5D81A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y57(cl-y)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
126
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Proton Delocalization in an Enzyme's Hydrogen Bond Network with Unnatural Amino Acids.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Delta(5)-3-ketosteroid isomerase
total genus 30
structure length 126
sequence length 127
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2015-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5d81A00
2A15A 4HZBB 4HM4B 1OF5A 2BMRB 1GYBA 2HMLB 5DRVA 5KP4A 4R9LA 3CNMA 1K41A 1O7HB 2HMMB 3EBTA 4FCJA 5AIHA 3VSYA 3I0YA 4J8TA 3SOYA 2INXA 2RCDA 5IG5A 1S5AA 1DMMA 1ULIB 1AR0A 3MG1A 3GZBA 5IENA 1HKXA 1Q40A 1U5OA 3JUNA 3NV0B 3EX9A 1O7MB 2RGQA 1STDA 4LEHA 4STDA 4CDLA 3FF2A 5AIIA 3RGRA 2W2CA 2XRXB 1GY6A 4H3UA 1OGZA 4XBXA 4HM2B 3OV4A 4HM6B 5G2GA 5IEOA 2STDA 4XM4A 1JKGA 1GS3A 3UNLA 1ULJB 3OXAA 2BMQB 2IMJA 3D9RA 2OWPA 4R1KA 4HM1B 3FGYA 5IF6A 1E3RA 2YFJB 5D81A 3F14A 4HM8B 3EF8A 3EQQB 4R9KA 3EN1B 5FW5A 1OPYA 3G16A 3KKGA 3BB9A 3DUKA 5JPUA 1E3VA 1GY5A 1UUVB 3EC9A 1OHOA 1NDOB 2GEXA 3HK4A 2GBWB 3F9SA 1Q42A 3CU3A 3HZPA 1DMQA 1Q40B 3LZAA 3OX9A 1IDPA 3H3HA 3NV0A 3HX8A 3Q90A 4HZ9B 2HMJB 3FH1A 1UUWB 3GZYB 2F86B 5AEWB 2CKFB 5TGNA 3G8ZA 5AIFA 1JB4A 4WWUC 3KSPA 3E99A 4IIAA 2B1XB 3MYTA 1Z1SA 5IERA 1NU3A 1O7NB 3GWRA 2GBXB 3G0KA 3GZXB 3MG2A 1EG9B 3F7SA 1CQSA 3FLJA 5AIGA 2Z76A 4HM5B 3EN8A 1W00A 5AI1A 1WQLB 3JUPA 3WMDA 1JKGB 4OUQA 4N3VA 3JUOA 4HVNA 5EVHA 1W6YA 4L8PA 2Z77A 1TP6A 1JB5A 2YFLB 3DZLA 3FSDA 3K0ZA 4K1UA 4L7KA 4ORLA 4U13A 4XB5A 4K1VA 5AEUB 2Z7AA 2XSHB 3JUMA 3K7CA 3H51A 5KP3A 3CNXA 1JN5A 1TUHA 3FKAA 1O7GB 1O7WB 3F8XA 3NUVA 4LMIA 5CXOA 5D82A 2YFIB 3B7CA 3ROBA 3S5CA 4LGQA 3DM8A 3MSOA 4XBTA 3B8LA 3KZTA 2BNGA 2GEYA 3FF0A 4KVHA 3EHCA 4GB5A 4XBYA 3T8UA 3OWSA 4HJLB 8CHOA 4WYKB 1EA2A 4XDVA 2GXFA 2F98A 3B4PA 4HM3B 4WP5A 1OHPA 4OVMA 5BXQA 3MHEA 5CK6A 5IG3A 3B4OA 5IG0A 1JB2A 1ZO2A 1ZX2A 1W01A 2XR8B 3DXOA 4HM7B 1ISKA 1ASKA 1O7PB 3GRDA 3OWUA 2QGUA 4PEJA 3KE7A 3MG3A 3CPOA 1OCVA 2K54A 5KP1A 3EJVA 3M8CA 4X2OA 3OWYA 3BLZA 3T8NA 1QJGA 3MKIA 5STDA 2RFRA 1GY7A 3F40A 3JUQA 1OHSA 2F99A 3F8HA 3UJMA 5CF1A 4J9AA 2JQ5A 4HM0B 3SEDA 1OF5B 2QIYA 1DMNA 4RZMA 4X2HA 5BVBA 3NM2A 2UX0A 3DMCA 2XSOB 4WYKA 3STDA 5CLKA 4I4KA 3RGAA 3F7XA 5D83A 1QMAA 1JN5B 1OUNA 2R4IA 2B24B 3NXJA 3NBRA 2HMNB 2HMOB 4L8OA 4HKVB 5DREA 5IG4A 1SJWA 5CF2A 5IEPA 2PZVA 1A2KA 1C7HA 2I9WA 1W02A 4MJDA 7STDA 5JPPA 1BUQA 1E97A 4FCMA 2CHCA 2BMOB 3ECFA 3FZWA 3IPTA 4Q53A 4XDWA 5HGRA 3ER7A 1OGXA 3NHXA 3A76A 3LYGA 3SOAA 3EBYA 1NWWA 2HMKB 1OH0A 3GZRA 6STDA 3VGNA 1VZZA
chains in the Genus database with same CATH superfamily
2A15A 3PXMA 2IA7A 2CK3H 3LT8A 3PYJA 1K41A 2HMMB 2HOHA 3AHWA 1ZGXA 1SIHA 3EBTA 4FMAA 3I0YA 3AMOA 1FUTA 1ULIB 2F4YA 1AR0A 1W5ZA 2OCTA 3FG1A 3GZBA 3Q2PA 1HKXA 1Q40A 2WOFA 3JUNA 1D6UA 4FMBA 1N5PA 5JBSA 1YIJ3 1O7MB 2RGQA 4CDLA 5I97A 3FF2A 3UL5A 2XRXB 3SVAA 4N6TA 4HM2B 3OV4A 4HM6B 1DYUA 1JV2B 1W2ZA 1JKGA 1GS3A 2IY2A 2Y73A 3UNLA 3OXAA 3CCM3 3T0UA 4HM1B 3FGYA 2ZHXB 2H0IA 4I5QA 3SXXA 4AEQA 1E3RA 3IMAB 1VQ93 4N6UA 2M7OA 3EF8A 1G0TA 4R9KA 3CCS3 3KKGA 5BIRA 3V92A 1VQ53 1G96A 2E2UA 3EC9A 1OHOA 3TDGA 3HK4A 2GBWB 5M19A 1SQWA 1IYYA 1Q40B 3K63A 2XFTA 3NV0A 1GMRA 1WNHA 2W04A 3HX8A 1SIIA 2UUGC 1GOYA 4N6OB 1PU4A 1FGQA 3SYUA 1NB3I 1VQO3 2E2TA 3G8ZA 3WDGB 4TX4A 1RCKA 3MYTA 5LC6A 1K734 1J2BA 1BVIA 1NU3A 2L1SA 2P09A 1RGEA 3GWRA 3GZXB 4DKIA 1FW7A 1EG9B 3F7SA 1CQSA 3FG4A 5EQLA 2WGQA 1R4YA 2Z76A 1UI8A 2W0QA 3EN8A 4R4KA 1WQLB 1MWRA 3JUOA 4HVNA 4MMYB 3U97A 1IVXA 2P0MA 2CIUA 1SARA 2YFLB 1BRNL 3K0ZA 4LSOA 2OQEC 4KFEA 1VQM3 1FYSA 1MWUA 2Z7AA 2XSHB 3K7CA 1RN7A 1JN5A 1O7GB 2CWTA 3F8XA 1FGOA 1T2HA 3S5CA 3D5IA 4OK0A 1JBTA 3KZTA 5AYRB 2CFDA 7RNTA 4H61A 4N6NB 2LYXA 3OWSA 1CYVA 1YJ93 1GMQA 1EA2A 1TRQA 3Q1CA 2ML6A 4HBRA 3URPA 1NB5I 2RNTA 1B27A 2CFWA 1UW1A 2CG1A 4AKZA 1I3IA 2ZL8A 1RN4A 3DXOA 3CXC2 1W01A 1YI23 4K61A 2QGUA 3IJEB 1KD14 5KP1A 3EJVA 3SLUA 4N6V0 5STDA 4WFOA 3F40A 3MWZA 4NPBA 2MC8A 2F99A 1RN1A 4ILFA 3I563 3UJMA 5CF1A 4HM0B 1LRAA 1DMNA 2F56A 4RNYA 1KC84 1BIRA 2UX0A 1RLSA 1D6YA 3STDA 5CLKA 2GU3A 4N6LA 1IU7A 2W9QA 2HMOB 5DREA 4L8OA 5IG4A 3CCJ3 2OTL3 1B2SA 5CF2A 1W02A 4MJDA 1V58A 1E97A 2CHCA 4IPBA 3X40A 2KF5A 1FA3A 1BRHA 3CCU3 4EYCA 1BNEA 1OGXA 1RTUA 3SOAA 2CWVA 1RGLA 4KZ1A 4EXRA 1A2VA 2C11A 2O9UX 2K3DA 1I2GA 4HZBB 4BL2A 1BSAA 1AVLA 1MWTA 5KP4A 3CNMA 2F5MA 3DGMA 5AIHA 4O3VA 3VSYA 4CCVA 3J7Yd 3G713 1BNRA 2KF6A 3LH4A 2CG0A 2KCDA 2RCDA 4J8TA 1VQP3 1BGSA 5IG5A 1S5AA 3MG1A 1VQL3 2D42A 3Q3FA 4STDA 1ROVA 2ML5A 3KSED 4R80A 4MMXB 3RGRA 3I553 4AKYA 1GY6A 1I2EA 1BUQA 2FNQA 5G2GA 1QAKA 2CFKA 2BMQB 3D9RA 1N9JA 5AYSC 4BU4A 1MNLA 1BSDA 3BNDA 3F14A 5IW9A 1Q864 1BOXA 1A90A 1LXEA 1LOWA 5BU4A 3F9SA 5D81A 3ZG5A 3Q90A 2W6JH 1LOYA 4MMZB 1GMPA 2HMJB 1HYFA 2CFGA 5AIFA 1BRKA 2BHMA 2CX0A 3KSPA 2B1XB 1RRLA 3X42A 1RGFA 1K28A 3DGOA 3G0KA 4EBGA 1N9EA 1RHLA 1NO3A 1VQ43 1U8CB 1RMSA 2CC3A 3LTCA 2KAAA 4GSPA 4MEIA 3BNEA 1JJ22 3JUPA 1FUSA 3EE1A 4OUQA 1BRGA 1LVNA 1JBSA 4GHOA 5M1AA 1QVF2 1MGWA 1TP6A 1BRIA 1LNIA 4XB5A 1T3BA 2ZDJA 3QRDA 1B2MA 1LQGC 1W7CA 3JUMA 5KP3A 1MWSA 1STFI 2FGTA 3H51A 2V1LA 1TUHA 3KCHA 3NUVA 1O7WB 4J5GA 5CXOA 9RNTA 2MF7A 2XGNA 3B7CA 3HIIA 2IYJA 1MGRA 4LGQA 4XBTA 4KVHA 2BNGA 1BRSA 3FF0A 3EHCA 4GB5A 4HJLB 3CC23 3ALAA 2GXFA 1UCIA 3BIRA 2H0HA 2F98A 4HM3B 4WP5A 2OQEA 3WA3A 2BU4A 5BXQA 5CK6A 3S28A 3DGLA 1JB2A 5IG0A 1ZX2A 2XR8B 3CCV3 3CCL3 1JBRA 1A67A 3CMA3 1B2XA 3GRDA 1TJDA 1IV7A 3CPOA 1BAOA 3M8CA 3OWYA 3MKIA 3K5TA 4ZM8A 1M1K4 1OHSA 2P38A 2IUKA 2WOHA 1BNSA 1YVSA 2P05A 1EEJA 3FG3A 4X2HA 2YX9A 4WYKA 3LOYA 2KXGA 1JN5B 3PS8A 5IEPA 2HMNB 2O3OA 3AMOB 3LXUX 4HKVB 1A2PA 3NX0A 3WA2X 1A2KA 1B2ZA 1KWIA 2I9WA 2SBLA 4KFDA 7STDA 2GSPA 4FCMA 1JZOA 4XDWA 3ECFA 2CWUA 3QK9A 4J5KA 3BU4A 3ER7A 1LQMB 3KIIA 1W6GA 3PZWA 3A76A 3CME3 1YIT3 1C54A 3GZRA 6STDA 3ZFZA 1VZZA 3FKAA 4FMCA 1I8VA 1G02A 2BMRB 2HMLB 4HM4B 4RBNA 2K0MA 4R9LA 1CH0A 4O02B 3KN4A 4BL3A 3CPW2 2GU1A 2SARA 3SOYA 2INXA 3A5EA 3CCR3 1DMMA 1N5HA 2JDIH 2XF3A 2WGOA 4EV2A 1U5OA 5IENA 1FZUA 3NV0B 3EX9A 5G1KA 1UGHI 1IVUA 1FGMA 1RSNA 1R4CA 1V57A 1K9M4 1YNVX 2H0GA 5AIIA 2Q07A 1KQS2 1M904 1UCKA 1OGZA 1NNVA 2RBIA 4H3UA 2STDA 5HOHA 1BNGA 1QALA 2IMJA 1X1WA 4R1KA 2QA43 1DE3A 1SPUA 1ROAA 2YFJB 3WHOA 3N9HA 5G1LA 4HM8B 3EQQB 1BANA 3SX1A 3EN1B 1BSCA 1T2IA 1OPYA 2KRTA 3G16A 3BB9A 1FGRA 1Q814 1I70A 1E3VA 1BNIA 1UUVB 5GSPA 4EV5A 2GEXA 3HZPA 1F8NA 3LZAA 4QWTA 4HAAA 2BT3A 3U1WA 1YJN3 1NJI4 1WMOA 3AGOA 3GZYB 2F86B 3CCQ3 5AEWB 2CKFB 5TGNA 3UB1A 2BIRA 1W2B2 3NQZA 4WWUC 4BIRA 2XGLA 1D6ZA 1RGKA 4IIAA 1CYUA 3RNTA 2OTJ3 1O7NB 3GAXA 1PFPA 3MG2A 3KFQC 1LNHA 1RCLA 4HM5B 4KFFA 2IUJA 3WODG 5AI1A 2E2VA 3LMLA 3LT9A 4N3VA 1BSBA 3BNCA 1DVCA 1W6YA 1W6CA 2Z77A 3L0RA 1RNBA 3FSDA 3O8YA 4K1UA 4ORLA 2CW9A 4K1VA 1CEWI 1RGAA 1T5YA 2QEX3 3G4S3 4K90B 3CD63 3ROBA 2YFIB 3JVCA 1X1XA 3S27A 3DM8A 3MSOA 1BU4A 1US1A 3B8LA 3T8UA 4XBYA 3UL6A 3DGYA 2UGIA 2XH9A 8CHOA 2W56A 4JF8A 4BTXA 1RGHA 4XDVA 1IVVA 3B4PA 2KF4A 3NM7A 2L4VA 3S67A 3B4OA 3NBJA 3HI7A 1ISKA 3OWUA 3CC43 3X3YA 2AADA 3KE7A 2FXTA 3AGNA 4X2OA 1QJGA 1N8R4 1GY7A 1BUJA 4NHFA 1TIJA 3F8HA 1UUGB 2JQ5A 3SEDA 1EQKA 3EB8A 1OF5B 2QIYA 1BNJA 4RZMA 1RDSA 2W56B 3NM2A 2XSOB 2Z6BA 1K8A4 3GSPA 4I4KA 1IK3A 1RRHA 3F7XA 2WO0A 1Q9EA 1TFKA 2R4IA 3NXJA 4O2HA 3NBRA 5D83A 5LC7A 3V98A 1X1YA 2PZVA 1IQ8A 1C7HA 3HOHA 5JPPA 1DVDA 2J8XB 5EEOA 1EKMA 2BMOB 3V99A 4EC6A 3X3XA 4NREA 2F5WA 1RKYA 1VQQA 3NHXA 1VQ83 3AHSA 1VQN3 5M18A 3LYGA 3K9MC 3EBYA 5ELJA 3S29A 5A0OB 2PNCA 1HZ1A 1N8QA 2ZA4A 3LTAA 1L5GB 1VQ73 1OF5A 1GYBA 1B3SA 1HU9A 1O7HB 4FCJA 1S723 1YHQ3 1EUIC 1GSPA 8RNTA 1UDII 1RNTA 3D79A 3ZG0A 1JZDA 4LYLB 2Y74A 1Q824 4LEHA 1STDA 1UGIA 3N8BA 1GOUA 1LOVA 2W2CA 3PGBA 1RGGA 5IEOA 4FCZA 4XBXA 3D4AA 4KT3B 3HIGA 4XM4A 1ULJB 2OWPA 3D3LA 1I0XA 5IF6A 4HOHA 5FW5A 1PY3A 3DUKA 5JPUA 1IVWA 1GY5A 1NDOB 3OX9A 1Q42A 1B20A 3CU3A 1DMQA 1IDPA 3H3HA 1BSEA 4HZ9B 7GSPA 3FH1A 1IQXA 1UUWB 1YJW3 4HYZA 3WR2A 3G6E3 1JB4A 1W4NA 1TU5A 2OOVA 3E99A 1RJOA 4JRFA 1Z1SA 2C10A 3FCSB 4O8SA 5IERA 3CCE3 3D5GA 2GBXB 4EW5A 1IV9A 1MOLA 3FLJA 2W9PA 2CX1A 3MPHA 5AIGA 1QAFA 4LZIA 1M9GA 1W00A 3WMDA 1BRJA 1JKGB 1OACA 2RSXA 5EVHA 1I0VA 2R41A 1GOVA 2P0XA 1BNFA 1V74A 4L8PA 4L7KA 1JB5A 6GSPA 3DZLA 4U13A 5AEUB 3CC73 1DETA 1IT8A 4RNZA 1UCLA 2XFSA 1AVKA 1AY7A 3CNXA 4LMIA 5DRVA 3PCSA 2LQVA 1VQK3 2AAEA 5D82A 3DH2A 3LTDA 1M1XB 4FR9A 2GEYA 1YVBI 1VQ63 1UCJA 1WTHA 1TRPA 1AV4A 1FGTA 1LOXA 4WYKB 2BO9B 3OW22 4GL6A 3BNBA 1OHPA 3PCRA 4OVMA 3MHEA 1WMNA 5IG3A 1ZO2A 1B2UA 1ZS7A 4HM7B 2OOVC 2XEPA 1AQZA 1ASKA 1IQYA 1O7PB 3VF1A 1WMPA 1B21A 1YGWA 4PEJA 3MG3A 2C4BA 1X1UA 2W03A 1OCVA 2K54A 3T8NA 3X41A 1YGEA 3BLZA 3DGNA 1QVG2 2RFRA 3RDEA 2CH9A 3JUQA 4BTYA 6RNTA 1GD3A 1KSIA 4J9AA 1IT7A 2D1WA 5BVBA 1JRQA 3N54B 3DMCA 4N6MA 4WHAA 3X3ZA 3NBBA 3RGAA 1FUWA 1QMAA 1OUNA 3VGNA 2B24B 3NQYA 1TTOA 5FGOA 4CPKA 5RNTA 1SJWA 2CFLA 1I2FA 1Q7HA 4FMDA 3LTBA 1TFOA 3FZWA 1GD4A 3IPTA 4Q53A 5ELUA 5HGRA 1I3FA 1Q7Y4 4IT7A 4G1MB 3WOEB 1PYLA 3WOFB 4CJNA 4RNTA 1JNQA 1NWWA 1OH0A 2HMKB 2KF3A 4BTWA 1UI7A 1Y4KA 3DY5A 1RGCA
chains in the Genus database with same CATH topology
2A15A 3PXMA 2IA7A 2CK3H 3LT8A 3PYJA 1K41A 2HMMB 3EBTA 4FMAA 1SIHA 3I0YA 3AMOA 1ULIB 3FG1A 1AR0A 1W5ZA 2OCTA 3Q2PA 3GZBA 1HKXA 1Q40A 2WOFA 3JUNA 1D6UA 4FMBA 1N5PA 5JBSA 1YIJ3 1O7MB 2RGQA 4CDLA 5I97A 3FF2A 3UL5A 2XRXB 3SVAA 4N6TA 4HM2B 3OV4A 4HM6B 1DYUA 1JV2B 1W2ZA 1JKGA 1GS3A 2Y73A 3UNLA 3OXAA 3CCM3 3T0UA 4HM1B 3FGYA 3SXXA 4AEQA 1VQ93 1E3RA 3IMAB 4N6UA 2M7OA 3EF8A 4R9KA 3CCS3 3KKGA 3V92A 1VQ53 1G96A 2E2UA 3EC9A 1OHOA 3TDGA 3HK4A 2GBWB 1SQWA 1Q40B 3K63A 2XFTA 3NV0A 2W04A 1WNHA 3HX8A 1SIIA 4N6OB 1PU4A 1FGQA 1VQO3 1NB3I 2E2TA 3G8ZA 3WDGB 4TX4A 3MYTA 1J2BA 5LC6A 1K734 1NU3A 2P09A 3GWRA 3GZXB 1EG9B 3F7SA 1CQSA 3FG4A 5EQLA 2WGQA 2Z76A 1UI8A 2W0QA 3EN8A 4R4KA 1WQLB 3JUOA 4HVNA 4MMYB 3U97A 1IVXA 2P0MA 2CIUA 2YFLB 3K0ZA 4LSOA 2OQEC 4KFEA 1VQM3 2Z7AA 2XSHB 3K7CA 1RN7A 1JN5A 1O7GB 2CWTA 3F8XA 1FGOA 3S5CA 4OK0A 3KZTA 5AYRB 2CFDA 4H61A 4N6NB 2LYXA 3OWSA 1CYVA 1YJ93 1EA2A 4HBRA 3Q1CA 2ML6A 1NB5I 2CG1A 2CFWA 4AKZA 1UW1A 2ZL8A 3DXOA 3CXC2 1W01A 1YI23 4K61A 2QGUA 3IJEB 1KD14 5KP1A 3EJVA 3SLUA 4N6V0 5STDA 4WFOA 3F40A 3MWZA 2MC8A 2F99A 3I563 3UJMA 5CF1A 4HM0B 1DMNA 1KC84 4RNYA 2UX0A 1D6YA 3STDA 5CLKA 2GU3A 4N6LA 1IU7A 2W9QA 2HMOB 5DREA 4L8OA 5IG4A 3CCJ3 2OTL3 5CF2A 1W02A 4MJDA 1E97A 2CHCA 4IPBA 3X40A 1FA3A 3CCU3 4EYCA 1OGXA 3SOAA 4EXRA 2CWVA 4KZ1A 1A2VA 2C11A 2O9UX 4HZBB 1AVLA 5KP4A 3CNMA 3DGMA 5AIHA 4O3VA 3VSYA 4CCVA 3J7Yd 3G713 3LH4A 1VQP3 2CG0A 2KCDA 2RCDA 4J8TA 5IG5A 1S5AA 3MG1A 1VQL3 2D42A 4STDA 1ROVA 2ML5A 3KSED 4R80A 4MMXB 3RGRA 3I553 4AKYA 1GY6A 1BUQA 2FNQA 5G2GA 1QAKA 2CFKA 2BMQB 3D9RA 1N9JA 5AYSC 1MNLA 3BNDA 3F14A 5IW9A 1Q864 1A90A 1LXEA 3F9SA 5D81A 3Q90A 2W6JH 4MMZB 2HMJB 2CFGA 5AIFA 2BHMA 3KSPA 2B1XB 1RRLA 3X42A 1K28A 3DGOA 3G0KA 4EBGA 1N9EA 1NO3A 1VQ43 1U8CB 2CC3A 3LTCA 4MEIA 3BNEA 1JJ22 3JUPA 3EE1A 4OUQA 1LVNA 1QVF2 1TP6A 4XB5A 2ZDJA 3QRDA 1W7CA 3JUMA 5KP3A 1STFI 3H51A 2FGTA 3NUVA 2V1LA 1TUHA 4KFDA 1O7WB 5CXOA 2MF7A 2XGNA 3B7CA 3HIIA 4LGQA 4XBTA 4KVHA 2BNGA 3FF0A 3EHCA 4GB5A 4HJLB 3CC23 3ALAA 2GXFA 2OQEA 3WA3A 2F98A 4HM3B 4WP5A 5BXQA 5CK6A 3S28A 3DGLA 1JB2A 5IG0A 1ZX2A 2XR8B 3CCV3 3CCL3 1A67A 3CMA3 3GRDA 1IV7A 3CPOA 3M8CA 3OWYA 3MKIA 3K5TA 4ZM8A 1M1K4 1OHSA 2P38A 2IUKA 2WOHA 2P05A 3FG3A 4X2HA 2YX9A 4WYKA 3LOYA 2KXGA 1JN5B 3PS8A 5IEPA 2HMNB 2O3OA 3AMOB 3LXUX 4HKVB 3NX0A 3WA2X 1A2KA 1KWIA 2I9WA 2SBLA 7STDA 4FCMA 4XDWA 3ECFA 2CWUA 3QK9A 3KIIA 3ER7A 1W6GA 3PZWA 3A76A 3CME3 1YIT3 3GZRA 6STDA 1VZZA 3FKAA 4FMCA 4HM4B 2BMRB 4RBNA 2HMLB 2K0MA 4R9LA 4O02B 3KN4A 3CPW2 2GU1A 3SOYA 2INXA 3CCR3 1DMMA 1N5HA 2JDIH 2XF3A 2WGOA 4EV2A 1U5OA 5IENA 3NV0B 3EX9A 1IVUA 1FGMA 1R4CA 1K9M4 5AIIA 2Q07A 1KQS2 1M904 4H3UA 1OGZA 2STDA 1QALA 2IMJA 4R1KA 2QA43 1SPUA 1ROAA 2YFJB 3N9HA 3SX1A 4HM8B 3EQQB 3EN1B 1OPYA 2KRTA 3G16A 3BB9A 1FGRA 1Q814 1E3VA 1UUVB 4EV5A 2GEXA 3HZPA 1F8NA 3LZAA 4QWTA 2BT3A 3U1WA 1YJN3 1NJI4 1WMOA 3GZYB 2F86B 3CCQ3 5AEWB 2CKFB 5TGNA 3UB1A 1W2B2 3NQZA 4WWUC 2XGLA 1D6ZA 4IIAA 1CYUA 2OTJ3 1O7NB 3GAXA 1PFPA 3MG2A 3KFQC 1LNHA 4HM5B 4KFFA 2IUJA 3WODG 5AI1A 2E2VA 3LMLA 3LT9A 4N3VA 3BNCA 1DVCA 1W6YA 1W6CA 2Z77A 3L0RA 3FSDA 3O8YA 4K1UA 4ORLA 2CW9A 4K1VA 1CEWI 1T5YA 2QEX3 3G4S3 4K90B 3CD63 3ROBA 2YFIB 3JVCA 3S27A 3DM8A 3MSOA 3B8LA 1US1A 3T8UA 4XBYA 3UL6A 2XH9A 8CHOA 2W56A 4JF8A 4BTXA 4XDVA 1IVVA 3B4PA 3NM7A 2L4VA 3S67A 3B4OA 3NBJA 3HI7A 1ISKA 3OWUA 3CC43 3X3YA 3KE7A 2FXTA 4X2OA 1QJGA 1N8R4 1GY7A 4NHFA 1TIJA 3F8HA 2JQ5A 3SEDA 1EQKA 3EB8A 1OF5B 2QIYA 4RZMA 2W56B 3NM2A 2XSOB 2Z6BA 1K8A4 1IK3A 4I4KA 1RRHA 3F7XA 2WO0A 1TFKA 3NXJA 2R4IA 5D83A 4O2HA 3NBRA 5LC7A 3V98A 2PZVA 1IQ8A 1C7HA 5JPPA 1DVDA 5EEOA 1EKMA 2BMOB 3V99A 4EC6A 3X3XA 4NREA 1RKYA 3NHXA 1VQ83 1VQN3 3LYGA 3K9MC 3EBYA 5ELJA 3S29A 5A0OB 2PNCA 1N8QA 1VQ73 3LTAA 1L5GB 1OF5A 1GYBA 1HU9A 1O7HB 4FCJA 1S723 1YHQ3 2Y74A 1Q824 4LEHA 1STDA 3N8BA 2W2CA 3PGBA 5IEOA 4FCZA 4XBXA 3HIGA 4XM4A 1ULJB 2OWPA 3D3LA 5IF6A 5FW5A 3DUKA 5JPUA 1IVWA 1GY5A 1NDOB 3OX9A 1Q42A 3CU3A 1DMQA 1IDPA 3H3HA 4HZ9B 3FH1A 1IQXA 1UUWB 1YJW3 4HYZA 3G6E3 1JB4A 1W4NA 1TU5A 2OOVA 3E99A 1RJOA 4JRFA 1Z1SA 2C10A 3FCSB 4O8SA 5IERA 3CCE3 2GBXB 1IV9A 1MOLA 3FLJA 2W9PA 3MPHA 5AIGA 1QAFA 4LZIA 1M9GA 1W00A 3WMDA 1JKGB 1OACA 2RSXA 5EVHA 2P0XA 1V74A 4L8PA 4L7KA 1JB5A 3DZLA 4U13A 5AEUB 3CC73 1IT8A 4RNZA 2XFSA 1AVKA 3CNXA 4LMIA 5DRVA 3PCSA 2LQVA 1VQK3 5D82A 3LTDA 1M1XB 4FR9A 2GEYA 1YVBI 1VQ63 1WTHA 1AV4A 1FGTA 1LOXA 4WYKB 2BO9B 3OW22 4GL6A 3BNBA 1OHPA 3PCRA 4OVMA 3MHEA 1WMNA 5IG3A 1ZO2A 4HM7B 2OOVC 2XEPA 1ASKA 1IQYA 1O7PB 3VF1A 1WMPA 4PEJA 3MG3A 2W03A 1OCVA 2K54A 3T8NA 3X41A 1YGEA 3BLZA 3DGNA 1QVG2 2RFRA 3RDEA 2CH9A 3JUQA 4BTYA 1GD3A 1KSIA 4J9AA 1IT7A 2D1WA 5BVBA 1JRQA 3N54B 3DMCA 4N6MA 4WHAA 3X3ZA 3NBBA 3RGAA 1FUWA 1QMAA 1OUNA 3VGNA 2B24B 3NQYA 5FGOA 1SJWA 2CFLA 4FMDA 3LTBA 1TFOA 3FZWA 1GD4A 3IPTA 4Q53A 5ELUA 5HGRA 1Q7Y4 4IT7A 4G1MB 3WOEB 3WOFB 1JNQA 1NWWA 1OH0A 2HMKB 4BTWA 1UI7A 1Y4KA 3DY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A15 A;  4HZB B;  4HM4 B;  1OF5 A;  2BMR B;  1GYB A;  2HML B;  5DRV A;  5KP4 A;  4R9L A;  3CNM A;  1K41 A;  1O7H B;  2HMM B;  3EBT A;  4FCJ A;  5AIH A;  3VSY A;  3I0Y A;  4J8T A;  3SOY A;  2INX A;  2RCD A;  5IG5 A;  1S5A A;  1DMM A;  1ULI B;  1AR0 A;  3MG1 A;  3GZB A;  5IEN A;  1HKX A;  1Q40 A;  1U5O A;  3JUN A;  3NV0 B;  3EX9 A;  1O7M B;  2RGQ A;  1STD A;  4LEH A;  4STD A;  4CDL A;  3FF2 A;  5AII A;  3RGR A;  2W2C A;  2XRX B;  1GY6 A;  4H3U A;  1OGZ A;  4XBX A;  4HM2 B;  3OV4 A;  4HM6 B;  5G2G A;  5IEO A;  2STD A;  4XM4 A;  1JKG A;  1GS3 A;  3UNL A;  1ULJ B;  3OXA A;  2BMQ B;  2IMJ A;  3D9R A;  2OWP A;  4R1K A;  4HM1 B;  3FGY A;  5IF6 A;  1E3R A;  2YFJ B;  5D81 A;  3F14 A;  4HM8 B;  3EF8 A;  3EQQ B;  4R9K A;  3EN1 B;  5FW5 A;  1OPY A;  3G16 A;  3KKG A;  3BB9 A;  3DUK A;  5JPU A;  1E3V A;  1GY5 A;  1UUV B;  3EC9 A;  1OHO A;  1NDO B;  2GEX A;  3HK4 A;  2GBW B;  3F9S A;  1Q42 A;  3CU3 A;  3HZP A;  1DMQ A;  1Q40 B;  3LZA A;  3OX9 A;  1IDP A;  3H3H A;  3NV0 A;  3HX8 A;  3Q90 A;  4HZ9 B;  2HMJ B;  3FH1 A;  1UUW B;  3GZY B;  2F86 B;  5AEW B;  2CKF B;  5TGN A;  3G8Z A;  5AIF A;  1JB4 A;  4WWU C;  3KSP A;  3E99 A;  4IIA A;  2B1X B;  3MYT A;  1Z1S A;  5IER A;  1NU3 A;  1O7N B;  3GWR A;  2GBX B;  3G0K A;  3GZX B;  3MG2 A;  1EG9 B;  3F7S A;  1CQS A;  3FLJ A;  5AIG A;  2Z76 A;  4HM5 B;  3EN8 A;  1W00 A;  5AI1 A;  1WQL B;  3JUP A;  3WMD A;  1JKG B;  4OUQ A;  4N3V A;  3JUO A;  4HVN A;  5EVH A;  1W6Y A;  4L8P A;  2Z77 A;  1TP6 A;  1JB5 A;  2YFL B;  3DZL A;  3FSD A;  3K0Z A;  4K1U A;  4L7K A;  4ORL A;  4U13 A;  4XB5 A;  4K1V A;  5AEU B;  2Z7A A;  2XSH B;  3JUM A;  3K7C A;  3H51 A;  5KP3 A;  3CNX A;  1JN5 A;  1TUH A;  3FKA A;  1O7G B;  1O7W B;  3F8X A;  3NUV A;  4LMI A;  5CXO A;  5D82 A;  2YFI B;  3B7C A;  3ROB A;  3S5C A;  4LGQ A;  3DM8 A;  3MSO A;  4XBT A;  3B8L A;  3KZT A;  2BNG A;  2GEY A;  3FF0 A;  4KVH A;  3EHC A;  4GB5 A;  4XBY A;  3T8U A;  3OWS A;  4HJL B;  8CHO A;  4WYK B;  1EA2 A;  4XDV A;  2GXF A;  2F98 A;  3B4P A;  4HM3 B;  4WP5 A;  1OHP A;  4OVM A;  5BXQ A;  3MHE A;  5CK6 A;  5IG3 A;  3B4O A;  5IG0 A;  1JB2 A;  1ZO2 A;  1ZX2 A;  1W01 A;  2XR8 B;  3DXO A;  4HM7 B;  1ISK A;  1ASK A;  1O7P B;  3GRD A;  3OWU A;  2QGU A;  4PEJ A;  3KE7 A;  3MG3 A;  3CPO A;  1OCV A;  2K54 A;  5KP1 A;  3EJV A;  3M8C A;  4X2O A;  3OWY A;  3BLZ A;  3T8N A;  1QJG A;  3MKI A;  5STD A;  2RFR A;  1GY7 A;  3F40 A;  3JUQ A;  1OHS A;  2F99 A;  3F8H A;  3UJM A;  5CF1 A;  4J9A A;  2JQ5 A;  4HM0 B;  3SED A;  1OF5 B;  2QIY A;  1DMN A;  4RZM A;  4X2H A;  5BVB A;  3NM2 A;  2UX0 A;  3DMC A;  2XSO B;  4WYK A;  3STD A;  5CLK A;  4I4K A;  3RGA A;  3F7X A;  5D83 A;  1QMA A;  1JN5 B;  1OUN A;  2R4I A;  2B24 B;  3NXJ A;  3NBR A;  2HMN B;  2HMO B;  4L8O A;  4HKV B;  5DRE A;  5IG4 A;  1SJW A;  5CF2 A;  5IEP A;  2PZV A;  1A2K A;  1C7H A;  2I9W A;  1W02 A;  4MJD A;  7STD A;  5JPP A;  1BUQ A;  1E97 A;  4FCM A;  2CHC A;  2BMO B;  3ECF A;  3FZW A;  3IPT A;  4Q53 A;  4XDW A;  5HGR A;  3ER7 A;  1OGX A;  3NHX A;  3A76 A;  3LYG A;  3SOA A;  3EBY A;  1NWW A;  2HMK B;  1OH0 A;  3GZR A;  6STD A;  3VGN A;  1VZZ A; 
#chains in the Genus database with same CATH topology
 2A15 A;  3PXM A;  2IA7 A;  2CK3 H;  3LT8 A;  3PYJ A;  1K41 A;  2HMM B;  2HOH A;  3AHW A;  1ZGX A;  1SIH A;  3EBT A;  4FMA A;  3I0Y A;  3AMO A;  1FUT A;  1ULI B;  2F4Y A;  1AR0 A;  1W5Z A;  2OCT A;  3FG1 A;  3GZB A;  3Q2P A;  1HKX A;  1Q40 A;  2WOF A;  3JUN A;  1D6U A;  4FMB A;  1N5P A;  5JBS A;  1YIJ 3;  1O7M B;  2RGQ A;  4CDL A;  5I97 A;  3FF2 A;  3UL5 A;  2XRX B;  3SVA A;  4N6T A;  4HM2 B;  3OV4 A;  4HM6 B;  1DYU A;  1JV2 B;  1W2Z A;  1JKG A;  1GS3 A;  2IY2 A;  2Y73 A;  3UNL A;  3OXA A;  3CCM 3;  3T0U A;  4HM1 B;  3FGY A;  2ZHX B;  2H0I A;  4I5Q A;  3SXX A;  4AEQ A;  1E3R A;  3IMA B;  1VQ9 3;  4N6U A;  2M7O A;  3EF8 A;  1G0T A;  4R9K A;  3CCS 3;  3KKG A;  5BIR A;  3V92 A;  1VQ5 3;  1G96 A;  2E2U A;  3EC9 A;  1OHO A;  3TDG A;  3HK4 A;  2GBW B;  5M19 A;  1SQW A;  1IYY A;  1Q40 B;  3K63 A;  2XFT A;  3NV0 A;  1GMR A;  1WNH A;  2W04 A;  3HX8 A;  1SII A;  2UUG C;  1GOY A;  4N6O B;  1PU4 A;  1FGQ A;  3SYU A;  1NB3 I;  1VQO 3;  2E2T A;  3G8Z A;  3WDG B;  4TX4 A;  1RCK A;  3MYT A;  5LC6 A;  1K73 4;  1J2B A;  1BVI A;  1NU3 A;  2L1S A;  2P09 A;  1RGE A;  3GWR A;  3GZX B;  4DKI A;  1FW7 A;  1EG9 B;  3F7S A;  1CQS A;  3FG4 A;  5EQL A;  2WGQ A;  1R4Y A;  2Z76 A;  1UI8 A;  2W0Q A;  3EN8 A;  4R4K A;  1WQL B;  1MWR A;  3JUO A;  4HVN A;  4MMY B;  3U97 A;  1IVX A;  2P0M A;  2CIU A;  1SAR A;  2YFL B;  1BRN L;  3K0Z A;  4LSO A;  2OQE C;  4KFE A;  1VQM 3;  1FYS A;  1MWU A;  2Z7A A;  2XSH B;  3K7C A;  1RN7 A;  1JN5 A;  1O7G B;  2CWT A;  3F8X A;  1FGO A;  1T2H A;  3S5C A;  3D5I A;  4OK0 A;  1JBT A;  3KZT A;  5AYR B;  2CFD A;  7RNT A;  4H61 A;  4N6N B;  2LYX A;  3OWS A;  1CYV A;  1YJ9 3;  1GMQ A;  1EA2 A;  1TRQ A;  3Q1C A;  2ML6 A;  4HBR A;  3URP A;  1NB5 I;  2RNT A;  1B27 A;  2CFW A;  1UW1 A;  2CG1 A;  4AKZ A;  1I3I A;  2ZL8 A;  1RN4 A;  3DXO A;  3CXC 2;  1W01 A;  1YI2 3;  4K61 A;  2QGU A;  3IJE B;  1KD1 4;  5KP1 A;  3EJV A;  3SLU A;  4N6V 0;  5STD A;  4WFO A;  3F40 A;  3MWZ A;  4NPB A;  2MC8 A;  2F99 A;  1RN1 A;  4ILF A;  3I56 3;  3UJM A;  5CF1 A;  4HM0 B;  1LRA A;  1DMN A;  2F56 A;  4RNY A;  1KC8 4;  1BIR A;  2UX0 A;  1RLS A;  1D6Y A;  3STD A;  5CLK A;  2GU3 A;  4N6L A;  1IU7 A;  2W9Q A;  2HMO B;  5DRE A;  4L8O A;  5IG4 A;  3CCJ 3;  2OTL 3;  1B2S A;  5CF2 A;  1W02 A;  4MJD A;  1V58 A;  1E97 A;  2CHC A;  4IPB A;  3X40 A;  2KF5 A;  1FA3 A;  1BRH A;  3CCU 3;  4EYC A;  1BNE A;  1OGX A;  1RTU A;  3SOA A;  2CWV A;  1RGL A;  4KZ1 A;  4EXR A;  1A2V A;  2C11 A;  2O9U X;  2K3D A;  1I2G A;  4HZB B;  4BL2 A;  1BSA A;  1AVL A;  1MWT A;  5KP4 A;  3CNM A;  2F5M A;  3DGM A;  5AIH A;  4O3V A;  3VSY A;  4CCV A;  3J7Y d;  3G71 3;  1BNR A;  2KF6 A;  3LH4 A;  2CG0 A;  2KCD A;  2RCD A;  4J8T A;  1VQP 3;  1BGS A;  5IG5 A;  1S5A A;  3MG1 A;  1VQL 3;  2D42 A;  3Q3F A;  4STD A;  1ROV A;  2ML5 A;  3KSE D;  4R80 A;  4MMX B;  3RGR A;  3I55 3;  4AKY A;  1GY6 A;  1I2E A;  1BUQ A;  2FNQ A;  5G2G A;  1QAK A;  2CFK A;  2BMQ B;  3D9R A;  1N9J A;  5AYS C;  4BU4 A;  1MNL A;  1BSD A;  3BND A;  3F14 A;  5IW9 A;  1Q86 4;  1BOX A;  1A90 A;  1LXE A;  1LOW A;  5BU4 A;  3F9S A;  5D81 A;  3ZG5 A;  3Q90 A;  2W6J H;  1LOY A;  4MMZ B;  1GMP A;  2HMJ B;  1HYF A;  2CFG A;  5AIF A;  1BRK A;  2BHM A;  2CX0 A;  3KSP A;  2B1X B;  1RRL A;  3X42 A;  1RGF A;  1K28 A;  3DGO A;  3G0K A;  4EBG A;  1N9E A;  1RHL A;  1NO3 A;  1VQ4 3;  1U8C B;  1RMS A;  2CC3 A;  3LTC A;  2KAA A;  4GSP A;  4MEI A;  3BNE A;  1JJ2 2;  3JUP A;  1FUS A;  3EE1 A;  4OUQ A;  1BRG A;  1LVN A;  1JBS A;  4GHO A;  5M1A A;  1QVF 2;  1MGW A;  1TP6 A;  1BRI A;  1LNI A;  4XB5 A;  1T3B A;  2ZDJ A;  3QRD A;  1B2M A;  1LQG C;  1W7C A;  3JUM A;  5KP3 A;  1MWS A;  1STF I;  2FGT A;  3H51 A;  2V1L A;  1TUH A;  3KCH A;  3NUV A;  1O7W B;  4J5G A;  5CXO A;  9RNT A;  2MF7 A;  2XGN A;  3B7C A;  3HII A;  2IYJ A;  1MGR A;  4LGQ A;  4XBT A;  4KVH A;  2BNG A;  1BRS A;  3FF0 A;  3EHC A;  4GB5 A;  4HJL B;  3CC2 3;  3ALA A;  2GXF A;  1UCI A;  3BIR A;  2H0H A;  2F98 A;  4HM3 B;  4WP5 A;  2OQE A;  3WA3 A;  2BU4 A;  5BXQ A;  5CK6 A;  3S28 A;  3DGL A;  1JB2 A;  5IG0 A;  1ZX2 A;  2XR8 B;  3CCV 3;  3CCL 3;  1JBR A;  1A67 A;  3CMA 3;  1B2X A;  3GRD A;  1TJD A;  1IV7 A;  3CPO A;  1BAO A;  3M8C A;  3OWY A;  3MKI A;  3K5T A;  4ZM8 A;  1M1K 4;  1OHS A;  2P38 A;  2IUK A;  2WOH A;  1BNS A;  1YVS A;  2P05 A;  1EEJ A;  3FG3 A;  4X2H A;  2YX9 A;  4WYK A;  3LOY A;  2KXG A;  1JN5 B;  3PS8 A;  5IEP A;  2HMN B;  2O3O A;  3AMO B;  3LXU X;  4HKV B;  1A2P A;  3NX0 A;  3WA2 X;  1A2K A;  1B2Z A;  1KWI A;  2I9W A;  2SBL A;  4KFD A;  7STD A;  2GSP A;  4FCM A;  1JZO A;  4XDW A;  3ECF A;  2CWU A;  3QK9 A;  4J5K A;  3BU4 A;  3ER7 A;  1LQM B;  3KII A;  1W6G A;  3PZW A;  3A76 A;  3CME 3;  1YIT 3;  1C54 A;  3GZR A;  6STD A;  3ZFZ A;  1VZZ A;  3FKA A;  4FMC A;  1I8V A;  1G02 A;  2BMR B;  2HML B;  4HM4 B;  4RBN A;  2K0M A;  4R9L A;  1CH0 A;  4O02 B;  3KN4 A;  4BL3 A;  3CPW 2;  2GU1 A;  2SAR A;  3SOY A;  2INX A;  3A5E A;  3CCR 3;  1DMM A;  1N5H A;  2JDI H;  2XF3 A;  2WGO A;  4EV2 A;  1U5O A;  5IEN A;  1FZU A;  3NV0 B;  3EX9 A;  5G1K A;  1UGH I;  1IVU A;  1FGM A;  1RSN A;  1R4C A;  1V57 A;  1K9M 4;  1YNV X;  2H0G A;  5AII A;  2Q07 A;  1KQS 2;  1M90 4;  1UCK A;  1OGZ A;  1NNV A;  2RBI A;  4H3U A;  2STD A;  5HOH A;  1BNG A;  1QAL A;  2IMJ A;  1X1W A;  4R1K A;  2QA4 3;  1DE3 A;  1SPU A;  1ROA A;  2YFJ B;  3WHO A;  3N9H A;  5G1L A;  4HM8 B;  3EQQ B;  1BAN A;  3SX1 A;  3EN1 B;  1BSC A;  1T2I A;  1OPY A;  2KRT A;  3G16 A;  3BB9 A;  1FGR A;  1Q81 4;  1I70 A;  1E3V A;  1BNI A;  1UUV B;  5GSP A;  4EV5 A;  2GEX A;  3HZP A;  1F8N A;  3LZA A;  4QWT A;  4HAA A;  2BT3 A;  3U1W A;  1YJN 3;  1NJI 4;  1WMO A;  3AGO A;  3GZY B;  2F86 B;  3CCQ 3;  5AEW B;  2CKF B;  5TGN A;  3UB1 A;  2BIR A;  1W2B 2;  3NQZ A;  4WWU C;  4BIR A;  2XGL A;  1D6Z A;  1RGK A;  4IIA A;  1CYU A;  3RNT A;  2OTJ 3;  1O7N B;  3GAX A;  1PFP A;  3MG2 A;  3KFQ C;  1LNH A;  1RCL A;  4HM5 B;  4KFF A;  2IUJ A;  3WOD G;  5AI1 A;  2E2V A;  3LML A;  3LT9 A;  4N3V A;  1BSB A;  3BNC A;  1DVC A;  1W6Y A;  1W6C A;  2Z77 A;  3L0R A;  1RNB A;  3FSD A;  3O8Y A;  4K1U A;  4ORL A;  2CW9 A;  4K1V A;  1CEW I;  1RGA A;  1T5Y A;  2QEX 3;  3G4S 3;  4K90 B;  3CD6 3;  3ROB A;  2YFI B;  3JVC A;  1X1X A;  3S27 A;  3DM8 A;  3MSO A;  1BU4 A;  1US1 A;  3B8L A;  3T8U A;  4XBY A;  3UL6 A;  3DGY A;  2UGI A;  2XH9 A;  8CHO A;  2W56 A;  4JF8 A;  4BTX A;  1RGH A;  4XDV A;  1IVV A;  3B4P A;  2KF4 A;  3NM7 A;  2L4V A;  3S67 A;  3B4O A;  3NBJ A;  3HI7 A;  1ISK A;  3OWU A;  3CC4 3;  3X3Y A;  2AAD A;  3KE7 A;  2FXT A;  3AGN A;  4X2O A;  1QJG A;  1N8R 4;  1GY7 A;  1BUJ A;  4NHF A;  1TIJ A;  3F8H A;  1UUG B;  2JQ5 A;  3SED A;  1EQK A;  3EB8 A;  1OF5 B;  2QIY A;  1BNJ A;  4RZM A;  1RDS A;  2W56 B;  3NM2 A;  2XSO B;  2Z6B A;  1K8A 4;  3GSP A;  4I4K A;  1IK3 A;  1RRH A;  3F7X A;  2WO0 A;  1Q9E A;  1TFK A;  2R4I A;  3NXJ A;  4O2H A;  3NBR A;  5D83 A;  5LC7 A;  3V98 A;  1X1Y A;  2PZV A;  1IQ8 A;  1C7H A;  3HOH A;  5JPP A;  1DVD A;  2J8X B;  5EEO A;  1EKM A;  2BMO B;  3V99 A;  4EC6 A;  3X3X A;  4NRE A;  2F5W A;  1RKY A;  1VQQ A;  3NHX A;  1VQ8 3;  3AHS A;  1VQN 3;  5M18 A;  3LYG A;  3K9M C;  3EBY A;  5ELJ A;  3S29 A;  5A0O B;  2PNC A;  1HZ1 A;  1N8Q A;  2ZA4 A;  3LTA A;  1L5G B;  1VQ7 3;  1OF5 A;  1GYB A;  1B3S A;  1HU9 A;  1O7H B;  4FCJ A;  1S72 3;  1YHQ 3;  1EUI C;  1GSP A;  8RNT A;  1UDI I;  1RNT A;  3D79 A;  3ZG0 A;  1JZD A;  4LYL B;  2Y74 A;  1Q82 4;  4LEH A;  1STD A;  1UGI A;  3N8B A;  1GOU A;  1LOV A;  2W2C A;  3PGB A;  1RGG A;  5IEO A;  4FCZ A;  4XBX A;  3D4A A;  4KT3 B;  3HIG A;  4XM4 A;  1ULJ B;  2OWP A;  3D3L A;  1I0X A;  5IF6 A;  4HOH A;  5FW5 A;  1PY3 A;  3DUK A;  5JPU A;  1IVW A;  1GY5 A;  1NDO B;  3OX9 A;  1Q42 A;  1B20 A;  3CU3 A;  1DMQ A;  1IDP A;  3H3H A;  1BSE A;  4HZ9 B;  7GSP A;  3FH1 A;  1IQX A;  1UUW B;  1YJW 3;  4HYZ A;  3WR2 A;  3G6E 3;  1JB4 A;  1W4N A;  1TU5 A;  2OOV A;  3E99 A;  1RJO A;  4JRF A;  1Z1S A;  2C10 A;  3FCS B;  4O8S A;  5IER A;  3CCE 3;  3D5G A;  2GBX B;  4EW5 A;  1IV9 A;  1MOL A;  3FLJ A;  2W9P A;  2CX1 A;  3MPH A;  5AIG A;  1QAF A;  4LZI A;  1M9G A;  1W00 A;  3WMD A;  1BRJ A;  1JKG B;  1OAC A;  2RSX A;  5EVH A;  1I0V A;  2R41 A;  1GOV A;  2P0X A;  1BNF A;  1V74 A;  4L8P A;  4L7K A;  1JB5 A;  6GSP A;  3DZL A;  4U13 A;  5AEU B;  3CC7 3;  1DET A;  1IT8 A;  4RNZ A;  1UCL A;  2XFS A;  1AVK A;  1AY7 A;  3CNX A;  4LMI A;  5DRV A;  3PCS A;  2LQV A;  1VQK 3;  2AAE A;  5D82 A;  3DH2 A;  3LTD A;  1M1X B;  4FR9 A;  2GEY A;  1YVB I;  1VQ6 3;  1UCJ A;  1WTH A;  1TRP A;  1AV4 A;  1FGT A;  1LOX A;  4WYK B;  2BO9 B;  3OW2 2;  4GL6 A;  3BNB A;  1OHP A;  3PCR A;  4OVM A;  3MHE A;  1WMN A;  5IG3 A;  1ZO2 A;  1B2U A;  1ZS7 A;  4HM7 B;  2OOV C;  2XEP A;  1AQZ A;  1ASK A;  1IQY A;  1O7P B;  3VF1 A;  1WMP A;  1B21 A;  1YGW A;  4PEJ A;  3MG3 A;  2C4B A;  1X1U A;  2W03 A;  1OCV A;  2K54 A;  3T8N A;  3X41 A;  1YGE A;  3BLZ A;  3DGN A;  1QVG 2;  2RFR A;  3RDE A;  2CH9 A;  3JUQ A;  4BTY A;  6RNT A;  1GD3 A;  1KSI A;  4J9A A;  1IT7 A;  2D1W A;  5BVB A;  1JRQ A;  3N54 B;  3DMC A;  4N6M A;  4WHA A;  3X3Z A;  3NBB A;  3RGA A;  1FUW A;  1QMA A;  1OUN A;  3VGN A;  2B24 B;  3NQY A;  1TTO A;  5FGO A;  4CPK A;  5RNT A;  1SJW A;  2CFL A;  1I2F A;  1Q7H A;  4FMD A;  3LTB A;  1TFO A;  3FZW A;  1GD4 A;  3IPT A;  4Q53 A;  5ELU A;  5HGR A;  1I3F A;  1Q7Y 4;  4IT7 A;  4G1M B;  3WOE B;  1PYL A;  3WOF B;  4CJN A;  4RNT A;  1JNQ A;  1NWW A;  1OH0 A;  2HMK B;  2KF3 A;  4BTW A;  1UI7 A;  1Y4K A;  3DY5 A;  1RGC A; 
#chains in the Genus database with same CATH homology
 2A15 A;  3PXM A;  2IA7 A;  2CK3 H;  3LT8 A;  3PYJ A;  1K41 A;  2HMM B;  3EBT A;  4FMA A;  1SIH A;  3I0Y A;  3AMO A;  1ULI B;  3FG1 A;  1AR0 A;  1W5Z A;  2OCT A;  3Q2P A;  3GZB A;  1HKX A;  1Q40 A;  2WOF A;  3JUN A;  1D6U A;  4FMB A;  1N5P A;  5JBS A;  1YIJ 3;  1O7M B;  2RGQ A;  4CDL A;  5I97 A;  3FF2 A;  3UL5 A;  2XRX B;  3SVA A;  4N6T A;  4HM2 B;  3OV4 A;  4HM6 B;  1DYU A;  1JV2 B;  1W2Z A;  1JKG A;  1GS3 A;  2Y73 A;  3UNL A;  3OXA A;  3CCM 3;  3T0U A;  4HM1 B;  3FGY A;  3SXX A;  4AEQ A;  1VQ9 3;  1E3R A;  3IMA B;  4N6U A;  2M7O A;  3EF8 A;  4R9K A;  3CCS 3;  3KKG A;  3V92 A;  1VQ5 3;  1G96 A;  2E2U A;  3EC9 A;  1OHO A;  3TDG A;  3HK4 A;  2GBW B;  1SQW A;  1Q40 B;  3K63 A;  2XFT A;  3NV0 A;  2W04 A;  1WNH A;  3HX8 A;  1SII A;  4N6O B;  1PU4 A;  1FGQ A;  1VQO 3;  1NB3 I;  2E2T A;  3G8Z A;  3WDG B;  4TX4 A;  3MYT A;  1J2B A;  5LC6 A;  1K73 4;  1NU3 A;  2P09 A;  3GWR A;  3GZX B;  1EG9 B;  3F7S A;  1CQS A;  3FG4 A;  5EQL A;  2WGQ A;  2Z76 A;  1UI8 A;  2W0Q A;  3EN8 A;  4R4K A;  1WQL B;  3JUO A;  4HVN A;  4MMY B;  3U97 A;  1IVX A;  2P0M A;  2CIU A;  2YFL B;  3K0Z A;  4LSO A;  2OQE C;  4KFE A;  1VQM 3;  2Z7A A;  2XSH B;  3K7C A;  1RN7 A;  1JN5 A;  1O7G B;  2CWT A;  3F8X A;  1FGO A;  3S5C A;  4OK0 A;  3KZT A;  5AYR B;  2CFD A;  4H61 A;  4N6N B;  2LYX A;  3OWS A;  1CYV A;  1YJ9 3;  1EA2 A;  4HBR A;  3Q1C A;  2ML6 A;  1NB5 I;  2CG1 A;  2CFW A;  4AKZ A;  1UW1 A;  2ZL8 A;  3DXO A;  3CXC 2;  1W01 A;  1YI2 3;  4K61 A;  2QGU A;  3IJE B;  1KD1 4;  5KP1 A;  3EJV A;  3SLU A;  4N6V 0;  5STD A;  4WFO A;  3F40 A;  3MWZ A;  2MC8 A;  2F99 A;  3I56 3;  3UJM A;  5CF1 A;  4HM0 B;  1DMN A;  1KC8 4;  4RNY A;  2UX0 A;  1D6Y A;  3STD A;  5CLK A;  2GU3 A;  4N6L A;  1IU7 A;  2W9Q A;  2HMO B;  5DRE A;  4L8O A;  5IG4 A;  3CCJ 3;  2OTL 3;  5CF2 A;  1W02 A;  4MJD A;  1E97 A;  2CHC A;  4IPB A;  3X40 A;  1FA3 A;  3CCU 3;  4EYC A;  1OGX A;  3SOA A;  4EXR A;  2CWV A;  4KZ1 A;  1A2V A;  2C11 A;  2O9U X;  4HZB B;  1AVL A;  5KP4 A;  3CNM A;  3DGM A;  5AIH A;  4O3V A;  3VSY A;  4CCV A;  3J7Y d;  3G71 3;  3LH4 A;  1VQP 3;  2CG0 A;  2KCD A;  2RCD A;  4J8T A;  5IG5 A;  1S5A A;  3MG1 A;  1VQL 3;  2D42 A;  4STD A;  1ROV A;  2ML5 A;  3KSE D;  4R80 A;  4MMX B;  3RGR A;  3I55 3;  4AKY A;  1GY6 A;  1BUQ A;  2FNQ A;  5G2G A;  1QAK A;  2CFK A;  2BMQ B;  3D9R A;  1N9J A;  5AYS C;  1MNL A;  3BND A;  3F14 A;  5IW9 A;  1Q86 4;  1A90 A;  1LXE A;  3F9S A;  5D81 A;  3Q90 A;  2W6J H;  4MMZ B;  2HMJ B;  2CFG A;  5AIF A;  2BHM A;  3KSP A;  2B1X B;  1RRL A;  3X42 A;  1K28 A;  3DGO A;  3G0K A;  4EBG A;  1N9E A;  1NO3 A;  1VQ4 3;  1U8C B;  2CC3 A;  3LTC A;  4MEI A;  3BNE A;  1JJ2 2;  3JUP A;  3EE1 A;  4OUQ A;  1LVN A;  1QVF 2;  1TP6 A;  4XB5 A;  2ZDJ A;  3QRD A;  1W7C A;  3JUM A;  5KP3 A;  1STF I;  3H51 A;  2FGT A;  3NUV A;  2V1L A;  1TUH A;  4KFD A;  1O7W B;  5CXO A;  2MF7 A;  2XGN A;  3B7C A;  3HII A;  4LGQ A;  4XBT A;  4KVH A;  2BNG A;  3FF0 A;  3EHC A;  4GB5 A;  4HJL B;  3CC2 3;  3ALA A;  2GXF A;  2OQE A;  3WA3 A;  2F98 A;  4HM3 B;  4WP5 A;  5BXQ A;  5CK6 A;  3S28 A;  3DGL A;  1JB2 A;  5IG0 A;  1ZX2 A;  2XR8 B;  3CCV 3;  3CCL 3;  1A67 A;  3CMA 3;  3GRD A;  1IV7 A;  3CPO A;  3M8C A;  3OWY A;  3MKI A;  3K5T A;  4ZM8 A;  1M1K 4;  1OHS A;  2P38 A;  2IUK A;  2WOH A;  2P05 A;  3FG3 A;  4X2H A;  2YX9 A;  4WYK A;  3LOY A;  2KXG A;  1JN5 B;  3PS8 A;  5IEP A;  2HMN B;  2O3O A;  3AMO B;  3LXU X;  4HKV B;  3NX0 A;  3WA2 X;  1A2K A;  1KWI A;  2I9W A;  2SBL A;  7STD A;  4FCM A;  4XDW A;  3ECF A;  2CWU A;  3QK9 A;  3KII A;  3ER7 A;  1W6G A;  3PZW A;  3A76 A;  3CME 3;  1YIT 3;  3GZR A;  6STD A;  1VZZ A;  3FKA A;  4FMC A;  4HM4 B;  2BMR B;  4RBN A;  2HML B;  2K0M A;  4R9L A;  4O02 B;  3KN4 A;  3CPW 2;  2GU1 A;  3SOY A;  2INX A;  3CCR 3;  1DMM A;  1N5H A;  2JDI H;  2XF3 A;  2WGO A;  4EV2 A;  1U5O A;  5IEN A;  3NV0 B;  3EX9 A;  1IVU A;  1FGM A;  1R4C A;  1K9M 4;  5AII A;  2Q07 A;  1KQS 2;  1M90 4;  4H3U A;  1OGZ A;  2STD A;  1QAL A;  2IMJ A;  4R1K A;  2QA4 3;  1SPU A;  1ROA A;  2YFJ B;  3N9H A;  3SX1 A;  4HM8 B;  3EQQ B;  3EN1 B;  1OPY A;  2KRT A;  3G16 A;  3BB9 A;  1FGR A;  1Q81 4;  1E3V A;  1UUV B;  4EV5 A;  2GEX A;  3HZP A;  1F8N A;  3LZA A;  4QWT A;  2BT3 A;  3U1W A;  1YJN 3;  1NJI 4;  1WMO A;  3GZY B;  2F86 B;  3CCQ 3;  5AEW B;  2CKF B;  5TGN A;  3UB1 A;  1W2B 2;  3NQZ A;  4WWU C;  2XGL A;  1D6Z A;  4IIA A;  1CYU A;  2OTJ 3;  1O7N B;  3GAX A;  1PFP A;  3MG2 A;  3KFQ C;  1LNH A;  4HM5 B;  4KFF A;  2IUJ A;  3WOD G;  5AI1 A;  2E2V A;  3LML A;  3LT9 A;  4N3V A;  3BNC A;  1DVC A;  1W6Y A;  1W6C A;  2Z77 A;  3L0R A;  3FSD A;  3O8Y A;  4K1U A;  4ORL A;  2CW9 A;  4K1V A;  1CEW I;  1T5Y A;  2QEX 3;  3G4S 3;  4K90 B;  3CD6 3;  3ROB A;  2YFI B;  3JVC A;  3S27 A;  3DM8 A;  3MSO A;  3B8L A;  1US1 A;  3T8U A;  4XBY A;  3UL6 A;  2XH9 A;  8CHO A;  2W56 A;  4JF8 A;  4BTX A;  4XDV A;  1IVV A;  3B4P A;  3NM7 A;  2L4V A;  3S67 A;  3B4O A;  3NBJ A;  3HI7 A;  1ISK A;  3OWU A;  3CC4 3;  3X3Y A;  3KE7 A;  2FXT A;  4X2O A;  1QJG A;  1N8R 4;  1GY7 A;  4NHF A;  1TIJ A;  3F8H A;  2JQ5 A;  3SED A;  1EQK A;  3EB8 A;  1OF5 B;  2QIY A;  4RZM A;  2W56 B;  3NM2 A;  2XSO B;  2Z6B A;  1K8A 4;  1IK3 A;  4I4K A;  1RRH A;  3F7X A;  2WO0 A;  1TFK A;  3NXJ A;  2R4I A;  5D83 A;  4O2H A;  3NBR A;  5LC7 A;  3V98 A;  2PZV A;  1IQ8 A;  1C7H A;  5JPP A;  1DVD A;  5EEO A;  1EKM A;  2BMO B;  3V99 A;  4EC6 A;  3X3X A;  4NRE A;  1RKY A;  3NHX A;  1VQ8 3;  1VQN 3;  3LYG A;  3K9M C;  3EBY A;  5ELJ A;  3S29 A;  5A0O B;  2PNC A;  1N8Q A;  1VQ7 3;  3LTA A;  1L5G B;  1OF5 A;  1GYB A;  1HU9 A;  1O7H B;  4FCJ A;  1S72 3;  1YHQ 3;  2Y74 A;  1Q82 4;  4LEH A;  1STD A;  3N8B A;  2W2C A;  3PGB A;  5IEO A;  4FCZ A;  4XBX A;  3HIG A;  4XM4 A;  1ULJ B;  2OWP A;  3D3L A;  5IF6 A;  5FW5 A;  3DUK A;  5JPU A;  1IVW A;  1GY5 A;  1NDO B;  3OX9 A;  1Q42 A;  3CU3 A;  1DMQ A;  1IDP A;  3H3H A;  4HZ9 B;  3FH1 A;  1IQX A;  1UUW B;  1YJW 3;  4HYZ A;  3G6E 3;  1JB4 A;  1W4N A;  1TU5 A;  2OOV A;  3E99 A;  1RJO A;  4JRF A;  1Z1S A;  2C10 A;  3FCS B;  4O8S A;  5IER A;  3CCE 3;  2GBX B;  1IV9 A;  1MOL A;  3FLJ A;  2W9P A;  3MPH A;  5AIG A;  1QAF A;  4LZI A;  1M9G A;  1W00 A;  3WMD A;  1JKG B;  1OAC A;  2RSX A;  5EVH A;  2P0X A;  1V74 A;  4L8P A;  4L7K A;  1JB5 A;  3DZL A;  4U13 A;  5AEU B;  3CC7 3;  1IT8 A;  4RNZ A;  2XFS A;  1AVK A;  3CNX A;  4LMI A;  5DRV A;  3PCS A;  2LQV A;  1VQK 3;  5D82 A;  3LTD A;  1M1X B;  4FR9 A;  2GEY A;  1YVB I;  1VQ6 3;  1WTH A;  1AV4 A;  1FGT A;  1LOX A;  4WYK B;  2BO9 B;  3OW2 2;  4GL6 A;  3BNB A;  1OHP A;  3PCR A;  4OVM A;  3MHE A;  1WMN A;  5IG3 A;  1ZO2 A;  4HM7 B;  2OOV C;  2XEP A;  1ASK A;  1IQY A;  1O7P B;  3VF1 A;  1WMP A;  4PEJ A;  3MG3 A;  2W03 A;  1OCV A;  2K54 A;  3T8N A;  3X41 A;  1YGE A;  3BLZ A;  3DGN A;  1QVG 2;  2RFR A;  3RDE A;  2CH9 A;  3JUQ A;  4BTY A;  1GD3 A;  1KSI A;  4J9A A;  1IT7 A;  2D1W A;  5BVB A;  1JRQ A;  3N54 B;  3DMC A;  4N6M A;  4WHA A;  3X3Z A;  3NBB A;  3RGA A;  1FUW A;  1QMA A;  1OUN A;  3VGN A;  2B24 B;  3NQY A;  5FGO A;  1SJW A;  2CFL A;  4FMD A;  3LTB A;  1TFO A;  3FZW A;  1GD4 A;  3IPT A;  4Q53 A;  5ELU A;  5HGR A;  1Q7Y 4;  4IT7 A;  4G1M B;  3WOE B;  3WOF B;  1JNQ A;  1NWW A;  1OH0 A;  2HMK B;  4BTW A;  1UI7 A;  1Y4K A;  3DY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...