;  3NV0 B;  4WYK B;  1ZO2 A;  3NM2 A;  4XBY A;  3G16 A;  3OWY A;  4X2O A;  1GY6 A;  4X2H A;  1W01 A;  1GS3 A;  2BNG A;  3FSD A;  3H3H A;  6STD A;  3ER7 A;  4LGQ A;  5JPP A;  4WWU C;  3FKA A;  1E97 A;  3JUO A;  1O7W B;  2R4I A;  2YFL B;  3MG3 A;  2RCD A;  3EX9 A;  5IEP A;  4PEJ A;  3FGY A;  3FH1 A;  5IG0 A;  3JUM A;  1OCV A;  2B24 B;  2XRX B;  2I9W A;  1O7N B;  4HM8 B;  2Z77 A;  1W6Y A;  2GEX A;  3Q90 A;  5IER A;  4LEH A;  4HJL B;  2QGU A;  1OH0 A;  1W02 A;  4HM6 B;  4CDL A;  1HKX A;  1OUN A;  2GBW B;  3DUK A;  3FF2 A;  1TUH A;  4XM4 A;  3EQQ B;  5BVB A;  2XSO B;  7STD A;  3KKG A;  1O7M B;  2CHC A;  4Q53 A;  4LMI A;  1JN5 B;  4R9K A;  5CK6 A;  2HMM B;  3UJM A;  3UNL A;  1ULI B;  5CF1 A;  1DMN A;  4K1V A;  3I0Y A;  2HMJ B;  5G2G A;  3EHC A;  3JUQ A;  1O7G B;  3CPO A;  3EN8 A;  4OVM A;  4RZM A;  3KZT A;  3F8H A;  5AEU B;  3GWR A;  1O7P B;  3EF8 A;  3B4P A;  3M8C A;  2A15 A;  1GY5 A;  3VSY A;  3MYT A;  3HX8 A;  3MG2 A;  3MG1 A;  5KP1 A;  3SOA A;  1Z1S A;  4FCM A;  3EN1 B;  3HK4 A;  2K54 A;  4HM4 B;  4WP5 A;  5IEO A;  2GBX B;  5KP4 A;  1OGZ A;  1TP6 A;  4R1K A;  3NHX A;  1AR0 A;  5CLK A;  5AEW B;  5CF2 A;  3BLZ A;  3H51 A;  3F14 A;  3CU3 A;  1SJW A;  1STD A;  3A76 A;  3BB9 A;  4WYK A;  4XDV A;  4HM3 B;  4XB5 A;  3WMD A;  3G8Z A;  3OX9 A;  3MSO A;  3MHE A;  3F7S A;  5DRV A;  1DMM A;  3LYG A;  2Z76 A;  3FZW A;  2W2C A;  3EC9 A;  3VGN A;  3DZL A;  1ASK A;  5IG5 A;  3GZR A;  1WQL B;  2QIY A;  2Z7A A;  5D81 A;  2HMO B;  3CNM A;  1C7H A;  2BMR B;  5IG3 A;  3IPT A;  3T8N A;  3SED A;  3JUN A;  3EJV A;  4L8P A;  3E99 A;  2F86 B;  3B7C A;  3HZP A;  1GY7 A;  1A2K A;  2HMN B;  4HZB B;  5HGR A;  1CQS A;  1OHP A;  3CNX A;  1NWW A;  1BUQ A;  3B8L A;  8CHO A;  4HM0 B;  1E3V A;  1OF5 A;  1JKG A;  2PZV A;  3EBY A;  5IG4 A;  3RGR A;  2BMQ B;  1ULJ B;  5AIF A;  1Q42 A;  2RFR A;  1Q40 B;  4J8T A;  1JB4 A;  1W00 A;  2HML B;  5IEN A;  4L7K A;  5AII A;  4J9A A;  4ORL A;  3ROB A;  3FLJ A;  3DXO A;  3OXA A;  1EA2 A;  3G0K A;  5EVH A;  2CKF B;  1VZZ A;  2STD A;  1NDO B;  1JB5 A;  3K0Z A;  3T8U A;  5DRE A;  3NXJ A;  4I4K A;  2YFI B;  5CXO A;  3D9R A;  3GZB A;  4XBX A;  4U13 A;  3NV0 A;  1OHO A;  4GB5 A;  1UUV B;  5D82 A;  1OPY A;  4HM5 B;  3GZY B;  5TGN A;  4STD A;  2JQ5 A;  1GYB A;  1O7H B;  1U5O A;  4MJD A;  1NU3 A;  5KP3 A;  4L8O A;  1OGX A;  4N3V A;  4HM1 B;  3JUP A;  3F8X A; 
#chains in the Genus database with same CATH topology
 1GD4 A;  1M1X B;  2D42 A;  1GSP A;  3DMC A;  3LT9 A;  1K8A 4;  3WOD G;  1Q81 4;  2HOH A;  2OCT A;  2F98 A;  4HZ9 B;  3OWS A;  4K1U A;  3OWU A;  5GSP A;  1I0X A;  4FMB A;  1RSN A;  1FGM A;  1FGR A;  1A2P A;  3X40 A;  1PY3 A;  3D79 A;  2BT3 A;  1RNB A;  1ISK A;  2ML6 A;  3BNC A;  1BRK A;  3FG3 A;  3LH4 A;  3RGA A;  2W6J H;  5IW9 A;  2B1X B;  4RNT A;  3STD A;  4NHF A;  1BRI A;  4RBN A;  1Q9E A;  1W7C A;  1BRG A;  1DMQ A;  2CIU A;  2FNQ A;  2JDI H;  3DM8 A;  3B4O A;  3K7C A;  1EG9 B;  1MWS A;  1W5Z A;  2SAR A;  5AIG A;  3V92 A;  3ZFZ A;  4O3V A;  2HMK B;  3URP A;  1K41 A;  4FCJ A;  3WHO A;  1VQ7 3;  4N6N B;  3PYJ A;  4HKV B;  2XFT A;  5STD A;  3OV4 A;  1PFP A;  2W03 A;  2P0M A;  3F7X A;  1ZGX A;  5IF6 A;  1FYS A;  1BRH A;  3S5C A;  4EYC A;  2GXF A;  8RNT A;  1B3S A;  1C54 A;  2BMO B;  3EB8 A;  4RNZ A;  4LSO A;  3U1W A;  3WA3 A;  1TJD A;  2CC3 A;  2BO9 B;  3NUV A;  4JRF A;  5AIH A;  2CG1 A;  1TU5 A;  4HBR A;  2CFK A;  3SOY A;  3VF1 A;  1QMA A;  2RBI A;  2IY2 A;  3MKI A;  1OF5 B;  1JKG B;  1BNI A;  3NX0 A;  5FW5 A;  2XR8 B;  5AYS C;  3KSE D;  3BU4 A;  4IIA A;  1BRS A;  1I70 A;  4XBT A;  3KFQ C;  3X3Z A;  1JB2 A;  2KF4 A;  1JJ2 2;  1ROV A;  2GSP A;  1X1Y A;  1RGF A;  4XDW A;  3HOH A;  1YVB I;  1S5A A;  4AKY A;  4H3U A;  1R4Y A;  1LXE A;  1HZ1 A;  1MWR A;  2C4B A;  2IMJ A;  1M90 4;  4KFE A;  1JN5 A;  2IYJ A;  1ZX2 A;  3PCR A;  3GRD A;  3PGB A;  3F40 A;  5JBS A;  1FUT A;  3CCR 3;  1QAL A;  1CH0 A;  2GEY A;  3L0R A;  1LNI A;  4OUQ A;  3N8B A;  1RLS A;  2F99 A;  3S67 A;  2OWP A;  3HIG A;  2INX A;  1IDP A;  1WMO A;  4K90 B;  3K9M C;  1GD3 A;  3EBT A;  2H0I A;  2XEP A;  4HM7 B;  1DVD A;  1OHS A;  1E3R A;  3RNT A;  2KF5 A;  1Q40 A;  1T2I A;  5D83 A;  1YJN 3;  3TDG A;  2XSH B;  4KVH A;  3PXM A;  3CC4 3;  3KE7 A;  1T2H A;  4HYZ A;  1LRA A;  3K5T A;  5LC7 A;  5JPU A;  2UX0 A;  1QJG A;  2CFD A;  4KFD A;  5BXQ A;  3ECF A;  3LZA A;  1WMN A;  1BU4 A;  4RNY A;  5AI1 A;  4R80 A;  2BHM A;  1SAR A;  1IK3 A;  2BIR A;  1BAO A;  3CC7 3;  1X1W A;  4HAA A;  2RGQ A;  2W04 A;  1QVG 2;  3RDE A;  3FF0 A;  3DGO A;  3WOF B;  4HM2 B;  3BND A;  4R9L A;  1N5H A;  2D1W A;  4HVN A;  3UL6 A;  1VQ6 3;  2IUK A;  3F9S A;  4N6M A;  2YFJ B;  1UUW B;  3ZG5 A;  1N8R 4;  3S28 A;  3GZX B;  2WOH A;  3D5G A;  3HII A;  3S29 A;  5AYR B;  5ELJ A;  2PNC A;  1Y4K A;  1N9E A;  3NBR A;  3KSP A;  1RGH A;  1YVS A;  3NV0 B;  4R4K A;  1A2V A;  1ZO2 A;  1UCJ A;  4WYK B;  3NM2 A;  2ZHX B;  1LOX A;  2CWV A;  2L1S A;  4XBY A;  3N54 B;  3G16 A;  3OWY A;  2K0M A;  1BVI A;  4X2O A;  1GY6 A;  3LTA A;  1V58 A;  3Q2P A;  1KC8 4;  3SVA A;  4X2H A;  3CCJ 3;  3OW2 2;  4IT7 A;  1RTU A;  1W01 A;  4DKI A;  1GS3 A;  1N5P A;  3QRD A;  4LYL B;  3QK9 A;  2BNG A;  2H0G A;  1NB3 I;  3FSD A;  1I3I A;  3H3H A;  1YHQ 3;  4I5Q A;  2R41 A;  2RNT A;  2UGI A;  6STD A;  3ER7 A;  4LGQ A;  1IT8 A;  5JPP A;  4WWU C;  3FKA A;  1E97 A;  3JUO A;  4HOH A;  1FZU A;  3ZG0 A;  1LQG C;  1O7W B;  3CCQ 3;  2R4I A;  1JRQ A;  3AGN A;  1D6Z A;  1QAK A;  1MWT A;  2GU1 A;  2YFL B;  1RGL A;  1EQK A;  3AGO A;  2CX0 A;  3DGY A;  2W0Q A;  2E2U A;  3MG3 A;  2RCD A;  3CCV 3;  1IU7 A;  3EX9 A;  5IEP A;  1BSA A;  4PEJ A;  3FGY A;  4KZ1 A;  3MWZ A;  1BNS A;  2ZA4 A;  3FH1 A;  5IG0 A;  3JUM A;  1OCV A;  2B24 B;  1V57 A;  2XRX B;  1RN4 A;  1LQM B;  1VQ4 3;  2I9W A;  1DYU A;  1O7N B;  1VQN 3;  4HM8 B;  2Z77 A;  1IVV A;  1IQ8 A;  4O2H A;  1LNH A;  1W6Y A;  2GEX A;  3AHS A;  2IUJ A;  3Q90 A;  5IER A;  4LEH A;  1R4C A;  3G4S 3;  4J5G A;  1RN7 A;  2QGU A;  4HJL B;  3LTD A;  2OTL 3;  2IA7 A;  1OH0 A;  2H0H A;  1W02 A;  4HM6 B;  4KT3 B;  3S27 A;  4CDL A;  1UDI I;  1HKX A;  1OUN A;  5FGO A;  4BTY A;  1B2M A;  1D6U A;  2P09 A;  2GBW B;  1G0T A;  3DUK A;  1BSE A;  1QAF A;  3FF2 A;  1K73 4;  1BRJ A;  3GAX A;  1TUH A;  1NB5 I;  2FXT A;  3KN4 A;  2F5M A;  1RJO A;  1SQW A;  1WMP A;  4XM4 A;  3J7Y d;  1LOV A;  3CMA 3;  5HOH A;  2AAD A;  3EQQ B;  5BVB A;  1GMR A;  2BU4 A;  2XSO B;  7STD A;  2XGL A;  3KKG A;  1UW1 A;  1O7M B;  1YIT 3;  1BNF A;  2V1L A;  1AVL A;  1YNV X;  2CW9 A;  3LTC A;  3T0U A;  2RSX A;  2O3O A;  1MGR A;  2L4V A;  3BIR A;  2KCD A;  2CHC A;  5I97 A;  3FG1 A;  2KRT A;  4LMI A;  4Q53 A;  1RNT A;  3UL5 A;  4EXR A;  1JN5 B;  3NQZ A;  4R9K A;  3CCM 3;  4N6U A;  5CK6 A;  1VQM 3;  4N6T A;  2HMM B;  4WFO A;  3HI7 A;  2C10 A;  3UJM A;  1X1U A;  3UNL A;  3CCE 3;  1ULI B;  5CF1 A;  1FW7 A;  1DMN A;  1IT7 A;  1IVX A;  1I3F A;  4K1V A;  3I0Y A;  3O8Y A;  2HMJ B;  5G2G A;  3EHC A;  1JZO A;  2F5W A;  2KAA A;  3JUQ A;  4N6L A;  1BSC A;  5EEO A;  2CK3 H;  1VQ5 3;  1AY7 A;  1NJI 4;  1W2B 2;  1TRP A;  1IQX A;  1O7G B;  3CPO A;  3EN8 A;  2WO0 A;  5M1A A;  3V98 A;  1VQO 3;  1B21 A;  1I2G A;  4OVM A;  3X42 A;  1IQY A;  6GSP A;  4RZM A;  2E2V A;  1NNV A;  3KZT A;  1JZD A;  3F8H A;  1STF I;  3MPH A;  4BL2 A;  5AEU B;  2F4Y A;  3GWR A;  1D6Y A;  2QA4 3;  1MWU A;  1O7P B;  1US1 A;  3EF8 A;  4IPB A;  3WR2 A;  1YI2 3;  2ZL8 A;  3FG4 A;  3ALA A;  3IJE B;  3B4P A;  3SYU A;  1SII A;  3M8C A;  2A15 A;  1FGT A;  1RCK A;  1G96 A;  1I0V A;  3KII A;  2CWU A;  1GY5 A;  3VSY A;  1U8C B;  3HX8 A;  2AAE A;  3MYT A;  3MG2 A;  3D5I A;  3MG1 A;  5KP1 A;  3SOA A;  1Z1S A;  4FCM A;  2OOV A;  1Q82 4;  1B20 A;  3EN1 B;  3HK4 A;  3KCH A;  1T3B A;  1CYU A;  1BNJ A;  2K54 A;  4HM4 B;  4WP5 A;  4FMD A;  5IEO A;  1WTH A;  1UI8 A;  2GBX B;  4JF8 A;  1DET A;  2SBL A;  5KP4 A;  4N6O B;  1VQP 3;  1BNE A;  1OGZ A;  3D3L A;  4O02 B;  1TP6 A;  1S72 3;  1RN1 A;  2XFS A;  3BNE A;  4R1K A;  3NHX A;  2P05 A;  1AR0 A;  5CLK A;  4LZI A;  3CCL 3;  5AEW B;  3N9H A;  5CF2 A;  3PS8 A;  1AVK A;  1VQQ A;  4K61 A;  3CCS 3;  3BLZ A;  1KWI A;  3NBJ A;  1B2Z A;  3H51 A;  5M18 A;  3AMO B;  3A5E A;  3F14 A;  3CU3 A;  2OQE A;  1TFK A;  1AV4 A;  4MMX B;  3I55 3;  1B27 A;  2K3D A;  1SJW A;  1RRL A;  1STD A;  3FCS B;  3CXC 2;  1K9M 4;  2P0X A;  3A76 A;  1QVF 2;  1UGI A;  2GU3 A;  3BB9 A;  1RGE A;  1HYF A;  4WYK A;  1ROA A;  1HU9 A;  3UB1 A;  4XDV A;  4HM3 B;  1F8N A;  1TTO A;  2XH9 A;  4FR9 A;  4XB5 A;  3G8Z A;  3WMD A;  1EEJ A;  3OX9 A;  3DGN A;  3MSO A;  3G6E 3;  4O8S A;  3MHE A;  3F7S A;  5DRV A;  1DMM A;  1L5G B;  3X3X A;  3LYG A;  2OTJ 3;  4BIR A;  1W2Z A;  2Z76 A;  4EC6 A;  3FZW A;  2W2C A;  3EC9 A;  3I56 3;  1ZS7 A;  2XGN A;  3DZL A;  1ASK A;  3VGN A;  1W6C A;  4N6V 0;  1KD1 4;  1FUS A;  2W56 A;  3LML A;  1VQK 3;  2WOF A;  2ZDJ A;  5A0O B;  1BOX A;  1YGE A;  1T5Y A;  5IG5 A;  5BIR A;  5LC6 A;  2W9P A;  3GZR A;  1WQL B;  1VQ9 3;  1IVW A;  2QIY A;  2Z7A A;  5D81 A;  4BTX A;  2QEX 3;  4EW5 A;  1TFO A;  2HMO B;  3CNM A;  1C7H A;  1Q7H A;  2BMR B;  1UI7 A;  3IPT A;  5IG3 A;  5ELU A;  4FMC A;  3T8N A;  3SED A;  3JUN A;  1RDS A;  2KXG A;  3EJV A;  3CPW 2;  4CJN A;  4L8P A;  1FUW A;  1BIR A;  3E99 A;  1FA3 A;  2WGQ A;  3SX1 A;  4MMZ B;  2F86 B;  2E2T A;  3B7C A;  1TIJ A;  3HZP A;  1DE3 A;  1VQL 3;  3CCU 3;  1GY7 A;  1LVN A;  2ML5 A;  1A2K A;  2LYX A;  4FCZ A;  2HMN B;  5RNT A;  4HZB B;  5HGR A;  1GOV A;  4GHO A;  3WOE B;  4CCV A;  1M9G A;  2CX1 A;  1G02 A;  1N9J A;  1CQS A;  1SPU A;  2UUG C;  1IV9 A;  1I8V A;  1BNG A;  2YX9 A;  1JNQ A;  1RCL A;  1OHP A;  3CNX A;  1Q7Y 4;  1IYY A;  2M7O A;  1NWW A;  7GSP A;  1I2E A;  1RGG A;  1BUQ A;  3PCS A;  7RNT A;  1M1K 4;  1UCI A;  1UCK A;  3B8L A;  1RRH A;  2Y73 A;  1KSI A;  1BSD A;  1IVU A;  4HM0 B;  8CHO A;  1E3V A;  1DVC A;  1JKG A;  1OF5 A;  2CWT A;  2MC8 A;  2PZV A;  3DY5 A;  6RNT A;  1WNH A;  3BNB A;  1UUG B;  4BU4 A;  3NM7 A;  3PZW A;  3EBY A;  3SLU A;  3WA2 X;  5IG4 A;  3LTB A;  4BTW A;  3RGR A;  2BMQ B;  1GOU A;  4BL3 A;  1ULJ B;  4GSP A;  4FMA A;  5AIF A;  1Q42 A;  4AEQ A;  3D4A A;  2F56 A;  2RFR A;  1FGO A;  1LOW A;  2O9U X;  1V74 A;  1MOL A;  1Q40 B;  4KFF A;  2OOV C;  3AHW A;  3X3Y A;  3NQY A;  1JB4 A;  4J8T A;  4EV2 A;  4AKZ A;  9RNT A;  1W00 A;  4G1M B;  2HML B;  1BSB A;  1JV2 B;  2CH9 A;  2Y74 A;  3GSP A;  5BU4 A;  5IEN A;  2P38 A;  5G1K A;  1NO3 A;  2CFL A;  3Q3F A;  4H61 A;  1TRQ A;  5M19 A;  4L7K A;  1RKY A;  1FGQ A;  3V99 A;  5AII A;  4MEI A;  1A90 A;  4J9A A;  4ORL A;  3CC2 3;  1PYL A;  3CME 3;  2Z6B A;  3ROB A;  1JBR A;  4EV5 A;  3FLJ A;  3DXO A;  1RGK A;  2OQE C;  3K63 A;  1GMP A;  1EKM A;  3OXA A;  3Q1C A;  4J5K A;  4CPK A;  1EA2 A;  2XF3 A;  4MMY B;  2KF6 A;  3G0K A;  5EVH A;  1B2X A;  3LOY A;  1BRN L;  2C11 A;  1LOY A;  4OK0 A;  2CFG A;  5EQL A;  2CKF B;  1VZZ A;  3LXU X;  3WDG B;  3CD6 3;  1RMS A;  2WGO A;  3G71 3;  1UGH I;  1BUJ A;  2STD A;  1IV7 A;  1NDO B;  1JB5 A;  1N8Q A;  1BGS A;  3K0Z A;  3T8U A;  1YGW A;  1A67 A;  4TX4 A;  3X41 A;  4ILF A;  1X1X A;  3DGM A;  1KQS 2;  3DH2 A;  3JVC A;  5DRE A;  3NXJ A;  1BNR A;  2CFW A;  2FGT A;  1UCL A;  1W4N A;  4I4K A;  1W6G A;  2KF3 A;  2YFI B;  5CXO A;  3D9R A;  2Q07 A;  1RGA A;  1CYV A;  3DGL A;  2LQV A;  1MNL A;  3GZB A;  1CEW I;  3NBB A;  1OAC A;  4NPB A;  1YJW 3;  1RGC A;  1VQ8 3;  1Q86 4;  2W9Q A;  4EBG A;  3NV0 A;  1OHO A;  4U13 A;  4GB5 A;  4XBX A;  1JBS A;  1K28 A;  1UUV B;  2J8X B;  1OPY A;  4WHA A;  5D82 A;  1B2U A;  2MF7 A;  3GZY B;  1AQZ A;  4HM5 B;  4STD A;  2JQ5 A;  1GYB A;  4GL6 A;  5TGN A;  3U97 A;  1GOY A;  1O7H B;  1MGW A;  1U5O A;  4MJD A;  2CG0 A;  5G1L A;  1NU3 A;  1SIH A;  5KP3 A;  3IMA B;  3SXX A;  4ZM8 A;  1B2S A;  3LT8 A;  1RHL A;  3AMO A;  1GMQ A;  1EUI C;  1PU4 A;  1YIJ 3;  1JBT A;  4L8O A;  1OGX A;  1I2F A;  1BAN A;  4NRE A;  2W56 B;  1J2B A;  4N3V A;  4HM1 B;  3EE1 A;  3JUP A;  3F8X A;  4QWT A;  1YJ9 3; 
#chains in the Genus database with same CATH homology
 1GD4 A;  1M1X B;  2D42 A;  3DMC A;  3LT9 A;  1K8A 4;  3WOD G;  1Q81 4;  2OCT A;  2F98 A;  4HZ9 B;  3OWS A;  4K1U A;  3OWU A;  4FMB A;  1FGM A;  1FGR A;  3X40 A;  2BT3 A;  1ISK A;  2ML6 A;  3BNC A;  3FG3 A;  3LH4 A;  3RGA A;  5IW9 A;  2W6J H;  2B1X B;  3STD A;  4NHF A;  4RBN A;  1W7C A;  1DMQ A;  2FNQ A;  2CIU A;  3K7C A;  2JDI H;  3DM8 A;  3B4O A;  3X3Y A;  1EG9 B;  1W5Z A;  3V92 A;  5AIG A;  4O3V A;  2HMK B;  1K41 A;  4FCJ A;  1VQ7 3;  4N6N B;  3PYJ A;  4HKV B;  2XFT A;  5STD A;  3OV4 A;  1PFP A;  2W03 A;  2P0M A;  3F7X A;  5IF6 A;  3S5C A;  4EYC A;  2GXF A;  2BMO B;  3EB8 A;  4RNZ A;  4LSO A;  3U1W A;  3WA3 A;  2CC3 A;  2BO9 B;  3NUV A;  4JRF A;  5AIH A;  2CG1 A;  1TU5 A;  4HBR A;  2CFK A;  3SOY A;  3VF1 A;  1QMA A;  3MKI A;  1OF5 B;  1JKG B;  3NX0 A;  5FW5 A;  2XR8 B;  5AYS C;  3KSE D;  4IIA A;  4XBT A;  3KFQ C;  3X3Z A;  1JB2 A;  1JJ2 2;  1ROV A;  4XDW A;  1YVB I;  1S5A A;  4AKY A;  4H3U A;  1LXE A;  2IMJ A;  1M90 4;  4KFE A;  1JN5 A;  1ZX2 A;  3PCR A;  3GRD A;  3PGB A;  3F40 A;  5JBS A;  3CCR 3;  1QAL A;  2GEY A;  3L0R A;  4OUQ A;  3N8B A;  2F99 A;  3S67 A;  2OWP A;  3HIG A;  2INX A;  1IDP A;  1WMO A;  4K90 B;  3K9M C;  1GD3 A;  3EBT A;  2XEP A;  4HM7 B;  1DVD A;  1OHS A;  1E3R A;  1Q40 A;  5D83 A;  1YJN 3;  3TDG A;  2XSH B;  4KVH A;  3PXM A;  3CC4 3;  3KE7 A;  4HYZ A;  3K5T A;  5LC7 A;  5JPU A;  2UX0 A;  1QJG A;  2CFD A;  4KFD A;  5BXQ A;  3ECF A;  3LZA A;  1WMN A;  4RNY A;  5AI1 A;  4R80 A;  2BHM A;  1IK3 A;  3CC7 3;  2RGQ A;  2W04 A;  1QVG 2;  3RDE A;  3FF0 A;  3DGO A;  4HM2 B;  3BND A;  4R9L A;  1N5H A;  2D1W A;  4HVN A;  3UL6 A;  1VQ6 3;  2IUK A;  3F9S A;  4N6M A;  2YFJ B;  1UUW B;  1N8R 4;  3S28 A;  3GZX B;  2WOH A;  3HII A;  3S29 A;  5AYR B;  5ELJ A;  2PNC A;  1Y4K A;  1N9E A;  3NBR A;  3KSP A;  3NV0 B;  4R4K A;  1A2V A;  1ZO2 A;  4WYK B;  3NM2 A;  1LOX A;  2CWV A;  4XBY A;  3N54 B;  3G16 A;  3OWY A;  2K0M A;  4X2O A;  1GY6 A;  3LTA A;  3Q2P A;  1KC8 4;  3SVA A;  4X2H A;  3CCJ 3;  3OW2 2;  4IT7 A;  1W01 A;  1GS3 A;  1N5P A;  3QRD A;  3QK9 A;  2BNG A;  1NB3 I;  3FSD A;  3H3H A;  1YHQ 3;  6STD A;  3ER7 A;  4LGQ A;  1IT8 A;  5JPP A;  4WWU C;  3FKA A;  1E97 A;  3JUO A;  3CCQ 3;  1O7W B;  2R4I A;  1JRQ A;  1D6Z A;  1QAK A;  2GU1 A;  2YFL B;  1EQK A;  2W0Q A;  2E2U A;  3MG3 A;  2RCD A;  3CCV 3;  1IU7 A;  3EX9 A;  5IEP A;  4PEJ A;  3FGY A;  4KZ1 A;  3MWZ A;  3FH1 A;  5IG0 A;  3JUM A;  1OCV A;  2B24 B;  2XRX B;  1VQ4 3;  2I9W A;  1DYU A;  1O7N B;  1VQN 3;  4HM8 B;  2Z77 A;  1IVV A;  1IQ8 A;  4O2H A;  1LNH A;  1W6Y A;  2GEX A;  2IUJ A;  3G4S 3;  3Q90 A;  5IER A;  4LEH A;  1R4C A;  1RN7 A;  2QGU A;  4HJL B;  3LTD A;  2OTL 3;  2IA7 A;  1OH0 A;  1W02 A;  4HM6 B;  4CDL A;  3S27 A;  1HKX A;  1OUN A;  5FGO A;  4BTY A;  1D6U A;  2P09 A;  2GBW B;  3DUK A;  3FF2 A;  1QAF A;  1K73 4;  3GAX A;  1TUH A;  1NB5 I;  2FXT A;  3KN4 A;  3J7Y d;  1RJO A;  1SQW A;  1WMP A;  4XM4 A;  3CMA 3;  3EQQ B;  5BVB A;  2XSO B;  7STD A;  2XGL A;  3KKG A;  1UW1 A;  1O7M B;  1YIT 3;  2V1L A;  1AVL A;  2CW9 A;  3LTC A;  3T0U A;  2RSX A;  2O3O A;  2L4V A;  2KCD A;  2CHC A;  5I97 A;  3FG1 A;  2KRT A;  4LMI A;  4Q53 A;  3UL5 A;  4EXR A;  1JN5 B;  3NQZ A;  4R9K A;  3CCM 3;  4N6U A;  5CK6 A;  1VQM 3;  4N6T A;  2HMM B;  4WFO A;  3HI7 A;  2C10 A;  3UJM A;  3CCE 3;  3UNL A;  1ULI B;  5CF1 A;  1DMN A;  1IVX A;  1IT7 A;  4K1V A;  3I0Y A;  3O8Y A;  2HMJ B;  5G2G A;  3EHC A;  3JUQ A;  4N6L A;  5EEO A;  1VQ5 3;  2CK3 H;  1NJI 4;  1W2B 2;  1IQX A;  1O7G B;  3CPO A;  3EN8 A;  2WO0 A;  3V98 A;  1VQO 3;  4OVM A;  3X42 A;  1IQY A;  4RZM A;  2E2V A;  3KZT A;  3F8H A;  1STF I;  3MPH A;  5AEU B;  3GWR A;  1D6Y A;  2QA4 3;  1O7P B;  1US1 A;  3EF8 A;  4IPB A;  1YI2 3;  2ZL8 A;  3FG4 A;  3ALA A;  3IJE B;  3B4P A;  1SII A;  3M8C A;  2A15 A;  1FGT A;  1G96 A;  3KII A;  2CWU A;  1GY5 A;  3VSY A;  1U8C B;  3HX8 A;  3MYT A;  3MG2 A;  3MG1 A;  5KP1 A;  3SOA A;  1Z1S A;  4FCM A;  2OOV A;  1Q82 4;  3EN1 B;  3HK4 A;  1CYU A;  2K54 A;  4HM4 B;  4WP5 A;  4FMD A;  5IEO A;  1WTH A;  1UI8 A;  2GBX B;  4JF8 A;  2SBL A;  5KP4 A;  4N6O B;  1VQP 3;  1OGZ A;  3D3L A;  4O02 B;  1TP6 A;  1S72 3;  2XFS A;  3BNE A;  4R1K A;  3NHX A;  2P05 A;  1AR0 A;  5CLK A;  4LZI A;  3CCL 3;  5AEW B;  3N9H A;  5CF2 A;  3PS8 A;  1AVK A;  4K61 A;  3CCS 3;  3BLZ A;  1KWI A;  3NBJ A;  3H51 A;  3AMO B;  3F14 A;  3CU3 A;  2OQE A;  1TFK A;  1AV4 A;  4MMX B;  3I55 3;  1SJW A;  1RRL A;  1STD A;  3FCS B;  3CXC 2;  1K9M 4;  3A76 A;  2P0X A;  1QVF 2;  2GU3 A;  3BB9 A;  4WYK A;  1ROA A;  1HU9 A;  3UB1 A;  4XDV A;  4HM3 B;  1F8N A;  2XH9 A;  4FR9 A;  4XB5 A;  3WMD A;  3G8Z A;  3OX9 A;  3DGN A;  3MSO A;  3G6E 3;  4O8S A;  3MHE A;  3F7S A;  5DRV A;  1DMM A;  1L5G B;  3X3X A;  3LYG A;  2OTJ 3;  1W2Z A;  2Z76 A;  4EC6 A;  3FZW A;  2W2C A;  3EC9 A;  3I56 3;  3VGN A;  2XGN A;  3DZL A;  1ASK A;  1KD1 4;  1W6C A;  4N6V 0;  3LML A;  2W56 A;  1VQK 3;  2WOF A;  2ZDJ A;  5A0O B;  1YGE A;  1T5Y A;  5IG5 A;  5LC6 A;  2W9P A;  3GZR A;  1WQL B;  1VQ9 3;  1IVW A;  2QIY A;  2Z7A A;  5D81 A;  4BTX A;  2QEX 3;  1TFO A;  2HMO B;  3CNM A;  1C7H A;  2BMR B;  5IG3 A;  1UI7 A;  3IPT A;  5ELU A;  4FMC A;  3T8N A;  3SED A;  3JUN A;  2KXG A;  3EJV A;  3CPW 2;  4L8P A;  1FUW A;  3E99 A;  1FA3 A;  2WGQ A;  3SX1 A;  4MMZ B;  2F86 B;  2E2T A;  3B7C A;  1TIJ A;  3HZP A;  1VQL 3;  3CCU 3;  1GY7 A;  1LVN A;  2ML5 A;  1A2K A;  2LYX A;  4FCZ A;  2HMN B;  4HZB B;  5HGR A;  3WOE B;  4CCV A;  1M9G A;  1N9J A;  1CQS A;  1SPU A;  1IV9 A;  2YX9 A;  1JNQ A;  1OHP A;  3CNX A;  1Q7Y 4;  2M7O A;  1NWW A;  1BUQ A;  3PCS A;  1M1K 4;  3B8L A;  1RRH A;  2Y73 A;  1KSI A;  1IVU A;  8CHO A;  4HM0 B;  1E3V A;  1DVC A;  1JKG A;  1OF5 A;  2CWT A;  2MC8 A;  2PZV A;  3DY5 A;  1WNH A;  3BNB A;  3NM7 A;  3PZW A;  3EBY A;  3SLU A;  3WA2 X;  5IG4 A;  3LTB A;  4BTW A;  3RGR A;  2BMQ B;  1ULJ B;  4FMA A;  5AIF A;  1Q42 A;  4AEQ A;  2RFR A;  1FGO A;  2O9U X;  1V74 A;  1MOL A;  1Q40 B;  4KFF A;  2OOV C;  3NQY A;  1JB4 A;  4J8T A;  4EV2 A;  4AKZ A;  1W00 A;  4G1M B;  2HML B;  1JV2 B;  2CH9 A;  2Y74 A;  5IEN A;  2P38 A;  1NO3 A;  2CFL A;  4H61 A;  4L7K A;  1RKY A;  1FGQ A;  3V99 A;  5AII A;  4MEI A;  1A90 A;  4J9A A;  4ORL A;  3CC2 3;  3CME 3;  2Z6B A;  3ROB A;  4EV5 A;  3FLJ A;  3DXO A;  2OQE C;  3K63 A;  1EKM A;  3OXA A;  3Q1C A;  1EA2 A;  2XF3 A;  4MMY B;  3G0K A;  5EVH A;  3LOY A;  2C11 A;  4OK0 A;  2CFG A;  5EQL A;  2CKF B;  1VZZ A;  3LXU X;  3WDG B;  3CD6 3;  2WGO A;  3G71 3;  2STD A;  1IV7 A;  1NDO B;  1JB5 A;  1N8Q A;  3K0Z A;  3T8U A;  1A67 A;  4TX4 A;  3X41 A;  3DGM A;  1KQS 2;  5DRE A;  3JVC A;  3NXJ A;  2CFW A;  2FGT A;  1W4N A;  4I4K A;  1W6G A;  2YFI B;  5CXO A;  3D9R A;  2Q07 A;  1CYV A;  3DGL A;  2LQV A;  1MNL A;  3GZB A;  1CEW I;  3NBB A;  1OAC A;  1YJW 3;  1VQ8 3;  1Q86 4;  2W9Q A;  4EBG A;  3NV0 A;  1OHO A;  4U13 A;  4GB5 A;  4XBX A;  1K28 A;  1UUV B;  5D82 A;  1OPY A;  4WHA A;  3WOF B;  2MF7 A;  4HM5 B;  3GZY B;  5TGN A;  4STD A;  2JQ5 A;  1GYB A;  4GL6 A;  3U97 A;  1O7H B;  1U5O A;  4MJD A;  2CG0 A;  1NU3 A;  1SIH A;  5KP3 A;  3IMA B;  3SXX A;  4ZM8 A;  3LT8 A;  3AMO A;  1PU4 A;  1YIJ 3;  4L8O A;  1OGX A;  4NRE A;  2W56 B;  1J2B A;  4N3V A;  4HM1 B;  3EE1 A;  3JUP A;  3F8X A;  4QWT A;  1YJ9 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...