5BVBA

Engineered digoxigenin binder dig5.1a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
SMNAKEILVHSLRLLENGDARGWCDLFHPEGVLEYPYAPPGWKTRFEGRETIWAHMRLHPEHVTWRFTDVQFYETADPDLAIGEYHGDGVVTVSGGKYAADYITVLRTRDGQILLLRVFWNPLRILEAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords DIG5.1a
publication title CSAR Benchmark Exercise 2013: Evaluation of Results from a Combined Computational Protein Design, Docking, and Scoring/Ranking Challenge.
pubmed doi rcsb
total genus 36
structure length 130
sequence length 130
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5bvbA00
2QIYA 5IG4A 3KKGA 3K0ZA 4R1KA 4K1VA 3F8HA 5STDA 1VZZA 3IPTA 3H3HA 3EN1B 2B24B 3EHCA 4I4KA 5FW5A 4OVMA 3OXAA 4FCJA 1JKGB 2BMRB 5AIGA 3DMCA 3F7XA 3H51A 3EBTA 1OGZA 3MSOA 3DZLA 4GB5A 3LZAA 1ZO2A 3EF8A 5IEOA 3B8LA 3JUPA 8CHOA 4HM1B 1OF5B 2XSHB 5IENA 4LGQA 3T8NA 1OUNA 1GY6A 3MYTA 1HKXA 2CKFB 1O7WB 1BUQA 1UUVB 1JN5B 4XDVA 1JN5A 3FKAA 3G16A 4XBTA 3EBYA 3Q90A 3OWUA 1NU3A 3SEDA 3NHXA 4N3VA 3CU3A 3G0KA 3F14A 3DXOA 1GS3A 1O7NB 3ROBA 2YFIB 2CHCA 4R9KA 1IDPA 3MG3A 5TGNA 4PEJA 3FH1A 3FSDA 1W01A 2PZVA 4WP5A 1OHSA 5JPUA 1C7HA 1OPYA 4HZBB 3OV4A 3UNLA 3JUMA 5IERA 5CF1A 5AIHA 3D9RA 5CXOA 7STDA 4J9AA 1GYBA 3B4PA 3WMDA 5DREA 4OUQA 1JB4A 5IG5A 4H3UA 3E99A 2GXFA 5CLKA 3K7CA 5KP4A 2IMJA 2W2CA 5AI1A 4IIAA 1QMAA 3SOYA 1E3RA 1GY5A 4HM4B 3F40A 2HMOB 3LYGA 5HGRA 3SOAA 2HMKB 4HM0B 3FLJA 3NV0A 2XRXB 3RGRA 1W02A 1TUHA 5IF6A 2R4IA 3GZBA 3M8CA 3MG1A 1Z1SA 3EX9A 4MJDA 4Q53A 1A2KA 3STDA 3HZPA 2JQ5A 3CPOA 3FF0A 5KP3A 2BNGA 1ZX2A 3BLZA 3FGYA 3DUKA 3DM8A 2YFJB 3EN8A 4HKVB 2I9WA 1O7HB 4XBYA 4XBXA 1O7GB 3CNXA 4CDLA 2F86B 2B1XB 3F8XA 1W00A 1GY7A 2GBXB 5D82A 4HM7B 5IG0A 1SJWA 2Z7AA 1OHOA 3B4OA 1UUWB 1DMQA 1STDA 3GZXB 2Z76A 5CF2A 4ORLA 4KVHA 3JUNA 2UX0A 3CNMA 3UJMA 6STDA 3A76A 4XDWA 4FCMA 4LMIA 4HM2B 1Q40A 3KE7A 1DMMA 3G8ZA 4WWUC 3S5CA 2HMNB 5AIFA 2F99A 5EVHA 4RZMA 4STDA 2INXA 4XM4A 4WYKA 3HX8A 5DRVA 3MKIA 3OWSA 4X2OA 2GEXA 4X2HA 4LEHA 3EJVA 2RGQA 2GEYA 3B7CA 3OX9A 3OWYA 1AR0A 3GRDA 3JUOA 1TP6A 3JUQA 3FF2A 5IG3A 1QJGA 3F7SA 5CK6A 1K41A 3VSYA 2Z77A 3NV0B 1S5AA 3T8UA 4L8OA 1E3VA 3NBRA 2XR8B 2A15A 2BMQB 3HK4A 1JKGA 1Q42A 5JPPA 4L7KA 4HM5B 3KZTA 5AEWB 5G2GA 2YFLB 2F98A 3RGAA 1OH0A 1EG9B 3GZYB 3BB9A 3GWRA 3KSPA 1ULIB 1W6YA 3EQQB 2GBWB 4HM3B 1NWWA 2HMJB 3I0YA 3MG2A 1OF5A 2RCDA 2K54A 4XB5A 4HZ9B 1JB2A 1ISKA 4L8PA 3FZWA 1JB5A 4HVNA 1OHPA 3F9SA 3EC9A 5AEUB 5BVBA 1ASKA 3NUVA 3NM2A 3VGNA 4HJLB 1OGXA 5AIIA 4J8TA 5IEPA 2STDA 2HMLB 1NDOB 2RFRA 2HMMB 5KP1A 1DMNA 1ULJB 1Q40B 4R9LA 2BMOB 1CQSA 4U13A 3GZRA 1E97A 3MHEA 1O7PB 3NXJA 4WYKB 5D83A 5D81A 5BXQA 1EA2A 2OWPA 3ECFA 2XSOB 1WQLB 4HM6B 2QGUA 3ER7A 4HM8B 1OCVA 4K1UA 1U5OA 1O7MB
chains in the Genus database with same CATH superfamily
2QIYA 2ML6A 3KN4A 1KQS2 5IG4A 3KKGA 1W5ZA 3K0ZA 4R1KA 4K1VA 1FGTA 1BRKA 4O2HA 3F8HA 1NO3A 1BGSA 4EC6A 1BSEA 1GOVA 5STDA 1BRHA 3BU4A 2MC8A 4BTYA 1VZZA 1DVCA 3IPTA 1MGWA 1N8R4 1WMNA 3H3HA 3EN1B 5EQLA 2B24B 1CH0A 3QK9A 3NQZA 1RGEA 1LOWA 3EHCA 5AYRB 4I4KA 3D4AA 1GMPA 1I0XA 4CJNA 5FW5A 1JJ22 1BSBA 4OVMA 1IK3A 3OXAA 4FCJA 1BRNL 2W56B 1JKGB 2BMRB 3KIIA 4G1MB 5AIGA 1UGIA 1G02A 3D79A 3DMCA 1AV4A 3F7XA 3H51A 1NB3I 3EBTA 4IPBA 3LOYA 1YJN3 1UDII 1B21A 1D6UA 3WOEB 1OGZA 1LOXA 5ELUA 3OW22 3MSOA 4R4KA 3DZLA 4GB5A 2AAEA 1N5HA 1SPUA 2CWUA 3DGLA 3LZAA 1ZO2A 3TDGA 2P0XA 2XF3A 3EF8A 2WOFA 5IEOA 3B8LA 1T2IA 3JUPA 6RNTA 1IYYA 8CHOA 1PYLA 4MMYB 1RGCA 1UGHI 1EKMA 2O3OA 1PFPA 1I70A 4FMCA 3L0RA 1UCIA 1RCKA 1SIHA 4HM1B 4I5QA 1OF5B 2XSHB 3CC43 5IENA 1IV7A 4LGQA 3DY5A 5M19A 3T8NA 1UI8A 3CCS3 1OUNA 1GY6A 1EQKA 1VQ83 2Z6BA 1TTOA 3MYTA 3G6E3 1J2BA 1HKXA 1YJW3 2BU4A 3AMOA 2CKFB 1VQ63 1O7WB 3WA3A 1A2PA 1BNFA 1BUQA 1UUVB 3KCHA 1GOYA 1JN5B 4WHAA 1RSNA 1N9JA 3BNCA 4XDVA 1JN5A 3FKAA 3G16A 4XBTA 2W9PA 1LOYA 1KWIA 4WFOA 5IW9A 3EBYA 3DGYA 3PYJA 4O8SA 1UI7A 3AHWA 1MGRA 3Q90A 1OACA 1UCJA 1VQ93 1RN4A 2XEPA 2W04A 3EB8A 3X42A 4EYCA 3HIGA 1RGGA 1BNSA 3PCSA 3NBBA 1Q7Y4 1R4YA 2XFSA 3OWUA 3WA2X 3V98A 1YGEA 3WR2A 1NU3A 3SEDA 2FNQA 3NHXA 4N3VA 3CU3A 3X3YA 4BU4A 2CX0A 3G0KA 3F14A 1JV2B 1PY3A 1Q864 1LQMB 1D6ZA 4AEQA 1UCLA 3DXOA 1DVDA 1GS3A 1T5YA 3HIIA 1O7NB 1X1UA 2CW9A 3LT8A 4NHFA 1FUSA 2YFIB 3ROBA 2CHCA 1YHQ3 2OTL3 1ZGXA 1IDPA 3MG3A 4R9KA 3AGOA 2PNCA 5TGNA 4PEJA 3FH1A 3FSDA 1STFI 2C11A 5GSPA 1W01A 3FCSB 1IVWA 2IA7A 1JBTA 1DETA 2PZVA 1OHSA 4WP5A 5HOHA 1C7HA 5JPUA 2KCDA 1OPYA 4HZBB 3SXXA 3OV4A 1LNIA 3LTBA 4K90B 3UNLA 3JUMA 4HYZA 5IERA 4N6LA 5CF1A 4MMXB 2K3DA 1RRHA 1BIRA 1RDSA 1IVVA 1NB5I 1RMSA 5AIHA 1N5PA 1K8A4 1QVG2 3LTDA 1M904 1IT8A 1JZDA 3QRDA 1V74A 3D9RA 4J5KA 5CXOA 2Y74A 4GHOA 7STDA 1F8NA 4J9AA 3Q1CA 1GYBA 4H61A 3B4PA 3D5GA 3WMDA 2WO0A 5DREA 4OUQA 4RNYA 3CD63 3KFQC 1JB4A 1B27A 1A90A 1UW1A 5IG5A 5I97A 4RNZA 3ZG0A 4H3UA 1RTUA 1GOUA 1W4NA 3E99A 2GXFA 2W03A 1TJDA 3V99A 1RRLA 5CLKA 3K7CA 3PS8A 2H0IA 3NBJA 5KP4A 1KD14 1Q824 2IMJA 2W2CA 5M18A 3I563 1RGHA 3MWZA 5AI1A 4IIAA 1QMAA 3HOHA 3SOYA 1E3RA 1C54A 1K734 1GY5A 1RGFA 1SARA 4HM4B 3F40A 2HMOB 4NPBA 1VQM3 3LYGA 3CCE3 1CYUA 1IT7A 3K63A 1B20A 4FR9A 5HGRA 2KF6A 1BU4A 3SOAA 4EW5A 1BNGA 1K28A 3WOFB 2HMKB 4HM0B 2KXGA 2M7OA 3S67A 1BRIA 2IY2A 3RNTA 1A2VA 4AKZA 3FLJA 1RNTA 2GU3A 1IQXA 3NV0A 2CFDA 1MWSA 2XRXB 1DYUA 3JVCA 2CFKA 3RGRA 1W02A 1TUHA 4LYLB 5IF6A 5RNTA 1X1WA 4BTWA 1YGWA 2R4IA 3GZBA 1T3BA 3M8CA 3MG1A 1FZUA 3D5IA 1W2ZA 1Z1SA 1WMOA 3EX9A 3K9MC 4MJDA 4KZ1A 1A67A 1JRQA 2XGNA 1B2XA 1Q7HA 1A2KA 1RGLA 2C4BA 4Q53A 2FGTA 2KF3A 3STDA 4DKIA 3I553 1GD4A 4ZM8A 3CME3 3HZPA 1I2FA 2JQ5A 2W9QA 1YIT3 3CPOA 9RNTA 3FF0A 3AMOB 5KP3A 3CCJ3 3LT9A 2ZL8A 3CXC2 3AHSA 3BNBA 1BNEA 2BNGA 2P38A 1ZX2A 1FW7A 4RNTA 2IUJA 3X3XA 2Y73A 2SBLA 1X1YA 3VF1A 3FG4A 3BLZA 5AYSC 1BRSA 1TFKA 2OCTA 3FGYA 1BNRA 3DUKA 3DM8A 2F5WA 2YFJB 1VQQA 3EN8A 3Q2PA 4HKVB 3CCQ3 1O7HB 2I9WA 4XBYA 4XBXA 3IMAB 2R41A 3LXUX 4GL6A 4N6MA 2ML5A 1KC84 1O7GB 1M1XB 4AKYA 2ZDJA 3CNXA 4CDLA 2F86B 2B1XB 4EV5A 1AQZA 2V1LA 2O9UX 1W00A 3F8XA 3NM7A 1HU9A 1Q814 1MWTA 1GY7A 1BRJA 2GBXB 2ZA4A 1IV9A 4HM7B 5D82A 2XFTA 5IG0A 2F56A 2XH9A 4ILFA 1SJWA 2Z7AA 3RDEA 1BSAA 1OHOA 1HYFA 3SLUA 4NREA 3UB1A 2CG0A 2F5MA 3B4OA 3CCL3 1UUWB 7GSPA 1PU4A 3LH4A 2Q07A 1DMQA 3UL6A 2KF5A 1STDA 1ROVA 3CMA3 1I2EA 1LRAA 3GZXB 1VQK3 2SARA 2CWVA 2C10A 2Z76A 3FG1A 3V92A 2UUGC 1YJ93 3NX0A 5CF2A 1ROAA 1BRGA 2D1WA 3WHOA 1QAFA 1CYVA 1TRPA 4ORLA 4KVHA 1SQWA 3JUNA 2UX0A 3CNMA 2JDIH 4JRFA 3UJMA 4JF8A 6STDA 1UCKA 1BVIA 5BU4A 3N54B 5G1KA 1K9M4 2KRTA 1AY7A 3A76A 4HBRA 4XDWA 3Q3FA 3S28A 4FCMA 2E2TA 2OOVC 4LMIA 1RGKA 2OQEC 1X1XA 1AVKA 1GMRA 4HM2B 1QVF2 1Q40A 3U97A 3KE7A 1WMPA 2CFGA 2W0QA 1DMMA 3G8ZA 2QEX3 3DGNA 2E2UA 4WWUC 3S5CA 1VQ43 2HMNB 5AIFA 1W6CA 3DGOA 4IT7A 3CPW2 3G4S3 1NNVA 2F99A 1I8VA 2WOHA 5EVHA 1FUTA 2HOHA 3LTCA 4RZMA 4STDA 2INXA 1IQ8A 1LXEA 4XM4A 1GSPA 4WYKA 1IQYA 3A5EA 1IVUA 3HX8A 5DRVA 2CK3H 2WGOA 2IYJA 1MOLA 2OOVA 1ZS7A 3MKIA 3OWSA 1R4CA 4X2OA 1FGQA 2GEXA 3SYUA 2QA43 1LNHA 2H0HA 2CC3A 4MEIA 4X2HA 1NJI4 4J5GA 4GSPA 4LEHA 3EJVA 5JBSA 2RGQA 4KT3B 2GEYA 4LSOA 3B7CA 5M1AA 3OX9A 1AVLA 3WDGB 3OWYA 1AR0A 3X3ZA 1JZOA 2RSXA 2CWTA 3GRDA 3JUOA 2GU1A 3HI7A 4TX4A 3IJEB 1FGOA 3ZFZA 4OK0A 1TP6A 3LMLA 3JUQA 4FMBA 4N6V0 3X41A 3FF2A 5IG3A 1QJGA 3X40A 3F7SA 4N6TA 5CK6A 2F4YA 1YVSA 3UL5A 1K41A 1IU7A 1HZ1A 3VSYA 2Z77A 3NV0B 4BL3A 1S5AA 3T8UA 1BNJA 5A0OB 1TFOA 3EE1A 1RGAA 1BANA 5G1LA 1WNHA 4L8OA 1MNLA 4BIRA 1E3VA 2J8XB 4EBGA 1VQ53 1RKYA 3NBRA 1D6YA 2XR8B 3ZG5A 2A15A 3G713 2BMQB 3DGMA 2W56A 3HK4A 1G0TA 1Q42A 1JKGA 2K0MA 2GSPA 4K61A 4O02B 1Y4KA 3CCU3 1S723 2CFLA 4L7KA 5JPPA 4HM5B 3KZTA 4BL2A 5AEWB 5G2GA 2YFLB 4HAAA 1QAKA 1B2SA 1Q9EA 2KAAA 4HOHA 1VQ73 2F98A 3RGAA 1GD3A 1OH0A 1EUIC 2FXTA 2P09A 1I2GA 1MWRA 4N6NB 1EG9B 3GZYB 3BB9A 4FMDA 4CPKA 1BSDA 1GMQA 3AGNA 3GWRA 3KSPA 3CC23 1YI23 1ULIB 5LC7A 1W6YA 3SX1A 3EQQB 3O8YA 1B3SA 2GBWB 4HM3B 1NWWA 2HMJB 4EXRA 3I0YA 1V58A 1EEJA 1RJOA 2L1SA 3T0UA 1UUGB 2P05A 1RN1A 5BIRA 3MG2A 1RCLA 3GAXA 1OF5A 1SIIA 1WTHA 1BNIA 3CCV3 3WODG 1RNBA 1MWUA 1RLSA 1CEWI 2K54A 2RCDA 3MPHA 2W6JH 1FUWA 1N8QA 1TRQA 1LQGC 4XB5A 2BIRA 4HZ9B 4KFFA 2XGLA 1DE3A 3CC73 1JB2A 1ISKA 4L8PA 2BT3A 1N9EA 4RBNA 3U1WA 3FZWA 4KFEA 3SVAA 2MF7A 1JNQA 1M9GA 1VQO3 2BO9B 1JB5A 4HVNA 1OHPA 2CX1A 1B2UA 2UGIA 3BNEA 3EC9A 3F9SA 2LQVA 1FGRA 5AEUB 5BVBA 2H0GA 3PCRA 1FA3A 1ASKA 3NUVA 1T2HA 3NM2A 2LYXA 2RNTA 3BNDA 3VGNA 2IUKA 1LOVA 1BAOA 4LZIA 4HJLB 1FYSA 1OGXA 1VQL3 5AIIA 4J8TA 3S27A 3GSPA 5IEPA 3LTAA 1BSCA 1L5GB 2STDA 2CG1A 4N6UA 3J7Yd 3N8BA 2HMLB 7RNTA 1KSIA 3CCM3 1W2B2 1IVXA 1VQP3 8RNTA 1NDOB 2BHMA 4R80A 5EEOA 1RHLA 1QALA 1LVNA 1BOXA 2RFRA 2HMMB 1B2ZA 1V57A 3KSED 4CCVA 1YVBI 1I3FA 2AADA 5KP1A 1DMNA 2ZHXB 3BIRA 1Q40B 1ULJB 4R9LA 1U8CB 2BMOB 2YX9A 5FGOA 2OTJ3 1FGMA 1CQSA 2RBIA 3CCR3 6GSPA 1B2MA 1JBSA 1JBRA 1YNVX 4U13A 2CH9A 4FMAA 1TIJA 3FG3A 4O3VA 1I0VA 1RN7A 3PZWA 3GZRA 5LC6A 1BUJA 1E97A 3MHEA 1YIJ3 1W7CA 4BTXA 1O7PB 1US1A 3NXJA 4WYKB 5D83A 1TU5A 5D81A 5BXQA 1EA2A 2OWPA 3URPA 3ECFA 2XSOB 2P0MA 2CFWA 3PXMA 1WQLB 2OQEA 1I3IA 3PGBA 1M1K4 4QWTA 4HM6B 2WGQA 4EV2A 2QGUA 1VQN3 3D3LA 2D42A 3ER7A 4HM8B 4MMZB 3DH2A 1OCVA 1W6GA 2CIUA 3NQYA 4N6OB 4K1UA 1G96A 2E2VA 4KFDA 1U5OA 3S29A 3N9HA 3ALAA 4FCZA 3K5TA 5ELJA 1O7MB 2KF4A 2L4VA
chains in the Genus database with same CATH topology
2QIYA 2ML6A 3KN4A 1KQS2 5IG4A 3KKGA 1W5ZA 3K0ZA 4R1KA 4K1VA 1FGTA 4O2HA 3F8HA 1NO3A 4EC6A 5STDA 4BTYA 2MC8A 1VZZA 1DVCA 3IPTA 1N8R4 1WMNA 3H3HA 3EN1B 5EQLA 2B24B 3QK9A 3NQZA 3EHCA 5IW9A 5AYRB 4I4KA 5FW5A 1JJ22 4OVMA 1IK3A 3OXAA 4FCJA 2W56B 1JKGB 2BMRB 3KIIA 4G1MB 5AIGA 3DMCA 1AV4A 3F7XA 3H51A 1NB3I 3EBTA 4IPBA 3LOYA 1YJN3 1D6UA 3WOEB 1OGZA 1LOXA 5ELUA 3OW22 3MSOA 4R4KA 3DZLA 4GB5A 1N5HA 1SPUA 2CWUA 3DGLA 3LZAA 1ZO2A 3TDGA 2P0XA 2XF3A 3EF8A 2WOFA 5IEOA 3B8LA 3JUPA 8CHOA 4MMYB 1EKMA 2O3OA 1PFPA 4FMCA 4HM1B 3L0RA 1SIHA 1OF5B 2XSHB 3CC43 5IENA 1IV7A 4LGQA 3DY5A 3T8NA 1UI8A 3CCS3 1OUNA 1GY6A 1EQKA 1VQ83 2Z6BA 3G6E3 3MYTA 1J2BA 1HKXA 1YJW3 3AMOA 2CKFB 1VQ63 1O7WB 3WA3A 1BUQA 1UUVB 1JN5B 4WHAA 1N9JA 3BNCA 4XDVA 1JN5A 3FKAA 3G16A 4XBTA 2W9PA 1KWIA 4WFOA 3EBYA 3PYJA 4O8SA 1UI7A 3Q90A 1OACA 1VQ93 2XEPA 2W04A 3EB8A 3X42A 4EYCA 3HIGA 1Q7Y4 3PCSA 3NBBA 2XFSA 3OWUA 3WA2X 3V98A 1YGEA 1NU3A 3SEDA 2FNQA 3NHXA 4N3VA 3CU3A 3X3YA 3G0KA 3F14A 1JV2B 1Q864 1D6ZA 4AEQA 1DVDA 3DXOA 1GS3A 1T5YA 3HIIA 1O7NB 2CW9A 3LT8A 4NHFA 3ROBA 2YFIB 2CHCA 1YHQ3 2OTL3 4R9KA 1IDPA 3MG3A 2PNCA 5TGNA 4PEJA 3FH1A 3FSDA 1STFI 2C11A 1W01A 3FCSB 1IVWA 2IA7A 2PZVA 4WP5A 1OHSA 5JPUA 1C7HA 2KCDA 1OPYA 4HZBB 3SXXA 3OV4A 3LTBA 4K90B 3UNLA 3JUMA 4HYZA 5IERA 4N6LA 5CF1A 4MMXB 1RRHA 1IVVA 1NB5I 5AIHA 1N5PA 1K8A4 1QVG2 3LTDA 1M904 1IT8A 3QRDA 1V74A 3D9RA 5CXOA 2Y74A 7STDA 1F8NA 4J9AA 3Q1CA 1GYBA 4H61A 3B4PA 3WMDA 2WO0A 5DREA 4OUQA 3CD63 3KFQC 1JB4A 1A90A 1UW1A 5IG5A 5I97A 4RNZA 4H3UA 3E99A 1W4NA 2GXFA 2W03A 3V99A 1RRLA 5CLKA 3K7CA 3PS8A 3NBJA 5KP4A 1KD14 1Q824 2IMJA 2W2CA 3I563 3MWZA 5AI1A 4IIAA 1QMAA 3SOYA 1E3RA 1K734 1GY5A 4HM4B 3F40A 2HMOB 1VQM3 3LYGA 3CCE3 1CYUA 1IT7A 3K63A 4FR9A 5HGRA 3SOAA 1K28A 3WOFB 2HMKB 4HM0B 2KXGA 2M7OA 3S67A 4AKZA 1A2VA 3FLJA 2GU3A 1IQXA 3NV0A 2CFDA 2XRXB 1DYUA 3JVCA 2CFKA 3RGRA 1W02A 1TUHA 5IF6A 4BTWA 2R4IA 3GZBA 3M8CA 3MG1A 1W2ZA 1Z1SA 1WMOA 3EX9A 3K9MC 4MJDA 4KZ1A 1A67A 1JRQA 2XGNA 4Q53A 1A2KA 2FGTA 3I553 3STDA 1GD4A 4ZM8A 3CME3 3HZPA 2JQ5A 2W9QA 1YIT3 3CPOA 3FF0A 3AMOB 5KP3A 3CCJ3 3LT9A 2ZL8A 3CXC2 3BNBA 2BNGA 2P38A 1ZX2A 2IUJA 3X3XA 2Y73A 2SBLA 3VF1A 3FG4A 3BLZA 5AYSC 1TFKA 2OCTA 3FGYA 3DUKA 3DM8A 2YFJB 3EN8A 4HKVB 3Q2PA 3CCQ3 2I9WA 1O7HB 4XBYA 4XBXA 3IMAB 3LXUX 4GL6A 4N6MA 2ML5A 1KC84 1O7GB 1M1XB 4AKYA 2ZDJA 3CNXA 4CDLA 2F86B 2B1XB 4EV5A 2V1LA 2O9UX 1W00A 3F8XA 3NM7A 1HU9A 1GY7A 2GBXB 5D82A 1IV9A 4HM7B 2XFTA 5IG0A 2XH9A 1SJWA 2Z7AA 3RDEA 3SLUA 1OHOA 3UB1A 4NREA 2CG0A 3B4OA 3CCL3 1UUWB 1PU4A 3LH4A 2Q07A 1DMQA 3UL6A 1STDA 1ROVA 3CMA3 3GZXB 1VQK3 1Q814 2Z76A 2CWVA 2C10A 3FG1A 3V92A 1YJ93 3NX0A 5CF2A 1ROAA 2D1WA 1QAFA 1CYVA 4ORLA 4KVHA 1SQWA 3JUNA 2UX0A 3CNMA 2JDIH 4JRFA 3UJMA 4JF8A 6STDA 3N54B 1K9M4 2KRTA 4HBRA 3A76A 4XDWA 3S28A 4FCMA 2E2TA 2OOVC 4LMIA 2OQEC 1AVKA 4HM2B 1QVF2 1Q40A 3U97A 3KE7A 1WMPA 2CFGA 2W0QA 1DMMA 3G8ZA 2QEX3 3DGNA 2E2UA 4WWUC 3S5CA 1VQ43 2HMNB 5AIFA 1W6CA 3DGOA 4IT7A 3CPW2 3G4S3 2F99A 2WOHA 5EVHA 3LTCA 4RZMA 4STDA 2INXA 1IQ8A 1LXEA 4XM4A 4WYKA 1IQYA 3HX8A 1IVUA 5DRVA 2CK3H 2WGOA 1MOLA 2OOVA 3MKIA 3OWSA 1R4CA 4X2OA 1FGQA 2GEXA 2QA43 1LNHA 2CC3A 4MEIA 4X2HA 1NJI4 4LEHA 3EJVA 5JBSA 2RGQA 2GEYA 4LSOA 3B7CA 3OX9A 1AVLA 3WDGB 3OWYA 1AR0A 3X3ZA 2RSXA 2CWTA 3GRDA 3JUOA 2GU1A 3HI7A 4TX4A 3IJEB 1FGOA 4OK0A 1TP6A 3LMLA 3JUQA 4FMBA 4N6V0 3X41A 3FF2A 5IG3A 1QJGA 3X40A 3F7SA 4N6TA 5CK6A 3UL5A 1K41A 1IU7A 3VSYA 2Z77A 3NV0B 1S5AA 3T8UA 5A0OB 1TFOA 3EE1A 1WNHA 4L8OA 1MNLA 1E3VA 4EBGA 1VQ53 1RKYA 3NBRA 1D6YA 2XR8B 2A15A 3G713 2BMQB 3DGMA 2W56A 3HK4A 2K0MA 1Q42A 1JKGA 4K61A 4O02B 3CCU3 1Y4KA 1S723 2CFLA 4L7KA 5JPPA 4HM5B 3KZTA 5AEWB 5G2GA 2YFLB 1QAKA 1VQ73 2F98A 3RGAA 1GD3A 1OH0A 2FXTA 2P09A 4N6NB 1EG9B 3GZYB 3BB9A 4FMDA 3GWRA 3KSPA 3CC23 1YI23 1ULIB 5LC7A 1W6YA 3SX1A 3EQQB 3O8YA 2GBWB 4HM3B 1NWWA 2HMJB 4EXRA 3I0YA 3T0UA 1RJOA 2P05A 3MG2A 3GAXA 1OF5A 1SIIA 1WTHA 3CCV3 3WODG 2RCDA 1CEWI 2K54A 3MPHA 2W6JH 1FUWA 1N8QA 4XB5A 4HZ9B 4KFFA 2XGLA 3CC73 1JB2A 1ISKA 4L8PA 2BT3A 1N9EA 4RBNA 3U1WA 3FZWA 4KFEA 3SVAA 2MF7A 1JNQA 1M9GA 1VQO3 2BO9B 1JB5A 4HVNA 1OHPA 3BNEA 3F9SA 3EC9A 2LQVA 1FGRA 5AEUB 5BVBA 3PCRA 1FA3A 1ASKA 3NUVA 3NM2A 2LYXA 3BNDA 3VGNA 2IUKA 4LZIA 4HJLB 1OGXA 1VQL3 5AIIA 4J8TA 3S27A 5IEPA 3LTAA 1L5GB 2STDA 2CG1A 4N6UA 3J7Yd 3N8BA 2HMLB 1KSIA 3CCM3 1W2B2 1IVXA 1VQP3 1NDOB 2BHMA 4R80A 5EEOA 1QALA 1LVNA 2RFRA 2HMMB 3KSED 4CCVA 1YVBI 5KP1A 1DMNA 1Q40B 1ULJB 4R9LA 1U8CB 2BMOB 2YX9A 5FGOA 2OTJ3 1FGMA 1CQSA 3CCR3 4U13A 2CH9A 4FMAA 1TIJA 3FG3A 4O3VA 1RN7A 3PZWA 3GZRA 5LC6A 1E97A 3MHEA 1YIJ3 1W7CA 4BTXA 1O7PB 1US1A 3NXJA 4WYKB 5D83A 1TU5A 5D81A 5BXQA 1EA2A 2OWPA 3ECFA 2XSOB 2P0MA 2CFWA 3PXMA 1WQLB 2OQEA 3PGBA 1M1K4 4QWTA 4HM6B 2WGQA 4EV2A 2QGUA 1VQN3 3D3LA 2D42A 3ER7A 4HM8B 4MMZB 4RNYA 1OCVA 1W6GA 2CIUA 3NQYA 4N6OB 4K1UA 1G96A 2E2VA 4KFDA 1U5OA 3S29A 3N9HA 3ALAA 4FCZA 3K5TA 5ELJA 1O7MB 2L4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIY A;  5IG4 A;  3KKG A;  3K0Z A;  4R1K A;  4K1V A;  3F8H A;  5STD A;  1VZZ A;  3IPT A;  3H3H A;  3EN1 B;  2B24 B;  3EHC A;  4I4K A;  5FW5 A;  4OVM A;  3OXA A;  4FCJ A;  1JKG B;  2BMR B;  5AIG A;  3DMC A;  3F7X A;  3H51 A;  3EBT A;  1OGZ A;  3MSO A;  3DZL A;  4GB5 A;  3LZA A;  1ZO2 A;  3EF8 A;  5IEO A;  3B8L A;  3JUP A;  8CHO A;  4HM1 B;  1OF5 B;  2XSH B;  5IEN A;  4LGQ A;  3T8N A;  1OUN A;  1GY6 A;  3MYT A;  1HKX A;  2CKF B;  1O7W B;  1BUQ A;  1UUV B;  1JN5 B;  4XDV A;  1JN5 A;  3FKA A;  3G16 A;  4XBT A;  3EBY A;  3Q90 A;  3OWU A;  1NU3 A;  3SED A;  3NHX A;  4N3V A;  3CU3 A;  3G0K A;  3F14 A;  3DXO A;  1GS3 A;  1O7N B;  3ROB A;  2YFI B;  2CHC A;  4R9K A;  1IDP A;  3MG3 A;  5TGN A;  4PEJ A;  3FH1 A;  3FSD A;  1W01 A;  2PZV A;  4WP5 A;  1OHS A;  5JPU A;  1C7H A;  1OPY A;  4HZB B;  3OV4 A;  3UNL A;  3JUM A;  5IER A;  5CF1 A;  5AIH A;  3D9R A;  5CXO A;  7STD A;  4J9A A;  1GYB A;  3B4P A;  3WMD A;  5DRE A;  4OUQ A;  1JB4 A;  5IG5 A;  4H3U A;  3E99 A;  2GXF A;  5CLK A;  3K7C A;  5KP4 A;  2IMJ A;  2W2C A;  5AI1 A;  4IIA A;  1QMA A;  3SOY A;  1E3R A;  1GY5 A;  4HM4 B;  3F40 A;  2HMO B;  3LYG A;  5HGR A;  3SOA A;  2HMK B;  4HM0 B;  3FLJ A;  3NV0 A;  2XRX B;  3RGR A;  1W02 A;  1TUH A;  5IF6 A;  2R4I A;  3GZB A;  3M8C A;  3MG1 A;  1Z1S A;  3EX9 A;  4MJD A;  4Q53 A;  1A2K A;  3STD A;  3HZP A;  2JQ5 A;  3CPO A;  3FF0 A;  5KP3 A;  2BNG A;  1ZX2 A;  3BLZ A;  3FGY A;  3DUK A;  3DM8 A;  2YFJ B;  3EN8 A;  4HKV B;  2I9W A;  1O7H B;  4XBY A;  4XBX A;  1O7G B;  3CNX A;  4CDL A;  2F86 B;  2B1X B;  3F8X A;  1W00 A;  1GY7 A;  2GBX B;  5D82 A;  4HM7 B;  5IG0 A;  1SJW A;  2Z7A A;  1OHO A;  3B4O A;  1UUW B;  1DMQ A;  1STD A;  3GZX B;  2Z76 A;  5CF2 A;  4ORL A;  4KVH A;  3JUN A;  2UX0 A;  3CNM A;  3UJM A;  6STD A;  3A76 A;  4XDW A;  4FCM A;  4LMI A;  4HM2 B;  1Q40 A;  3KE7 A;  1DMM A;  3G8Z A;  4WWU C;  3S5C A;  2HMN B;  5AIF A;  2F99 A;  5EVH A;  4RZM A;  4STD A;  2INX A;  4XM4 A;  4WYK A;  3HX8 A;  5DRV A;  3MKI A;  3OWS A;  4X2O A;  2GEX A;  4X2H A;  4LEH A;  3EJV A;  2RGQ A;  2GEY A;  3B7C A;  3OX9 A;  3OWY A;  1AR0 A;  3GRD A;  3JUO A;  1TP6 A;  3JUQ A;  3FF2 A;  5IG3 A;  1QJG A;  3F7S A;  5CK6 A;  1K41 A;  3VSY A;  2Z77 A;  3NV0 B;  1S5A A;  3T8U A;  4L8O A;  1E3V A;  3NBR A;  2XR8 B;  2A15 A;  2BMQ B;  3HK4 A;  1JKG A;  1Q42 A;  5JPP A;  4L7K A;  4HM5 B;  3KZT A;  5AEW B;  5G2G A;  2YFL B;  2F98 A;  3RGA A;  1OH0 A;  1EG9 B;  3GZY B;  3BB9 A;  3GWR A;  3KSP A;  1ULI B;  1W6Y A;  3EQQ B;  2GBW B;  4HM3 B;  1NWW A;  2HMJ B;  3I0Y A;  3MG2 A;  1OF5 A;  2RCD A;  2K54 A;  4XB5 A;  4HZ9 B;  1JB2 A;  1ISK A;  4L8P A;  3FZW A;  1JB5 A;  4HVN A;  1OHP A;  3F9S A;  3EC9 A;  5AEU B;  5BVB A;  1ASK A;  3NUV A;  3NM2 A;  3VGN A;  4HJL B;  1OGX A;  5AII A;  4J8T A;  5IEP A;  2STD A;  2HML B;  1NDO B;  2RFR A;  2HMM B;  5KP1 A;  1DMN A;  1ULJ B;  1Q40 B;  4R9L A;  2BMO B;  1CQS A;  4U13 A;  3GZR A;  1E97 A;  3MHE A;  1O7P B;  3NXJ A;  4WYK B;  5D83 A;  5D81 A;  5BXQ A;  1EA2 A;  2OWP A;  3ECF A;  2XSO B;  1WQL B;  4HM6 B;  2QGU A;  3ER7 A;  4HM8 B;  1OCV A;  4K1U A;  1U5O A;  1O7M B; 
#chains in the Genus database with same CATH topology
 2QIY A;  2ML6 A;  3KN4 A;  1KQS 2;  5IG4 A;  3KKG A;  1W5Z A;  3K0Z A;  4R1K A;  4K1V A;  1FGT A;  1BRK A;  4O2H A;  3F8H A;  1NO3 A;  1BGS A;  4EC6 A;  1BSE A;  1GOV A;  5STD A;  1BRH A;  3BU4 A;  2MC8 A;  4BTY A;  1VZZ A;  1DVC A;  3IPT A;  1MGW A;  1N8R 4;  1WMN A;  3H3H A;  3EN1 B;  5EQL A;  2B24 B;  1CH0 A;  3QK9 A;  3NQZ A;  1RGE A;  1LOW A;  3EHC A;  5AYR B;  4I4K A;  3D4A A;  1GMP A;  1I0X A;  4CJN A;  5FW5 A;  1JJ2 2;  1BSB A;  4OVM A;  1IK3 A;  3OXA A;  4FCJ A;  1BRN L;  2W56 B;  1JKG B;  2BMR B;  3KII A;  4G1M B;  5AIG A;  1UGI A;  1G02 A;  3D79 A;  3DMC A;  1AV4 A;  3F7X A;  3H51 A;  1NB3 I;  3EBT A;  4IPB A;  3LOY A;  1YJN 3;  1UDI I;  1B21 A;  1D6U A;  3WOE B;  1OGZ A;  1LOX A;  5ELU A;  3OW2 2;  3MSO A;  4R4K A;  3DZL A;  4GB5 A;  2AAE A;  1N5H A;  1SPU A;  2CWU A;  3DGL A;  3LZA A;  1ZO2 A;  3TDG A;  2P0X A;  2XF3 A;  3EF8 A;  2WOF A;  5IEO A;  3B8L A;  1T2I A;  3JUP A;  6RNT A;  1IYY A;  8CHO A;  1PYL A;  4MMY B;  1RGC A;  1UGH I;  1EKM A;  2O3O A;  1PFP A;  1I70 A;  4FMC A;  3L0R A;  1UCI A;  1RCK A;  1SIH A;  4HM1 B;  4I5Q A;  1OF5 B;  2XSH B;  3CC4 3;  5IEN A;  1IV7 A;  4LGQ A;  3DY5 A;  5M19 A;  3T8N A;  1UI8 A;  3CCS 3;  1OUN A;  1GY6 A;  1EQK A;  1VQ8 3;  2Z6B A;  1TTO A;  3MYT A;  3G6E 3;  1J2B A;  1HKX A;  1YJW 3;  2BU4 A;  3AMO A;  2CKF B;  1VQ6 3;  1O7W B;  3WA3 A;  1A2P A;  1BNF A;  1BUQ A;  1UUV B;  3KCH A;  1GOY A;  1JN5 B;  4WHA A;  1RSN A;  1N9J A;  3BNC A;  4XDV A;  1JN5 A;  3FKA A;  3G16 A;  4XBT A;  2W9P A;  1LOY A;  1KWI A;  4WFO A;  5IW9 A;  3EBY A;  3DGY A;  3PYJ A;  4O8S A;  1UI7 A;  3AHW A;  1MGR A;  3Q90 A;  1OAC A;  1UCJ A;  1VQ9 3;  1RN4 A;  2XEP A;  2W04 A;  3EB8 A;  3X42 A;  4EYC A;  3HIG A;  1RGG A;  1BNS A;  3PCS A;  3NBB A;  1Q7Y 4;  1R4Y A;  2XFS A;  3OWU A;  3WA2 X;  3V98 A;  1YGE A;  3WR2 A;  1NU3 A;  3SED A;  2FNQ A;  3NHX A;  4N3V A;  3CU3 A;  3X3Y A;  4BU4 A;  2CX0 A;  3G0K A;  3F14 A;  1JV2 B;  1PY3 A;  1Q86 4;  1LQM B;  1D6Z A;  4AEQ A;  1UCL A;  3DXO A;  1DVD A;  1GS3 A;  1T5Y A;  3HII A;  1O7N B;  1X1U A;  2CW9 A;  3LT8 A;  4NHF A;  1FUS A;  2YFI B;  3ROB A;  2CHC A;  1YHQ 3;  2OTL 3;  1ZGX A;  1IDP A;  3MG3 A;  4R9K A;  3AGO A;  2PNC A;  5TGN A;  4PEJ A;  3FH1 A;  3FSD A;  1STF I;  2C11 A;  5GSP A;  1W01 A;  3FCS B;  1IVW A;  2IA7 A;  1JBT A;  1DET A;  2PZV A;  1OHS A;  4WP5 A;  5HOH A;  1C7H A;  5JPU A;  2KCD A;  1OPY A;  4HZB B;  3SXX A;  3OV4 A;  1LNI A;  3LTB A;  4K90 B;  3UNL A;  3JUM A;  4HYZ A;  5IER A;  4N6L A;  5CF1 A;  4MMX B;  2K3D A;  1RRH A;  1BIR A;  1RDS A;  1IVV A;  1NB5 I;  1RMS A;  5AIH A;  1N5P A;  1K8A 4;  1QVG 2;  3LTD A;  1M90 4;  1IT8 A;  1JZD A;  3QRD A;  1V74 A;  3D9R A;  4J5K A;  5CXO A;  2Y74 A;  4GHO A;  7STD A;  1F8N A;  4J9A A;  3Q1C A;  1GYB A;  4H61 A;  3B4P A;  3D5G A;  3WMD A;  2WO0 A;  5DRE A;  4OUQ A;  4RNY A;  3CD6 3;  3KFQ C;  1JB4 A;  1B27 A;  1A90 A;  1UW1 A;  5IG5 A;  5I97 A;  4RNZ A;  3ZG0 A;  4H3U A;  1RTU A;  1GOU A;  1W4N A;  3E99 A;  2GXF A;  2W03 A;  1TJD A;  3V99 A;  1RRL A;  5CLK A;  3K7C A;  3PS8 A;  2H0I A;  3NBJ A;  5KP4 A;  1KD1 4;  1Q82 4;  2IMJ A;  2W2C A;  5M18 A;  3I56 3;  1RGH A;  3MWZ A;  5AI1 A;  4IIA A;  1QMA A;  3HOH A;  3SOY A;  1E3R A;  1C54 A;  1K73 4;  1GY5 A;  1RGF A;  1SAR A;  4HM4 B;  3F40 A;  2HMO B;  4NPB A;  1VQM 3;  3LYG A;  3CCE 3;  1CYU A;  1IT7 A;  3K63 A;  1B20 A;  4FR9 A;  5HGR A;  2KF6 A;  1BU4 A;  3SOA A;  4EW5 A;  1BNG A;  1K28 A;  3WOF B;  2HMK B;  4HM0 B;  2KXG A;  2M7O A;  3S67 A;  1BRI A;  2IY2 A;  3RNT A;  1A2V A;  4AKZ A;  3FLJ A;  1RNT A;  2GU3 A;  1IQX A;  3NV0 A;  2CFD A;  1MWS A;  2XRX B;  1DYU A;  3JVC A;  2CFK A;  3RGR A;  1W02 A;  1TUH A;  4LYL B;  5IF6 A;  5RNT A;  1X1W A;  4BTW A;  1YGW A;  2R4I A;  3GZB A;  1T3B A;  3M8C A;  3MG1 A;  1FZU A;  3D5I A;  1W2Z A;  1Z1S A;  1WMO A;  3EX9 A;  3K9M C;  4MJD A;  4KZ1 A;  1A67 A;  1JRQ A;  2XGN A;  1B2X A;  1Q7H A;  1A2K A;  1RGL A;  2C4B A;  4Q53 A;  2FGT A;  2KF3 A;  3STD A;  4DKI A;  3I55 3;  1GD4 A;  4ZM8 A;  3CME 3;  3HZP A;  1I2F A;  2JQ5 A;  2W9Q A;  1YIT 3;  3CPO A;  9RNT A;  3FF0 A;  3AMO B;  5KP3 A;  3CCJ 3;  3LT9 A;  2ZL8 A;  3CXC 2;  3AHS A;  3BNB A;  1BNE A;  2BNG A;  2P38 A;  1ZX2 A;  1FW7 A;  4RNT A;  2IUJ A;  3X3X A;  2Y73 A;  2SBL A;  1X1Y A;  3VF1 A;  3FG4 A;  3BLZ A;  5AYS C;  1BRS A;  1TFK A;  2OCT A;  3FGY A;  1BNR A;  3DUK A;  3DM8 A;  2F5W A;  2YFJ B;  1VQQ A;  3EN8 A;  3Q2P A;  4HKV B;  3CCQ 3;  1O7H B;  2I9W A;  4XBY A;  4XBX A;  3IMA B;  2R41 A;  3LXU X;  4GL6 A;  4N6M A;  2ML5 A;  1KC8 4;  1O7G B;  1M1X B;  4AKY A;  2ZDJ A;  3CNX A;  4CDL A;  2F86 B;  2B1X B;  4EV5 A;  1AQZ A;  2V1L A;  2O9U X;  1W00 A;  3F8X A;  3NM7 A;  1HU9 A;  1Q81 4;  1MWT A;  1GY7 A;  1BRJ A;  2GBX B;  2ZA4 A;  1IV9 A;  4HM7 B;  5D82 A;  2XFT A;  5IG0 A;  2F56 A;  2XH9 A;  4ILF A;  1SJW A;  2Z7A A;  3RDE A;  1BSA A;  1OHO A;  1HYF A;  3SLU A;  4NRE A;  3UB1 A;  2CG0 A;  2F5M A;  3B4O A;  3CCL 3;  1UUW B;  7GSP A;  1PU4 A;  3LH4 A;  2Q07 A;  1DMQ A;  3UL6 A;  2KF5 A;  1STD A;  1ROV A;  3CMA 3;  1I2E A;  1LRA A;  3GZX B;  1VQK 3;  2SAR A;  2CWV A;  2C10 A;  2Z76 A;  3FG1 A;  3V92 A;  2UUG C;  1YJ9 3;  3NX0 A;  5CF2 A;  1ROA A;  1BRG A;  2D1W A;  3WHO A;  1QAF A;  1CYV A;  1TRP A;  4ORL A;  4KVH A;  1SQW A;  3JUN A;  2UX0 A;  3CNM A;  2JDI H;  4JRF A;  3UJM A;  4JF8 A;  6STD A;  1UCK A;  1BVI A;  5BU4 A;  3N54 B;  5G1K A;  1K9M 4;  2KRT A;  1AY7 A;  3A76 A;  4HBR A;  4XDW A;  3Q3F A;  3S28 A;  4FCM A;  2E2T A;  2OOV C;  4LMI A;  1RGK A;  2OQE C;  1X1X A;  1AVK A;  1GMR A;  4HM2 B;  1QVF 2;  1Q40 A;  3U97 A;  3KE7 A;  1WMP A;  2CFG A;  2W0Q A;  1DMM A;  3G8Z A;  2QEX 3;  3DGN A;  2E2U A;  4WWU C;  3S5C A;  1VQ4 3;  2HMN B;  5AIF A;  1W6C A;  3DGO A;  4IT7 A;  3CPW 2;  3G4S 3;  1NNV A;  2F99 A;  1I8V A;  2WOH A;  5EVH A;  1FUT A;  2HOH A;  3LTC A;  4RZM A;  4STD A;  2INX A;  1IQ8 A;  1LXE A;  4XM4 A;  1GSP A;  4WYK A;  1IQY A;  3A5E A;  1IVU A;  3HX8 A;  5DRV A;  2CK3 H;  2WGO A;  2IYJ A;  1MOL A;  2OOV A;  1ZS7 A;  3MKI A;  3OWS A;  1R4C A;  4X2O A;  1FGQ A;  2GEX A;  3SYU A;  2QA4 3;  1LNH A;  2H0H A;  2CC3 A;  4MEI A;  4X2H A;  1NJI 4;  4J5G A;  4GSP A;  4LEH A;  3EJV A;  5JBS A;  2RGQ A;  4KT3 B;  2GEY A;  4LSO A;  3B7C A;  5M1A A;  3OX9 A;  1AVL A;  3WDG B;  3OWY A;  1AR0 A;  3X3Z A;  1JZO A;  2RSX A;  2CWT A;  3GRD A;  3JUO A;  2GU1 A;  3HI7 A;  4TX4 A;  3IJE B;  1FGO A;  3ZFZ A;  4OK0 A;  1TP6 A;  3LML A;  3JUQ A;  4FMB A;  4N6V 0;  3X41 A;  3FF2 A;  5IG3 A;  1QJG A;  3X40 A;  3F7S A;  4N6T A;  5CK6 A;  2F4Y A;  1YVS A;  3UL5 A;  1K41 A;  1IU7 A;  1HZ1 A;  3VSY A;  2Z77 A;  3NV0 B;  4BL3 A;  1S5A A;  3T8U A;  1BNJ A;  5A0O B;  1TFO A;  3EE1 A;  1RGA A;  1BAN A;  5G1L A;  1WNH A;  4L8O A;  1MNL A;  4BIR A;  1E3V A;  2J8X B;  4EBG A;  1VQ5 3;  1RKY A;  3NBR A;  1D6Y A;  2XR8 B;  3ZG5 A;  2A15 A;  3G71 3;  2BMQ B;  3DGM A;  2W56 A;  3HK4 A;  1G0T A;  1Q42 A;  1JKG A;  2K0M A;  2GSP A;  4K61 A;  4O02 B;  1Y4K A;  3CCU 3;  1S72 3;  2CFL A;  4L7K A;  5JPP A;  4HM5 B;  3KZT A;  4BL2 A;  5AEW B;  5G2G A;  2YFL B;  4HAA A;  1QAK A;  1B2S A;  1Q9E A;  2KAA A;  4HOH A;  1VQ7 3;  2F98 A;  3RGA A;  1GD3 A;  1OH0 A;  1EUI C;  2FXT A;  2P09 A;  1I2G A;  1MWR A;  4N6N B;  1EG9 B;  3GZY B;  3BB9 A;  4FMD A;  4CPK A;  1BSD A;  1GMQ A;  3AGN A;  3GWR A;  3KSP A;  3CC2 3;  1YI2 3;  1ULI B;  5LC7 A;  1W6Y A;  3SX1 A;  3EQQ B;  3O8Y A;  1B3S A;  2GBW B;  4HM3 B;  1NWW A;  2HMJ B;  4EXR A;  3I0Y A;  1V58 A;  1EEJ A;  1RJO A;  2L1S A;  3T0U A;  1UUG B;  2P05 A;  1RN1 A;  5BIR A;  3MG2 A;  1RCL A;  3GAX A;  1OF5 A;  1SII A;  1WTH A;  1BNI A;  3CCV 3;  3WOD G;  1RNB A;  1MWU A;  1RLS A;  1CEW I;  2K54 A;  2RCD A;  3MPH A;  2W6J H;  1FUW A;  1N8Q A;  1TRQ A;  1LQG C;  4XB5 A;  2BIR A;  4HZ9 B;  4KFF A;  2XGL A;  1DE3 A;  3CC7 3;  1JB2 A;  1ISK A;  4L8P A;  2BT3 A;  1N9E A;  4RBN A;  3U1W A;  3FZW A;  4KFE A;  3SVA A;  2MF7 A;  1JNQ A;  1M9G A;  1VQO 3;  2BO9 B;  1JB5 A;  4HVN A;  1OHP A;  2CX1 A;  1B2U A;  2UGI A;  3BNE A;  3EC9 A;  3F9S A;  2LQV A;  1FGR A;  5AEU B;  5BVB A;  2H0G A;  3PCR A;  1FA3 A;  1ASK A;  3NUV A;  1T2H A;  3NM2 A;  2LYX A;  2RNT A;  3BND A;  3VGN A;  2IUK A;  1LOV A;  1BAO A;  4LZI A;  4HJL B;  1FYS A;  1OGX A;  1VQL 3;  5AII A;  4J8T A;  3S27 A;  3GSP A;  5IEP A;  3LTA A;  1BSC A;  1L5G B;  2STD A;  2CG1 A;  4N6U A;  3J7Y d;  3N8B A;  2HML B;  7RNT A;  1KSI A;  3CCM 3;  1W2B 2;  1IVX A;  1VQP 3;  8RNT A;  1NDO B;  2BHM A;  4R80 A;  5EEO A;  1RHL A;  1QAL A;  1LVN A;  1BOX A;  2RFR A;  2HMM B;  1B2Z A;  1V57 A;  3KSE D;  4CCV A;  1YVB I;  1I3F A;  2AAD A;  5KP1 A;  1DMN A;  2ZHX B;  3BIR A;  1Q40 B;  1ULJ B;  4R9L A;  1U8C B;  2BMO B;  2YX9 A;  5FGO A;  2OTJ 3;  1FGM A;  1CQS A;  2RBI A;  3CCR 3;  6GSP A;  1B2M A;  1JBS A;  1JBR A;  1YNV X;  4U13 A;  2CH9 A;  4FMA A;  1TIJ A;  3FG3 A;  4O3V A;  1I0V A;  1RN7 A;  3PZW A;  3GZR A;  5LC6 A;  1BUJ A;  1E97 A;  3MHE A;  1YIJ 3;  1W7C A;  4BTX A;  1O7P B;  1US1 A;  3NXJ A;  4WYK B;  5D83 A;  1TU5 A;  5D81 A;  5BXQ A;  1EA2 A;  2OWP A;  3URP A;  3ECF A;  2XSO B;  2P0M A;  2CFW A;  3PXM A;  1WQL B;  2OQE A;  1I3I A;  3PGB A;  1M1K 4;  4QWT A;  4HM6 B;  2WGQ A;  4EV2 A;  2QGU A;  1VQN 3;  3D3L A;  2D42 A;  3ER7 A;  4HM8 B;  4MMZ B;  3DH2 A;  1OCV A;  1W6G A;  2CIU A;  3NQY A;  4N6O B;  4K1U A;  1G96 A;  2E2V A;  4KFD A;  1U5O A;  3S29 A;  3N9H A;  3ALA A;  4FCZ A;  3K5T A;  5ELJ A;  1O7M B;  2KF4 A;  2L4V A; 
#chains in the Genus database with same CATH homology
 2QIY A;  2ML6 A;  3KN4 A;  1KQS 2;  5IG4 A;  3KKG A;  1W5Z A;  3K0Z A;  4R1K A;  4K1V A;  1FGT A;  4O2H A;  3F8H A;  1NO3 A;  4EC6 A;  5STD A;  4BTY A;  2MC8 A;  1VZZ A;  1DVC A;  3IPT A;  1N8R 4;  1WMN A;  3H3H A;  3EN1 B;  5EQL A;  2B24 B;  3QK9 A;  3NQZ A;  3EHC A;  5IW9 A;  5AYR B;  4I4K A;  5FW5 A;  1JJ2 2;  4OVM A;  1IK3 A;  3OXA A;  4FCJ A;  2W56 B;  1JKG B;  2BMR B;  3KII A;  4G1M B;  5AIG A;  3DMC A;  1AV4 A;  3F7X A;  3H51 A;  1NB3 I;  3EBT A;  4IPB A;  3LOY A;  1YJN 3;  1D6U A;  3WOE B;  1OGZ A;  1LOX A;  5ELU A;  3OW2 2;  3MSO A;  4R4K A;  3DZL A;  4GB5 A;  1N5H A;  1SPU A;  2CWU A;  3DGL A;  3LZA A;  1ZO2 A;  3TDG A;  2P0X A;  2XF3 A;  3EF8 A;  2WOF A;  5IEO A;  3B8L A;  3JUP A;  8CHO A;  4MMY B;  1EKM A;  2O3O A;  1PFP A;  4FMC A;  4HM1 B;  3L0R A;  1SIH A;  1OF5 B;  2XSH B;  3CC4 3;  5IEN A;  1IV7 A;  4LGQ A;  3DY5 A;  3T8N A;  1UI8 A;  3CCS 3;  1OUN A;  1GY6 A;  1EQK A;  1VQ8 3;  2Z6B A;  3G6E 3;  3MYT A;  1J2B A;  1HKX A;  1YJW 3;  3AMO A;  2CKF B;  1VQ6 3;  1O7W B;  3WA3 A;  1BUQ A;  1UUV B;  1JN5 B;  4WHA A;  1N9J A;  3BNC A;  4XDV A;  1JN5 A;  3FKA A;  3G16 A;  4XBT A;  2W9P A;  1KWI A;  4WFO A;  3EBY A;  3PYJ A;  4O8S A;  1UI7 A;  3Q90 A;  1OAC A;  1VQ9 3;  2XEP A;  2W04 A;  3EB8 A;  3X42 A;  4EYC A;  3HIG A;  1Q7Y 4;  3PCS A;  3NBB A;  2XFS A;  3OWU A;  3WA2 X;  3V98 A;  1YGE A;  1NU3 A;  3SED A;  2FNQ A;  3NHX A;  4N3V A;  3CU3 A;  3X3Y A;  3G0K A;  3F14 A;  1JV2 B;  1Q86 4;  1D6Z A;  4AEQ A;  1DVD A;  3DXO A;  1GS3 A;  1T5Y A;  3HII A;  1O7N B;  2CW9 A;  3LT8 A;  4NHF A;  3ROB A;  2YFI B;  2CHC A;  1YHQ 3;  2OTL 3;  4R9K A;  1IDP A;  3MG3 A;  2PNC A;  5TGN A;  4PEJ A;  3FH1 A;  3FSD A;  1STF I;  2C11 A;  1W01 A;  3FCS B;  1IVW A;  2IA7 A;  2PZV A;  4WP5 A;  1OHS A;  5JPU A;  1C7H A;  2KCD A;  1OPY A;  4HZB B;  3SXX A;  3OV4 A;  3LTB A;  4K90 B;  3UNL A;  3JUM A;  4HYZ A;  5IER A;  4N6L A;  5CF1 A;  4MMX B;  1RRH A;  1IVV A;  1NB5 I;  5AIH A;  1N5P A;  1K8A 4;  1QVG 2;  3LTD A;  1M90 4;  1IT8 A;  3QRD A;  1V74 A;  3D9R A;  5CXO A;  2Y74 A;  7STD A;  1F8N A;  4J9A A;  3Q1C A;  1GYB A;  4H61 A;  3B4P A;  3WMD A;  2WO0 A;  5DRE A;  4OUQ A;  3CD6 3;  3KFQ C;  1JB4 A;  1A90 A;  1UW1 A;  5IG5 A;  5I97 A;  4RNZ A;  4H3U A;  3E99 A;  1W4N A;  2GXF A;  2W03 A;  3V99 A;  1RRL A;  5CLK A;  3K7C A;  3PS8 A;  3NBJ A;  5KP4 A;  1KD1 4;  1Q82 4;  2IMJ A;  2W2C A;  3I56 3;  3MWZ A;  5AI1 A;  4IIA A;  1QMA A;  3SOY A;  1E3R A;  1K73 4;  1GY5 A;  4HM4 B;  3F40 A;  2HMO B;  1VQM 3;  3LYG A;  3CCE 3;  1CYU A;  1IT7 A;  3K63 A;  4FR9 A;  5HGR A;  3SOA A;  1K28 A;  3WOF B;  2HMK B;  4HM0 B;  2KXG A;  2M7O A;  3S67 A;  4AKZ A;  1A2V A;  3FLJ A;  2GU3 A;  1IQX A;  3NV0 A;  2CFD A;  2XRX B;  1DYU A;  3JVC A;  2CFK A;  3RGR A;  1W02 A;  1TUH A;  5IF6 A;  4BTW A;  2R4I A;  3GZB A;  3M8C A;  3MG1 A;  1W2Z A;  1Z1S A;  1WMO A;  3EX9 A;  3K9M C;  4MJD A;  4KZ1 A;  1A67 A;  1JRQ A;  2XGN A;  4Q53 A;  1A2K A;  2FGT A;  3I55 3;  3STD A;  1GD4 A;  4ZM8 A;  3CME 3;  3HZP A;  2JQ5 A;  2W9Q A;  1YIT 3;  3CPO A;  3FF0 A;  3AMO B;  5KP3 A;  3CCJ 3;  3LT9 A;  2ZL8 A;  3CXC 2;  3BNB A;  2BNG A;  2P38 A;  1ZX2 A;  2IUJ A;  3X3X A;  2Y73 A;  2SBL A;  3VF1 A;  3FG4 A;  3BLZ A;  5AYS C;  1TFK A;  2OCT A;  3FGY A;  3DUK A;  3DM8 A;  2YFJ B;  3EN8 A;  4HKV B;  3Q2P A;  3CCQ 3;  2I9W A;  1O7H B;  4XBY A;  4XBX A;  3IMA B;  3LXU X;  4GL6 A;  4N6M A;  2ML5 A;  1KC8 4;  1O7G B;  1M1X B;  4AKY A;  2ZDJ A;  3CNX A;  4CDL A;  2F86 B;  2B1X B;  4EV5 A;  2V1L A;  2O9U X;  1W00 A;  3F8X A;  3NM7 A;  1HU9 A;  1GY7 A;  2GBX B;  5D82 A;  1IV9 A;  4HM7 B;  2XFT A;  5IG0 A;  2XH9 A;  1SJW A;  2Z7A A;  3RDE A;  3SLU A;  1OHO A;  3UB1 A;  4NRE A;  2CG0 A;  3B4O A;  3CCL 3;  1UUW B;  1PU4 A;  3LH4 A;  2Q07 A;  1DMQ A;  3UL6 A;  1STD A;  1ROV A;  3CMA 3;  3GZX B;  1VQK 3;  1Q81 4;  2Z76 A;  2CWV A;  2C10 A;  3FG1 A;  3V92 A;  1YJ9 3;  3NX0 A;  5CF2 A;  1ROA A;  2D1W A;  1QAF A;  1CYV A;  4ORL A;  4KVH A;  1SQW A;  3JUN A;  2UX0 A;  3CNM A;  2JDI H;  4JRF A;  3UJM A;  4JF8 A;  6STD A;  3N54 B;  1K9M 4;  2KRT A;  4HBR A;  3A76 A;  4XDW A;  3S28 A;  4FCM A;  2E2T A;  2OOV C;  4LMI A;  2OQE C;  1AVK A;  4HM2 B;  1QVF 2;  1Q40 A;  3U97 A;  3KE7 A;  1WMP A;  2CFG A;  2W0Q A;  1DMM A;  3G8Z A;  2QEX 3;  3DGN A;  2E2U A;  4WWU C;  3S5C A;  1VQ4 3;  2HMN B;  5AIF A;  1W6C A;  3DGO A;  4IT7 A;  3CPW 2;  3G4S 3;  2F99 A;  2WOH A;  5EVH A;  3LTC A;  4RZM A;  4STD A;  2INX A;  1IQ8 A;  1LXE A;  4XM4 A;  4WYK A;  1IQY A;  3HX8 A;  1IVU A;  5DRV A;  2CK3 H;  2WGO A;  1MOL A;  2OOV A;  3MKI A;  3OWS A;  1R4C A;  4X2O A;  1FGQ A;  2GEX A;  2QA4 3;  1LNH A;  2CC3 A;  4MEI A;  4X2H A;  1NJI 4;  4LEH A;  3EJV A;  5JBS A;  2RGQ A;  2GEY A;  4LSO A;  3B7C A;  3OX9 A;  1AVL A;  3WDG B;  3OWY A;  1AR0 A;  3X3Z A;  2RSX A;  2CWT A;  3GRD A;  3JUO A;  2GU1 A;  3HI7 A;  4TX4 A;  3IJE B;  1FGO A;  4OK0 A;  1TP6 A;  3LML A;  3JUQ A;  4FMB A;  4N6V 0;  3X41 A;  3FF2 A;  5IG3 A;  1QJG A;  3X40 A;  3F7S A;  4N6T A;  5CK6 A;  3UL5 A;  1K41 A;  1IU7 A;  3VSY A;  2Z77 A;  3NV0 B;  1S5A A;  3T8U A;  5A0O B;  1TFO A;  3EE1 A;  1WNH A;  4L8O A;  1MNL A;  1E3V A;  4EBG A;  1VQ5 3;  1RKY A;  3NBR A;  1D6Y A;  2XR8 B;  2A15 A;  3G71 3;  2BMQ B;  3DGM A;  2W56 A;  3HK4 A;  2K0M A;  1Q42 A;  1JKG A;  4K61 A;  4O02 B;  3CCU 3;  1Y4K A;  1S72 3;  2CFL A;  4L7K A;  5JPP A;  4HM5 B;  3KZT A;  5AEW B;  5G2G A;  2YFL B;  1QAK A;  1VQ7 3;  2F98 A;  3RGA A;  1GD3 A;  1OH0 A;  2FXT A;  2P09 A;  4N6N B;  1EG9 B;  3GZY B;  3BB9 A;  4FMD A;  3GWR A;  3KSP A;  3CC2 3;  1YI2 3;  1ULI B;  5LC7 A;  1W6Y A;  3SX1 A;  3EQQ B;  3O8Y A;  2GBW B;  4HM3 B;  1NWW A;  2HMJ B;  4EXR A;  3I0Y A;  3T0U A;  1RJO A;  2P05 A;  3MG2 A;  3GAX A;  1OF5 A;  1SII A;  1WTH A;  3CCV 3;  3WOD G;  2RCD A;  1CEW I;  2K54 A;  3MPH A;  2W6J H;  1FUW A;  1N8Q A;  4XB5 A;  4HZ9 B;  4KFF A;  2XGL A;  3CC7 3;  1JB2 A;  1ISK A;  4L8P A;  2BT3 A;  1N9E A;  4RBN A;  3U1W A;  3FZW A;  4KFE A;  3SVA A;  2MF7 A;  1JNQ A;  1M9G A;  1VQO 3;  2BO9 B;  1JB5 A;  4HVN A;  1OHP A;  3BNE A;  3F9S A;  3EC9 A;  2LQV A;  1FGR A;  5AEU B;  5BVB A;  3PCR A;  1FA3 A;  1ASK A;  3NUV A;  3NM2 A;  2LYX A;  3BND A;  3VGN A;  2IUK A;  4LZI A;  4HJL B;  1OGX A;  1VQL 3;  5AII A;  4J8T A;  3S27 A;  5IEP A;  3LTA A;  1L5G B;  2STD A;  2CG1 A;  4N6U A;  3J7Y d;  3N8B A;  2HML B;  1KSI A;  3CCM 3;  1W2B 2;  1IVX A;  1VQP 3;  1NDO B;  2BHM A;  4R80 A;  5EEO A;  1QAL A;  1LVN A;  2RFR A;  2HMM B;  3KSE D;  4CCV A;  1YVB I;  5KP1 A;  1DMN A;  1Q40 B;  1ULJ B;  4R9L A;  1U8C B;  2BMO B;  2YX9 A;  5FGO A;  2OTJ 3;  1FGM A;  1CQS A;  3CCR 3;  4U13 A;  2CH9 A;  4FMA A;  1TIJ A;  3FG3 A;  4O3V A;  1RN7 A;  3PZW A;  3GZR A;  5LC6 A;  1E97 A;  3MHE A;  1YIJ 3;  1W7C A;  4BTX A;  1O7P B;  1US1 A;  3NXJ A;  4WYK B;  5D83 A;  1TU5 A;  5D81 A;  5BXQ A;  1EA2 A;  2OWP A;  3ECF A;  2XSO B;  2P0M A;  2CFW A;  3PXM A;  1WQL B;  2OQE A;  3PGB A;  1M1K 4;  4QWT A;  4HM6 B;  2WGQ A;  4EV2 A;  2QGU A;  1VQN 3;  3D3L A;  2D42 A;  3ER7 A;  4HM8 B;  4MMZ B;  4RNY A;  1OCV A;  1W6G A;  2CIU A;  3NQY A;  4N6O B;  4K1U A;  1G96 A;  2E2V A;  4KFD A;  1U5O A;  3S29 A;  3N9H A;  3ALA A;  4FCZ A;  3K5T A;  5ELJ A;  1O7M B;  2L4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...