5D81A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y57(cl-y)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
126
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Delta(5)-3-ketosteroid isomerase
publication title Dissecting Proton Delocalization in an Enzyme's Hydrogen Bond Network with Unnatural Amino Acids.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 30
structure length 126
sequence length 127
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2015-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5d81A00
5TGNA 3EHCA 3NM2A 4LMIA 4WYKA 2R4IA 5AIFA 1E97A 1QJGA 3CNMA 1GY5A 3LYGA 5IG4A 4HM8B 1JKGA 1W01A 1AR0A 2IMJA 2STDA 2HMMB 3K0ZA 4X2OA 3G16A 4L8OA 1HKXA 5IERA 2XSHB 2BMOB 3MG1A 4PEJA 2YFJB 3FKAA 5IG3A 4J9AA 4RZMA 3NV0B 4N3VA 3BB9A 2GBXB 4HM5B 1OHPA 3FSDA 2HMLB 5DRVA 3LZAA 5KP3A 3GRDA 3RGRA 1OPYA 1WQLB 1JB5A 3B8LA 5IEOA 3GZXB 3GZYB 3OWYA 1K41A 3GZBA 3EF8A 3HK4A 3ER7A 3D9RA 3B7CA 2GEYA 1TUHA 3F9SA 2QGUA 4R1KA 5G2GA 2F99A 3I0YA 3EJVA 3F7XA 2OWPA 3S5CA 3B4OA 3CNXA 2I9WA 2BMQB 4IIAA 5AI1A 4STDA 3DM8A 3OWUA 1EG9B 3KKGA 1STDA 4HZ9B 4KVHA 5JPPA 3DMCA 5AEWB 3JUOA 2F98A 3OX9A 5EVHA 5STDA 5JPUA 3MHEA 2B1XB 1W02A 1EA2A 3UNLA 3DUKA 3GWRA 1O7GB 4LEHA 1JB2A 1O7MB 1IDPA 1ASKA 3MSOA 1OGZA 4XBTA 8CHOA 3SOYA 4HM4B 4HM7B 4L8PA 5CF2A 5D83A 3NV0A 3CU3A 3HZPA 2XR8B 4XDVA 1CQSA 1Q40B 3T8NA 5D82A 1Z1SA 4GB5A 3BLZA 4XB5A 3EBYA 5AIIA 3K7CA 5HGRA 5CLKA 3IPTA 5BXQA 7STDA 4LGQA 2W2CA 2Z76A 3NUVA 4XM4A 2YFLB 3NHXA 1DMQA 2Z7AA 4ORLA 4XBXA 3JUPA 3NBRA 3A76A 1ISKA 5AIGA 3EC9A 1NDOB 1ULIB 3VGNA 1OGXA 4HZBB 3OV4A 3NXJA 2GEXA 1NWWA 1OF5B 4I4KA 2GXFA 1O7PB 3UJMA 5IEPA 4WP5A 1S5AA 1E3RA 4OUQA 3F8HA 3OWSA 2PZVA 2UX0A 3DXOA 1VZZA 4HM6B 1GY7A 1OUNA 4FCMA 3SOAA 3DZLA 1GY6A 3ECFA 3H3HA 4CDLA 2RGQA 1SJWA 1DMMA 1Q40A 5AEUB 5IF6A 1C7HA 1JN5B 3H51A 3KE7A 3E99A 2GBWB 3FF2A 5DREA 4U13A 4WWUC 5CXOA 3F8XA 1ZX2A 3JUMA 1ULJB 4R9LA 4HKVB 1W6YA 1GS3A 5FW5A 1ZO2A 6STDA 3EBTA 1JB4A 1U5OA 5BVBA 1QMAA 3F40A 5KP4A 4Q53A 1BUQA 2HMJB 3OXAA 1OF5A 3FLJA 5D81A 4HM1B 3GZRA 4K1VA 3B4PA 2Z77A 2BMRB 3ROBA 3EN8A 3MYTA 5IG0A 3FZWA 2XSOB 3F7SA 2CHCA 4HJLB 2BNGA 3F14A 1O7HB 1O7WB 2JQ5A 2YFIB 1DMNA 1E3VA 1UUVB 3MKIA 3EX9A 1JN5A 1NU3A 1OH0A 1OHSA 3MG2A 4WYKB 4XDWA 4HM0B 3VSYA 1JKGB 4HVNA 2B24B 3EN1B 2HMOB 2XRXB 1UUWB 3JUNA 3CPOA 4HM2B 4XBYA 5IG5A 5IENA 1TP6A 2A15A 2INXA 4K1UA 4MJDA 3EQQB 4J8TA 4FCJA 2QIYA 3FF0A 3G8ZA 3RGAA 3SEDA 5CK6A 4H3UA 3HX8A 4HM3B 1GYBA 3T8UA 2RFRA 2K54A 3KZTA 1O7NB 3FH1A 4X2HA 5KP1A 2CKFB 2HMNB 5CF1A 3STDA 3Q90A 5AIHA 3WMDA 2F86B 3MG3A 1OHOA 1OCVA 3M8CA 4OVMA 1A2KA 1Q42A 3KSPA 2HMKB 3G0KA 4R9KA 3FGYA 1W00A 3JUQA 4L7KA 2RCDA
chains in the Genus database with same CATH superfamily
1X1UA 1VQQA 3WOEB 4BU4A 1BOXA 5TGNA 1RRLA 1RKYA 3EHCA 1STFI 3NM2A 4LMIA 3S27A 1W2ZA 1FUTA 4WYKA 2XFTA 1R4YA 2R4IA 2YX9A 1RCKA 5AIFA 1E97A 1QJGA 3CMA3 2CG1A 3CNMA 1GY5A 2XF3A 3BNCA 3LYGA 5IG4A 2FGTA 3SYUA 3CC73 1SPUA 3I563 1YGWA 1G0TA 4HM8B 3X3ZA 1CYUA 1JKGA 4BIRA 3LMLA 4RNZA 1B2ZA 2H0GA 1W01A 4K90B 1BGSA 4LZIA 3K63A 1AR0A 2IMJA 2STDA 1VQL3 1MOLA 2HMMB 2BO9B 3K0ZA 4X2OA 3U97A 1VQ63 1HU9A 3G16A 2GSPA 4L8OA 1HKXA 4GHOA 2KCDA 4ILFA 4BTWA 1BNIA 1GOUA 5IERA 3CME3 3LTCA 1CYVA 1UCIA 2XFSA 4N6NB 9RNTA 2XSHB 3EB8A 4HYZA 1BVIA 5AYSC 1RHLA 4EV5A 2BMOB 3MG1A 1LXEA 4RNTA 1RN4A 4PEJA 1RSNA 1IVUA 2YFJB 2MC8A 3O8YA 3FKAA 2CFKA 3WHOA 1NO3A 3CXC2 2ZA4A 1UW1A 5IG3A 4J9AA 4RZMA 1FZUA 3NV0B 2F4YA 2Y74A 1JJ22 2FXTA 2P38A 1RGLA 4N3VA 3BB9A 1UDII 3HI7A 4O02B 2GBXB 4HM5B 3G6E3 1OHPA 3FSDA 2HMLB 3JVCA 2P09A 3CCL3 2KXGA 5DRVA 2W6JH 2CC3A 3LZAA 5KP3A 1J2BA 3X40A 3GRDA 3RGRA 1UGIA 1A2VA 1OPYA 3CCS3 1WQLB 2Y73A 4HBRA 1JB5A 1YNVX 3B8LA 3GZXB 5IEOA 1GMPA 1TRQA 3FCSB 2HOHA 3GZYB 4BL3A 3OWYA 1DVCA 1MWTA 1Q814 1K41A 1UI7A 2E2TA 3PS8A 1VQ53 3GZBA 3EF8A 4R4KA 2P0MA 1BUJA 1US1A 1LNHA 3HK4A 3ER7A 5LC7A 1FGOA 3L0RA 2F56A 3D9RA 1YJ93 2P05A 3B7CA 2GEYA 2Z6BA 1FGQA 3WR2A 2CK3H 1BSCA 4EV2A 1TUHA 3F9SA 1IK3A 3DY5A 2RSXA 1M9GA 3OW22 3LTAA 1BRGA 1BSAA 1FYSA 1PYLA 2O3OA 2QGUA 2V1LA 4R1KA 4DKIA 1BNGA 5G2GA 2F99A 1WMNA 3WOFB 1QVG2 3BU4A 3I0YA 3I553 1K734 3EJVA 1RGAA 2MF7A 3F7XA 3URPA 3PCSA 2OWPA 3PXMA 3S5CA 1K9M4 3B4OA 3KCHA 3CNXA 2I9WA 4FMDA 1QAKA 4TX4A 1MGWA 5RNTA 1NB3I 2IUKA 4MMZB 2BMQB 4IIAA 5AI1A 4STDA 3DM8A 3OWUA 1AV4A 1EG9B 3KKGA 1STDA 1VQM3 4HZ9B 4KVHA 2CW9A 3D3LA 3DMCA 3V98A 3JUOA 5AEWB 1U8CB 5JPPA 2OOVC 1B2UA 2F98A 1GSPA 4RNYA 3OX9A 2JDIH 4GSPA 4LYLB 1DYUA 3MHEA 5EVHA 4H61A 5STDA 2OQEA 5JPUA 2SARA 3DGNA 2B1XB 1G96A 3Q1CA 1W02A 2CFLA 2OTJ3 1EA2A 4O3VA 1IQ8A 3UNLA 3PGBA 2M7OA 3K9MC 3DUKA 3GWRA 1UCLA 2O9UX 1O7GB 4LEHA 1LOXA 1JB2A 1N8QA 1I70A 4KFDA 5G1KA 4BL2A 1O7MB 3U1WA 1IDPA 1M1K4 1ASKA 1A67A 3MSOA 1OGZA 4XBTA 3AGNA 8CHOA 4N6UA 1BSDA 4N6V0 3SOYA 4HM4B 3LH4A 4HM7B 1B21A 1T2IA 4L8PA 5D83A 3NV0A 5CF2A 2CWTA 2GU1A 3CU3A 1LOWA 3HZPA 3ZG5A 1IT7A 4N6MA 1W5ZA 2XR8B 1EUIC 1MWUA 4OK0A 4XDVA 1CQSA 1Q40B 3Q3FA 4K61A 5D82A 3T8NA 1BRHA 1ROVA 1Z1SA 1NNVA 1VQK3 4GB5A 5BU4A 3BLZA 5M19A 1A90A 4XB5A 1RGEA 3SLUA 1EQKA 2W56A 1BNFA 2W03A 1BANA 3EBYA 4KZ1A 5AIIA 4EW5A 4JF8A 4MMXB 1QVF2 1YJW3 3K7CA 5HGRA 1IT8A 1I2FA 3CCV3 3AGOA 2CFDA 1LQGC 1N5PA 3X3XA 5CLKA 3FG3A 2R41A 3IMAB 1SIIA 2CH9A 3IPTA 3PZWA 1B3SA 1A2PA 1AVLA 4FCZA 5BXQA 4LSOA 3PCRA 7STDA 3IJEB 2AADA 1JRQA 2QEX3 3FG1A 1RTUA 1AQZA 1KSIA 2BT3A 1GD4A 2H0IA 4LGQA 2W2CA 1WMPA 5GSPA 2Q07A 2Z76A 1MNLA 3NUVA 4XM4A 3J7Yd 2C11A 2YFLB 5ELJA 1I2GA 3NHXA 1LOYA 1DMQA 3NX0A 1B2XA 2Z7AA 3A5EA 4ORLA 1JBSA 1YVSA 3D5IA 4XBXA 1W7CA 2IUJA 1RNBA 3JUPA 4FR9A 1WMOA 3NBRA 1TRPA 3A76A 2D42A 1RGGA 1KC84 3LTDA 1I0XA 1ISKA 4MMYB 1JZOA 5AIGA 3EC9A 1NDOB 1TIJA 1ULIB 2LYXA 2XGLA 4J5KA 3VGNA 1FGMA 1BRSA 1OGXA 3LT8A 3LXUX 2WOFA 4HZBB 2W56B 1JV2B 1Q9EA 1SIHA 3DGOA 3OV4A 4FMCA 1Q7Y4 3CCR3 1D6ZA 1TJDA 3NXJA 4WFOA 3BNDA 1G02A 2BU4A 4HOHA 2GEXA 4AKYA 1B27A 1NWWA 4BTYA 1OF5B 1RGHA 2GXFA 4I4KA 1MGRA 3SVAA 2W04A 3UL6A 1O7PB 4I5QA 3SXXA 1YGEA 3GAXA 3UJMA 1KWIA 4RBNA 3NBBA 5IEPA 3CCU3 4J5GA 1YJN3 4WP5A 4MEIA 2KAAA 1UUGB 3S29A 2PNCA 1FGRA 2W9QA 4HAAA 2CWVA 1W4NA 1T3BA 1IVWA 3WA2X 1D6YA 1S5AA 2IYJA 3KN4A 2OQEC 2IA7A 1TFOA 1UCKA 3HIGA 3N9HA 3Q2PA 4NREA 1DVDA 1B2MA 1E3RA 4OUQA 1W6GA 1VQ43 2RCDA 3F8HA 3GSPA 1I2EA 1RRHA 2PZVA 2UX0A 3OWSA 3DXOA 3MPHA 1VZZA 4HM6B 1RJOA 4JRFA 1GY7A 1YIT3 3DGYA 3ZG0A 1OUNA 4FCMA 1JZDA 3SOAA 3DZLA 2F5MA 5IW9A 4KFFA 1GY6A 1W6CA 3ECFA 1VQN3 3H3HA 1PU4A 1LQMB 1B2SA 4CDLA 2RGQA 1BU4A 1SJWA 1DMMA 1Q40A 5AEUB 3G4S3 2IY2A 1GOVA 1LRAA 1SARA 5IF6A 3X42A 1BRIA 5I97A 2L1SA 1UGHI 4N6OB 1C7HA 1RMSA 3CCJ3 2CG0A 1I3FA 3ZFZA 4NPBA 1V58A 1JN5B 3H51A 4AKZA 3CCQ3 3KE7A 3DGMA 1DETA 2D1WA 2K3DA 2LQVA 2OCTA 4G1MB 1YIJ3 2E2VA 3E99A 1N8R4 3ALAA 3HOHA 1RNTA 3T0UA 2GBWB 1UI8A 3FF2A 1YI23 5ELUA 1FW7A 1LOVA 1Q824 5DREA 3WDGB 4U13A 3BNBA 3HIIA 4CPKA 5HOHA 1N9EA 4WWUC 5CXOA 3F8XA 1ZX2A 3JUMA 3CD63 4N6LA 1ULJB 1GOYA 1LVNA 2XEPA 3PYJA 4HKVB 4R9LA 1W6YA 1GS3A 1QALA 2UUGC 2WGQA 5FW5A 3UB1A 4EC6A 1ZO2A 6STDA 3EBTA 1M1XB 1JB4A 2KF4A 1FGTA 1U5OA 3LOYA 5M1AA 5BVBA 1TTOA 2W0QA 4AEQA 1QMAA 3CCM3 3F40A 3N8BA 1KQS2 1EEJA 4CJNA 2H0HA 2W9PA 3V92A 1IU7A 2BHMA 5KP4A 4Q53A 1BUQA 2HMJB 1RGKA 5EEOA 1I3IA 1K28A 3S67A 4ZM8A 1KD14 1CEWI 3AHSA 4EBGA 1BRNL 1MWSA 3OXAA 2E2UA 1OF5A 1QAFA 1BNRA 1PFPA 2J8XB 1HYFA 3FLJA 4O2HA 1GD3A 5D81A 5AYRB 1JNQA 4HM1B 3G713 1PY3A 1WNHA 3GZRA 3K5TA 4K1VA 3B4PA 4KFEA 4IT7A 1K8A4 1VQ93 2ML5A 3V99A 3WA3A 3CC43 2Z77A 1N9JA 2BMRB 3ROBA 3EN8A 1FA3A 3MYTA 2OOVA 2WOHA 6RNTA 2CX1A 5IG0A 1RDSA 3BNEA 3AMOB 8RNTA 3WODG 3S28A 3FZWA 1Q864 3KSED 2KRTA 2ZDJA 2XSOB 3KFQC 3NBJA 5FGOA 1T2HA 3F7SA 4FMBA 1IVVA 1BRKA 1W2B2 1NB5I 7RNTA 2QA43 2CHCA 3N54B 1N5HA 4HJLB 2CFWA 2BNGA 1RN7A 3DGLA 1BIRA 1O7HB 1O7WB 2KF3A 3F14A 2K0MA 1IYYA 1X1WA 2JQ5A 2YFIB 1DMNA 1E3VA 3NM7A 4GL6A 1UUVB 3MKIA 3UL5A 4N6TA 1IV9A 3EX9A 1BRJA 1JN5A 4BTXA 1NU3A 3SX1A 2L4VA 2XGNA 1OH0A 1GMRA 1OHSA 3MG2A 4WYKB 1ROAA 2OTL3 2CX0A 4XDWA 1VQ73 1LNIA 1B20A 3TDGA 1V57A 3KIIA 1R4CA 4HM0B 1IQYA 1HZ1A 7GSPA 3VSYA 2CIUA 1IV7A 2SBLA 4FMAA 3D4AA 4CCVA 1JKGB 4HVNA 2B24B 1VQP3 3EN1B 1BSEA 4O8SA 2HMOB 2XRXB 1UUWB 1YHQ3 1C54A 3JUNA 3NQYA 4IPBA 1F8NA 3NQZA 3CPOA 3MWZA 4HM2B 1X1YA 3DH2A 4XBYA 5IG5A 3BIRA 2AAEA 5IENA 1TP6A 4KT3B 4QWTA 1VQO3 1JBRA 2A15A 1DE3A 3LTBA 2F5WA 1BNSA 2INXA 2WGOA 1RLSA 4K1UA 4MJDA 4R80A 5LC6A 3EQQB 1M904 5BIRA 4J8TA 4FCJA 2QIYA 5M18A 1YVBI 3FF0A 3G8ZA 3RGAA 3SEDA 5CK6A 3CCE3 4H3UA 1BAOA 1RGFA 1D6UA 3LT9A 1I8VA 3QRDA 3X41A 5A0OB 3RDEA 4WHAA 3HX8A 1IVXA 4HM3B 4NHFA 1IQXA 1VQ83 1V74A 1GYBA 1Q7HA 3EE1A 3QK9A 1BSBA 3CC23 2C10A 3T8UA 2RFRA 1Y4KA 2C4BA 2KF6A 3RNTA 2K54A 3KZTA 1TFKA 4EXRA 1RN1A 2FNQA 1RCLA 2GU3A 2ML6A 2CFGA 1I0VA 1O7NB 3FH1A 1GMQA 1BNEA 4X2HA 1FUSA 1SQWA 2KF5A 4EYCA 1MWRA 1JBTA 1BNJA 2UGIA 3FG4A 2ZL8A 1ZGXA 3VF1A 5KP1A 2CKFB 2HMNB 5CF1A 1OACA 2BIRA 2P0XA 2ZHXB 1CH0A 3STDA 2RBIA 1UCJA 3Q90A 3AMOA 5AIHA 3WMDA 2XH9A 3D79A 1X1XA 2F86B 3MG3A 1L5GB 1NJI4 2RNTA 1AY7A 1OHOA 1OCVA 3M8CA 5EQLA 1WTHA 4OVMA 1A2KA 1Q42A 1EKMA 1RGCA 5G1LA 3KSPA 2HMKB 3G0KA 3X3YA 4R9KA 3D5GA 6GSPA 3FGYA 1ZS7A 1S723 2CWUA 1TU5A 1W00A 5JBSA 3AHWA 3CPW2 3JUQA 2WO0A 4L7KA 1AVKA 1FUWA 1T5YA
chains in the Genus database with same CATH topology
3WOEB 5TGNA 1RRLA 1RKYA 3EHCA 1STFI 3NM2A 4LMIA 3S27A 1W2ZA 4WYKA 2XFTA 2R4IA 2YX9A 5AIFA 1E97A 1QJGA 3CMA3 2CG1A 3CNMA 1GY5A 2XF3A 3BNCA 3LYGA 5IG4A 2FGTA 3CC73 1SPUA 3I563 1CYUA 4HM8B 3X3ZA 1JKGA 3LMLA 4RNZA 1W01A 4K90B 4LZIA 3K63A 1AR0A 2IMJA 2STDA 1VQL3 1MOLA 2HMMB 2BO9B 3K0ZA 4X2OA 3U97A 1VQ63 1HU9A 3G16A 4L8OA 1HKXA 4BTWA 2KCDA 3CME3 5IERA 3LTCA 1CYVA 2XFSA 4N6NB 2XSHB 3EB8A 4HYZA 5AYSC 4EV5A 2BMOB 3MG1A 1LXEA 4PEJA 2YFJB 1IVUA 2MC8A 3O8YA 3FKAA 2CFKA 3CXC2 1NO3A 1UW1A 5IG3A 4J9AA 4RZMA 3NV0B 2Y74A 1JJ22 2FXTA 2P38A 4N3VA 3BB9A 3HI7A 4O02B 2GBXB 4HM5B 3G6E3 1OHPA 3FSDA 2HMLB 3JVCA 2P09A 3CCL3 2KXGA 5DRVA 2W6JH 2CC3A 3LZAA 5KP3A 1J2BA 3X40A 3GRDA 3RGRA 1A2VA 1OPYA 3CCS3 1WQLB 2Y73A 4HBRA 1JB5A 3B8LA 5IEOA 3GZXB 3FCSB 3GZYB 3OWYA 1DVCA 1Q814 1K41A 1UI7A 2E2TA 3PS8A 1VQ53 3GZBA 3EF8A 4R4KA 2P0MA 1US1A 1LNHA 3HK4A 3ER7A 5LC7A 1FGOA 3L0RA 3D9RA 1YJ93 2P05A 3B7CA 2GEYA 2Z6BA 1FGQA 2CK3H 4EV2A 1TUHA 3F9SA 1IK3A 3DY5A 2RSXA 1M9GA 3OW22 3LTAA 2O3OA 2QGUA 4R1KA 2V1LA 5G2GA 1AVKA 2F99A 1WMNA 3WOFB 1QVG2 3I0YA 3I553 1K734 3EJVA 2MF7A 3F7XA 3PCSA 2OWPA 3PXMA 3S5CA 1K9M4 3B4OA 4FMDA 3CNXA 2I9WA 4TX4A 1QAKA 1NB3I 2IUKA 4MMZB 2BMQB 4IIAA 5AI1A 4STDA 3DM8A 3OWUA 1AV4A 1EG9B 3KKGA 1STDA 1VQM3 4HZ9B 4KVHA 2CW9A 3D3LA 3DMCA 3V98A 3JUOA 5AEWB 1U8CB 5JPPA 2OOVC 2F98A 4RNYA 3OX9A 2JDIH 5EVHA 5STDA 1DYUA 3MHEA 5JPUA 4H61A 2OQEA 3DGNA 2B1XB 1G96A 3Q1CA 1W02A 2CFLA 2OTJ3 1EA2A 4O3VA 1IQ8A 3UNLA 3PGBA 2M7OA 3K9MC 3DUKA 3GWRA 2O9UX 1O7GB 4LEHA 1LOXA 1JB2A 1N8QA 4KFDA 1O7MB 3U1WA 1IDPA 1M1K4 1ASKA 1A67A 3MSOA 1OGZA 4XBTA 8CHOA 4N6UA 3SOYA 4N6V0 4HM4B 3LH4A 4HM7B 4L8PA 5CF2A 5D83A 3NV0A 2CWTA 2GU1A 3CU3A 3HZPA 1IT7A 4N6MA 1W5ZA 2XR8B 4OK0A 4XDVA 1CQSA 1Q40B 4K61A 5D82A 3T8NA 1ROVA 1Z1SA 1VQK3 4GB5A 3BLZA 1A90A 4XB5A 3SLUA 1EQKA 2W56A 3EBYA 2W03A 5AIIA 4KZ1A 1QVF2 4JF8A 4MMXB 1YJW3 3K7CA 5HGRA 1IT8A 3CCV3 2CFDA 1N5PA 3X3XA 5CLKA 3FG3A 3IMAB 3IPTA 1SIIA 2CH9A 3PZWA 1AVLA 4FCZA 5BXQA 4LSOA 3PCRA 7STDA 3IJEB 2QEX3 1JRQA 3FG1A 1KSIA 2BT3A 1GD4A 4LGQA 2W2CA 1WMPA 2Q07A 2Z76A 1MNLA 3NUVA 4XM4A 3J7Yd 2C11A 2YFLB 5ELJA 3NHXA 3NX0A 1DMQA 2Z7AA 4ORLA 4XBXA 1W7CA 2IUJA 3JUPA 4FR9A 1WMOA 3NBRA 3A76A 2D42A 1KC84 3LTDA 1ISKA 4MMYB 5AIGA 3EC9A 1NDOB 1TIJA 1ULIB 2LYXA 2XGLA 3VGNA 1TU5A 1FGMA 1OGXA 3LT8A 3LXUX 2WOFA 4HZBB 2W56B 1JV2B 4FMCA 1SIHA 3DGOA 3OV4A 1Q7Y4 3CCR3 1D6ZA 3NXJA 4WFOA 3BNDA 4BTYA 4AKYA 2GEXA 1NWWA 1OF5B 4I4KA 2GXFA 3SVAA 3UL6A 2W04A 1O7PB 3SXXA 1YGEA 3GAXA 3UJMA 1KWIA 4RBNA 3NBBA 5IEPA 3CCU3 1YJN3 4WP5A 4MEIA 3S29A 2PNCA 1FGRA 2W9QA 2CWVA 1W4NA 3WA2X 1IVWA 1D6YA 1S5AA 3KN4A 2OQEC 2IA7A 1TFOA 3HIGA 3Q2PA 3N9HA 4NREA 1DVDA 1E3RA 4OUQA 1W6GA 1VQ43 3F8HA 3OWSA 1RRHA 2PZVA 2UX0A 3DXOA 3MPHA 1VZZA 4HM6B 1RJOA 4JRFA 1GY7A 1YIT3 1OUNA 4FCMA 3SOAA 3DZLA 5IW9A 4KFFA 1GY6A 1W6CA 3ECFA 1VQN3 3H3HA 1PU4A 4CDLA 2RGQA 1SJWA 1DMMA 1Q40A 5AEUB 3G4S3 5IF6A 3X42A 5I97A 4N6OB 1C7HA 3CCJ3 2CG0A 4AKZA 1JN5B 3H51A 3CCQ3 3KE7A 3DGMA 2D1WA 2LQVA 2OCTA 4G1MB 1YIJ3 2E2VA 3E99A 1N8R4 3ALAA 3T0UA 2GBWB 1UI8A 3FF2A 1YI23 5ELUA 1Q824 5DREA 3WDGB 4U13A 3BNBA 3HIIA 1N9EA 4WWUC 5CXOA 3F8XA 1ZX2A 3JUMA 3CD63 4N6LA 1ULJB 1LVNA 2XEPA 3PYJA 4HKVB 4R9LA 1W6YA 1GS3A 1QALA 2WGQA 5FW5A 3UB1A 4EC6A 1ZO2A 6STDA 3EBTA 1M1XB 1JB4A 1FGTA 1U5OA 3LOYA 5BVBA 2W0QA 4AEQA 1QMAA 3CCM3 3F40A 3N8BA 1KQS2 2W9PA 3V92A 1IU7A 2BHMA 5KP4A 4Q53A 1BUQA 2HMJB 5EEOA 1K28A 3S67A 4ZM8A 1KD14 1CEWI 4EBGA 3OXAA 2E2UA 1OF5A 1QAFA 1PFPA 3FLJA 4O2HA 1GD3A 5D81A 5AYRB 1JNQA 4HM1B 3G713 1WNHA 3GZRA 3K5TA 4K1VA 3B4PA 4KFEA 4IT7A 1K8A4 1VQ93 2ML5A 3V99A 3WA3A 3CC43 2Z77A 1N9JA 2BMRB 3ROBA 3EN8A 1FA3A 3MYTA 2OOVA 2WOHA 5IG0A 3BNEA 3AMOB 3WODG 3S28A 3FZWA 1Q864 3KSED 2KRTA 2ZDJA 2XSOB 3KFQC 3NBJA 5FGOA 3F7SA 4FMBA 1IVVA 1W2B2 1NB5I 2QA43 2CHCA 3N54B 1N5HA 4HJLB 2CFWA 2BNGA 1RN7A 3DGLA 3F14A 1O7HB 1O7WB 2K0MA 2JQ5A 2YFIB 1DMNA 1E3VA 3NM7A 4GL6A 1UUVB 3MKIA 3UL5A 4N6TA 1IV9A 3EX9A 1JN5A 4BTXA 1NU3A 3SX1A 2L4VA 2XGNA 1OH0A 1OHSA 3MG2A 4WYKB 1ROAA 2OTL3 4XDWA 1VQ73 3TDGA 3KIIA 1R4CA 4HM0B 1IQYA 3VSYA 2CIUA 1IV7A 2SBLA 4FMAA 4CCVA 1JKGB 4HVNA 2B24B 1VQP3 3EN1B 4O8SA 2HMOB 2XRXB 1UUWB 1YHQ3 3JUNA 3NQYA 4IPBA 1F8NA 3NQZA 3CPOA 3MWZA 4HM2B 4XBYA 5IG5A 5IENA 1VQO3 1TP6A 4QWTA 2A15A 3LTBA 2INXA 2WGOA 4R80A 4K1UA 4MJDA 5LC6A 3EQQB 1M904 4J8TA 4FCJA 2QIYA 1YVBI 3FF0A 3G8ZA 3RGAA 3SEDA 5CK6A 3CCE3 4H3UA 3X41A 1D6UA 3LT9A 5A0OB 3QRDA 3RDEA 4WHAA 3HX8A 1IVXA 4HM3B 4NHFA 1IQXA 1VQ83 1V74A 1GYBA 3EE1A 3QK9A 3CC23 2C10A 3T8UA 2RFRA 1Y4KA 2K54A 3KZTA 1TFKA 4EXRA 2FNQA 2GU3A 2ML6A 2CFGA 1O7NB 3FH1A 4X2HA 1SQWA 4EYCA 3FG4A 2ZL8A 3VF1A 5KP1A 2CKFB 2HMNB 5CF1A 1OACA 3STDA 2P0XA 3Q90A 3AMOA 5AIHA 3WMDA 2XH9A 2F86B 3MG3A 1L5GB 1NJI4 1OHOA 1OCVA 3M8CA 5EQLA 1WTHA 4OVMA 1A2KA 1Q42A 1EKMA 3KSPA 2HMKB 3G0KA 3X3YA 4R9KA 3FGYA 1S723 2CWUA 1W00A 5JBSA 3CPW2 3JUQA 2WO0A 4L7KA 2RCDA 1FUWA 1T5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TGN A;  3EHC A;  3NM2 A;  4LMI A;  4WYK A;  2R4I A;  5AIF A;  1E97 A;  1QJG A;  3CNM A;  1GY5 A;  3LYG A;  5IG4 A;  4HM8 B;  1JKG A;  1W01 A;  1AR0 A;  2IMJ A;  2STD A;  2HMM B;  3K0Z A;  4X2O A;  3G16 A;  4L8O A;  1HKX A;  5IER A;  2XSH B;  2BMO B;  3MG1 A;  4PEJ A;  2YFJ B;  3FKA A;  5IG3 A;  4J9A A;  4RZM A;  3NV0 B;  4N3V A;  3BB9 A;  2GBX B;  4HM5 B;  1OHP A;  3FSD A;  2HML B;  5DRV A;  3LZA A;  5KP3 A;  3GRD A;  3RGR A;  1OPY A;  1WQL B;  1JB5 A;  3B8L A;  5IEO A;  3GZX B;  3GZY B;  3OWY A;  1K41 A;  3GZB A;  3EF8 A;  3HK4 A;  3ER7 A;  3D9R A;  3B7C A;  2GEY A;  1TUH A;  3F9S A;  2QGU A;  4R1K A;  5G2G A;  2F99 A;  3I0Y A;  3EJV A;  3F7X A;  2OWP A;  3S5C A;  3B4O A;  3CNX A;  2I9W A;  2BMQ B;  4IIA A;  5AI1 A;  4STD A;  3DM8 A;  3OWU A;  1EG9 B;  3KKG A;  1STD A;  4HZ9 B;  4KVH A;  5JPP A;  3DMC A;  5AEW B;  3JUO A;  2F98 A;  3OX9 A;  5EVH A;  5STD A;  5JPU A;  3MHE A;  2B1X B;  1W02 A;  1EA2 A;  3UNL A;  3DUK A;  3GWR A;  1O7G B;  4LEH A;  1JB2 A;  1O7M B;  1IDP A;  1ASK A;  3MSO A;  1OGZ A;  4XBT A;  8CHO A;  3SOY A;  4HM4 B;  4HM7 B;  4L8P A;  5CF2 A;  5D83 A;  3NV0 A;  3CU3 A;  3HZP A;  2XR8 B;  4XDV A;  1CQS A;  1Q40 B;  3T8N A;  5D82 A;  1Z1S A;  4GB5 A;  3BLZ A;  4XB5 A;  3EBY A;  5AII A;  3K7C A;  5HGR A;  5CLK A;  3IPT A;  5BXQ A;  7STD A;  4LGQ A;  2W2C A;  2Z76 A;  3NUV A;  4XM4 A;  2YFL B;  3NHX A;  1DMQ A;  2Z7A A;  4ORL A;  4XBX A;  3JUP A;  3NBR A;  3A76 A;  1ISK A;  5AIG A;  3EC9 A;  1NDO B;  1ULI B;  3VGN A;  1OGX A;  4HZB B;  3OV4 A;  3NXJ A;  2GEX A;  1NWW A;  1OF5 B;  4I4K A;  2GXF A;  1O7P B;  3UJM A;  5IEP A;  4WP5 A;  1S5A A;  1E3R A;  4OUQ A;  3F8H A;  3OWS A;  2PZV A;  2UX0 A;  3DXO A;  1VZZ A;  4HM6 B;  1GY7 A;  1OUN A;  4FCM A;  3SOA A;  3DZL A;  1GY6 A;  3ECF A;  3H3H A;  4CDL A;  2RGQ A;  1SJW A;  1DMM A;  1Q40 A;  5AEU B;  5IF6 A;  1C7H A;  1JN5 B;  3H51 A;  3KE7 A;  3E99 A;  2GBW B;  3FF2 A;  5DRE A;  4U13 A;  4WWU C;  5CXO A;  3F8X A;  1ZX2 A;  3JUM A;  1ULJ B;  4R9L A;  4HKV B;  1W6Y A;  1GS3 A;  5FW5 A;  1ZO2 A;  6STD A;  3EBT A;  1JB4 A;  1U5O A;  5BVB A;  1QMA A;  3F40 A;  5KP4 A;  4Q53 A;  1BUQ A;  2HMJ B;  3OXA A;  1OF5 A;  3FLJ A;  5D81 A;  4HM1 B;  3GZR A;  4K1V A;  3B4P A;  2Z77 A;  2BMR B;  3ROB A;  3EN8 A;  3MYT A;  5IG0 A;  3FZW A;  2XSO B;  3F7S A;  2CHC A;  4HJL B;  2BNG A;  3F14 A;  1O7H B;  1O7W B;  2JQ5 A;  2YFI B;  1DMN A;  1E3V A;  1UUV B;  3MKI A;  3EX9 A;  1JN5 A;  1NU3 A;  1OH0 A;  1OHS A;  3MG2 A;  4WYK B;  4XDW A;  4HM0 B;  3VSY A;  1JKG B;  4HVN A;  2B24 B;  3EN1 B;  2HMO B;  2XRX B;  1UUW B;  3JUN A;  3CPO A;  4HM2 B;  4XBY A;  5IG5 A;  5IEN A;  1TP6 A;  2A15 A;  2INX A;  4K1U A;  4MJD A;  3EQQ B;  4J8T A;  4FCJ A;  2QIY A;  3FF0 A;  3G8Z A;  3RGA A;  3SED A;  5CK6 A;  4H3U A;  3HX8 A;  4HM3 B;  1GYB A;  3T8U A;  2RFR A;  2K54 A;  3KZT A;  1O7N B;  3FH1 A;  4X2H A;  5KP1 A;  2CKF B;  2HMN B;  5CF1 A;  3STD A;  3Q90 A;  5AIH A;  3WMD A;  2F86 B;  3MG3 A;  1OHO A;  1OCV A;  3M8C A;  4OVM A;  1A2K A;  1Q42 A;  3KSP A;  2HMK B;  3G0K A;  4R9K A;  3FGY A;  1W00 A;  3JUQ A;  4L7K A;  2RCD A; 
#chains in the Genus database with same CATH topology
 1X1U A;  1VQQ A;  3WOE B;  4BU4 A;  1BOX A;  5TGN A;  1RRL A;  1RKY A;  3EHC A;  1STF I;  3NM2 A;  4LMI A;  3S27 A;  1W2Z A;  1FUT A;  4WYK A;  2XFT A;  1R4Y A;  2R4I A;  2YX9 A;  1RCK A;  5AIF A;  1E97 A;  1QJG A;  3CMA 3;  2CG1 A;  3CNM A;  1GY5 A;  2XF3 A;  3BNC A;  3LYG A;  5IG4 A;  2FGT A;  3SYU A;  3CC7 3;  1SPU A;  3I56 3;  1YGW A;  1G0T A;  4HM8 B;  3X3Z A;  1CYU A;  1JKG A;  4BIR A;  3LML A;  4RNZ A;  1B2Z A;  2H0G A;  1W01 A;  4K90 B;  1BGS A;  4LZI A;  3K63 A;  1AR0 A;  2IMJ A;  2STD A;  1VQL 3;  1MOL A;  2HMM B;  2BO9 B;  3K0Z A;  4X2O A;  3U97 A;  1VQ6 3;  1HU9 A;  3G16 A;  2GSP A;  4L8O A;  1HKX A;  4GHO A;  2KCD A;  4ILF A;  4BTW A;  1BNI A;  1GOU A;  5IER A;  3CME 3;  3LTC A;  1CYV A;  1UCI A;  2XFS A;  4N6N B;  9RNT A;  2XSH B;  3EB8 A;  4HYZ A;  1BVI A;  5AYS C;  1RHL A;  4EV5 A;  2BMO B;  3MG1 A;  1LXE A;  4RNT A;  1RN4 A;  4PEJ A;  1RSN A;  1IVU A;  2YFJ B;  2MC8 A;  3O8Y A;  3FKA A;  2CFK A;  3WHO A;  1NO3 A;  3CXC 2;  2ZA4 A;  1UW1 A;  5IG3 A;  4J9A A;  4RZM A;  1FZU A;  3NV0 B;  2F4Y A;  2Y74 A;  1JJ2 2;  2FXT A;  2P38 A;  1RGL A;  4N3V A;  3BB9 A;  1UDI I;  3HI7 A;  4O02 B;  2GBX B;  4HM5 B;  3G6E 3;  1OHP A;  3FSD A;  2HML B;  3JVC A;  2P09 A;  3CCL 3;  2KXG A;  5DRV A;  2W6J H;  2CC3 A;  3LZA A;  5KP3 A;  1J2B A;  3X40 A;  3GRD A;  3RGR A;  1UGI A;  1A2V A;  1OPY A;  3CCS 3;  1WQL B;  2Y73 A;  4HBR A;  1JB5 A;  1YNV X;  3B8L A;  3GZX B;  5IEO A;  1GMP A;  1TRQ A;  3FCS B;  2HOH A;  3GZY B;  4BL3 A;  3OWY A;  1DVC A;  1MWT A;  1Q81 4;  1K41 A;  1UI7 A;  2E2T A;  3PS8 A;  1VQ5 3;  3GZB A;  3EF8 A;  4R4K A;  2P0M A;  1BUJ A;  1US1 A;  1LNH A;  3HK4 A;  3ER7 A;  5LC7 A;  1FGO A;  3L0R A;  2F56 A;  3D9R A;  1YJ9 3;  2P05 A;  3B7C A;  2GEY A;  2Z6B A;  1FGQ A;  3WR2 A;  2CK3 H;  1BSC A;  4EV2 A;  1TUH A;  3F9S A;  1IK3 A;  3DY5 A;  2RSX A;  1M9G A;  3OW2 2;  3LTA A;  1BRG A;  1BSA A;  1FYS A;  1PYL A;  2O3O A;  2QGU A;  2V1L A;  4R1K A;  4DKI A;  1BNG A;  5G2G A;  2F99 A;  1WMN A;  3WOF B;  1QVG 2;  3BU4 A;  3I0Y A;  3I55 3;  1K73 4;  3EJV A;  1RGA A;  2MF7 A;  3F7X A;  3URP A;  3PCS A;  2OWP A;  3PXM A;  3S5C A;  1K9M 4;  3B4O A;  3KCH A;  3CNX A;  2I9W A;  4FMD A;  1QAK A;  4TX4 A;  1MGW A;  5RNT A;  1NB3 I;  2IUK A;  4MMZ B;  2BMQ B;  4IIA A;  5AI1 A;  4STD A;  3DM8 A;  3OWU A;  1AV4 A;  1EG9 B;  3KKG A;  1STD A;  1VQM 3;  4HZ9 B;  4KVH A;  2CW9 A;  3D3L A;  3DMC A;  3V98 A;  3JUO A;  5AEW B;  1U8C B;  5JPP A;  2OOV C;  1B2U A;  2F98 A;  1GSP A;  4RNY A;  3OX9 A;  2JDI H;  4GSP A;  4LYL B;  1DYU A;  3MHE A;  5EVH A;  4H61 A;  5STD A;  2OQE A;  5JPU A;  2SAR A;  3DGN A;  2B1X B;  1G96 A;  3Q1C A;  1W02 A;  2CFL A;  2OTJ 3;  1EA2 A;  4O3V A;  1IQ8 A;  3UNL A;  3PGB A;  2M7O A;  3K9M C;  3DUK A;  3GWR A;  1UCL A;  2O9U X;  1O7G B;  4LEH A;  1LOX A;  1JB2 A;  1N8Q A;  1I70 A;  4KFD A;  5G1K A;  4BL2 A;  1O7M B;  3U1W A;  1IDP A;  1M1K 4;  1ASK A;  1A67 A;  3MSO A;  1OGZ A;  4XBT A;  3AGN A;  8CHO A;  4N6U A;  1BSD A;  4N6V 0;  3SOY A;  4HM4 B;  3LH4 A;  4HM7 B;  1B21 A;  1T2I A;  4L8P A;  5D83 A;  3NV0 A;  5CF2 A;  2CWT A;  2GU1 A;  3CU3 A;  1LOW A;  3HZP A;  3ZG5 A;  1IT7 A;  4N6M A;  1W5Z A;  2XR8 B;  1EUI C;  1MWU A;  4OK0 A;  4XDV A;  1CQS A;  1Q40 B;  3Q3F A;  4K61 A;  5D82 A;  3T8N A;  1BRH A;  1ROV A;  1Z1S A;  1NNV A;  1VQK 3;  4GB5 A;  5BU4 A;  3BLZ A;  5M19 A;  1A90 A;  4XB5 A;  1RGE A;  3SLU A;  1EQK A;  2W56 A;  1BNF A;  2W03 A;  1BAN A;  3EBY A;  4KZ1 A;  5AII A;  4EW5 A;  4JF8 A;  4MMX B;  1QVF 2;  1YJW 3;  3K7C A;  5HGR A;  1IT8 A;  1I2F A;  3CCV 3;  3AGO A;  2CFD A;  1LQG C;  1N5P A;  3X3X A;  5CLK A;  3FG3 A;  2R41 A;  3IMA B;  1SII A;  2CH9 A;  3IPT A;  3PZW A;  1B3S A;  1A2P A;  1AVL A;  4FCZ A;  5BXQ A;  4LSO A;  3PCR A;  7STD A;  3IJE B;  2AAD A;  1JRQ A;  2QEX 3;  3FG1 A;  1RTU A;  1AQZ A;  1KSI A;  2BT3 A;  1GD4 A;  2H0I A;  4LGQ A;  2W2C A;  1WMP A;  5GSP A;  2Q07 A;  2Z76 A;  1MNL A;  3NUV A;  4XM4 A;  3J7Y d;  2C11 A;  2YFL B;  5ELJ A;  1I2G A;  3NHX A;  1LOY A;  1DMQ A;  3NX0 A;  1B2X A;  2Z7A A;  3A5E A;  4ORL A;  1JBS A;  1YVS A;  3D5I A;  4XBX A;  1W7C A;  2IUJ A;  1RNB A;  3JUP A;  4FR9 A;  1WMO A;  3NBR A;  1TRP A;  3A76 A;  2D42 A;  1RGG A;  1KC8 4;  3LTD A;  1I0X A;  1ISK A;  4MMY B;  1JZO A;  5AIG A;  3EC9 A;  1NDO B;  1TIJ A;  1ULI B;  2LYX A;  2XGL A;  4J5K A;  3VGN A;  1FGM A;  1BRS A;  1OGX A;  3LT8 A;  3LXU X;  2WOF A;  4HZB B;  2W56 B;  1JV2 B;  1Q9E A;  1SIH A;  3DGO A;  3OV4 A;  4FMC A;  1Q7Y 4;  3CCR 3;  1D6Z A;  1TJD A;  3NXJ A;  4WFO A;  3BND A;  1G02 A;  2BU4 A;  4HOH A;  2GEX A;  4AKY A;  1B27 A;  1NWW A;  4BTY A;  1OF5 B;  1RGH A;  2GXF A;  4I4K A;  1MGR A;  3SVA A;  2W04 A;  3UL6 A;  1O7P B;  4I5Q A;  3SXX A;  1YGE A;  3GAX A;  3UJM A;  1KWI A;  4RBN A;  3NBB A;  5IEP A;  3CCU 3;  4J5G A;  1YJN 3;  4WP5 A;  4MEI A;  2KAA A;  1UUG B;  3S29 A;  2PNC A;  1FGR A;  2W9Q A;  4HAA A;  2CWV A;  1W4N A;  1T3B A;  1IVW A;  3WA2 X;  1D6Y A;  1S5A A;  2IYJ A;  3KN4 A;  2OQE C;  2IA7 A;  1TFO A;  1UCK A;  3HIG A;  3N9H A;  3Q2P A;  4NRE A;  1DVD A;  1B2M A;  1E3R A;  4OUQ A;  1W6G A;  1VQ4 3;  2RCD A;  3F8H A;  3GSP A;  1I2E A;  1RRH A;  2PZV A;  2UX0 A;  3OWS A;  3DXO A;  3MPH A;  1VZZ A;  4HM6 B;  1RJO A;  4JRF A;  1GY7 A;  1YIT 3;  3DGY A;  3ZG0 A;  1OUN A;  4FCM A;  1JZD A;  3SOA A;  3DZL A;  2F5M A;  5IW9 A;  4KFF A;  1GY6 A;  1W6C A;  3ECF A;  1VQN 3;  3H3H A;  1PU4 A;  1LQM B;  1B2S A;  4CDL A;  2RGQ A;  1BU4 A;  1SJW A;  1DMM A;  1Q40 A;  5AEU B;  3G4S 3;  2IY2 A;  1GOV A;  1LRA A;  1SAR A;  5IF6 A;  3X42 A;  1BRI A;  5I97 A;  2L1S A;  1UGH I;  4N6O B;  1C7H A;  1RMS A;  3CCJ 3;  2CG0 A;  1I3F A;  3ZFZ A;  4NPB A;  1V58 A;  1JN5 B;  3H51 A;  4AKZ A;  3CCQ 3;  3KE7 A;  3DGM A;  1DET A;  2D1W A;  2K3D A;  2LQV A;  2OCT A;  4G1M B;  1YIJ 3;  2E2V A;  3E99 A;  1N8R 4;  3ALA A;  3HOH A;  1RNT A;  3T0U A;  2GBW B;  1UI8 A;  3FF2 A;  1YI2 3;  5ELU A;  1FW7 A;  1LOV A;  1Q82 4;  5DRE A;  3WDG B;  4U13 A;  3BNB A;  3HII A;  4CPK A;  5HOH A;  1N9E A;  4WWU C;  5CXO A;  3F8X A;  1ZX2 A;  3JUM A;  3CD6 3;  4N6L A;  1ULJ B;  1GOY A;  1LVN A;  2XEP A;  3PYJ A;  4HKV B;  4R9L A;  1W6Y A;  1GS3 A;  1QAL A;  2UUG C;  2WGQ A;  5FW5 A;  3UB1 A;  4EC6 A;  1ZO2 A;  6STD A;  3EBT A;  1M1X B;  1JB4 A;  2KF4 A;  1FGT A;  1U5O A;  3LOY A;  5M1A A;  5BVB A;  1TTO A;  2W0Q A;  4AEQ A;  1QMA A;  3CCM 3;  3F40 A;  3N8B A;  1KQS 2;  1EEJ A;  4CJN A;  2H0H A;  2W9P A;  3V92 A;  1IU7 A;  2BHM A;  5KP4 A;  4Q53 A;  1BUQ A;  2HMJ B;  1RGK A;  5EEO A;  1I3I A;  1K28 A;  3S67 A;  4ZM8 A;  1KD1 4;  1CEW I;  3AHS A;  4EBG A;  1BRN L;  1MWS A;  3OXA A;  2E2U A;  1OF5 A;  1QAF A;  1BNR A;  1PFP A;  2J8X B;  1HYF A;  3FLJ A;  4O2H A;  1GD3 A;  5D81 A;  5AYR B;  1JNQ A;  4HM1 B;  3G71 3;  1PY3 A;  1WNH A;  3GZR A;  3K5T A;  4K1V A;  3B4P A;  4KFE A;  4IT7 A;  1K8A 4;  1VQ9 3;  2ML5 A;  3V99 A;  3WA3 A;  3CC4 3;  2Z77 A;  1N9J A;  2BMR B;  3ROB A;  3EN8 A;  1FA3 A;  3MYT A;  2OOV A;  2WOH A;  6RNT A;  2CX1 A;  5IG0 A;  1RDS A;  3BNE A;  3AMO B;  8RNT A;  3WOD G;  3S28 A;  3FZW A;  1Q86 4;  3KSE D;  2KRT A;  2ZDJ A;  2XSO B;  3KFQ C;  3NBJ A;  5FGO A;  1T2H A;  3F7S A;  4FMB A;  1IVV A;  1BRK A;  1W2B 2;  1NB5 I;  7RNT A;  2QA4 3;  2CHC A;  3N54 B;  1N5H A;  4HJL B;  2CFW A;  2BNG A;  1RN7 A;  3DGL A;  1BIR A;  1O7H B;  1O7W B;  2KF3 A;  3F14 A;  2K0M A;  1IYY A;  1X1W A;  2JQ5 A;  2YFI B;  1DMN A;  1E3V A;  3NM7 A;  4GL6 A;  1UUV B;  3MKI A;  3UL5 A;  4N6T A;  1IV9 A;  3EX9 A;  1BRJ A;  1JN5 A;  4BTX A;  1NU3 A;  3SX1 A;  2L4V A;  2XGN A;  1OH0 A;  1GMR A;  1OHS A;  3MG2 A;  4WYK B;  1ROA A;  2OTL 3;  2CX0 A;  4XDW A;  1VQ7 3;  1LNI A;  1B20 A;  3TDG A;  1V57 A;  3KII A;  1R4C A;  4HM0 B;  1IQY A;  1HZ1 A;  7GSP A;  3VSY A;  2CIU A;  1IV7 A;  2SBL A;  4FMA A;  3D4A A;  4CCV A;  1JKG B;  4HVN A;  2B24 B;  1VQP 3;  3EN1 B;  1BSE A;  4O8S A;  2HMO B;  2XRX B;  1UUW B;  1YHQ 3;  1C54 A;  3JUN A;  3NQY A;  4IPB A;  1F8N A;  3NQZ A;  3CPO A;  3MWZ A;  4HM2 B;  1X1Y A;  3DH2 A;  4XBY A;  5IG5 A;  3BIR A;  2AAE A;  5IEN A;  1TP6 A;  4KT3 B;  4QWT A;  1VQO 3;  1JBR A;  2A15 A;  1DE3 A;  3LTB A;  2F5W A;  1BNS A;  2INX A;  2WGO A;  1RLS A;  4K1U A;  4MJD A;  4R80 A;  5LC6 A;  3EQQ B;  1M90 4;  5BIR A;  4J8T A;  4FCJ A;  2QIY A;  5M18 A;  1YVB I;  3FF0 A;  3G8Z A;  3RGA A;  3SED A;  5CK6 A;  3CCE 3;  4H3U A;  1BAO A;  1RGF A;  1D6U A;  3LT9 A;  1I8V A;  3QRD A;  3X41 A;  5A0O B;  3RDE A;  4WHA A;  3HX8 A;  1IVX A;  4HM3 B;  4NHF A;  1IQX A;  1VQ8 3;  1V74 A;  1GYB A;  1Q7H A;  3EE1 A;  3QK9 A;  1BSB A;  3CC2 3;  2C10 A;  3T8U A;  2RFR A;  1Y4K A;  2C4B A;  2KF6 A;  3RNT A;  2K54 A;  3KZT A;  1TFK A;  4EXR A;  1RN1 A;  2FNQ A;  1RCL A;  2GU3 A;  2ML6 A;  2CFG A;  1I0V A;  1O7N B;  3FH1 A;  1GMQ A;  1BNE A;  4X2H A;  1FUS A;  1SQW A;  2KF5 A;  4EYC A;  1MWR A;  1JBT A;  1BNJ A;  2UGI A;  3FG4 A;  2ZL8 A;  1ZGX A;  3VF1 A;  5KP1 A;  2CKF B;  2HMN B;  5CF1 A;  1OAC A;  2BIR A;  2P0X A;  2ZHX B;  1CH0 A;  3STD A;  2RBI A;  1UCJ A;  3Q90 A;  3AMO A;  5AIH A;  3WMD A;  2XH9 A;  3D79 A;  1X1X A;  2F86 B;  3MG3 A;  1L5G B;  1NJI 4;  2RNT A;  1AY7 A;  1OHO A;  1OCV A;  3M8C A;  5EQL A;  1WTH A;  4OVM A;  1A2K A;  1Q42 A;  1EKM A;  1RGC A;  5G1L A;  3KSP A;  2HMK B;  3G0K A;  3X3Y A;  4R9K A;  3D5G A;  6GSP A;  3FGY A;  1ZS7 A;  1S72 3;  2CWU A;  1TU5 A;  1W00 A;  5JBS A;  3AHW A;  3CPW 2;  3JUQ A;  2WO0 A;  4L7K A;  1AVK A;  1FUW A;  1T5Y A; 
#chains in the Genus database with same CATH homology
 3WOE B;  5TGN A;  1RRL A;  1RKY A;  3EHC A;  1STF I;  3NM2 A;  4LMI A;  3S27 A;  1W2Z A;  4WYK A;  2XFT A;  2R4I A;  2YX9 A;  5AIF A;  1E97 A;  1QJG A;  3CMA 3;  2CG1 A;  3CNM A;  1GY5 A;  2XF3 A;  3BNC A;  3LYG A;  5IG4 A;  2FGT A;  3CC7 3;  1SPU A;  3I56 3;  1CYU A;  4HM8 B;  3X3Z A;  1JKG A;  3LML A;  4RNZ A;  1W01 A;  4K90 B;  4LZI A;  3K63 A;  1AR0 A;  2IMJ A;  2STD A;  1VQL 3;  1MOL A;  2HMM B;  2BO9 B;  3K0Z A;  4X2O A;  3U97 A;  1VQ6 3;  1HU9 A;  3G16 A;  4L8O A;  1HKX A;  4BTW A;  2KCD A;  3CME 3;  5IER A;  3LTC A;  1CYV A;  2XFS A;  4N6N B;  2XSH B;  3EB8 A;  4HYZ A;  5AYS C;  4EV5 A;  2BMO B;  3MG1 A;  1LXE A;  4PEJ A;  2YFJ B;  1IVU A;  2MC8 A;  3O8Y A;  3FKA A;  2CFK A;  3CXC 2;  1NO3 A;  1UW1 A;  5IG3 A;  4J9A A;  4RZM A;  3NV0 B;  2Y74 A;  1JJ2 2;  2FXT A;  2P38 A;  4N3V A;  3BB9 A;  3HI7 A;  4O02 B;  2GBX B;  4HM5 B;  3G6E 3;  1OHP A;  3FSD A;  2HML B;  3JVC A;  2P09 A;  3CCL 3;  2KXG A;  5DRV A;  2W6J H;  2CC3 A;  3LZA A;  5KP3 A;  1J2B A;  3X40 A;  3GRD A;  3RGR A;  1A2V A;  1OPY A;  3CCS 3;  1WQL B;  2Y73 A;  4HBR A;  1JB5 A;  3B8L A;  5IEO A;  3GZX B;  3FCS B;  3GZY B;  3OWY A;  1DVC A;  1Q81 4;  1K41 A;  1UI7 A;  2E2T A;  3PS8 A;  1VQ5 3;  3GZB A;  3EF8 A;  4R4K A;  2P0M A;  1US1 A;  1LNH A;  3HK4 A;  3ER7 A;  5LC7 A;  1FGO A;  3L0R A;  3D9R A;  1YJ9 3;  2P05 A;  3B7C A;  2GEY A;  2Z6B A;  1FGQ A;  2CK3 H;  4EV2 A;  1TUH A;  3F9S A;  1IK3 A;  3DY5 A;  2RSX A;  1M9G A;  3OW2 2;  3LTA A;  2O3O A;  2QGU A;  4R1K A;  2V1L A;  5G2G A;  1AVK A;  2F99 A;  1WMN A;  3WOF B;  1QVG 2;  3I0Y A;  3I55 3;  1K73 4;  3EJV A;  2MF7 A;  3F7X A;  3PCS A;  2OWP A;  3PXM A;  3S5C A;  1K9M 4;  3B4O A;  4FMD A;  3CNX A;  2I9W A;  4TX4 A;  1QAK A;  1NB3 I;  2IUK A;  4MMZ B;  2BMQ B;  4IIA A;  5AI1 A;  4STD A;  3DM8 A;  3OWU A;  1AV4 A;  1EG9 B;  3KKG A;  1STD A;  1VQM 3;  4HZ9 B;  4KVH A;  2CW9 A;  3D3L A;  3DMC A;  3V98 A;  3JUO A;  5AEW B;  1U8C B;  5JPP A;  2OOV C;  2F98 A;  4RNY A;  3OX9 A;  2JDI H;  5EVH A;  5STD A;  1DYU A;  3MHE A;  5JPU A;  4H61 A;  2OQE A;  3DGN A;  2B1X B;  1G96 A;  3Q1C A;  1W02 A;  2CFL A;  2OTJ 3;  1EA2 A;  4O3V A;  1IQ8 A;  3UNL A;  3PGB A;  2M7O A;  3K9M C;  3DUK A;  3GWR A;  2O9U X;  1O7G B;  4LEH A;  1LOX A;  1JB2 A;  1N8Q A;  4KFD A;  1O7M B;  3U1W A;  1IDP A;  1M1K 4;  1ASK A;  1A67 A;  3MSO A;  1OGZ A;  4XBT A;  8CHO A;  4N6U A;  3SOY A;  4N6V 0;  4HM4 B;  3LH4 A;  4HM7 B;  4L8P A;  5CF2 A;  5D83 A;  3NV0 A;  2CWT A;  2GU1 A;  3CU3 A;  3HZP A;  1IT7 A;  4N6M A;  1W5Z A;  2XR8 B;  4OK0 A;  4XDV A;  1CQS A;  1Q40 B;  4K61 A;  5D82 A;  3T8N A;  1ROV A;  1Z1S A;  1VQK 3;  4GB5 A;  3BLZ A;  1A90 A;  4XB5 A;  3SLU A;  1EQK A;  2W56 A;  3EBY A;  2W03 A;  5AII A;  4KZ1 A;  1QVF 2;  4JF8 A;  4MMX B;  1YJW 3;  3K7C A;  5HGR A;  1IT8 A;  3CCV 3;  2CFD A;  1N5P A;  3X3X A;  5CLK A;  3FG3 A;  3IMA B;  3IPT A;  1SII A;  2CH9 A;  3PZW A;  1AVL A;  4FCZ A;  5BXQ A;  4LSO A;  3PCR A;  7STD A;  3IJE B;  2QEX 3;  1JRQ A;  3FG1 A;  1KSI A;  2BT3 A;  1GD4 A;  4LGQ A;  2W2C A;  1WMP A;  2Q07 A;  2Z76 A;  1MNL A;  3NUV A;  4XM4 A;  3J7Y d;  2C11 A;  2YFL B;  5ELJ A;  3NHX A;  3NX0 A;  1DMQ A;  2Z7A A;  4ORL A;  4XBX A;  1W7C A;  2IUJ A;  3JUP A;  4FR9 A;  1WMO A;  3NBR A;  3A76 A;  2D42 A;  1KC8 4;  3LTD A;  1ISK A;  4MMY B;  5AIG A;  3EC9 A;  1NDO B;  1TIJ A;  1ULI B;  2LYX A;  2XGL A;  3VGN A;  1TU5 A;  1FGM A;  1OGX A;  3LT8 A;  3LXU X;  2WOF A;  4HZB B;  2W56 B;  1JV2 B;  4FMC A;  1SIH A;  3DGO A;  3OV4 A;  1Q7Y 4;  3CCR 3;  1D6Z A;  3NXJ A;  4WFO A;  3BND A;  4BTY A;  4AKY A;  2GEX A;  1NWW A;  1OF5 B;  4I4K A;  2GXF A;  3SVA A;  3UL6 A;  2W04 A;  1O7P B;  3SXX A;  1YGE A;  3GAX A;  3UJM A;  1KWI A;  4RBN A;  3NBB A;  5IEP A;  3CCU 3;  1YJN 3;  4WP5 A;  4MEI A;  3S29 A;  2PNC A;  1FGR A;  2W9Q A;  2CWV A;  1W4N A;  3WA2 X;  1IVW A;  1D6Y A;  1S5A A;  3KN4 A;  2OQE C;  2IA7 A;  1TFO A;  3HIG A;  3Q2P A;  3N9H A;  4NRE A;  1DVD A;  1E3R A;  4OUQ A;  1W6G A;  1VQ4 3;  3F8H A;  3OWS A;  1RRH A;  2PZV A;  2UX0 A;  3DXO A;  3MPH A;  1VZZ A;  4HM6 B;  1RJO A;  4JRF A;  1GY7 A;  1YIT 3;  1OUN A;  4FCM A;  3SOA A;  3DZL A;  5IW9 A;  4KFF A;  1GY6 A;  1W6C A;  3ECF A;  1VQN 3;  3H3H A;  1PU4 A;  4CDL A;  2RGQ A;  1SJW A;  1DMM A;  1Q40 A;  5AEU B;  3G4S 3;  5IF6 A;  3X42 A;  5I97 A;  4N6O B;  1C7H A;  3CCJ 3;  2CG0 A;  4AKZ A;  1JN5 B;  3H51 A;  3CCQ 3;  3KE7 A;  3DGM A;  2D1W A;  2LQV A;  2OCT A;  4G1M B;  1YIJ 3;  2E2V A;  3E99 A;  1N8R 4;  3ALA A;  3T0U A;  2GBW B;  1UI8 A;  3FF2 A;  1YI2 3;  5ELU A;  1Q82 4;  5DRE A;  3WDG B;  4U13 A;  3BNB A;  3HII A;  1N9E A;  4WWU C;  5CXO A;  3F8X A;  1ZX2 A;  3JUM A;  3CD6 3;  4N6L A;  1ULJ B;  1LVN A;  2XEP A;  3PYJ A;  4HKV B;  4R9L A;  1W6Y A;  1GS3 A;  1QAL A;  2WGQ A;  5FW5 A;  3UB1 A;  4EC6 A;  1ZO2 A;  6STD A;  3EBT A;  1M1X B;  1JB4 A;  1FGT A;  1U5O A;  3LOY A;  5BVB A;  2W0Q A;  4AEQ A;  1QMA A;  3CCM 3;  3F40 A;  3N8B A;  1KQS 2;  2W9P A;  3V92 A;  1IU7 A;  2BHM A;  5KP4 A;  4Q53 A;  1BUQ A;  2HMJ B;  5EEO A;  1K28 A;  3S67 A;  4ZM8 A;  1KD1 4;  1CEW I;  4EBG A;  3OXA A;  2E2U A;  1OF5 A;  1QAF A;  1PFP A;  3FLJ A;  4O2H A;  1GD3 A;  5D81 A;  5AYR B;  1JNQ A;  4HM1 B;  3G71 3;  1WNH A;  3GZR A;  3K5T A;  4K1V A;  3B4P A;  4KFE A;  4IT7 A;  1K8A 4;  1VQ9 3;  2ML5 A;  3V99 A;  3WA3 A;  3CC4 3;  2Z77 A;  1N9J A;  2BMR B;  3ROB A;  3EN8 A;  1FA3 A;  3MYT A;  2OOV A;  2WOH A;  5IG0 A;  3BNE A;  3AMO B;  3WOD G;  3S28 A;  3FZW A;  1Q86 4;  3KSE D;  2KRT A;  2ZDJ A;  2XSO B;  3KFQ C;  3NBJ A;  5FGO A;  3F7S A;  4FMB A;  1IVV A;  1W2B 2;  1NB5 I;  2QA4 3;  2CHC A;  3N54 B;  1N5H A;  4HJL B;  2CFW A;  2BNG A;  1RN7 A;  3DGL A;  3F14 A;  1O7H B;  1O7W B;  2K0M A;  2JQ5 A;  2YFI B;  1DMN A;  1E3V A;  3NM7 A;  4GL6 A;  1UUV B;  3MKI A;  3UL5 A;  4N6T A;  1IV9 A;  3EX9 A;  1JN5 A;  4BTX A;  1NU3 A;  3SX1 A;  2L4V A;  2XGN A;  1OH0 A;  1OHS A;  3MG2 A;  4WYK B;  1ROA A;  2OTL 3;  4XDW A;  1VQ7 3;  3TDG A;  3KII A;  1R4C A;  4HM0 B;  1IQY A;  3VSY A;  2CIU A;  1IV7 A;  2SBL A;  4FMA A;  4CCV A;  1JKG B;  4HVN A;  2B24 B;  1VQP 3;  3EN1 B;  4O8S A;  2HMO B;  2XRX B;  1UUW B;  1YHQ 3;  3JUN A;  3NQY A;  4IPB A;  1F8N A;  3NQZ A;  3CPO A;  3MWZ A;  4HM2 B;  4XBY A;  5IG5 A;  5IEN A;  1VQO 3;  1TP6 A;  4QWT A;  2A15 A;  3LTB A;  2INX A;  2WGO A;  4R80 A;  4K1U A;  4MJD A;  5LC6 A;  3EQQ B;  1M90 4;  4J8T A;  4FCJ A;  2QIY A;  1YVB I;  3FF0 A;  3G8Z A;  3RGA A;  3SED A;  5CK6 A;  3CCE 3;  4H3U A;  3X41 A;  1D6U A;  3LT9 A;  5A0O B;  3QRD A;  3RDE A;  4WHA A;  3HX8 A;  1IVX A;  4HM3 B;  4NHF A;  1IQX A;  1VQ8 3;  1V74 A;  1GYB A;  3EE1 A;  3QK9 A;  3CC2 3;  2C10 A;  3T8U A;  2RFR A;  1Y4K A;  2K54 A;  3KZT A;  1TFK A;  4EXR A;  2FNQ A;  2GU3 A;  2ML6 A;  2CFG A;  1O7N B;  3FH1 A;  4X2H A;  1SQW A;  4EYC A;  3FG4 A;  2ZL8 A;  3VF1 A;  5KP1 A;  2CKF B;  2HMN B;  5CF1 A;  1OAC A;  3STD A;  2P0X A;  3Q90 A;  3AMO A;  5AIH A;  3WMD A;  2XH9 A;  2F86 B;  3MG3 A;  1L5G B;  1NJI 4;  1OHO A;  1OCV A;  3M8C A;  5EQL A;  1WTH A;  4OVM A;  1A2K A;  1Q42 A;  1EKM A;  3KSP A;  2HMK B;  3G0K A;  3X3Y A;  4R9K A;  3FGY A;  1S72 3;  2CWU A;  1W00 A;  5JBS A;  3CPW 2;  3JUQ A;  2WO0 A;  4L7K A;  2RCD A;  1FUW A;  1T5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...