5D81A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y57(cl-y)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
126
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Proton Delocalization in an Enzyme's Hydrogen Bond Network with Unnatural Amino Acids.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Delta(5)-3-ketosteroid isomerase
total genus 30
structure length 126
sequence length 127
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2015-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5d81A00
3EBYA 1WQLB 3FLJA 3MG3A 4L8PA 5AEUB 5JPUA 4HM7B 1Q42A 4K1VA 4ORLA 1AR0A 1OHOA 3DUKA 2RFRA 1SJWA 3EQQB 1O7GB 4HJLB 5IEPA 5IF6A 1OUNA 3T8UA 4XBTA 5AI1A 3JUNA 3K7CA 4OUQA 1W00A 2HMOB 3OX9A 5AIGA 1OHSA 5EVHA 3OV4A 2GEXA 3H51A 4CDLA 1O7PB 4HM4B 4LMIA 1OHPA 3EN1B 3SOAA 1UUVB 2CHCA 1JB4A 2UX0A 2XSHB 3A76A 3G16A 2BMQB 3HK4A 3HZPA 4XDWA 2IMJA 5IEOA 3SEDA 2HMNB 3VGNA 5CF1A 1JKGB 4L7KA 5D82A 3F7SA 3NV0B 3G0KA 4OVMA 5DRVA 4J8TA 2B1XB 1O7HB 3EJVA 3NHXA 4WYKB 1EA2A 2CKFB 1DMMA 4HM3B 3OWYA 1ULJB 7STDA 5KP4A 2INXA 4XM4A 4XDVA 3BLZA 3Q90A 3MG2A 1JN5A 5KP1A 4WP5A 3FZWA 2I9WA 4LGQA 4HM6B 2W2CA 4HZBB 2HMKB 5BXQA 1TUHA 3F7XA 1ZX2A 4WWUC 3ECFA 5D81A 1TP6A 1OF5A 3CU3A 3B7CA 3GZYB 3KKGA 1O7MB 2Z77A 3LYGA 3DZLA 3NUVA 4HM5B 5STDA 3S5CA 4R1KA 3ROBA 3T8NA 1Z1SA 1W02A 2XSOB 3ER7A 3NBRA 4HM8B 5IG5A 3EHCA 1BUQA 1IDPA 1GY6A 2F98A 3JUOA 3MHEA 5KP3A 4K1UA 4KVHA 2YFJB 3GRDA 1CQSA 3OXAA 1JB2A 5AEWB 3M8CA 3OWUA 2BMOB 5IG4A 5AIFA 1O7NB 3FH1A 2BNGA 1GY5A 2GEYA 5IERA 3K0ZA 2XR8B 1NU3A 2K54A 2GXFA 3D9RA 3FF0A 2QIYA 3EC9A 4U13A 5HGRA 3JUQA 4R9KA 4L8OA 1EG9B 5AIIA 1GY7A 3B4OA 3GWRA 1STDA 4XBXA 3MYTA 3NM2A 3I0YA 3KZTA 2STDA 2QGUA 5TGNA 1W01A 1Q40B 1JN5B 5DREA 6STDA 3MG1A 1GS3A 4FCMA 3JUMA 4IIAA 4HM2B 3UJMA 1NWWA 2GBXB 1QJGA 3EN8A 3IPTA 4HZ9B 2BMRB 1K41A 4STDA 2HMLB 5D83A 3STDA 2RCDA 1OF5B 4X2HA 2B24B 4PEJA 8CHOA 5BVBA 3CNXA 3EF8A 1UUWB 3F8XA 3FKAA 2PZVA 3E99A 3VSYA 4I4KA 1OPYA 1OH0A 2XRXB 4HVNA 3UNLA 4RZMA 3RGRA 5IG3A 1GYBA 3F8HA 1QMAA 3WMDA 4XBYA 4J9AA 3F9SA 5AIHA 4XB5A 3MSOA 1OGXA 4MJDA 1JB5A 1OGZA 3MKIA 1W6YA 3FSDA 5FW5A 2Z76A 1DMNA 1O7WB 1ULIB 3B8LA 1NDOB 3LZAA 2JQ5A 4LEHA 4HKVB 1ISKA 1ZO2A 3GZRA 1ASKA 3DMCA 2YFLB 3H3HA 4N3VA 1E3RA 2Z7AA 2F99A 2R4IA 3GZXB 3HX8A 4FCJA 1HKXA 3EBTA 3F14A 1JKGA 3EX9A 1Q40A 3B4PA 3FF2A 4HM0B 2HMJB 1OCVA 1A2KA 3F40A 3NV0A 3DXOA 2HMMB 4HM1B 3BB9A 1VZZA 3JUPA 4H3UA 2OWPA 2YFIB 3FGYA 4R9LA 4WYKA 1DMQA 3RGAA 5CXOA 2GBWB 3SOYA 1U5OA 3OWSA 4GB5A 3GZBA 5JPPA 3CPOA 5CLKA 5IG0A 2F86B 3CNMA 3KE7A 4Q53A 1S5AA 3G8ZA 5CF2A 1C7HA 2A15A 3KSPA 1E3VA 4X2OA 3DM8A 5G2GA 5CK6A 3NXJA 5IENA 2RGQA 1E97A
chains in the Genus database with same CATH superfamily
3EBYA 3FLJA 3MG3A 1VQ73 1W2B2 1YJN3 4TX4A 2CWTA 1AR0A 3AMOB 2RFRA 1SJWA 1RCLA 1YVSA 2FXTA 2RBIA 3EQQB 5IEPA 2F56A 3CCQ3 1LQGC 1K28A 1W00A 1ZS7A 4JF8A 2ZA4A 1OHPA 2CHCA 3G16A 1JB4A 1W4NA 1T3BA 2JDIH 2BMQB 8RNTA 1B3SA 1W2ZA 2XEPA 3SEDA 2HMNB 3WR2A 3BIRA 4L7KA 1T2HA 2O9UX 1PU4A 4LZIA 1PYLA 3DGYA 3GAXA 2B1XB 1BNFA 2L1SA 3NHXA 4KFEA 2CKFB 2J8XB 3EE1A 4HM3B 1JZOA 4WYKB 1CYUA 2CC3A 2Z6BA 5ELUA 3MG2A 3CCU3 1JN5A 1BANA 1HYFA 1G0TA 4LGQA 4HM6B 1I0XA 4NPBA 2P05A 3QK9A 3CCE3 1T5YA 1RLSA 2C11A 2HMKB 3CC73 1X1WA 1JRQA 2KXGA 2MC8A 3CU3A 4FR9A 3NUVA 3S29A 1N9JA 1D6ZA 3S5CA 2K3DA 3EB8A 2IUJA 1Z1SA 2XSOB 3LTBA 4RBNA 5IG5A 3X42A 1BNRA 5KP3A 3MHEA 5AYRB 1GMPA 2IUKA 4KT3B 1B27A 1CQSA 1RCKA 1VQ53 3M8CA 1BOXA 1TRQA 3PCRA 1O7NB 2XFTA 2CH9A 1K8A4 1X1YA 3KN4A 3V99A 2CFLA 3EC9A 5HGRA 5M1AA 3B4OA 4XBXA 3DGMA 2WOFA 4KFDA 1UCLA 2QA43 1YGEA 1I70A 7GSPA 1BNEA 3X3ZA 1JN5B 1UW1A 3MG1A 2CFDA 3TDGA 4BTYA 4O2HA 4FCMA 4IIAA 3LOYA 1RRHA 3STDA 1ROVA 2RNTA 5D83A 2QEX3 2HMLB 3JVCA 3Q2PA 1VQM3 4X2HA 2LQVA 1BNJA 1UCIA 3E99A 2LYXA 4I4KA 1I2EA 1KQS2 3RGRA 5IG3A 1I3IA 2XF3A 1GYBA 3WMDA 4XBYA 4J9AA 3KIIA 2P09A 1LXEA 1K9M4 2CFWA 2H0GA 4XB5A 1WNHA 4MJDA 1JB5A 1I0VA 4R4KA 1UDII 1JNQA 5FW5A 1BRSA 3B8LA 3CXC2 3CCR3 2KCDA 4LEHA 1GOVA 4HKVB 3GZRA 1YGWA 3D5IA 1IK3A 1Q864 3H3HA 1FW7A 1VQ83 4WFOA 3KFQC 1E3RA 2Z7AA 2F99A 2R4IA 3GZXB 1BSAA 3DGLA 1T2IA 3EX9A 3F14A 1FGQA 3NBBA 1V74A 2HMJB 1KC84 1A2PA 3RDEA 1D6UA 1Q9EA 2OWPA 2YFIB 4GL6A 1DMQA 1PY3A 4K90B 1MGRA 3IMAB 4NHFA 3SX1A 3GZBA 5IG0A 1V57A 2Q07A 1A90A 1C7HA 1U8CB 1FUTA 2A15A 1SIIA 1TTOA 2L4VA 5CK6A 1K734 2GU1A 2RGQA 1Q7Y4 3N8BA 2D42A 4L8PA 3S28A 5JPUA 4FCZA 2W0QA 1Q42A 2OOVC 3WHOA 1FYSA 4HJLB 3SXXA 3SVAA 3LTDA 4XBTA 2C4BA 5ELJA 3JUNA 4GSPA 3D5GA 4OUQA 5AIGA 1FGOA 1BRJA 3OV4A 1DVDA 3BNDA 3H51A 1O7PB 4LMIA 4EW5A 1JBTA 3SOAA 1UUVB 1G96A 2IMJA 5CF1A 1IT8A 2C10A 3NV0B 4OVMA 3ZG5A 3EJVA 1O7HB 1W7CA 1EA2A 5EEOA 2CX1A 3WODG 2RSXA 3BU4A 1GMRA 1ULJB 2CFGA 3OWYA 3U97A 4EBGA 3Q90A 4EV2A 1KWIA 3FZWA 4EC6A 1N8R4 1SIHA 2CK3H 1TUHA 1IQ8A 5D81A 1TP6A 1OF5A 2F5MA 4HM5B 1ISKA 2Z77A 3FG1A 5STDA 3K5TA 4R1KA 3NBRA 3G6E3 1VQQA 2OTJ3 1BUQA 1CYVA 1IDPA 1GY6A 1TIJA 3G4S3 3OXAA 3DY5A 2Y73A 4BU4A 3K63A 4BTXA 3FH1A 2BNGA 3URPA 2KF6A 1VQ63 4O02B 3I563 1RGCA 3D9RA 1NU3A 2K54A 3FF0A 4U13A 1JV2B 2QIYA 1LRAA 1TU5A 1BNSA 3NM2A 2WO0A 1IYYA 3I0YA 3PS8A 4LYLB 3X3XA 1IT7A 2STDA 4H61A 1W01A 1UCKA 1UCJA 1MNLA 3LTCA 5M19A 1AVLA 4MEIA 1GS3A 4DKIA 3JUMA 1QJGA 2W56B 3CCV3 1WMNA 2F4YA 1K41A 2W9QA 3WOEB 3CMA3 1VQO3 2RCDA 3Q3FA 4ZM8A 2AADA 1OF5B 2B24B 2OQEA 3MWZA 1B20A 1X1XA 4NREA 3EF8A 4PEJA 3F8XA 1M1K4 1CH0A 3VSYA 1IVXA 5IERA 1OPYA 2XRXB 4HYZA 1R4YA 1IV7A 3F8HA 4HAAA 2CFKA 2F5WA 3GSPA 3HOHA 1BIRA 1OACA 1ROAA 4N6LA 3MSOA 3J7Yd 1VQL3 1QVF2 1BU4A 1RGAA 3FG3A 1NJI4 1O7WB 1ULIB 4EV5A 1BRGA 4KFFA 5BIRA 1C54A 1B2SA 1RGGA 5A0OB 3LH4A 2M7OA 3S27A 1J2BA 1IQXA 3AHSA 3FF2A 3EBTA 3FCSB 3PYJA 3B4PA 2ZDJA 1FUSA 1AVKA 4HM0B 5HOHA 1EEJA 3DXOA 5G1KA 1BSDA 4R9LA 2IY2A 5CXOA 1LVNA 4GB5A 1RJOA 3MPHA 3X41A 3KE7A 3D4AA 3KCHA 3AGOA 1VQ93 2WOHA 1RHLA 1V58A 4X2OA 3DM8A 1Q7HA 1KSIA 1JZDA 3CCL3 4N6MA 2CWUA 4HM7B 1OHOA 1Y4KA 1IQYA 1RRLA 2CX0A 1O7GB 2CW9A 3QRDA 1ZGXA 5AI1A 1A67A 6RNTA 2HMOB 3OX9A 5EVHA 4CDLA 1OHSA 2HOHA 4HM4B 3U1WA 3CCS3 2KF3A 1GSPA 3HZPA 3HK4A 4XDWA 4AKZA 4R80A 2KAAA 5IEOA 5AYSC 1Q814 1BSCA 3F7SA 3G0KA 5DRVA 1FA3A 2BO9B 3UL6A 7RNTA 4HBRA 1DMMA 5IW9A 3T0UA 7STDA 5KP4A 3K9MC 3BLZA 4XDVA 3SLUA 3A5EA 1N5HA 1YVBI 1PFPA 4IT7A 4WP5A 5LC6A 2CG1A 6GSPA 3CC23 3KSED 4ILFA 3N54B 4AKYA 5BXQA 2OCTA 5G1LA 3Q1CA 3ZFZA 3BNEA 3ECFA 3D79A 5GSPA 3AHWA 1BNGA 1O7MB 2P0XA 3T8NA 1W5ZA 1M904 1LNHA 1W02A 3DGOA 4HM8B 1MOLA 1EKMA 3JUOA 1EUIC 1FZUA 4K1UA 4KVHA 1GMQA 3GRDA 1UI8A 2UUGC 1JB2A 3ZG0A 5AEWB 4G1MB 2BMOB 4N6NB 5AIFA 2BHMA 3VF1A 1LOXA 3WOFB 3X40A 3PGBA 1B2UA 1D6YA 2GXFA 4WHAA 3X3YA 2UGIA 5AEUB 1RGEA 3JUQA 1HU9A 2ML5A 4L8OA 1GY7A 3GWRA 1STDA 3UB1A 1B2XA 3KZTA 4CPKA 2QGUA 4EXRA 1SPUA 5DREA 1CEWI 1MGWA 4RNYA 1DVCA 4GHOA 1LOVA 1IVVA 4EYCA 3DGNA 4HM2B 4N6UA 3UJMA 2GBXB 3EN8A 3IPTA 4HZ9B 2BMRB 2FGTA 4STDA 4LSOA 5RNTA 1RN7A 1IVWA 3CC43 8CHOA 5BVBA 1TRPA 3CNXA 2ZHXB 3FKAA 4FMDA 2PZVA 3HIIA 1OH0A 2BIRA 4N6TA 3LXUX 3S67A 5I97A 4FMCA 2MF7A 3FG4A 4N6OB 2KF5A 3F9SA 5AIHA 4MMZB 3AMOA 1RTUA 4BIRA 1YIJ3 1OGXA 1BRKA 1OGZA 2AAEA 1YIT3 2BT3A 4FMAA 1QAFA 2FNQA 1NDOB 2JQ5A 1AY7A 2KF4A 1ZO2A 4K61A 4O3VA 3DMCA 1JBSA 3HIGA 1STFI 1UGHI 3DH2A 3HX8A 4O8SA 1LOWA 1HKXA 4J5GA 1JKGA 3RNTA 1VQK3 1VQN3 3NV0A 3F40A 1NNVA 4JRFA 4HM1B 1A2VA 1FGMA 3ALAA 3BB9A 1VZZA 3JUPA 4H3UA 4WYKA 3FGYA 5EQLA 1BNIA 1NB3I 1US1A 2W56A 2XGNA 1LNIA 2E2UA 2F86B 3CNMA 1L5GB 1VQP3 1S5AA 4MMYB 3G8ZA 5JBSA 5FGOA 2OTL3 1R4CA 1RGFA 3V92A 4CCVA 1GOUA 5IENA 2INXA 3N9HA 4XM4A 1WQLB 2ZL8A 4K1VA 4ORLA 1B2ZA 1GD3A 1TFOA 3DUKA 5IF6A 1BSEA 1OUNA 3T8UA 1RNTA 2CWVA 2D1WA 3WA3A 1B21A 3K7CA 3I553 3D3LA 5KP1A 1W6GA 2Y74A 1YI23 2GEXA 1DE3A 3G713 3BNBA 5LC7A 3SYUA 2H0HA 3EN1B 2BU4A 1KD14 2XSHB 1MWTA 2UX0A 3A76A 1QALA 4I5QA 1M9GA 1BGSA 2WGQA 2XGLA 1RN1A 3VGNA 1MWRA 1JKGB 5D82A 3CD63 4J8TA 2SARA 3UL5A 1DYUA 2V1LA 2P0MA 1AQZA 4FMBA 1NO3A 1RGHA 4OK0A 1LOYA 1FGTA 1BAOA 1BRHA 3V98A 1Q824 1YJ93 3PXMA 2I9WA 4CJNA 2W2CA 4HZBB 1VQ43 4HOHA 3OW22 3F7XA 2PNCA 2OOVA 1ZX2A 4WWUC 3B7CA 3GZYB 1RDSA 3KKGA 3LYGA 4BL3A 3DZLA 1B2MA 3CCJ3 2ML6A 3ROBA 1GD4A 2IYJA 3ER7A 3LT9A 2KRTA 3LMLA 1FGRA 3EHCA 5BU4A 2F98A 2W9PA 2YFJB 1IVUA 3OWUA 1QAKA 1GY5A 2GEYA 2W04A 1TJDA 2H0IA 3K0ZA 1BRNL 2XR8B 1MWSA 1UI7A 4RNTA 1JJ22 4R9KA 1UGIA 3NM7A 1EG9B 5AIIA 3MYTA 1F8NA 3CCM3 1WMPA 2R41A 1RMSA 5TGNA 1IV9A 1Q40B 1I8VA 1SARA 1YNVX 6STDA 1IU7A 3PCSA 9RNTA 1NWWA 3NX0A 3O8YA 1QVG2 3HI7A 1I3FA 1AV4A 1N5PA 1N9EA 3CPW2 1I2FA 4RNZA 1UUWB 2SBLA 1BRIA 1I2GA 1WTHA 4HVNA 3UNLA 4RZMA 4BTWA 2WGOA 3LTAA 1NB5I 2GU3A 1QMAA 2E2TA 5M18A 2O3OA 1X1UA 1BVIA 1YHQ3 4AEQA 1RNBA 3MKIA 2GSPA 1EQKA 2W6JH 3CME3 1RGLA 1W6YA 3FSDA 3NBJA 3AGNA 2P38A 2Z76A 1DMNA 1DETA 4J5KA 1FUWA 4BL2A 3LZAA 1LQMB 1N8QA 1ASKA 2CIUA 4KZ1A 2CG0A 2E2VA 2YFLB 4N3VA 1UUGB 1RKYA 1MWUA 1RGKA 1YJW3 3BNCA 2XFSA 3WA2X 5IG4A 4FCJA 1BSBA 1S723 1JBRA 4N6V0 1Q40A 1OCVA 1A2KA 3NQYA 2HMMB 1TFKA 3PZWA 4IPBA 2IA7A 3RGAA 1WMOA 1SQWA 3NQZA 1BUJA 1M1XB 3L0RA 2GBWB 3SOYA 1U5OA 1GOYA 3OWSA 3LT8A 1HZ1A 3CPOA 5CLKA 2W03A 5JPPA 3IJEB 4MMXB 4Q53A 4QWTA 5CF2A 2OQEC 1RSNA 2XH9A 2K0MA 2YX9A 1RN4A 1W6CA 1G02A 1E3VA 3KSPA 5G2GA 3WDGB 3NXJA 1E97A
chains in the Genus database with same CATH topology
3EBYA 3FLJA 3MG3A 1VQ73 1W2B2 1YJN3 4TX4A 2CWTA 1AR0A 3AMOB 2RFRA 1SJWA 3EQQB 5IEPA 2FXTA 3CCQ3 1K28A 1W00A 4JF8A 1OHPA 2CHCA 3G16A 1JB4A 1W4NA 2JDIH 2BMQB 3SEDA 1W2ZA 2XEPA 2HMNB 4L7KA 2O9UX 1PU4A 4LZIA 3GAXA 4KFEA 2B1XB 3NHXA 4WYKB 3EE1A 2CKFB 4HM3B 1CYUA 2CC3A 2Z6BA 5ELUA 3MG2A 3CCU3 1JN5A 4LGQA 4HM6B 3CCE3 2P05A 3QK9A 1T5YA 2HMKB 2C11A 3CC73 1JRQA 2KXGA 2MC8A 3CU3A 4FR9A 3NUVA 3S29A 1N9JA 1D6ZA 3S5CA 3EB8A 2IUJA 1Z1SA 2XSOB 3LTBA 4RBNA 5IG5A 3X42A 5KP3A 3MHEA 5AYRB 2IUKA 1CQSA 1VQ53 3M8CA 3PCRA 1O7NB 2XFTA 2CH9A 1K8A4 3KN4A 3V99A 2CFLA 3EC9A 5HGRA 3B4OA 4XBXA 3DGMA 2WOFA 4KFDA 2QA43 1YGEA 3X3ZA 1JN5B 1UW1A 3MG1A 2CFDA 3TDGA 4BTYA 4O2HA 4FCMA 4IIAA 3LOYA 1RRHA 3STDA 1ROVA 5D83A 2QEX3 1VQM3 2HMLB 3JVCA 3Q2PA 4X2HA 2LQVA 3E99A 2LYXA 4I4KA 1KQS2 3RGRA 5IG3A 2XF3A 1GYBA 3WMDA 4XBYA 4J9AA 3KIIA 2P09A 1LXEA 1K9M4 2CFWA 4XB5A 1WNHA 4MJDA 1JB5A 4R4KA 1JNQA 5FW5A 3B8LA 3CXC2 3CCR3 2KCDA 4LEHA 4HKVB 3GZRA 1IK3A 1Q864 3H3HA 1VQ83 4WFOA 3KFQC 1E3RA 2Z7AA 2F99A 2R4IA 3GZXB 3F14A 3DGLA 3NBBA 3EX9A 1FGQA 1V74A 2HMJB 1KC84 3RDEA 1D6UA 2OWPA 2YFIB 4GL6A 1DMQA 4K90B 4NHFA 3SX1A 3IMAB 3GZBA 5IG0A 2Q07A 1A90A 1C7HA 1U8CB 2A15A 1SIIA 2L4VA 5CK6A 1K734 2RGQA 2GU1A 1Q7Y4 3N8BA 2D42A 4L8PA 3S28A 5JPUA 4FCZA 2W0QA 1Q42A 2OOVC 4HJLB 3SXXA 3SVAA 3LTDA 4XBTA 5ELJA 3JUNA 4OUQA 5AIGA 1FGOA 1DVDA 3OV4A 3BNDA 3H51A 1O7PB 4LMIA 3SOAA 1UUVB 1G96A 2IMJA 5CF1A 1IT8A 2C10A 3NV0B 4OVMA 3EJVA 1O7HB 1W7CA 1EA2A 5EEOA 3WODG 2RSXA 3OWYA 4EBGA 1ULJB 2CFGA 3U97A 3Q90A 4EV2A 1KWIA 3FZWA 4EC6A 1N8R4 1SIHA 2CK3H 1TUHA 1IQ8A 5D81A 1TP6A 1OF5A 1ISKA 4HM5B 2Z77A 3FG1A 5STDA 3K5TA 4R1KA 3NBRA 3G6E3 2OTJ3 1BUQA 1CYVA 1IDPA 1GY6A 1TIJA 3G4S3 3OXAA 3DY5A 2Y73A 3K63A 4BTXA 3FH1A 2BNGA 1VQ63 4O02B 3I563 3D9RA 1NU3A 2K54A 3FF0A 4U13A 1JV2B 2QIYA 1TU5A 3NM2A 2WO0A 3I0YA 3PS8A 3X3XA 1IT7A 2STDA 4H61A 1W01A 1MNLA 3LTCA 1AVLA 4MEIA 1GS3A 3JUMA 1QJGA 2W56B 3CCV3 1WMNA 3WOEB 2W9QA 1K41A 3CMA3 1VQO3 2RCDA 4ZM8A 1OF5B 2B24B 2OQEA 3MWZA 4PEJA 4NREA 1M1K4 3EF8A 3F8XA 3VSYA 1IVXA 5IERA 1OPYA 2XRXB 4HYZA 3F8HA 1IV7A 2CFKA 1OACA 1ROAA 4N6LA 3MSOA 3J7Yd 1VQL3 1QVF2 3FG3A 1NJI4 1O7WB 1ULIB 4EV5A 4KFFA 5A0OB 3LH4A 2M7OA 3S27A 1J2BA 1IQXA 3FF2A 3EBTA 3FCSB 3PYJA 3B4PA 2ZDJA 4HM0B 1AVKA 3DXOA 4R9LA 5CXOA 1LVNA 4GB5A 1RJOA 3MPHA 3X41A 3KE7A 1VQ93 2WOHA 4X2OA 3DM8A 1KSIA 3CCL3 4N6MA 2CWUA 4HM7B 1OHOA 1Y4KA 1IQYA 1RRLA 1O7GB 2CW9A 3QRDA 5AI1A 1A67A 2HMOB 3OX9A 5EVHA 4CDLA 1OHSA 4HM4B 3U1WA 3CCS3 3HZPA 3HK4A 4XDWA 4AKZA 4R80A 5IEOA 5AYSC 1Q814 3F7SA 5DRVA 3G0KA 1FA3A 2BO9B 3UL6A 4HBRA 1DMMA 5IW9A 3T0UA 7STDA 5KP4A 3K9MC 3BLZA 4XDVA 3SLUA 4IT7A 1N5HA 1YVBI 1PFPA 4WP5A 5LC6A 2CG1A 3CC23 3KSED 3N54B 4AKYA 5BXQA 2OCTA 3Q1CA 3BNEA 3ECFA 1O7MB 3T8NA 2P0XA 1W5ZA 1M904 1LNHA 1W02A 3DGOA 4HM8B 1MOLA 1EKMA 3JUOA 4K1UA 4KVHA 3GRDA 1UI8A 5AEWB 1JB2A 4G1MB 2BMOB 4N6NB 5AIFA 2BHMA 3VF1A 1LOXA 3WOFB 3X40A 3PGBA 1D6YA 2GXFA 4WHAA 3X3YA 5AEUB 3JUQA 1HU9A 2ML5A 4L8OA 1GY7A 3GWRA 1STDA 3UB1A 3KZTA 2QGUA 4EXRA 1SPUA 5DREA 1CEWI 4RNYA 1DVCA 1IVVA 4EYCA 3DGNA 4HM2B 4N6UA 3UJMA 2GBXB 3EN8A 3IPTA 4HZ9B 2BMRB 2FGTA 4STDA 4LSOA 1RN7A 1IVWA 3CC43 8CHOA 5BVBA 3CNXA 3FKAA 4FMDA 2PZVA 3HIIA 1OH0A 4N6TA 3S67A 3LXUX 5I97A 4FMCA 2MF7A 3FG4A 4N6OB 3F9SA 5AIHA 4MMZB 3AMOA 1YIJ3 1OGXA 1OGZA 1YIT3 2BT3A 4FMAA 1QAFA 2FNQA 1NDOB 2JQ5A 1ZO2A 4K61A 4O3VA 3DMCA 3HIGA 1STFI 3HX8A 4O8SA 1HKXA 1VQN3 1JKGA 1VQK3 3NV0A 3F40A 4JRFA 4HM1B 1A2VA 3ALAA 1FGMA 3BB9A 1VZZA 3JUPA 4H3UA 4WYKA 3FGYA 5EQLA 1NB3I 1US1A 2W56A 2XGNA 2E2UA 2F86B 3CNMA 1L5GB 1VQP3 1S5AA 4MMYB 3G8ZA 5JBSA 5FGOA 2OTL3 1R4CA 3V92A 4CCVA 5IENA 2INXA 3N9HA 4XM4A 1WQLB 2ZL8A 4K1VA 4ORLA 1GD3A 1TFOA 3DUKA 5IF6A 1OUNA 3T8UA 2CWVA 2D1WA 3WA3A 3I553 3K7CA 3D3LA 5KP1A 1W6GA 2Y74A 1YI23 2GEXA 3G713 3BNBA 5LC7A 3EN1B 1KD14 2XSHB 3A76A 2UX0A 1QALA 1M9GA 2WGQA 2XGLA 3VGNA 1JKGB 5D82A 3CD63 4J8TA 3UL5A 1DYUA 2V1LA 2P0MA 4FMBA 1NO3A 4OK0A 1FGTA 3V98A 1Q824 1YJ93 3PXMA 2I9WA 2W2CA 4HZBB 1VQ43 3OW22 3F7XA 2PNCA 2OOVA 1ZX2A 4WWUC 3B7CA 3GZYB 3KKGA 3LYGA 3DZLA 3CCJ3 2ML6A 3ROBA 1GD4A 3ER7A 3LT9A 2KRTA 3LMLA 1FGRA 3EHCA 2F98A 2W9PA 2YFJB 1IVUA 3OWUA 1QAKA 1GY5A 2GEYA 2W04A 3K0ZA 2XR8B 1UI7A 1JJ22 4R9KA 3NM7A 5AIIA 1EG9B 3MYTA 1F8NA 3CCM3 1WMPA 5TGNA 1IV9A 1Q40B 6STDA 1IU7A 3PCSA 1NWWA 3NX0A 3O8YA 1QVG2 3HI7A 1AV4A 1N5PA 1N9EA 3CPW2 4RNZA 1UUWB 2SBLA 1WTHA 4HVNA 3UNLA 4RZMA 4BTWA 2WGOA 3LTAA 1NB5I 2GU3A 1QMAA 2E2TA 2O3OA 1YHQ3 4AEQA 3MKIA 1EQKA 2W6JH 3CME3 1W6YA 3FSDA 3NBJA 2P38A 2Z76A 1DMNA 1FUWA 3LZAA 1N8QA 1ASKA 2CIUA 4KZ1A 2CG0A 2E2VA 2YFLB 4N3VA 1RKYA 1YJW3 3BNCA 2XFSA 3WA2X 5IG4A 4FCJA 1S723 4N6V0 1Q40A 1OCVA 1A2KA 3NQYA 2HMMB 1TFKA 3PZWA 4IPBA 2IA7A 3RGAA 1WMOA 1SQWA 3NQZA 1M1XB 3L0RA 2GBWB 3SOYA 1U5OA 3OWSA 5JPPA 3LT8A 3CPOA 5CLKA 2W03A 3IJEB 4MMXB 4Q53A 4QWTA 5CF2A 2OQEC 2XH9A 2K0MA 2YX9A 1W6CA 3KSPA 1E3VA 5G2GA 3WDGB 3NXJA 1E97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBY A;  1WQL B;  3FLJ A;  3MG3 A;  4L8P A;  5AEU B;  5JPU A;  4HM7 B;  1Q42 A;  4K1V A;  4ORL A;  1AR0 A;  1OHO A;  3DUK A;  2RFR A;  1SJW A;  3EQQ B;  1O7G B;  4HJL B;  5IEP A;  5IF6 A;  1OUN A;  3T8U A;  4XBT A;  5AI1 A;  3JUN A;  3K7C A;  4OUQ A;  1W00 A;  2HMO B;  3OX9 A;  5AIG A;  1OHS A;  5EVH A;  3OV4 A;  2GEX A;  3H51 A;  4CDL A;  1O7P B;  4HM4 B;  4LMI A;  1OHP A;  3EN1 B;  3SOA A;  1UUV B;  2CHC A;  1JB4 A;  2UX0 A;  2XSH B;  3A76 A;  3G16 A;  2BMQ B;  3HK4 A;  3HZP A;  4XDW A;  2IMJ A;  5IEO A;  3SED A;  2HMN B;  3VGN A;  5CF1 A;  1JKG B;  4L7K A;  5D82 A;  3F7S A;  3NV0 B;  3G0K A;  4OVM A;  5DRV A;  4J8T A;  2B1X B;  1O7H B;  3EJV A;  3NHX A;  4WYK B;  1EA2 A;  2CKF B;  1DMM A;  4HM3 B;  3OWY A;  1ULJ B;  7STD A;  5KP4 A;  2INX A;  4XM4 A;  4XDV A;  3BLZ A;  3Q90 A;  3MG2 A;  1JN5 A;  5KP1 A;  4WP5 A;  3FZW A;  2I9W A;  4LGQ A;  4HM6 B;  2W2C A;  4HZB B;  2HMK B;  5BXQ A;  1TUH A;  3F7X A;  1ZX2 A;  4WWU C;  3ECF A;  5D81 A;  1TP6 A;  1OF5 A;  3CU3 A;  3B7C A;  3GZY B;  3KKG A;  1O7M B;  2Z77 A;  3LYG A;  3DZL A;  3NUV A;  4HM5 B;  5STD A;  3S5C A;  4R1K A;  3ROB A;  3T8N A;  1Z1S A;  1W02 A;  2XSO B;  3ER7 A;  3NBR A;  4HM8 B;  5IG5 A;  3EHC A;  1BUQ A;  1IDP A;  1GY6 A;  2F98 A;  3JUO A;  3MHE A;  5KP3 A;  4K1U A;  4KVH A;  2YFJ B;  3GRD A;  1CQS A;  3OXA A;  1JB2 A;  5AEW B;  3M8C A;  3OWU A;  2BMO B;  5IG4 A;  5AIF A;  1O7N B;  3FH1 A;  2BNG A;  1GY5 A;  2GEY A;  5IER A;  3K0Z A;  2XR8 B;  1NU3 A;  2K54 A;  2GXF A;  3D9R A;  3FF0 A;  2QIY A;  3EC9 A;  4U13 A;  5HGR A;  3JUQ A;  4R9K A;  4L8O A;  1EG9 B;  5AII A;  1GY7 A;  3B4O A;  3GWR A;  1STD A;  4XBX A;  3MYT A;  3NM2 A;  3I0Y A;  3KZT A;  2STD A;  2QGU A;  5TGN A;  1W01 A;  1Q40 B;  1JN5 B;  5DRE A;  6STD A;  3MG1 A;  1GS3 A;  4FCM A;  3JUM A;  4IIA A;  4HM2 B;  3UJM A;  1NWW A;  2GBX B;  1QJG A;  3EN8 A;  3IPT A;  4HZ9 B;  2BMR B;  1K41 A;  4STD A;  2HML B;  5D83 A;  3STD A;  2RCD A;  1OF5 B;  4X2H A;  2B24 B;  4PEJ A;  8CHO A;  5BVB A;  3CNX A;  3EF8 A;  1UUW B;  3F8X A;  3FKA A;  2PZV A;  3E99 A;  3VSY A;  4I4K A;  1OPY A;  1OH0 A;  2XRX B;  4HVN A;  3UNL A;  4RZM A;  3RGR A;  5IG3 A;  1GYB A;  3F8H A;  1QMA A;  3WMD A;  4XBY A;  4J9A A;  3F9S A;  5AIH A;  4XB5 A;  3MSO A;  1OGX A;  4MJD A;  1JB5 A;  1OGZ A;  3MKI A;  1W6Y A;  3FSD A;  5FW5 A;  2Z76 A;  1DMN A;  1O7W B;  1ULI B;  3B8L A;  1NDO B;  3LZA A;  2JQ5 A;  4LEH A;  4HKV B;  1ISK A;  1ZO2 A;  3GZR A;  1ASK A;  3DMC A;  2YFL B;  3H3H A;  4N3V A;  1E3R A;  2Z7A A;  2F99 A;  2R4I A;  3GZX B;  3HX8 A;  4FCJ A;  1HKX A;  3EBT A;  3F14 A;  1JKG A;  3EX9 A;  1Q40 A;  3B4P A;  3FF2 A;  4HM0 B;  2HMJ B;  1OCV A;  1A2K A;  3F40 A;  3NV0 A;  3DXO A;  2HMM B;  4HM1 B;  3BB9 A;  1VZZ A;  3JUP A;  4H3U A;  2OWP A;  2YFI B;  3FGY A;  4R9L A;  4WYK A;  1DMQ A;  3RGA A;  5CXO A;  2GBW B;  3SOY A;  1U5O A;  3OWS A;  4GB5 A;  3GZB A;  5JPP A;  3CPO A;  5CLK A;  5IG0 A;  2F86 B;  3CNM A;  3KE7 A;  4Q53 A;  1S5A A;  3G8Z A;  5CF2 A;  1C7H A;  2A15 A;  3KSP A;  1E3V A;  4X2O A;  3DM8 A;  5G2G A;  5CK6 A;  3NXJ A;  5IEN A;  2RGQ A;  1E97 A; 
#chains in the Genus database with same CATH topology
 3EBY A;  3FLJ A;  3MG3 A;  1VQ7 3;  1W2B 2;  1YJN 3;  4TX4 A;  2CWT A;  1AR0 A;  3AMO B;  2RFR A;  1SJW A;  1RCL A;  1YVS A;  2FXT A;  2RBI A;  3EQQ B;  5IEP A;  2F56 A;  3CCQ 3;  1LQG C;  1K28 A;  1W00 A;  1ZS7 A;  4JF8 A;  2ZA4 A;  1OHP A;  2CHC A;  3G16 A;  1JB4 A;  1W4N A;  1T3B A;  2JDI H;  2BMQ B;  8RNT A;  1B3S A;  1W2Z A;  2XEP A;  3SED A;  2HMN B;  3WR2 A;  3BIR A;  4L7K A;  1T2H A;  2O9U X;  1PU4 A;  4LZI A;  1PYL A;  3DGY A;  3GAX A;  2B1X B;  1BNF A;  2L1S A;  3NHX A;  4KFE A;  2CKF B;  2J8X B;  3EE1 A;  4HM3 B;  1JZO A;  4WYK B;  1CYU A;  2CC3 A;  2Z6B A;  5ELU A;  3MG2 A;  3CCU 3;  1JN5 A;  1BAN A;  1HYF A;  1G0T A;  4LGQ A;  4HM6 B;  1I0X A;  4NPB A;  2P05 A;  3QK9 A;  3CCE 3;  1T5Y A;  1RLS A;  2C11 A;  2HMK B;  3CC7 3;  1X1W A;  1JRQ A;  2KXG A;  2MC8 A;  3CU3 A;  4FR9 A;  3NUV A;  3S29 A;  1N9J A;  1D6Z A;  3S5C A;  2K3D A;  3EB8 A;  2IUJ A;  1Z1S A;  2XSO B;  3LTB A;  4RBN A;  5IG5 A;  3X42 A;  1BNR A;  5KP3 A;  3MHE A;  5AYR B;  1GMP A;  2IUK A;  4KT3 B;  1B27 A;  1CQS A;  1RCK A;  1VQ5 3;  3M8C A;  1BOX A;  1TRQ A;  3PCR A;  1O7N B;  2XFT A;  2CH9 A;  1K8A 4;  1X1Y A;  3KN4 A;  3V99 A;  2CFL A;  3EC9 A;  5HGR A;  5M1A A;  3B4O A;  4XBX A;  3DGM A;  2WOF A;  4KFD A;  1UCL A;  2QA4 3;  1YGE A;  1I70 A;  7GSP A;  1BNE A;  3X3Z A;  1JN5 B;  1UW1 A;  3MG1 A;  2CFD A;  3TDG A;  4BTY A;  4O2H A;  4FCM A;  4IIA A;  3LOY A;  1RRH A;  3STD A;  1ROV A;  2RNT A;  5D83 A;  2QEX 3;  2HML B;  3JVC A;  3Q2P A;  1VQM 3;  4X2H A;  2LQV A;  1BNJ A;  1UCI A;  3E99 A;  2LYX A;  4I4K A;  1I2E A;  1KQS 2;  3RGR A;  5IG3 A;  1I3I A;  2XF3 A;  1GYB A;  3WMD A;  4XBY A;  4J9A A;  3KII A;  2P09 A;  1LXE A;  1K9M 4;  2CFW A;  2H0G A;  4XB5 A;  1WNH A;  4MJD A;  1JB5 A;  1I0V A;  4R4K A;  1UDI I;  1JNQ A;  5FW5 A;  1BRS A;  3B8L A;  3CXC 2;  3CCR 3;  2KCD A;  4LEH A;  1GOV A;  4HKV B;  3GZR A;  1YGW A;  3D5I A;  1IK3 A;  1Q86 4;  3H3H A;  1FW7 A;  1VQ8 3;  4WFO A;  3KFQ C;  1E3R A;  2Z7A A;  2F99 A;  2R4I A;  3GZX B;  1BSA A;  3DGL A;  1T2I A;  3EX9 A;  3F14 A;  1FGQ A;  3NBB A;  1V74 A;  2HMJ B;  1KC8 4;  1A2P A;  3RDE A;  1D6U A;  1Q9E A;  2OWP A;  2YFI B;  4GL6 A;  1DMQ A;  1PY3 A;  4K90 B;  1MGR A;  3IMA B;  4NHF A;  3SX1 A;  3GZB A;  5IG0 A;  1V57 A;  2Q07 A;  1A90 A;  1C7H A;  1U8C B;  1FUT A;  2A15 A;  1SII A;  1TTO A;  2L4V A;  5CK6 A;  1K73 4;  2GU1 A;  2RGQ A;  1Q7Y 4;  3N8B A;  2D42 A;  4L8P A;  3S28 A;  5JPU A;  4FCZ A;  2W0Q A;  1Q42 A;  2OOV C;  3WHO A;  1FYS A;  4HJL B;  3SXX A;  3SVA A;  3LTD A;  4XBT A;  2C4B A;  5ELJ A;  3JUN A;  4GSP A;  3D5G A;  4OUQ A;  5AIG A;  1FGO A;  1BRJ A;  3OV4 A;  1DVD A;  3BND A;  3H51 A;  1O7P B;  4LMI A;  4EW5 A;  1JBT A;  3SOA A;  1UUV B;  1G96 A;  2IMJ A;  5CF1 A;  1IT8 A;  2C10 A;  3NV0 B;  4OVM A;  3ZG5 A;  3EJV A;  1O7H B;  1W7C A;  1EA2 A;  5EEO A;  2CX1 A;  3WOD G;  2RSX A;  3BU4 A;  1GMR A;  1ULJ B;  2CFG A;  3OWY A;  3U97 A;  4EBG A;  3Q90 A;  4EV2 A;  1KWI A;  3FZW A;  4EC6 A;  1N8R 4;  1SIH A;  2CK3 H;  1TUH A;  1IQ8 A;  5D81 A;  1TP6 A;  1OF5 A;  2F5M A;  4HM5 B;  1ISK A;  2Z77 A;  3FG1 A;  5STD A;  3K5T A;  4R1K A;  3NBR A;  3G6E 3;  1VQQ A;  2OTJ 3;  1BUQ A;  1CYV A;  1IDP A;  1GY6 A;  1TIJ A;  3G4S 3;  3OXA A;  3DY5 A;  2Y73 A;  4BU4 A;  3K63 A;  4BTX A;  3FH1 A;  2BNG A;  3URP A;  2KF6 A;  1VQ6 3;  4O02 B;  3I56 3;  1RGC A;  3D9R A;  1NU3 A;  2K54 A;  3FF0 A;  4U13 A;  1JV2 B;  2QIY A;  1LRA A;  1TU5 A;  1BNS A;  3NM2 A;  2WO0 A;  1IYY A;  3I0Y A;  3PS8 A;  4LYL B;  3X3X A;  1IT7 A;  2STD A;  4H61 A;  1W01 A;  1UCK A;  1UCJ A;  1MNL A;  3LTC A;  5M19 A;  1AVL A;  4MEI A;  1GS3 A;  4DKI A;  3JUM A;  1QJG A;  2W56 B;  3CCV 3;  1WMN A;  2F4Y A;  1K41 A;  2W9Q A;  3WOE B;  3CMA 3;  1VQO 3;  2RCD A;  3Q3F A;  4ZM8 A;  2AAD A;  1OF5 B;  2B24 B;  2OQE A;  3MWZ A;  1B20 A;  1X1X A;  4NRE A;  3EF8 A;  4PEJ A;  3F8X A;  1M1K 4;  1CH0 A;  3VSY A;  1IVX A;  5IER A;  1OPY A;  2XRX B;  4HYZ A;  1R4Y A;  1IV7 A;  3F8H A;  4HAA A;  2CFK A;  2F5W A;  3GSP A;  3HOH A;  1BIR A;  1OAC A;  1ROA A;  4N6L A;  3MSO A;  3J7Y d;  1VQL 3;  1QVF 2;  1BU4 A;  1RGA A;  3FG3 A;  1NJI 4;  1O7W B;  1ULI B;  4EV5 A;  1BRG A;  4KFF A;  5BIR A;  1C54 A;  1B2S A;  1RGG A;  5A0O B;  3LH4 A;  2M7O A;  3S27 A;  1J2B A;  1IQX A;  3AHS A;  3FF2 A;  3EBT A;  3FCS B;  3PYJ A;  3B4P A;  2ZDJ A;  1FUS A;  1AVK A;  4HM0 B;  5HOH A;  1EEJ A;  3DXO A;  5G1K A;  1BSD A;  4R9L A;  2IY2 A;  5CXO A;  1LVN A;  4GB5 A;  1RJO A;  3MPH A;  3X41 A;  3KE7 A;  3D4A A;  3KCH A;  3AGO A;  1VQ9 3;  2WOH A;  1RHL A;  1V58 A;  4X2O A;  3DM8 A;  1Q7H A;  1KSI A;  1JZD A;  3CCL 3;  4N6M A;  2CWU A;  4HM7 B;  1OHO A;  1Y4K A;  1IQY A;  1RRL A;  2CX0 A;  1O7G B;  2CW9 A;  3QRD A;  1ZGX A;  5AI1 A;  1A67 A;  6RNT A;  2HMO B;  3OX9 A;  5EVH A;  4CDL A;  1OHS A;  2HOH A;  4HM4 B;  3U1W A;  3CCS 3;  2KF3 A;  1GSP A;  3HZP A;  3HK4 A;  4XDW A;  4AKZ A;  4R80 A;  2KAA A;  5IEO A;  5AYS C;  1Q81 4;  1BSC A;  3F7S A;  3G0K A;  5DRV A;  1FA3 A;  2BO9 B;  3UL6 A;  7RNT A;  4HBR A;  1DMM A;  5IW9 A;  3T0U A;  7STD A;  5KP4 A;  3K9M C;  3BLZ A;  4XDV A;  3SLU A;  3A5E A;  1N5H A;  1YVB I;  1PFP A;  4IT7 A;  4WP5 A;  5LC6 A;  2CG1 A;  6GSP A;  3CC2 3;  3KSE D;  4ILF A;  3N54 B;  4AKY A;  5BXQ A;  2OCT A;  5G1L A;  3Q1C A;  3ZFZ A;  3BNE A;  3ECF A;  3D79 A;  5GSP A;  3AHW A;  1BNG A;  1O7M B;  2P0X A;  3T8N A;  1W5Z A;  1M90 4;  1LNH A;  1W02 A;  3DGO A;  4HM8 B;  1MOL A;  1EKM A;  3JUO A;  1EUI C;  1FZU A;  4K1U A;  4KVH A;  1GMQ A;  3GRD A;  1UI8 A;  2UUG C;  1JB2 A;  3ZG0 A;  5AEW B;  4G1M B;  2BMO B;  4N6N B;  5AIF A;  2BHM A;  3VF1 A;  1LOX A;  3WOF B;  3X40 A;  3PGB A;  1B2U A;  1D6Y A;  2GXF A;  4WHA A;  3X3Y A;  2UGI A;  5AEU B;  1RGE A;  3JUQ A;  1HU9 A;  2ML5 A;  4L8O A;  1GY7 A;  3GWR A;  1STD A;  3UB1 A;  1B2X A;  3KZT A;  4CPK A;  2QGU A;  4EXR A;  1SPU A;  5DRE A;  1CEW I;  1MGW A;  4RNY A;  1DVC A;  4GHO A;  1LOV A;  1IVV A;  4EYC A;  3DGN A;  4HM2 B;  4N6U A;  3UJM A;  2GBX B;  3EN8 A;  3IPT A;  4HZ9 B;  2BMR B;  2FGT A;  4STD A;  4LSO A;  5RNT A;  1RN7 A;  1IVW A;  3CC4 3;  8CHO A;  5BVB A;  1TRP A;  3CNX A;  2ZHX B;  3FKA A;  4FMD A;  2PZV A;  3HII A;  1OH0 A;  2BIR A;  4N6T A;  3LXU X;  3S67 A;  5I97 A;  4FMC A;  2MF7 A;  3FG4 A;  4N6O B;  2KF5 A;  3F9S A;  5AIH A;  4MMZ B;  3AMO A;  1RTU A;  4BIR A;  1YIJ 3;  1OGX A;  1BRK A;  1OGZ A;  2AAE A;  1YIT 3;  2BT3 A;  4FMA A;  1QAF A;  2FNQ A;  1NDO B;  2JQ5 A;  1AY7 A;  2KF4 A;  1ZO2 A;  4K61 A;  4O3V A;  3DMC A;  1JBS A;  3HIG A;  1STF I;  1UGH I;  3DH2 A;  3HX8 A;  4O8S A;  1LOW A;  1HKX A;  4J5G A;  1JKG A;  3RNT A;  1VQK 3;  1VQN 3;  3NV0 A;  3F40 A;  1NNV A;  4JRF A;  4HM1 B;  1A2V A;  1FGM A;  3ALA A;  3BB9 A;  1VZZ A;  3JUP A;  4H3U A;  4WYK A;  3FGY A;  5EQL A;  1BNI A;  1NB3 I;  1US1 A;  2W56 A;  2XGN A;  1LNI A;  2E2U A;  2F86 B;  3CNM A;  1L5G B;  1VQP 3;  1S5A A;  4MMY B;  3G8Z A;  5JBS A;  5FGO A;  2OTL 3;  1R4C A;  1RGF A;  3V92 A;  4CCV A;  1GOU A;  5IEN A;  2INX A;  3N9H A;  4XM4 A;  1WQL B;  2ZL8 A;  4K1V A;  4ORL A;  1B2Z A;  1GD3 A;  1TFO A;  3DUK A;  5IF6 A;  1BSE A;  1OUN A;  3T8U A;  1RNT A;  2CWV A;  2D1W A;  3WA3 A;  1B21 A;  3K7C A;  3I55 3;  3D3L A;  5KP1 A;  1W6G A;  2Y74 A;  1YI2 3;  2GEX A;  1DE3 A;  3G71 3;  3BNB A;  5LC7 A;  3SYU A;  2H0H A;  3EN1 B;  2BU4 A;  1KD1 4;  2XSH B;  1MWT A;  2UX0 A;  3A76 A;  1QAL A;  4I5Q A;  1M9G A;  1BGS A;  2WGQ A;  2XGL A;  1RN1 A;  3VGN A;  1MWR A;  1JKG B;  5D82 A;  3CD6 3;  4J8T A;  2SAR A;  3UL5 A;  1DYU A;  2V1L A;  2P0M A;  1AQZ A;  4FMB A;  1NO3 A;  1RGH A;  4OK0 A;  1LOY A;  1FGT A;  1BAO A;  1BRH A;  3V98 A;  1Q82 4;  1YJ9 3;  3PXM A;  2I9W A;  4CJN A;  2W2C A;  4HZB B;  1VQ4 3;  4HOH A;  3OW2 2;  3F7X A;  2PNC A;  2OOV A;  1ZX2 A;  4WWU C;  3B7C A;  3GZY B;  1RDS A;  3KKG A;  3LYG A;  4BL3 A;  3DZL A;  1B2M A;  3CCJ 3;  2ML6 A;  3ROB A;  1GD4 A;  2IYJ A;  3ER7 A;  3LT9 A;  2KRT A;  3LML A;  1FGR A;  3EHC A;  5BU4 A;  2F98 A;  2W9P A;  2YFJ B;  1IVU A;  3OWU A;  1QAK A;  1GY5 A;  2GEY A;  2W04 A;  1TJD A;  2H0I A;  3K0Z A;  1BRN L;  2XR8 B;  1MWS A;  1UI7 A;  4RNT A;  1JJ2 2;  4R9K A;  1UGI A;  3NM7 A;  1EG9 B;  5AII A;  3MYT A;  1F8N A;  3CCM 3;  1WMP A;  2R41 A;  1RMS A;  5TGN A;  1IV9 A;  1Q40 B;  1I8V A;  1SAR A;  1YNV X;  6STD A;  1IU7 A;  3PCS A;  9RNT A;  1NWW A;  3NX0 A;  3O8Y A;  1QVG 2;  3HI7 A;  1I3F A;  1AV4 A;  1N5P A;  1N9E A;  3CPW 2;  1I2F A;  4RNZ A;  1UUW B;  2SBL A;  1BRI A;  1I2G A;  1WTH A;  4HVN A;  3UNL A;  4RZM A;  4BTW A;  2WGO A;  3LTA A;  1NB5 I;  2GU3 A;  1QMA A;  2E2T A;  5M18 A;  2O3O A;  1X1U A;  1BVI A;  1YHQ 3;  4AEQ A;  1RNB A;  3MKI A;  2GSP A;  1EQK A;  2W6J H;  3CME 3;  1RGL A;  1W6Y A;  3FSD A;  3NBJ A;  3AGN A;  2P38 A;  2Z76 A;  1DMN A;  1DET A;  4J5K A;  1FUW A;  4BL2 A;  3LZA A;  1LQM B;  1N8Q A;  1ASK A;  2CIU A;  4KZ1 A;  2CG0 A;  2E2V A;  2YFL B;  4N3V A;  1UUG B;  1RKY A;  1MWU A;  1RGK A;  1YJW 3;  3BNC A;  2XFS A;  3WA2 X;  5IG4 A;  4FCJ A;  1BSB A;  1S72 3;  1JBR A;  4N6V 0;  1Q40 A;  1OCV A;  1A2K A;  3NQY A;  2HMM B;  1TFK A;  3PZW A;  4IPB A;  2IA7 A;  3RGA A;  1WMO A;  1SQW A;  3NQZ A;  1BUJ A;  1M1X B;  3L0R A;  2GBW B;  3SOY A;  1U5O A;  1GOY A;  3OWS A;  3LT8 A;  1HZ1 A;  3CPO A;  5CLK A;  2W03 A;  5JPP A;  3IJE B;  4MMX B;  4Q53 A;  4QWT A;  5CF2 A;  2OQE C;  1RSN A;  2XH9 A;  2K0M A;  2YX9 A;  1RN4 A;  1W6C A;  1G02 A;  1E3V A;  3KSP A;  5G2G A;  3WDG B;  3NXJ A;  1E97 A; 
#chains in the Genus database with same CATH homology
 3EBY A;  3FLJ A;  3MG3 A;  1VQ7 3;  1W2B 2;  1YJN 3;  4TX4 A;  2CWT A;  1AR0 A;  3AMO B;  2RFR A;  1SJW A;  3EQQ B;  5IEP A;  2FXT A;  3CCQ 3;  1K28 A;  1W00 A;  4JF8 A;  1OHP A;  2CHC A;  3G16 A;  1JB4 A;  1W4N A;  2JDI H;  2BMQ B;  3SED A;  1W2Z A;  2XEP A;  2HMN B;  4L7K A;  2O9U X;  1PU4 A;  4LZI A;  3GAX A;  4KFE A;  2B1X B;  3NHX A;  4WYK B;  3EE1 A;  2CKF B;  4HM3 B;  1CYU A;  2CC3 A;  2Z6B A;  5ELU A;  3MG2 A;  3CCU 3;  1JN5 A;  4LGQ A;  4HM6 B;  3CCE 3;  2P05 A;  3QK9 A;  1T5Y A;  2HMK B;  2C11 A;  3CC7 3;  1JRQ A;  2KXG A;  2MC8 A;  3CU3 A;  4FR9 A;  3NUV A;  3S29 A;  1N9J A;  1D6Z A;  3S5C A;  3EB8 A;  2IUJ A;  1Z1S A;  2XSO B;  3LTB A;  4RBN A;  5IG5 A;  3X42 A;  5KP3 A;  3MHE A;  5AYR B;  2IUK A;  1CQS A;  1VQ5 3;  3M8C A;  3PCR A;  1O7N B;  2XFT A;  2CH9 A;  1K8A 4;  3KN4 A;  3V99 A;  2CFL A;  3EC9 A;  5HGR A;  3B4O A;  4XBX A;  3DGM A;  2WOF A;  4KFD A;  2QA4 3;  1YGE A;  3X3Z A;  1JN5 B;  1UW1 A;  3MG1 A;  2CFD A;  3TDG A;  4BTY A;  4O2H A;  4FCM A;  4IIA A;  3LOY A;  1RRH A;  3STD A;  1ROV A;  5D83 A;  2QEX 3;  1VQM 3;  2HML B;  3JVC A;  3Q2P A;  4X2H A;  2LQV A;  3E99 A;  2LYX A;  4I4K A;  1KQS 2;  3RGR A;  5IG3 A;  2XF3 A;  1GYB A;  3WMD A;  4XBY A;  4J9A A;  3KII A;  2P09 A;  1LXE A;  1K9M 4;  2CFW A;  4XB5 A;  1WNH A;  4MJD A;  1JB5 A;  4R4K A;  1JNQ A;  5FW5 A;  3B8L A;  3CXC 2;  3CCR 3;  2KCD A;  4LEH A;  4HKV B;  3GZR A;  1IK3 A;  1Q86 4;  3H3H A;  1VQ8 3;  4WFO A;  3KFQ C;  1E3R A;  2Z7A A;  2F99 A;  2R4I A;  3GZX B;  3F14 A;  3DGL A;  3NBB A;  3EX9 A;  1FGQ A;  1V74 A;  2HMJ B;  1KC8 4;  3RDE A;  1D6U A;  2OWP A;  2YFI B;  4GL6 A;  1DMQ A;  4K90 B;  4NHF A;  3SX1 A;  3IMA B;  3GZB A;  5IG0 A;  2Q07 A;  1A90 A;  1C7H A;  1U8C B;  2A15 A;  1SII A;  2L4V A;  5CK6 A;  1K73 4;  2RGQ A;  2GU1 A;  1Q7Y 4;  3N8B A;  2D42 A;  4L8P A;  3S28 A;  5JPU A;  4FCZ A;  2W0Q A;  1Q42 A;  2OOV C;  4HJL B;  3SXX A;  3SVA A;  3LTD A;  4XBT A;  5ELJ A;  3JUN A;  4OUQ A;  5AIG A;  1FGO A;  1DVD A;  3OV4 A;  3BND A;  3H51 A;  1O7P B;  4LMI A;  3SOA A;  1UUV B;  1G96 A;  2IMJ A;  5CF1 A;  1IT8 A;  2C10 A;  3NV0 B;  4OVM A;  3EJV A;  1O7H B;  1W7C A;  1EA2 A;  5EEO A;  3WOD G;  2RSX A;  3OWY A;  4EBG A;  1ULJ B;  2CFG A;  3U97 A;  3Q90 A;  4EV2 A;  1KWI A;  3FZW A;  4EC6 A;  1N8R 4;  1SIH A;  2CK3 H;  1TUH A;  1IQ8 A;  5D81 A;  1TP6 A;  1OF5 A;  1ISK A;  4HM5 B;  2Z77 A;  3FG1 A;  5STD A;  3K5T A;  4R1K A;  3NBR A;  3G6E 3;  2OTJ 3;  1BUQ A;  1CYV A;  1IDP A;  1GY6 A;  1TIJ A;  3G4S 3;  3OXA A;  3DY5 A;  2Y73 A;  3K63 A;  4BTX A;  3FH1 A;  2BNG A;  1VQ6 3;  4O02 B;  3I56 3;  3D9R A;  1NU3 A;  2K54 A;  3FF0 A;  4U13 A;  1JV2 B;  2QIY A;  1TU5 A;  3NM2 A;  2WO0 A;  3I0Y A;  3PS8 A;  3X3X A;  1IT7 A;  2STD A;  4H61 A;  1W01 A;  1MNL A;  3LTC A;  1AVL A;  4MEI A;  1GS3 A;  3JUM A;  1QJG A;  2W56 B;  3CCV 3;  1WMN A;  3WOE B;  2W9Q A;  1K41 A;  3CMA 3;  1VQO 3;  2RCD A;  4ZM8 A;  1OF5 B;  2B24 B;  2OQE A;  3MWZ A;  4PEJ A;  4NRE A;  1M1K 4;  3EF8 A;  3F8X A;  3VSY A;  1IVX A;  5IER A;  1OPY A;  2XRX B;  4HYZ A;  3F8H A;  1IV7 A;  2CFK A;  1OAC A;  1ROA A;  4N6L A;  3MSO A;  3J7Y d;  1VQL 3;  1QVF 2;  3FG3 A;  1NJI 4;  1O7W B;  1ULI B;  4EV5 A;  4KFF A;  5A0O B;  3LH4 A;  2M7O A;  3S27 A;  1J2B A;  1IQX A;  3FF2 A;  3EBT A;  3FCS B;  3PYJ A;  3B4P A;  2ZDJ A;  4HM0 B;  1AVK A;  3DXO A;  4R9L A;  5CXO A;  1LVN A;  4GB5 A;  1RJO A;  3MPH A;  3X41 A;  3KE7 A;  1VQ9 3;  2WOH A;  4X2O A;  3DM8 A;  1KSI A;  3CCL 3;  4N6M A;  2CWU A;  4HM7 B;  1OHO A;  1Y4K A;  1IQY A;  1RRL A;  1O7G B;  2CW9 A;  3QRD A;  5AI1 A;  1A67 A;  2HMO B;  3OX9 A;  5EVH A;  4CDL A;  1OHS A;  4HM4 B;  3U1W A;  3CCS 3;  3HZP A;  3HK4 A;  4XDW A;  4AKZ A;  4R80 A;  5IEO A;  5AYS C;  1Q81 4;  3F7S A;  5DRV A;  3G0K A;  1FA3 A;  2BO9 B;  3UL6 A;  4HBR A;  1DMM A;  5IW9 A;  3T0U A;  7STD A;  5KP4 A;  3K9M C;  3BLZ A;  4XDV A;  3SLU A;  4IT7 A;  1N5H A;  1YVB I;  1PFP A;  4WP5 A;  5LC6 A;  2CG1 A;  3CC2 3;  3KSE D;  3N54 B;  4AKY A;  5BXQ A;  2OCT A;  3Q1C A;  3BNE A;  3ECF A;  1O7M B;  3T8N A;  2P0X A;  1W5Z A;  1M90 4;  1LNH A;  1W02 A;  3DGO A;  4HM8 B;  1MOL A;  1EKM A;  3JUO A;  4K1U A;  4KVH A;  3GRD A;  1UI8 A;  5AEW B;  1JB2 A;  4G1M B;  2BMO B;  4N6N B;  5AIF A;  2BHM A;  3VF1 A;  1LOX A;  3WOF B;  3X40 A;  3PGB A;  1D6Y A;  2GXF A;  4WHA A;  3X3Y A;  5AEU B;  3JUQ A;  1HU9 A;  2ML5 A;  4L8O A;  1GY7 A;  3GWR A;  1STD A;  3UB1 A;  3KZT A;  2QGU A;  4EXR A;  1SPU A;  5DRE A;  1CEW I;  4RNY A;  1DVC A;  1IVV A;  4EYC A;  3DGN A;  4HM2 B;  4N6U A;  3UJM A;  2GBX B;  3EN8 A;  3IPT A;  4HZ9 B;  2BMR B;  2FGT A;  4STD A;  4LSO A;  1RN7 A;  1IVW A;  3CC4 3;  8CHO A;  5BVB A;  3CNX A;  3FKA A;  4FMD A;  2PZV A;  3HII A;  1OH0 A;  4N6T A;  3S67 A;  3LXU X;  5I97 A;  4FMC A;  2MF7 A;  3FG4 A;  4N6O B;  3F9S A;  5AIH A;  4MMZ B;  3AMO A;  1YIJ 3;  1OGX A;  1OGZ A;  1YIT 3;  2BT3 A;  4FMA A;  1QAF A;  2FNQ A;  1NDO B;  2JQ5 A;  1ZO2 A;  4K61 A;  4O3V A;  3DMC A;  3HIG A;  1STF I;  3HX8 A;  4O8S A;  1HKX A;  1VQN 3;  1JKG A;  1VQK 3;  3NV0 A;  3F40 A;  4JRF A;  4HM1 B;  1A2V A;  3ALA A;  1FGM A;  3BB9 A;  1VZZ A;  3JUP A;  4H3U A;  4WYK A;  3FGY A;  5EQL A;  1NB3 I;  1US1 A;  2W56 A;  2XGN A;  2E2U A;  2F86 B;  3CNM A;  1L5G B;  1VQP 3;  1S5A A;  4MMY B;  3G8Z A;  5JBS A;  5FGO A;  2OTL 3;  1R4C A;  3V92 A;  4CCV A;  5IEN A;  2INX A;  3N9H A;  4XM4 A;  1WQL B;  2ZL8 A;  4K1V A;  4ORL A;  1GD3 A;  1TFO A;  3DUK A;  5IF6 A;  1OUN A;  3T8U A;  2CWV A;  2D1W A;  3WA3 A;  3I55 3;  3K7C A;  3D3L A;  5KP1 A;  1W6G A;  2Y74 A;  1YI2 3;  2GEX A;  3G71 3;  3BNB A;  5LC7 A;  3EN1 B;  1KD1 4;  2XSH B;  3A76 A;  2UX0 A;  1QAL A;  1M9G A;  2WGQ A;  2XGL A;  3VGN A;  1JKG B;  5D82 A;  3CD6 3;  4J8T A;  3UL5 A;  1DYU A;  2V1L A;  2P0M A;  4FMB A;  1NO3 A;  4OK0 A;  1FGT A;  3V98 A;  1Q82 4;  1YJ9 3;  3PXM A;  2I9W A;  2W2C A;  4HZB B;  1VQ4 3;  3OW2 2;  3F7X A;  2PNC A;  2OOV A;  1ZX2 A;  4WWU C;  3B7C A;  3GZY B;  3KKG A;  3LYG A;  3DZL A;  3CCJ 3;  2ML6 A;  3ROB A;  1GD4 A;  3ER7 A;  3LT9 A;  2KRT A;  3LML A;  1FGR A;  3EHC A;  2F98 A;  2W9P A;  2YFJ B;  1IVU A;  3OWU A;  1QAK A;  1GY5 A;  2GEY A;  2W04 A;  3K0Z A;  2XR8 B;  1UI7 A;  1JJ2 2;  4R9K A;  3NM7 A;  5AII A;  1EG9 B;  3MYT A;  1F8N A;  3CCM 3;  1WMP A;  5TGN A;  1IV9 A;  1Q40 B;  6STD A;  1IU7 A;  3PCS A;  1NWW A;  3NX0 A;  3O8Y A;  1QVG 2;  3HI7 A;  1AV4 A;  1N5P A;  1N9E A;  3CPW 2;  4RNZ A;  1UUW B;  2SBL A;  1WTH A;  4HVN A;  3UNL A;  4RZM A;  4BTW A;  2WGO A;  3LTA A;  1NB5 I;  2GU3 A;  1QMA A;  2E2T A;  2O3O A;  1YHQ 3;  4AEQ A;  3MKI A;  1EQK A;  2W6J H;  3CME 3;  1W6Y A;  3FSD A;  3NBJ A;  2P38 A;  2Z76 A;  1DMN A;  1FUW A;  3LZA A;  1N8Q A;  1ASK A;  2CIU A;  4KZ1 A;  2CG0 A;  2E2V A;  2YFL B;  4N3V A;  1RKY A;  1YJW 3;  3BNC A;  2XFS A;  3WA2 X;  5IG4 A;  4FCJ A;  1S72 3;  4N6V 0;  1Q40 A;  1OCV A;  1A2K A;  3NQY A;  2HMM B;  1TFK A;  3PZW A;  4IPB A;  2IA7 A;  3RGA A;  1WMO A;  1SQW A;  3NQZ A;  1M1X B;  3L0R A;  2GBW B;  3SOY A;  1U5O A;  3OWS A;  5JPP A;  3LT8 A;  3CPO A;  5CLK A;  2W03 A;  3IJE B;  4MMX B;  4Q53 A;  4QWT A;  5CF2 A;  2OQE C;  2XH9 A;  2K0M A;  2YX9 A;  1W6C A;  3KSP A;  1E3V A;  5G2G A;  3WDG B;  3NXJ A;  1E97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...