5BVBA

Engineered digoxigenin binder dig5.1a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
b'SMNAKEILVHSLRLLENGDARGWCDLFHPEGVLEYPYAPPGWKTRFEGRETIWAHMRLHPEHVTWRFTDVQFYETADPDLAIGEYHGDGVVTVSGGKYAADYITVLRTRDGQILLLRVFWNPLRILEAAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIG5.1a
publication title CSAR Benchmark Exercise 2013: Evaluation of Results from a Combined Computational Protein Design, Docking, and Scoring/Ranking Challenge.
pubmed doi rcsb
molecule tags De novo protein
total genus 36
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5bvbA00
5D81A 1NDOB 1OHSA 2RGQA 2BMQB 2BNGA 1NU3A 3RGRA 5AIHA 1W6YA 3ECFA 3FF0A 3NHXA 3EJVA 3F8HA 3SEDA 1OF5A 5DRVA 5IEPA 5KP1A 1ASKA 4R1KA 4OVMA 3K7CA 5IG4A 3DMCA 1C7HA 5BVBA 2QIYA 2INXA 3OWYA 2STDA 1NWWA 1JKGB 3KSPA 3OXAA 1IDPA 2HMJB 2RFRA 3FH1A 3OWSA 2JQ5A 4KVHA 3JUOA 2XR8B 2GEXA 3EX9A 3MSOA 3EN1B 3F8XA 4HZ9B 1E97A 1Q42A 3D9RA 5HGRA 2CHCA 1QMAA 3EHCA 2I9WA 1ULIB 3GZBA 1Q40A 1O7GB 3MKIA 3GRDA 2XSHB 5CXOA 4WYKB 5CF2A 3STDA 1UUWB 3CNMA 3CU3A 3MG2A 3JUPA 4HM6B 1E3VA 4I4KA 3E99A 1JN5A 3OWUA 2YFIB 3MHEA 3GZYB 6STDA 1W01A 3FF2A 4HVNA 3FKAA 1Z1SA 3I0YA 4FCMA 2HMKB 4HM3B 4PEJA 1BUQA 1UUVB 3GZRA 4OUQA 3JUQA 1W02A 3DZLA 3UJMA 4X2OA 4K1VA 1K41A 1O7PB 1QJGA 4HKVB 3B4PA 4HZBB 1JB4A 1OCVA 1S5AA 3MYTA 3HK4A 5FW5A 4ORLA 1GY6A 2GBXB 4HM5B 2QGUA 3UNLA 3OX9A 3VSYA 4J8TA 5CF1A 3CNXA 3NV0B 4HM7B 3H3HA 1TP6A 1HKXA 1O7MB 1OGZA 3GWRA 5G2GA 1A2KA 1VZZA 3B4OA 2HMMB 2BMOB 4U13A 2PZVA 1O7NB 3ER7A 3KZTA 2W2CA 3T8UA 2Z77A 4LMIA 4XBXA 1ULJB 5CK6A 2F99A 2OWPA 3EN8A 1JB5A 1DMMA 2RCDA 3KKGA 3Q90A 3MG1A 2R4IA 2Z76A 3OV4A 3GZXB 2BMRB 2YFJB 1GYBA 2GBWB 4WYKA 5AIFA 4K1UA 3VGNA 3F9SA 4LEHA 3HX8A 1E3RA 5D83A 4L8OA 4R9LA 5IF6A 2B24B 2GEYA 1OHOA 5CLKA 7STDA 2HMLB 2A15A 4RZMA 1Q40B 4L8PA 4J9AA 2HMOB 4CDLA 3G8ZA 1JN5B 3WMDA 3DXOA 3LYGA 1JB2A 5BXQA 5IG3A 4XB5A 3F14A 2B1XB 5AIGA 5STDA 5EVHA 1TUHA 4FCJA 3DM8A 4N3VA 3NBRA 3JUMA 3G0KA 3CPOA 4L7KA 4XDWA 1W00A 4WWUC 5JPPA 3NV0A 3IPTA 1DMNA 1ISKA 2UX0A 8CHOA 4HM0B 3EQQB 2GXFA 1OHPA 1GY5A 3FLJA 4LGQA 3NM2A 1JKGA 2K54A 1ZO2A 3NXJA 4Q53A 4XM4A 5AIIA 5IERA 4X2HA 1OF5B 1ZX2A 5D82A 3F40A 5KP3A 1OPYA 1DMQA 4STDA 1OGXA 3SOYA 4HM4B 2YFLB 3FSDA 4XBYA 3EC9A 4HM2B 4HM8B 3A76A 1OH0A 4IIAA 3F7XA 2IMJA 3G16A 2XSOB 2XRXB 3LZAA 1STDA 5AEWB 3M8CA 5JPUA 4MJDA 1U5OA 5AI1A 3B7CA 3K0ZA 1OUNA 2F86B 5TGNA 3F7SA 2HMNB 4XDVA 1CQSA 4WP5A 5IENA 3EBYA 4XBTA 3FZWA 3EF8A 1WQLB 3EBTA 3FGYA 4HJLB 5IEOA 3T8NA 1GS3A 5KP4A 3BLZA 3DUKA 3JUNA 4GB5A 4H3UA 1AR0A 1O7HB 3HZPA 5IG5A 1O7WB 3S5CA 2Z7AA 3NUVA 1SJWA 1GY7A 3BB9A 3H51A 1EG9B 5AEUB 5IG0A 5DREA 3RGAA 3KE7A 3SOAA 2CKFB 3ROBA 3MG3A 1EA2A 4HM1B 2F98A 3B8LA 4R9KA
chains in the Genus database with same CATH superfamily
4MMXB 5D81A 2ML5A 1LRAA 1NDOB 2XH9A 1OHSA 2CH9A 1BSCA 2BMQB 2RGQA 3WODG 3L0RA 3VF1A 1JBRA 1VQ63 2BNGA 1NU3A 3MWZA 3RGRA 5AIHA 3CCS3 1W6YA 3ECFA 2R41A 3FF0A 2M7OA 3LTCA 1FGOA 1YGWA 3NHXA 2KF6A 3EJVA 3X3YA 3F8HA 3SEDA 2W56B 1MGRA 2ZL8A 1OF5A 2BHMA 5DRVA 3RDEA 3D3LA 1BRIA 1FW7A 5IEPA 5KP1A 1ASKA 4R1KA 4N6MA 4OVMA 5M1AA 3K7CA 1B2ZA 1JBTA 1HZ1A 5IG4A 4BL2A 3D5IA 4FMBA 1IK3A 1TRPA 3DMCA 1C7HA 1RGEA 1RN7A 1IQ8A 1W4NA 2O9UX 5BVBA 1Q9EA 2CG0A 2QIYA 5LC7A 3G6E3 2INXA 2P09A 1EUIC 2MF7A 1N9JA 3OWYA 1IVVA 1U8CB 2STDA 3BNBA 1NWWA 1JKGB 2HOHA 3FCSB 1RRLA 3KSPA 3OXAA 4DKIA 3LTBA 1IDPA 1GD4A 2HMJB 2RFRA 3FH1A 4H61A 3U97A 3LT9A 3CXC2 3OWSA 2JQ5A 4GL6A 3JUOA 4KVHA 1Q7Y4 2XFSA 2XR8B 2GEXA 1UI8A 3EX9A 3MSOA 1VQK3 3EN1B 1FGMA 4O2HA 4RNYA 3F8XA 1LNIA 2WGQA 3QRDA 3FG1A 4HZ9B 4OK0A 4O3VA 1E97A 5BU4A 1V57A 1Q42A 3D9RA 1A67A 5HGRA 1S723 2CHCA 4KFDA 1FGRA 1IV9A 1I3FA 2FNQA 2QEX3 1B2UA 2D1WA 1QMAA 1LOVA 2ZHXB 3CC23 1QVF2 2FXTA 3EHCA 1B2MA 3CC73 2BU4A 1IQYA 2KF5A 1B2SA 1W6GA 3Q3FA 1ULIB 1EQKA 3GZBA 4I5QA 3DGOA 1IV7A 1Q40A 1RGCA 3K5TA 4N6OB 2YX9A 1W2B2 1O7GB 3MKIA 3GRDA 2P05A 2CFWA 2XSHB 1BANA 5CXOA 9RNTA 1JZOA 1Q864 4WYKB 5CF2A 1IVUA 3STDA 1UUWB 3CNMA 3CU3A 3MG2A 2KRTA 3JUPA 3DGYA 4R9KA 4HM6B 1E3VA 4I4KA 2K0MA 2OQEA 3E99A 1JN5A 1RGGA 3EB8A 1TFOA 3OWUA 4ZM8A 1A90A 1BSDA 1A2PA 3WR2A 2E2UA 1W2ZA 2YFIB 3MHEA 4RNZA 1QALA 3GZYB 6STDA 1UI7A 1W01A 2CK3H 3FF2A 3S28A 4HVNA 3FKAA 2Y73A 1VQL3 2OQEC 1NNVA 4R4KA 3SYUA 2D42A 1Z1SA 1T5YA 3I0YA 3MPHA 3NQZA 4FCMA 1RSNA 2IYJA 2HMKB 1TRQA 2CX0A 4HM3B 4O8SA 4PEJA 4CCVA 4N6TA 1BUQA 1UUVB 1PY3A 3GZRA 4OUQA 2MC8A 3SX1A 1KD14 3JUQA 1W02A 1UDII 2AAEA 3DZLA 4QWTA 1CEWI 1X1UA 4X2OA 3SLUA 3UJMA 2IUKA 4AEQA 3ZG5A 4K1VA 3NBJA 1K41A 3SXXA 4HAAA 1BIRA 2CWVA 1O7PB 1QJGA 4HKVB 1HU9A 1VQP3 1Q824 1ROAA 1JJ22 1RDSA 3B4PA 4HZBB 3AMOA 3KSED 3Q2PA 1YGEA 6GSPA 1RKYA 1JB4A 4IT7A 1OCVA 1S5AA 3AHWA 1BRKA 3MYTA 4GSPA 3HK4A 5FW5A 1RLSA 4NREA 1NJI4 2BIRA 4ORLA 1BNFA 1GY6A 4BTWA 2GBXB 1BU4A 4HM5B 2ML6A 2K3DA 2QGUA 1B21A 1MNLA 1VQO3 1LNHA 1V74A 3UNLA 2CFLA 3PZWA 4BTXA 3HI7A 2LYXA 1V58A 4KFEA 3QK9A 1HYFA 3GSPA 3OX9A 1BAOA 3VSYA 4J8TA 5CF1A 3CNXA 4KZ1A 1K8A4 1UGHI 1B27A 3NV0B 3PGBA 4HM7B 1BRNL 3DGNA 1VQ43 3BIRA 2F4YA 1AVLA 1WNHA 4K61A 1I3IA 5JBSA 1BRSA 1DVCA 3FG4A 3K63A 4KT3B 3WOFB 1G0TA 1OACA 3H3HA 5I97A 1BUJA 1TP6A 2ZA4A 1HKXA 1O7MB 1OGZA 1N8R4 2V1LA 2C10A 2XF3A 2CG1A 3D4AA 3LH4A 5FGOA 1PYLA 3GWRA 2F56A 3Q1CA 4K90B 1TTOA 5G2GA 3AGOA 1VQ73 1A2KA 1TIJA 1F8NA 1RGHA 3I563 4GHOA 3CCJ3 1VZZA 1IU7A 3G4S3 3B4OA 2HMMB 2Y74A 3FG3A 2BMOB 5M19A 4U13A 2PZVA 1O7NB 3KN4A 2W9QA 2FGTA 3CME3 3ER7A 3KZTA 3LOYA 1MWTA 2W2CA 3T8UA 2Z77A 1YJN3 1T3BA 5AYRB 1W7CA 4LMIA 4JF8A 2O3OA 4XBXA 1FZUA 1ULJB 2P0MA 2CFKA 1RNBA 1RJOA 1W5ZA 5CK6A 2F99A 1VQ53 1NB5I 2OWPA 3V92A 3EN8A 3AGNA 3UB1A 2CWTA 1JB5A 1DMMA 1RCKA 2RCDA 1VQ83 4J5KA 4J5GA 1UCLA 3KKGA 3Q90A 2C4BA 2R4IA 2Z76A 3MG1A 7GSPA 1W6CA 3OV4A 1QVG2 1WMPA 1NO3A 1YVBI 1UCIA 3GZXB 3D79A 3CCQ3 3ALAA 2BMRB 2SBLA 2YFJB 1N5HA 1FA3A 1PU4A 3WA2X 1GYBA 2GBWB 1STFI 3N8BA 1RMSA 1VQM3 5G1KA 1Q7HA 4WYKA 1TJDA 3PYJA 5AIFA 3S27A 4K1UA 3VGNA 1US1A 1RGFA 3F9SA 4LEHA 1ZGXA 1R4CA 1E3RA 3HX8A 4JRFA 2OOVA 5D83A 1CH0A 3ZG0A 2OCTA 1GOUA 3ZFZA 1D6ZA 4L8OA 3WHOA 1RTUA 2W04A 4R9LA 5IF6A 1X1XA 1BSAA 3URPA 2B24B 3PCSA 4MEIA 5IW9A 2GEYA 3CMA3 1OHOA 5CLKA 1JRQA 7STDA 2HMLB 1BVIA 2A15A 2OOVC 3NX0A 4RZMA 1Q40B 4FCZA 1PFPA 4L8PA 4J9AA 3GAXA 2RNTA 3LTDA 2HMOB 4CDLA 2BT3A 3G8ZA 2UUGC 5BIRA 1JN5B 1FYSA 5AYSC 3WMDA 3DXOA 3KFQC 1KC84 2QA43 2CIUA 1G02A 3NM7A 1YJ93 2XGNA 1GOVA 1BOXA 1B20A 3LYGA 2LQVA 1UCKA 3OW22 1JB2A 5BXQA 4MMYB 3CCL3 3BNEA 4KFFA 1M1XB 5IG3A 4XB5A 3F14A 1RHLA 2CW9A 1MWUA 1BSBA 3CCM3 1YIJ3 3G713 2W03A 1LOYA 2B1XB 3D5GA 4TX4A 1I70A 2H0HA 2E2VA 5AIGA 5STDA 4CPKA 1L5GB 1MWSA 2KF3A 5EVHA 1Q814 1I0VA 1TUHA 4FCJA 3DM8A 1FUSA 1D6UA 1R4YA 4N3VA 3NBRA 3JUMA 2XEPA 3G0KA 3CPOA 3I553 1I2EA 1YHQ3 4L7KA 3S29A 4XDWA 3O8YA 4N6V0 1W00A 4WWUC 3WDGB 5JPPA 3NV0A 1MWRA 1Y4KA 2Z6BA 4NPBA 1M1K4 3X3ZA 5A0OB 1K9M4 1IYYA 3IPTA 3T0UA 1YI23 4EV5A 4HYZA 3LTAA 5GSPA 3NQYA 1DMNA 1K28A 2W56A 2KAAA 4N6NB 1RRHA 2F5WA 1IVWA 2AADA 1YJW3 1VQ93 1ISKA 3A5EA 4RBNA 4EV2A 2UX0A 1UUGB 8CHOA 4BTYA 1BNEA 3KIIA 4HM0B 3WA3A 3PCRA 5G1LA 2XFTA 3EQQB 4EW5A 3V99A 3K9MC 1AV4A 1QAKA 5HOHA 1BNJA 1DYUA 1RNTA 2GXFA 4LYLB 4FR9A 1WMNA 1K734 1OHPA 1RN1A 1GY5A 3PS8A 4FMCA 4IPBA 3FLJA 4AKZA 3BU4A 3KCHA 3NM2A 4LGQA 1JKGA 2K54A 2KCDA 2WO0A 1ZO2A 2W9PA 1GD3A 1A2VA 3NXJA 4AKYA 4Q53A 3HIIA 4XM4A 1SIHA 5AIIA 3J7Yd 2W6JH 2WOHA 4LZIA 4FMAA 5IERA 4ILFA 1MOLA 4X2HA 1UCJA 1SQWA 1B3SA 2GSPA 4HOHA 1N8QA 1OF5B 1BRJA 2IA7A 1ZX2A 5LC6A 3CC43 1G96A 1GMPA 1RGLA 1JNQA 1LOXA 5D82A 3F40A 4EBGA 4R80A 1I2GA 1OPYA 1DMQA 5KP3A 1AVKA 4STDA 2GU1A 1OGXA 1X1WA 2WGOA 3SOYA 1JBSA 2XGLA 2IY2A 2GU3A 4HM4B 2YFLB 1SARA 3DH2A 1IT8A 3FSDA 3EC9A 4G1MB 4XBYA 4HM2B 3NBBA 1JV2B 4HM8B 3LXUX 1N9EA 3DGLA 3DY5A 3SVAA 1CYVA 2JDIH 2CFDA 3A76A 1OH0A 1IVXA 4N6LA 4IIAA 1BNSA 4WHAA 1BNRA 3F7XA 2IMJA 3G16A 1GOYA 2H0IA 1FGQA 1N5PA 2W0QA 2KF4A 1LQMB 3S67A 1AY7A 2XRXB 2XSOB 3CCU3 1YNVX 1I0XA 4BL3A 1J2BA 3IMAB 2BO9B 2C11A 1KQS2 3LZAA 1STDA 3HOHA 5AEWB 1VQQA 1IQXA 3CCE3 3BNDA 1AQZA 1WMOA 3IJEB 3M8CA 2Q07A 3V98A 5JPUA 3TDGA 4WFOA 4MJDA 1U5OA 3X3XA 5AI1A 1BSEA 1NB3I 4LSOA 1KSIA 4MMZB 3B7CA 3X42A 4BIRA 3K0ZA 8RNTA 3CD63 1SPUA 1OUNA 2KXGA 4FMDA 3CCV3 1EEJA 2F86B 1GMRA 5TGNA 3CPW2 3F7SA 2HMNB 4XDVA 1LQGC 3N9HA 1CQSA 1C54A 4CJNA 1KWIA 3EE1A 2OTJ3 1CYUA 2H0GA 1ROVA 2J8XB 3BNCA 1T2HA 4EXRA 2WOFA 1M904 2OTL3 4WP5A 2PNCA 2P0XA 3RNTA 5IENA 1YIT3 1DETA 3AHSA 3EBYA 1TU5A 1RCLA 5EEOA 3UL6A 2CWUA 4XBTA 3FZWA 2E2TA 1BRGA 3EF8A 1FUTA 1GMQA 1BGSA 1RGAA 1WQLB 1X1YA 2RBIA 1BNGA 4N6UA 3N54B 2L4VA 1LOWA 2CX1A 3EBTA 3FGYA 1WTHA 1IT7A 2CFGA 3LMLA 4HJLB 5M18A 5IEOA 1M9GA 3T8NA 2ZDJA 4O02B 1GS3A 5KP4A 2CC3A 3BLZA 1JZDA 3DUKA 3JUNA 4GB5A 4H3UA 7RNTA 1D6YA 1AR0A 1TFKA 1O7HB 1GSPA 1RGKA 3HZPA 5IG5A 1O7WB 1LVNA 1QAFA 6RNTA 1DE3A 1I2FA 3S5CA 2IUJA 1B2XA 2Z7AA 1EKMA 3NUVA 1SJWA 3X40A 1GY7A 3BB9A 3H51A 1EG9B 4EYCA 5IG0A 5AEUB 3AMOB 1FUWA 1FGTA 5DREA 5ELUA 1UGIA 2SARA 3RGAA 3HIGA 3CCR3 1SIIA 3KE7A 1UW1A 3SOAA 2CKFB 4BU4A 3JVCA 1ZS7A 3DGMA 3LT8A 1YVSA 1RN4A 2RSXA 2UGIA 3ROBA 3MG3A 5EQLA 4NHFA 4EC6A 1EA2A 3UL5A 4HM1B 1MGWA 2L1SA 3WOEB 5ELJA 2F5MA 1T2IA 5RNTA 1I8VA 3U1WA 3PXMA 1VQN3 4RNTA 2F98A 3B8LA 1DVDA 1BRHA 1LXEA 4HBRA 2P38A 3X41A 2I9WA 1BNIA
chains in the Genus database with same CATH topology
4MMXB 5D81A 2ML5A 1NDOB 2XH9A 1OHSA 2CH9A 2BMQB 2RGQA 3WODG 3L0RA 3VF1A 1VQ63 2BNGA 1NU3A 3MWZA 3RGRA 5AIHA 3CCS3 1W6YA 3ECFA 3FF0A 3LTCA 2M7OA 1FGOA 3NHXA 3EJVA 3X3YA 3F8HA 3SEDA 2W56B 2ZL8A 1OF5A 2BHMA 5DRVA 3RDEA 3D3LA 5IEPA 5KP1A 1ASKA 4R1KA 4N6MA 4OVMA 3K7CA 5IG4A 4FMBA 1IK3A 3DMCA 1C7HA 1W4NA 1RN7A 1IQ8A 5BVBA 2O9UX 2CG0A 3G6E3 2QIYA 5LC7A 2INXA 2P09A 2MF7A 1N9JA 3OWYA 1IVVA 1U8CB 2STDA 3BNBA 1NWWA 1JKGB 3FCSB 1RRLA 3KSPA 3OXAA 3LTBA 1IDPA 1GD4A 2HMJB 2RFRA 3FH1A 4H61A 3U97A 3LT9A 3CXC2 3OWSA 2JQ5A 4GL6A 3JUOA 4KVHA 1Q7Y4 2XFSA 2XR8B 2GEXA 1UI8A 3EX9A 3MSOA 1VQK3 3EN1B 1FGMA 4O2HA 4RNYA 3F8XA 2WGQA 3QRDA 4HZ9B 3FG1A 4OK0A 4O3VA 1E97A 1Q42A 3D9RA 1A67A 5HGRA 1S723 2CHCA 4KFDA 1FGRA 1IV9A 2FNQA 2QEX3 2D1WA 1QMAA 3CC23 1QVF2 2FXTA 3EHCA 3CC73 1IQYA 1W6GA 1ULIB 1EQKA 3GZBA 3DGOA 1IV7A 1Q40A 3K5TA 4N6OB 2YX9A 1W2B2 1O7GB 3MKIA 3GRDA 2P05A 2CFWA 2XSHB 5CXOA 1Q864 4WYKB 5CF2A 1IVUA 3STDA 1UUWB 3CNMA 3CU3A 3MG2A 2KRTA 3JUPA 4R9KA 4HM6B 1E3VA 4I4KA 2K0MA 2OQEA 3E99A 1JN5A 3EB8A 1TFOA 3OWUA 4ZM8A 1A90A 2E2UA 1W2ZA 2YFIB 3MHEA 4RNZA 1QALA 3GZYB 6STDA 1UI7A 1W01A 2CK3H 3FF2A 3S28A 4HVNA 3FKAA 2Y73A 1VQL3 2OQEC 4R4KA 2D42A 1Z1SA 1T5YA 3I0YA 3MPHA 3NQZA 4FCMA 2HMKB 4HM3B 4O8SA 4CCVA 4PEJA 4N6TA 1BUQA 1UUVB 2MC8A 3GZRA 4OUQA 3SX1A 1KD14 3JUQA 1W02A 3DZLA 4QWTA 4AEQA 1CEWI 3SLUA 4X2OA 3UJMA 2IUKA 4K1VA 3NBJA 1K41A 3SXXA 2CWVA 1O7PB 1QJGA 4HKVB 1HU9A 1VQP3 1Q824 1ROAA 1JJ22 3B4PA 4HZBB 3AMOA 3KSED 3Q2PA 1YGEA 1RKYA 1JB4A 4IT7A 1OCVA 1S5AA 3MYTA 3HK4A 5FW5A 4NREA 1NJI4 4ORLA 1GY6A 4BTWA 2GBXB 4HM5B 2ML6A 2QGUA 1MNLA 1VQO3 1LNHA 1V74A 3UNLA 2CFLA 3PZWA 4BTXA 3HI7A 2LYXA 4KFEA 3QK9A 3OX9A 3VSYA 4J8TA 5CF1A 3CNXA 4KZ1A 1K8A4 3NV0B 3PGBA 4HM7B 1VQ43 3DGNA 1AVLA 1WNHA 4K61A 5JBSA 1DVCA 3FG4A 3WOFB 3K63A 1OACA 3H3HA 5I97A 1TP6A 1HKXA 1O7MB 1OGZA 1N8R4 2V1LA 2C10A 2XF3A 2CG1A 3LH4A 5FGOA 3GWRA 3Q1CA 4K90B 5G2GA 1VQ73 1A2KA 1TIJA 1F8NA 3I563 3CCJ3 1VZZA 1IU7A 3G4S3 3B4OA 2HMMB 2Y74A 3FG3A 2BMOB 4U13A 2PZVA 1O7NB 3KN4A 2W9QA 2FGTA 3CME3 3ER7A 3KZTA 3LOYA 2W2CA 3T8UA 2Z77A 1YJN3 5AYRB 1W7CA 4LMIA 4JF8A 2O3OA 4XBXA 1ULJB 2P0MA 2CFKA 1RJOA 1W5ZA 5CK6A 2F99A 1VQ53 1NB5I 2OWPA 3V92A 3EN8A 3UB1A 2CWTA 1JB5A 1DMMA 1VQ83 2RCDA 3KKGA 3Q90A 3MG1A 2R4IA 2Z76A 1W6CA 3OV4A 1QVG2 1WMPA 1NO3A 1YVBI 3GZXB 3CCQ3 3ALAA 2BMRB 2SBLA 2YFJB 1N5HA 1FA3A 1PU4A 3WA2X 1GYBA 2GBWB 1STFI 3N8BA 1VQM3 4WYKA 3PYJA 5AIFA 3S27A 4K1UA 3VGNA 1US1A 3F9SA 4LEHA 1R4CA 3HX8A 1E3RA 4JRFA 2OOVA 1M904 5D83A 2OCTA 1D6ZA 4L8OA 2W04A 4R9LA 5IF6A 2B24B 3PCSA 4MEIA 5IW9A 2GEYA 3CMA3 1OHOA 5CLKA 1JRQA 7STDA 2HMLB 2A15A 2OOVC 3NX0A 4RZMA 1Q40B 4FCZA 1PFPA 4L8PA 4J9AA 3GAXA 3LTDA 2HMOB 4CDLA 2BT3A 3G8ZA 1JN5B 3WMDA 5AYSC 3DXOA 3KFQC 1KC84 2QA43 2CIUA 3NM7A 1YJ93 2XGNA 3LYGA 2LQVA 3OW22 1JB2A 5BXQA 4MMYB 3CCL3 3BNEA 4KFFA 1M1XB 5IG3A 4XB5A 3F14A 2CW9A 3CCM3 1YIJ3 3G713 2W03A 2B1XB 4TX4A 2E2VA 5AIGA 5STDA 1L5GB 5EVHA 1Q814 1TUHA 4FCJA 3DM8A 1D6UA 4N3VA 3NBRA 3JUMA 2XEPA 3G0KA 3CPOA 3I553 1YHQ3 4L7KA 3S29A 4XDWA 3O8YA 4N6V0 1W00A 4WWUC 3WDGB 5JPPA 3NV0A 1Y4KA 2Z6BA 1M1K4 3X3ZA 5A0OB 1K9M4 3IPTA 3T0UA 1YI23 4EV5A 4HYZA 3LTAA 3NQYA 1DMNA 1K28A 2W56A 4N6NB 1YJW3 1RRHA 1VQ93 1IVWA 1ISKA 4RBNA 4EV2A 2UX0A 8CHOA 4BTYA 3KIIA 4HM0B 3WA3A 3PCRA 2XFTA 3EQQB 3V99A 3K9MC 1AV4A 1QAKA 1DYUA 2GXFA 4FR9A 1WMNA 1K734 1OHPA 3PS8A 1GY5A 4FMCA 4IPBA 3FLJA 4AKZA 4LGQA 3NM2A 1JKGA 2WO0A 2K54A 2KCDA 1ZO2A 2W9PA 1GD3A 1A2VA 3NXJA 4AKYA 4Q53A 3HIIA 4XM4A 1SIHA 5AIIA 3J7Yd 2W6JH 2WOHA 4LZIA 4FMAA 5IERA 1MOLA 4X2HA 1SQWA 5LC6A 1N8QA 1OF5B 2IA7A 1ZX2A 3CC43 1G96A 1JNQA 1LOXA 5D82A 3F40A 4EBGA 4R80A 5KP3A 1OPYA 1DMQA 1AVKA 4STDA 2WGOA 2GU1A 1OGXA 3SOYA 2XGLA 2GU3A 4HM4B 2YFLB 1IT8A 3FSDA 3EC9A 4G1MB 4XBYA 4HM2B 3NBBA 1JV2B 4HM8B 3LXUX 1N9EA 3DGLA 3DY5A 3SVAA 1CYVA 2JDIH 2CFDA 3A76A 1OH0A 1IVXA 4N6LA 4IIAA 4WHAA 3F7XA 2IMJA 3G16A 1FGQA 1N5PA 2W0QA 3S67A 2XSOB 2XRXB 3CCU3 1J2BA 3IMAB 2BO9B 2C11A 1KQS2 3LZAA 1STDA 5AEWB 1IQXA 3CCE3 3BNDA 3IJEB 1WMOA 3M8CA 2Q07A 3V98A 5JPUA 3TDGA 4WFOA 4MJDA 1U5OA 3X3XA 5AI1A 1NB3I 4LSOA 1KSIA 4MMZB 3B7CA 3X42A 3CD63 3K0ZA 1SPUA 1OUNA 2KXGA 4FMDA 3CCV3 2F86B 5TGNA 3CPW2 3F7SA 2HMNB 4XDVA 3N9HA 1CQSA 1KWIA 3EE1A 2OTJ3 1CYUA 1ROVA 3BNCA 4EXRA 2WOFA 2OTL3 4WP5A 2PNCA 2P0XA 5IENA 1YIT3 3EBYA 1TU5A 5EEOA 3UL6A 2CWUA 4XBTA 3FZWA 2E2TA 3EF8A 4N6UA 1WQLB 3N54B 2L4VA 3LMLA 3EBTA 3FGYA 1WTHA 1IT7A 2CFGA 4HJLB 5IEOA 1M9GA 3T8NA 2ZDJA 4O02B 1GS3A 5KP4A 2CC3A 3BLZA 3DUKA 3JUNA 4GB5A 4H3UA 1D6YA 1AR0A 1TFKA 1O7HB 3HZPA 5IG5A 1O7WB 1LVNA 1QAFA 3S5CA 2IUJA 2Z7AA 1EKMA 3NUVA 1SJWA 3X40A 1GY7A 3BB9A 3H51A 1EG9B 4EYCA 5IG0A 5AEUB 3AMOB 1FUWA 1FGTA 5DREA 5ELUA 3RGAA 3HIGA 3CCR3 1SIIA 3KE7A 1UW1A 3SOAA 2CKFB 3JVCA 3DGMA 3LT8A 2RSXA 3ROBA 3MG3A 5EQLA 4NHFA 4EC6A 1EA2A 3UL5A 4HM1B 3WOEB 5ELJA 3U1WA 3PXMA 1VQN3 2F98A 3B8LA 1DVDA 1LXEA 4HBRA 2P38A 3X41A 2I9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D81 A;  1NDO B;  1OHS A;  2RGQ A;  2BMQ B;  2BNG A;  1NU3 A;  3RGR A;  5AIH A;  1W6Y A;  3ECF A;  3FF0 A;  3NHX A;  3EJV A;  3F8H A;  3SED A;  1OF5 A;  5DRV A;  5IEP A;  5KP1 A;  1ASK A;  4R1K A;  4OVM A;  3K7C A;  5IG4 A;  3DMC A;  1C7H A;  5BVB A;  2QIY A;  2INX A;  3OWY A;  2STD A;  1NWW A;  1JKG B;  3KSP A;  3OXA A;  1IDP A;  2HMJ B;  2RFR A;  3FH1 A;  3OWS A;  2JQ5 A;  4KVH A;  3JUO A;  2XR8 B;  2GEX A;  3EX9 A;  3MSO A;  3EN1 B;  3F8X A;  4HZ9 B;  1E97 A;  1Q42 A;  3D9R A;  5HGR A;  2CHC A;  1QMA A;  3EHC A;  2I9W A;  1ULI B;  3GZB A;  1Q40 A;  1O7G B;  3MKI A;  3GRD A;  2XSH B;  5CXO A;  4WYK B;  5CF2 A;  3STD A;  1UUW B;  3CNM A;  3CU3 A;  3MG2 A;  3JUP A;  4HM6 B;  1E3V A;  4I4K A;  3E99 A;  1JN5 A;  3OWU A;  2YFI B;  3MHE A;  3GZY B;  6STD A;  1W01 A;  3FF2 A;  4HVN A;  3FKA A;  1Z1S A;  3I0Y A;  4FCM A;  2HMK B;  4HM3 B;  4PEJ A;  1BUQ A;  1UUV B;  3GZR A;  4OUQ A;  3JUQ A;  1W02 A;  3DZL A;  3UJM A;  4X2O A;  4K1V A;  1K41 A;  1O7P B;  1QJG A;  4HKV B;  3B4P A;  4HZB B;  1JB4 A;  1OCV A;  1S5A A;  3MYT A;  3HK4 A;  5FW5 A;  4ORL A;  1GY6 A;  2GBX B;  4HM5 B;  2QGU A;  3UNL A;  3OX9 A;  3VSY A;  4J8T A;  5CF1 A;  3CNX A;  3NV0 B;  4HM7 B;  3H3H A;  1TP6 A;  1HKX A;  1O7M B;  1OGZ A;  3GWR A;  5G2G A;  1A2K A;  1VZZ A;  3B4O A;  2HMM B;  2BMO B;  4U13 A;  2PZV A;  1O7N B;  3ER7 A;  3KZT A;  2W2C A;  3T8U A;  2Z77 A;  4LMI A;  4XBX A;  1ULJ B;  5CK6 A;  2F99 A;  2OWP A;  3EN8 A;  1JB5 A;  1DMM A;  2RCD A;  3KKG A;  3Q90 A;  3MG1 A;  2R4I A;  2Z76 A;  3OV4 A;  3GZX B;  2BMR B;  2YFJ B;  1GYB A;  2GBW B;  4WYK A;  5AIF A;  4K1U A;  3VGN A;  3F9S A;  4LEH A;  3HX8 A;  1E3R A;  5D83 A;  4L8O A;  4R9L A;  5IF6 A;  2B24 B;  2GEY A;  1OHO A;  5CLK A;  7STD A;  2HML B;  2A15 A;  4RZM A;  1Q40 B;  4L8P A;  4J9A A;  2HMO B;  4CDL A;  3G8Z A;  1JN5 B;  3WMD A;  3DXO A;  3LYG A;  1JB2 A;  5BXQ A;  5IG3 A;  4XB5 A;  3F14 A;  2B1X B;  5AIG A;  5STD A;  5EVH A;  1TUH A;  4FCJ A;  3DM8 A;  4N3V A;  3NBR A;  3JUM A;  3G0K A;  3CPO A;  4L7K A;  4XDW A;  1W00 A;  4WWU C;  5JPP A;  3NV0 A;  3IPT A;  1DMN A;  1ISK A;  2UX0 A;  8CHO A;  4HM0 B;  3EQQ B;  2GXF A;  1OHP A;  1GY5 A;  3FLJ A;  4LGQ A;  3NM2 A;  1JKG A;  2K54 A;  1ZO2 A;  3NXJ A;  4Q53 A;  4XM4 A;  5AII A;  5IER A;  4X2H A;  1OF5 B;  1ZX2 A;  5D82 A;  3F40 A;  5KP3 A;  1OPY A;  1DMQ A;  4STD A;  1OGX A;  3SOY A;  4HM4 B;  2YFL B;  3FSD A;  4XBY A;  3EC9 A;  4HM2 B;  4HM8 B;  3A76 A;  1OH0 A;  4IIA A;  3F7X A;  2IMJ A;  3G16 A;  2XSO B;  2XRX B;  3LZA A;  1STD A;  5AEW B;  3M8C A;  5JPU A;  4MJD A;  1U5O A;  5AI1 A;  3B7C A;  3K0Z A;  1OUN A;  2F86 B;  5TGN A;  3F7S A;  2HMN B;  4XDV A;  1CQS A;  4WP5 A;  5IEN A;  3EBY A;  4XBT A;  3FZW A;  3EF8 A;  1WQL B;  3EBT A;  3FGY A;  4HJL B;  5IEO A;  3T8N A;  1GS3 A;  5KP4 A;  3BLZ A;  3DUK A;  3JUN A;  4GB5 A;  4H3U A;  1AR0 A;  1O7H B;  3HZP A;  5IG5 A;  1O7W B;  3S5C A;  2Z7A A;  3NUV A;  1SJW A;  1GY7 A;  3BB9 A;  3H51 A;  1EG9 B;  5AEU B;  5IG0 A;  5DRE A;  3RGA A;  3KE7 A;  3SOA A;  2CKF B;  3ROB A;  3MG3 A;  1EA2 A;  4HM1 B;  2F98 A;  3B8L A;  4R9K A; 
#chains in the Genus database with same CATH topology
 4MMX B;  5D81 A;  2ML5 A;  1LRA A;  1NDO B;  2XH9 A;  1OHS A;  2CH9 A;  1BSC A;  2BMQ B;  2RGQ A;  3WOD G;  3L0R A;  3VF1 A;  1JBR A;  1VQ6 3;  2BNG A;  1NU3 A;  3MWZ A;  3RGR A;  5AIH A;  3CCS 3;  1W6Y A;  3ECF A;  2R41 A;  3FF0 A;  2M7O A;  3LTC A;  1FGO A;  1YGW A;  3NHX A;  2KF6 A;  3EJV A;  3X3Y A;  3F8H A;  3SED A;  2W56 B;  1MGR A;  2ZL8 A;  1OF5 A;  2BHM A;  5DRV A;  3RDE A;  3D3L A;  1BRI A;  1FW7 A;  5IEP A;  5KP1 A;  1ASK A;  4R1K A;  4N6M A;  4OVM A;  5M1A A;  3K7C A;  1B2Z A;  1JBT A;  1HZ1 A;  5IG4 A;  4BL2 A;  3D5I A;  4FMB A;  1IK3 A;  1TRP A;  3DMC A;  1C7H A;  1RGE A;  1RN7 A;  1IQ8 A;  1W4N A;  2O9U X;  5BVB A;  1Q9E A;  2CG0 A;  2QIY A;  5LC7 A;  3G6E 3;  2INX A;  2P09 A;  1EUI C;  2MF7 A;  1N9J A;  3OWY A;  1IVV A;  1U8C B;  2STD A;  3BNB A;  1NWW A;  1JKG B;  2HOH A;  3FCS B;  1RRL A;  3KSP A;  3OXA A;  4DKI A;  3LTB A;  1IDP A;  1GD4 A;  2HMJ B;  2RFR A;  3FH1 A;  4H61 A;  3U97 A;  3LT9 A;  3CXC 2;  3OWS A;  2JQ5 A;  4GL6 A;  3JUO A;  4KVH A;  1Q7Y 4;  2XFS A;  2XR8 B;  2GEX A;  1UI8 A;  3EX9 A;  3MSO A;  1VQK 3;  3EN1 B;  1FGM A;  4O2H A;  4RNY A;  3F8X A;  1LNI A;  2WGQ A;  3QRD A;  3FG1 A;  4HZ9 B;  4OK0 A;  4O3V A;  1E97 A;  5BU4 A;  1V57 A;  1Q42 A;  3D9R A;  1A67 A;  5HGR A;  1S72 3;  2CHC A;  4KFD A;  1FGR A;  1IV9 A;  1I3F A;  2FNQ A;  2QEX 3;  1B2U A;  2D1W A;  1QMA A;  1LOV A;  2ZHX B;  3CC2 3;  1QVF 2;  2FXT A;  3EHC A;  1B2M A;  3CC7 3;  2BU4 A;  1IQY A;  2KF5 A;  1B2S A;  1W6G A;  3Q3F A;  1ULI B;  1EQK A;  3GZB A;  4I5Q A;  3DGO A;  1IV7 A;  1Q40 A;  1RGC A;  3K5T A;  4N6O B;  2YX9 A;  1W2B 2;  1O7G B;  3MKI A;  3GRD A;  2P05 A;  2CFW A;  2XSH B;  1BAN A;  5CXO A;  9RNT A;  1JZO A;  1Q86 4;  4WYK B;  5CF2 A;  1IVU A;  3STD A;  1UUW B;  3CNM A;  3CU3 A;  3MG2 A;  2KRT A;  3JUP A;  3DGY A;  4R9K A;  4HM6 B;  1E3V A;  4I4K A;  2K0M A;  2OQE A;  3E99 A;  1JN5 A;  1RGG A;  3EB8 A;  1TFO A;  3OWU A;  4ZM8 A;  1A90 A;  1BSD A;  1A2P A;  3WR2 A;  2E2U A;  1W2Z A;  2YFI B;  3MHE A;  4RNZ A;  1QAL A;  3GZY B;  6STD A;  1UI7 A;  1W01 A;  2CK3 H;  3FF2 A;  3S28 A;  4HVN A;  3FKA A;  2Y73 A;  1VQL 3;  2OQE C;  1NNV A;  4R4K A;  3SYU A;  2D42 A;  1Z1S A;  1T5Y A;  3I0Y A;  3MPH A;  3NQZ A;  4FCM A;  1RSN A;  2IYJ A;  2HMK B;  1TRQ A;  2CX0 A;  4HM3 B;  4O8S A;  4PEJ A;  4CCV A;  4N6T A;  1BUQ A;  1UUV B;  1PY3 A;  3GZR A;  4OUQ A;  2MC8 A;  3SX1 A;  1KD1 4;  3JUQ A;  1W02 A;  1UDI I;  2AAE A;  3DZL A;  4QWT A;  1CEW I;  1X1U A;  4X2O A;  3SLU A;  3UJM A;  2IUK A;  4AEQ A;  3ZG5 A;  4K1V A;  3NBJ A;  1K41 A;  3SXX A;  4HAA A;  1BIR A;  2CWV A;  1O7P B;  1QJG A;  4HKV B;  1HU9 A;  1VQP 3;  1Q82 4;  1ROA A;  1JJ2 2;  1RDS A;  3B4P A;  4HZB B;  3AMO A;  3KSE D;  3Q2P A;  1YGE A;  6GSP A;  1RKY A;  1JB4 A;  4IT7 A;  1OCV A;  1S5A A;  3AHW A;  1BRK A;  3MYT A;  4GSP A;  3HK4 A;  5FW5 A;  1RLS A;  4NRE A;  1NJI 4;  2BIR A;  4ORL A;  1BNF A;  1GY6 A;  4BTW A;  2GBX B;  1BU4 A;  4HM5 B;  2ML6 A;  2K3D A;  2QGU A;  1B21 A;  1MNL A;  1VQO 3;  1LNH A;  1V74 A;  3UNL A;  2CFL A;  3PZW A;  4BTX A;  3HI7 A;  2LYX A;  1V58 A;  4KFE A;  3QK9 A;  1HYF A;  3GSP A;  3OX9 A;  1BAO A;  3VSY A;  4J8T A;  5CF1 A;  3CNX A;  4KZ1 A;  1K8A 4;  1UGH I;  1B27 A;  3NV0 B;  3PGB A;  4HM7 B;  1BRN L;  3DGN A;  1VQ4 3;  3BIR A;  2F4Y A;  1AVL A;  1WNH A;  4K61 A;  1I3I A;  5JBS A;  1BRS A;  1DVC A;  3FG4 A;  3K63 A;  4KT3 B;  3WOF B;  1G0T A;  1OAC A;  3H3H A;  5I97 A;  1BUJ A;  1TP6 A;  2ZA4 A;  1HKX A;  1O7M B;  1OGZ A;  1N8R 4;  2V1L A;  2C10 A;  2XF3 A;  2CG1 A;  3D4A A;  3LH4 A;  5FGO A;  1PYL A;  3GWR A;  2F56 A;  3Q1C A;  4K90 B;  1TTO A;  5G2G A;  3AGO A;  1VQ7 3;  1A2K A;  1TIJ A;  1F8N A;  1RGH A;  3I56 3;  4GHO A;  3CCJ 3;  1VZZ A;  1IU7 A;  3G4S 3;  3B4O A;  2HMM B;  2Y74 A;  3FG3 A;  2BMO B;  5M19 A;  4U13 A;  2PZV A;  1O7N B;  3KN4 A;  2W9Q A;  2FGT A;  3CME 3;  3ER7 A;  3KZT A;  3LOY A;  1MWT A;  2W2C A;  3T8U A;  2Z77 A;  1YJN 3;  1T3B A;  5AYR B;  1W7C A;  4LMI A;  4JF8 A;  2O3O A;  4XBX A;  1FZU A;  1ULJ B;  2P0M A;  2CFK A;  1RNB A;  1RJO A;  1W5Z A;  5CK6 A;  2F99 A;  1VQ5 3;  1NB5 I;  2OWP A;  3V92 A;  3EN8 A;  3AGN A;  3UB1 A;  2CWT A;  1JB5 A;  1DMM A;  1RCK A;  2RCD A;  1VQ8 3;  4J5K A;  4J5G A;  1UCL A;  3KKG A;  3Q90 A;  2C4B A;  2R4I A;  2Z76 A;  3MG1 A;  7GSP A;  1W6C A;  3OV4 A;  1QVG 2;  1WMP A;  1NO3 A;  1YVB I;  1UCI A;  3GZX B;  3D79 A;  3CCQ 3;  3ALA A;  2BMR B;  2SBL A;  2YFJ B;  1N5H A;  1FA3 A;  1PU4 A;  3WA2 X;  1GYB A;  2GBW B;  1STF I;  3N8B A;  1RMS A;  1VQM 3;  5G1K A;  1Q7H A;  4WYK A;  1TJD A;  3PYJ A;  5AIF A;  3S27 A;  4K1U A;  3VGN A;  1US1 A;  1RGF A;  3F9S A;  4LEH A;  1ZGX A;  1R4C A;  1E3R A;  3HX8 A;  4JRF A;  2OOV A;  5D83 A;  1CH0 A;  3ZG0 A;  2OCT A;  1GOU A;  3ZFZ A;  1D6Z A;  4L8O A;  3WHO A;  1RTU A;  2W04 A;  4R9L A;  5IF6 A;  1X1X A;  1BSA A;  3URP A;  2B24 B;  3PCS A;  4MEI A;  5IW9 A;  2GEY A;  3CMA 3;  1OHO A;  5CLK A;  1JRQ A;  7STD A;  2HML B;  1BVI A;  2A15 A;  2OOV C;  3NX0 A;  4RZM A;  1Q40 B;  4FCZ A;  1PFP A;  4L8P A;  4J9A A;  3GAX A;  2RNT A;  3LTD A;  2HMO B;  4CDL A;  2BT3 A;  3G8Z A;  2UUG C;  5BIR A;  1JN5 B;  1FYS A;  5AYS C;  3WMD A;  3DXO A;  3KFQ C;  1KC8 4;  2QA4 3;  2CIU A;  1G02 A;  3NM7 A;  1YJ9 3;  2XGN A;  1GOV A;  1BOX A;  1B20 A;  3LYG A;  2LQV A;  1UCK A;  3OW2 2;  1JB2 A;  5BXQ A;  4MMY B;  3CCL 3;  3BNE A;  4KFF A;  1M1X B;  5IG3 A;  4XB5 A;  3F14 A;  1RHL A;  2CW9 A;  1MWU A;  1BSB A;  3CCM 3;  1YIJ 3;  3G71 3;  2W03 A;  1LOY A;  2B1X B;  3D5G A;  4TX4 A;  1I70 A;  2H0H A;  2E2V A;  5AIG A;  5STD A;  4CPK A;  1L5G B;  1MWS A;  2KF3 A;  5EVH A;  1Q81 4;  1I0V A;  1TUH A;  4FCJ A;  3DM8 A;  1FUS A;  1D6U A;  1R4Y A;  4N3V A;  3NBR A;  3JUM A;  2XEP A;  3G0K A;  3CPO A;  3I55 3;  1I2E A;  1YHQ 3;  4L7K A;  3S29 A;  4XDW A;  3O8Y A;  4N6V 0;  1W00 A;  4WWU C;  3WDG B;  5JPP A;  3NV0 A;  1MWR A;  1Y4K A;  2Z6B A;  4NPB A;  1M1K 4;  3X3Z A;  5A0O B;  1K9M 4;  1IYY A;  3IPT A;  3T0U A;  1YI2 3;  4EV5 A;  4HYZ A;  3LTA A;  5GSP A;  3NQY A;  1DMN A;  1K28 A;  2W56 A;  2KAA A;  4N6N B;  1RRH A;  2F5W A;  1IVW A;  2AAD A;  1YJW 3;  1VQ9 3;  1ISK A;  3A5E A;  4RBN A;  4EV2 A;  2UX0 A;  1UUG B;  8CHO A;  4BTY A;  1BNE A;  3KII A;  4HM0 B;  3WA3 A;  3PCR A;  5G1L A;  2XFT A;  3EQQ B;  4EW5 A;  3V99 A;  3K9M C;  1AV4 A;  1QAK A;  5HOH A;  1BNJ A;  1DYU A;  1RNT A;  2GXF A;  4LYL B;  4FR9 A;  1WMN A;  1K73 4;  1OHP A;  1RN1 A;  1GY5 A;  3PS8 A;  4FMC A;  4IPB A;  3FLJ A;  4AKZ A;  3BU4 A;  3KCH A;  3NM2 A;  4LGQ A;  1JKG A;  2K54 A;  2KCD A;  2WO0 A;  1ZO2 A;  2W9P A;  1GD3 A;  1A2V A;  3NXJ A;  4AKY A;  4Q53 A;  3HII A;  4XM4 A;  1SIH A;  5AII A;  3J7Y d;  2W6J H;  2WOH A;  4LZI A;  4FMA A;  5IER A;  4ILF A;  1MOL A;  4X2H A;  1UCJ A;  1SQW A;  1B3S A;  2GSP A;  4HOH A;  1N8Q A;  1OF5 B;  1BRJ A;  2IA7 A;  1ZX2 A;  5LC6 A;  3CC4 3;  1G96 A;  1GMP A;  1RGL A;  1JNQ A;  1LOX A;  5D82 A;  3F40 A;  4EBG A;  4R80 A;  1I2G A;  1OPY A;  1DMQ A;  5KP3 A;  1AVK A;  4STD A;  2GU1 A;  1OGX A;  1X1W A;  2WGO A;  3SOY A;  1JBS A;  2XGL A;  2IY2 A;  2GU3 A;  4HM4 B;  2YFL B;  1SAR A;  3DH2 A;  1IT8 A;  3FSD A;  3EC9 A;  4G1M B;  4XBY A;  4HM2 B;  3NBB A;  1JV2 B;  4HM8 B;  3LXU X;  1N9E A;  3DGL A;  3DY5 A;  3SVA A;  1CYV A;  2JDI H;  2CFD A;  3A76 A;  1OH0 A;  1IVX A;  4N6L A;  4IIA A;  1BNS A;  4WHA A;  1BNR A;  3F7X A;  2IMJ A;  3G16 A;  1GOY A;  2H0I A;  1FGQ A;  1N5P A;  2W0Q A;  2KF4 A;  1LQM B;  3S67 A;  1AY7 A;  2XRX B;  2XSO B;  3CCU 3;  1YNV X;  1I0X A;  4BL3 A;  1J2B A;  3IMA B;  2BO9 B;  2C11 A;  1KQS 2;  3LZA A;  1STD A;  3HOH A;  5AEW B;  1VQQ A;  1IQX A;  3CCE 3;  3BND A;  1AQZ A;  1WMO A;  3IJE B;  3M8C A;  2Q07 A;  3V98 A;  5JPU A;  3TDG A;  4WFO A;  4MJD A;  1U5O A;  3X3X A;  5AI1 A;  1BSE A;  1NB3 I;  4LSO A;  1KSI A;  4MMZ B;  3B7C A;  3X42 A;  4BIR A;  3K0Z A;  8RNT A;  3CD6 3;  1SPU A;  1OUN A;  2KXG A;  4FMD A;  3CCV 3;  1EEJ A;  2F86 B;  1GMR A;  5TGN A;  3CPW 2;  3F7S A;  2HMN B;  4XDV A;  1LQG C;  3N9H A;  1CQS A;  1C54 A;  4CJN A;  1KWI A;  3EE1 A;  2OTJ 3;  1CYU A;  2H0G A;  1ROV A;  2J8X B;  3BNC A;  1T2H A;  4EXR A;  2WOF A;  1M90 4;  2OTL 3;  4WP5 A;  2PNC A;  2P0X A;  3RNT A;  5IEN A;  1YIT 3;  1DET A;  3AHS A;  3EBY A;  1TU5 A;  1RCL A;  5EEO A;  3UL6 A;  2CWU A;  4XBT A;  3FZW A;  2E2T A;  1BRG A;  3EF8 A;  1FUT A;  1GMQ A;  1BGS A;  1RGA A;  1WQL B;  1X1Y A;  2RBI A;  1BNG A;  4N6U A;  3N54 B;  2L4V A;  1LOW A;  2CX1 A;  3EBT A;  3FGY A;  1WTH A;  1IT7 A;  2CFG A;  3LML A;  4HJL B;  5M18 A;  5IEO A;  1M9G A;  3T8N A;  2ZDJ A;  4O02 B;  1GS3 A;  5KP4 A;  2CC3 A;  3BLZ A;  1JZD A;  3DUK A;  3JUN A;  4GB5 A;  4H3U A;  7RNT A;  1D6Y A;  1AR0 A;  1TFK A;  1O7H B;  1GSP A;  1RGK A;  3HZP A;  5IG5 A;  1O7W B;  1LVN A;  1QAF A;  6RNT A;  1DE3 A;  1I2F A;  3S5C A;  2IUJ A;  1B2X A;  2Z7A A;  1EKM A;  3NUV A;  1SJW A;  3X40 A;  1GY7 A;  3BB9 A;  3H51 A;  1EG9 B;  4EYC A;  5IG0 A;  5AEU B;  3AMO B;  1FUW A;  1FGT A;  5DRE A;  5ELU A;  1UGI A;  2SAR A;  3RGA A;  3HIG A;  3CCR 3;  1SII A;  3KE7 A;  1UW1 A;  3SOA A;  2CKF B;  4BU4 A;  3JVC A;  1ZS7 A;  3DGM A;  3LT8 A;  1YVS A;  1RN4 A;  2RSX A;  2UGI A;  3ROB A;  3MG3 A;  5EQL A;  4NHF A;  4EC6 A;  1EA2 A;  3UL5 A;  4HM1 B;  1MGW A;  2L1S A;  3WOE B;  5ELJ A;  2F5M A;  1T2I A;  5RNT A;  1I8V A;  3U1W A;  3PXM A;  1VQN 3;  4RNT A;  2F98 A;  3B8L A;  1DVD A;  1BRH A;  1LXE A;  4HBR A;  2P38 A;  3X41 A;  2I9W A;  1BNI A; 
#chains in the Genus database with same CATH homology
 4MMX B;  5D81 A;  2ML5 A;  1NDO B;  2XH9 A;  1OHS A;  2CH9 A;  2BMQ B;  2RGQ A;  3WOD G;  3L0R A;  3VF1 A;  1VQ6 3;  2BNG A;  1NU3 A;  3MWZ A;  3RGR A;  5AIH A;  3CCS 3;  1W6Y A;  3ECF A;  3FF0 A;  3LTC A;  2M7O A;  1FGO A;  3NHX A;  3EJV A;  3X3Y A;  3F8H A;  3SED A;  2W56 B;  2ZL8 A;  1OF5 A;  2BHM A;  5DRV A;  3RDE A;  3D3L A;  5IEP A;  5KP1 A;  1ASK A;  4R1K A;  4N6M A;  4OVM A;  3K7C A;  5IG4 A;  4FMB A;  1IK3 A;  3DMC A;  1C7H A;  1W4N A;  1RN7 A;  1IQ8 A;  5BVB A;  2O9U X;  2CG0 A;  3G6E 3;  2QIY A;  5LC7 A;  2INX A;  2P09 A;  2MF7 A;  1N9J A;  3OWY A;  1IVV A;  1U8C B;  2STD A;  3BNB A;  1NWW A;  1JKG B;  3FCS B;  1RRL A;  3KSP A;  3OXA A;  3LTB A;  1IDP A;  1GD4 A;  2HMJ B;  2RFR A;  3FH1 A;  4H61 A;  3U97 A;  3LT9 A;  3CXC 2;  3OWS A;  2JQ5 A;  4GL6 A;  3JUO A;  4KVH A;  1Q7Y 4;  2XFS A;  2XR8 B;  2GEX A;  1UI8 A;  3EX9 A;  3MSO A;  1VQK 3;  3EN1 B;  1FGM A;  4O2H A;  4RNY A;  3F8X A;  2WGQ A;  3QRD A;  4HZ9 B;  3FG1 A;  4OK0 A;  4O3V A;  1E97 A;  1Q42 A;  3D9R A;  1A67 A;  5HGR A;  1S72 3;  2CHC A;  4KFD A;  1FGR A;  1IV9 A;  2FNQ A;  2QEX 3;  2D1W A;  1QMA A;  3CC2 3;  1QVF 2;  2FXT A;  3EHC A;  3CC7 3;  1IQY A;  1W6G A;  1ULI B;  1EQK A;  3GZB A;  3DGO A;  1IV7 A;  1Q40 A;  3K5T A;  4N6O B;  2YX9 A;  1W2B 2;  1O7G B;  3MKI A;  3GRD A;  2P05 A;  2CFW A;  2XSH B;  5CXO A;  1Q86 4;  4WYK B;  5CF2 A;  1IVU A;  3STD A;  1UUW B;  3CNM A;  3CU3 A;  3MG2 A;  2KRT A;  3JUP A;  4R9K A;  4HM6 B;  1E3V A;  4I4K A;  2K0M A;  2OQE A;  3E99 A;  1JN5 A;  3EB8 A;  1TFO A;  3OWU A;  4ZM8 A;  1A90 A;  2E2U A;  1W2Z A;  2YFI B;  3MHE A;  4RNZ A;  1QAL A;  3GZY B;  6STD A;  1UI7 A;  1W01 A;  2CK3 H;  3FF2 A;  3S28 A;  4HVN A;  3FKA A;  2Y73 A;  1VQL 3;  2OQE C;  4R4K A;  2D42 A;  1Z1S A;  1T5Y A;  3I0Y A;  3MPH A;  3NQZ A;  4FCM A;  2HMK B;  4HM3 B;  4O8S A;  4CCV A;  4PEJ A;  4N6T A;  1BUQ A;  1UUV B;  2MC8 A;  3GZR A;  4OUQ A;  3SX1 A;  1KD1 4;  3JUQ A;  1W02 A;  3DZL A;  4QWT A;  4AEQ A;  1CEW I;  3SLU A;  4X2O A;  3UJM A;  2IUK A;  4K1V A;  3NBJ A;  1K41 A;  3SXX A;  2CWV A;  1O7P B;  1QJG A;  4HKV B;  1HU9 A;  1VQP 3;  1Q82 4;  1ROA A;  1JJ2 2;  3B4P A;  4HZB B;  3AMO A;  3KSE D;  3Q2P A;  1YGE A;  1RKY A;  1JB4 A;  4IT7 A;  1OCV A;  1S5A A;  3MYT A;  3HK4 A;  5FW5 A;  4NRE A;  1NJI 4;  4ORL A;  1GY6 A;  4BTW A;  2GBX B;  4HM5 B;  2ML6 A;  2QGU A;  1MNL A;  1VQO 3;  1LNH A;  1V74 A;  3UNL A;  2CFL A;  3PZW A;  4BTX A;  3HI7 A;  2LYX A;  4KFE A;  3QK9 A;  3OX9 A;  3VSY A;  4J8T A;  5CF1 A;  3CNX A;  4KZ1 A;  1K8A 4;  3NV0 B;  3PGB A;  4HM7 B;  1VQ4 3;  3DGN A;  1AVL A;  1WNH A;  4K61 A;  5JBS A;  1DVC A;  3FG4 A;  3WOF B;  3K63 A;  1OAC A;  3H3H A;  5I97 A;  1TP6 A;  1HKX A;  1O7M B;  1OGZ A;  1N8R 4;  2V1L A;  2C10 A;  2XF3 A;  2CG1 A;  3LH4 A;  5FGO A;  3GWR A;  3Q1C A;  4K90 B;  5G2G A;  1VQ7 3;  1A2K A;  1TIJ A;  1F8N A;  3I56 3;  3CCJ 3;  1VZZ A;  1IU7 A;  3G4S 3;  3B4O A;  2HMM B;  2Y74 A;  3FG3 A;  2BMO B;  4U13 A;  2PZV A;  1O7N B;  3KN4 A;  2W9Q A;  2FGT A;  3CME 3;  3ER7 A;  3KZT A;  3LOY A;  2W2C A;  3T8U A;  2Z77 A;  1YJN 3;  5AYR B;  1W7C A;  4LMI A;  4JF8 A;  2O3O A;  4XBX A;  1ULJ B;  2P0M A;  2CFK A;  1RJO A;  1W5Z A;  5CK6 A;  2F99 A;  1VQ5 3;  1NB5 I;  2OWP A;  3V92 A;  3EN8 A;  3UB1 A;  2CWT A;  1JB5 A;  1DMM A;  1VQ8 3;  2RCD A;  3KKG A;  3Q90 A;  3MG1 A;  2R4I A;  2Z76 A;  1W6C A;  3OV4 A;  1QVG 2;  1WMP A;  1NO3 A;  1YVB I;  3GZX B;  3CCQ 3;  3ALA A;  2BMR B;  2SBL A;  2YFJ B;  1N5H A;  1FA3 A;  1PU4 A;  3WA2 X;  1GYB A;  2GBW B;  1STF I;  3N8B A;  1VQM 3;  4WYK A;  3PYJ A;  5AIF A;  3S27 A;  4K1U A;  3VGN A;  1US1 A;  3F9S A;  4LEH A;  1R4C A;  3HX8 A;  1E3R A;  4JRF A;  2OOV A;  1M90 4;  5D83 A;  2OCT A;  1D6Z A;  4L8O A;  2W04 A;  4R9L A;  5IF6 A;  2B24 B;  3PCS A;  4MEI A;  5IW9 A;  2GEY A;  3CMA 3;  1OHO A;  5CLK A;  1JRQ A;  7STD A;  2HML B;  2A15 A;  2OOV C;  3NX0 A;  4RZM A;  1Q40 B;  4FCZ A;  1PFP A;  4L8P A;  4J9A A;  3GAX A;  3LTD A;  2HMO B;  4CDL A;  2BT3 A;  3G8Z A;  1JN5 B;  3WMD A;  5AYS C;  3DXO A;  3KFQ C;  1KC8 4;  2QA4 3;  2CIU A;  3NM7 A;  1YJ9 3;  2XGN A;  3LYG A;  2LQV A;  3OW2 2;  1JB2 A;  5BXQ A;  4MMY B;  3CCL 3;  3BNE A;  4KFF A;  1M1X B;  5IG3 A;  4XB5 A;  3F14 A;  2CW9 A;  3CCM 3;  1YIJ 3;  3G71 3;  2W03 A;  2B1X B;  4TX4 A;  2E2V A;  5AIG A;  5STD A;  1L5G B;  5EVH A;  1Q81 4;  1TUH A;  4FCJ A;  3DM8 A;  1D6U A;  4N3V A;  3NBR A;  3JUM A;  2XEP A;  3G0K A;  3CPO A;  3I55 3;  1YHQ 3;  4L7K A;  3S29 A;  4XDW A;  3O8Y A;  4N6V 0;  1W00 A;  4WWU C;  3WDG B;  5JPP A;  3NV0 A;  1Y4K A;  2Z6B A;  1M1K 4;  3X3Z A;  5A0O B;  1K9M 4;  3IPT A;  3T0U A;  1YI2 3;  4EV5 A;  4HYZ A;  3LTA A;  3NQY A;  1DMN A;  1K28 A;  2W56 A;  4N6N B;  1YJW 3;  1RRH A;  1VQ9 3;  1IVW A;  1ISK A;  4RBN A;  4EV2 A;  2UX0 A;  8CHO A;  4BTY A;  3KII A;  4HM0 B;  3WA3 A;  3PCR A;  2XFT A;  3EQQ B;  3V99 A;  3K9M C;  1AV4 A;  1QAK A;  1DYU A;  2GXF A;  4FR9 A;  1WMN A;  1K73 4;  1OHP A;  3PS8 A;  1GY5 A;  4FMC A;  4IPB A;  3FLJ A;  4AKZ A;  4LGQ A;  3NM2 A;  1JKG A;  2WO0 A;  2K54 A;  2KCD A;  1ZO2 A;  2W9P A;  1GD3 A;  1A2V A;  3NXJ A;  4AKY A;  4Q53 A;  3HII A;  4XM4 A;  1SIH A;  5AII A;  3J7Y d;  2W6J H;  2WOH A;  4LZI A;  4FMA A;  5IER A;  1MOL A;  4X2H A;  1SQW A;  5LC6 A;  1N8Q A;  1OF5 B;  2IA7 A;  1ZX2 A;  3CC4 3;  1G96 A;  1JNQ A;  1LOX A;  5D82 A;  3F40 A;  4EBG A;  4R80 A;  5KP3 A;  1OPY A;  1DMQ A;  1AVK A;  4STD A;  2WGO A;  2GU1 A;  1OGX A;  3SOY A;  2XGL A;  2GU3 A;  4HM4 B;  2YFL B;  1IT8 A;  3FSD A;  3EC9 A;  4G1M B;  4XBY A;  4HM2 B;  3NBB A;  1JV2 B;  4HM8 B;  3LXU X;  1N9E A;  3DGL A;  3DY5 A;  3SVA A;  1CYV A;  2JDI H;  2CFD A;  3A76 A;  1OH0 A;  1IVX A;  4N6L A;  4IIA A;  4WHA A;  3F7X A;  2IMJ A;  3G16 A;  1FGQ A;  1N5P A;  2W0Q A;  3S67 A;  2XSO B;  2XRX B;  3CCU 3;  1J2B A;  3IMA B;  2BO9 B;  2C11 A;  1KQS 2;  3LZA A;  1STD A;  5AEW B;  1IQX A;  3CCE 3;  3BND A;  3IJE B;  1WMO A;  3M8C A;  2Q07 A;  3V98 A;  5JPU A;  3TDG A;  4WFO A;  4MJD A;  1U5O A;  3X3X A;  5AI1 A;  1NB3 I;  4LSO A;  1KSI A;  4MMZ B;  3B7C A;  3X42 A;  3CD6 3;  3K0Z A;  1SPU A;  1OUN A;  2KXG A;  4FMD A;  3CCV 3;  2F86 B;  5TGN A;  3CPW 2;  3F7S A;  2HMN B;  4XDV A;  3N9H A;  1CQS A;  1KWI A;  3EE1 A;  2OTJ 3;  1CYU A;  1ROV A;  3BNC A;  4EXR A;  2WOF A;  2OTL 3;  4WP5 A;  2PNC A;  2P0X A;  5IEN A;  1YIT 3;  3EBY A;  1TU5 A;  5EEO A;  3UL6 A;  2CWU A;  4XBT A;  3FZW A;  2E2T A;  3EF8 A;  4N6U A;  1WQL B;  3N54 B;  2L4V A;  3LML A;  3EBT A;  3FGY A;  1WTH A;  1IT7 A;  2CFG A;  4HJL B;  5IEO A;  1M9G A;  3T8N A;  2ZDJ A;  4O02 B;  1GS3 A;  5KP4 A;  2CC3 A;  3BLZ A;  3DUK A;  3JUN A;  4GB5 A;  4H3U A;  1D6Y A;  1AR0 A;  1TFK A;  1O7H B;  3HZP A;  5IG5 A;  1O7W B;  1LVN A;  1QAF A;  3S5C A;  2IUJ A;  2Z7A A;  1EKM A;  3NUV A;  1SJW A;  3X40 A;  1GY7 A;  3BB9 A;  3H51 A;  1EG9 B;  4EYC A;  5IG0 A;  5AEU B;  3AMO B;  1FUW A;  1FGT A;  5DRE A;  5ELU A;  3RGA A;  3HIG A;  3CCR 3;  1SII A;  3KE7 A;  1UW1 A;  3SOA A;  2CKF B;  3JVC A;  3DGM A;  3LT8 A;  2RSX A;  3ROB A;  3MG3 A;  5EQL A;  4NHF A;  4EC6 A;  1EA2 A;  3UL5 A;  4HM1 B;  3WOE B;  5ELJ A;  3U1W A;  3PXM A;  1VQN 3;  2F98 A;  3B8L A;  1DVD A;  1LXE A;  4HBR A;  2P38 A;  3X41 A;  2I9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...