1I3FA

Ribonuclease t1 v89s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGSITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i3fA00
1R4YA 1T2HA 4HOHA 1I70A 1B2MA 1BSCA 3URPA 1I2GA 1RGKA 4J5KA 1MGWA 1BRGA 2KF3A 3A5EA 1BU4A 2RNTA 1BGSA 3AHSA 1G02A 2ZA4A 2RBIA 2KF6A 1FUTA 1RNTA 8RNTA 1SARA 3SYUA 1B2SA 1FW7A 3RNTA 1UCLA 1IYYA 1B2XA 1DETA 1JBTA 2AADA 4HAAA 5BIRA 1T2IA 4J5GA 3AGOA 1X1YA 1BUJA 1RNBA 1FYSA 1GMPA 2F56A 1BSAA 3D4AA 1RN4A 1BAOA 2KAAA 1BNGA 6RNTA 1BNEA 1TRPA 1YVSA 1B21A 3D5GA 7GSPA 1RDSA 1RMSA 1AY7A 3WR2A 3BIRA 1BSDA 1I3IA 2F5WA 1Q9EA 1GSPA 1AQZA 2F4YA 1BRIA 3BU4A 1HYFA 1ZGXA 3DH2A 1A2PA 1LOWA 1TRQA 1BNJA 5BU4A 1X1WA 1B3SA 1X1UA 2C4BA 1BRSA 1I2EA 1B2ZA 1FUSA 1RGCA 1BANA 2BU4A 1RSNA 1B2UA 1UCKA 1UCIA 1C54A 3AGNA 1LRAA 3GSPA 1I3FA 1HZ1A 3D5IA 1MGRA 1LOYA 1RGHA 2KF5A 4BU4A 1LNIA 2F5MA 1B20A 5HOHA 1RGLA 1RGAA 1BNFA 1BNRA 1GMRA 1BOXA 1BVIA 5RNTA 1BNSA 1I0VA 5GSPA 1YNVX 1I8VA 1TTOA 3KCHA 2BIRA 1JBRA 1RTUA 2AAEA 1BIRA 1DE3A 1I0XA 1FZUA 1YGWA 1LOVA 1RLSA 4GSPA 1BSEA 1GOYA 6GSPA 1GMQA 1BRNL 1I2FA 1GOUA 1RN1A 2KF4A 1CH0A 1RCKA 1RGEA 2HOHA 3Q3FA 1X1XA 7RNTA 1PYLA 1B27A 1BRJA 3HOHA 1RGGA 1BNIA 2SARA 1JBSA 3DGYA 9RNTA 2GSPA 1PY3A 4RNTA 4GHOA 1BRHA 1BSBA 3AHWA 1BRKA 3WHOA 1UCJA 1GOVA 1RGFA 4BIRA 1RCLA 1RHLA
chains in the Genus database with same CATH superfamily
1VQQA 3CCJ3 1R4YA 3NBJA 1NDOB 3CC73 3PXMA 2CKFB 1B2MA 2CHCA 3URPA 1IVWA 4HM3B 2E2TA 2OOVA 3EB8A 4I4KA 1D6ZA 2RNTA 1BGSA 1EG9B 2P0XA 8RNTA 5G2GA 5KP4A 4OVMA 3T8UA 2CG0A 3OXAA 1ZS7A 1LQMB 2Z77A 3FGYA 2CFLA 1K28A 1FGMA 3WA2X 4WHAA 1YHQ3 4NREA 1CQSA 4HAAA 1VQ53 1W02A 1X1YA 1JB5A 3D3LA 3FG3A 3CCL3 3PGBA 3T0UA 3KFQC 2Z76A 1BNGA 6RNTA 7GSPA 1RMSA 2INXA 5STDA 1Q7Y4 3BIRA 1CEWI 1JB2A 1SIIA 1RRLA 3OX9A 3NQYA 1TP6A 5AIGA 1A2KA 3Q2PA 1NWWA 1LXEA 1QAFA 5D81A 3BU4A 1YJN3 3DH2A 1ZGXA 2WO0A 3AMOA 3EF8A 1AVKA 4BL3A 3DGOA 3FH1A 1GYBA 1N5HA 1IQXA 4AKZA 1FGTA 4WFOA 3WOFB 2BNGA 1LQGC 1OHOA 2UGIA 4FMDA 3KKGA 4LYLB 4GL6A 1BANA 1QJGA 2QIYA 3V99A 3LTAA 3X41A 4CJNA 3UL6A 3B4PA 1UCKA 3UB1A 3B4OA 3OV4A 5TGNA 1UCIA 2F99A 4FCJA 5CF2A 3DMCA 3S29A 1UW1A 1MWTA 3ROBA 2F5MA 3JUOA 3KIIA 3NV0A 5CXOA 1FUWA 1VQ83 2P38A 4CCVA 3LTDA 3D9RA 4HM0B 3VF1A 3CC43 1IVXA 3AMOB 3J7Yd 4KFFA 3CCS3 1JNQA 2RGQA 3K9MC 2CX0A 5GSPA 3LYGA 1E3VA 1UI8A 1S5AA 2B1XB 4MMZB 1VQO3 1RJOA 1YJW3 4HKVB 3DZLA 4MMYB 1JBRA 1OH0A 1LVNA 1N8QA 1SIHA 1JJ22 2IUKA 2C11A 2WOHA 3DY5A 4R80A 1YIT3 1ULJB 4HM7B 3PYJA 3LT9A 3MKIA 1FA3A 3K63A 3TDGA 3X3ZA 1G0TA 3NV0B 1GMQA 1M904 1OF5A 3CCQ3 1IT7A 4KT3B 2HMLB 5CK6A 4L7KA 1JV2B 2W9PA 1B27A 2HMMB 2UX0A 3CC23 3MHEA 2XFTA 4FR9A 3DGYA 2GSPA 3NM7A 4LEHA 2CC3A 1UGIA 4N6UA 4EYCA 2IA7A 3AHWA 2IUJA 3CCE3 1WQLB 3U1WA 2Y73A 1WMOA 4H3UA 1IK3A 3CPOA 3PZWA 4XB5A 1RGFA 1WNHA 2XRXB 2YFIB 3DXOA 3KN4A 4HJLB 4J5KA 3HK4A 1JKGA 3G16A 1T2HA 1T3BA 4I5QA 5FW5A 1I70A 3JUPA 4TX4A 1L5GB 4RNYA 1I2GA 1RGKA 5I97A 2OQEC 3V92A 4QWTA 3A5EA 3AHSA 1MOLA 1G02A 3LZAA 2ZA4A 3QRDA 4IT7A 4R9LA 1O7MB 1FUTA 1RNTA 3B8LA 3F7XA 3OWYA 1SARA 4H61A 5IERA 7STDA 4ORLA 1C7HA 1B2SA 2ZL8A 1TFOA 4HVNA 1FW7A 1UCLA 2OWPA 2YFLB 1IYYA 2CW9A 1OGZA 4K1VA 1B2XA 1DETA 3KSPA 3CPW2 3CCR3 1QAKA 4WYKB 2OQEA 3FLJA 1T2IA 2JDIH 3AGOA 1U8CB 1BUJA 1RNBA 1FYSA 2OTJ3 1N5PA 1QVG2 5JPPA 1JKGB 2FNQA 1BAOA 2KAAA 3D5GA 1YVSA 4N6MA 3VSYA 3I0YA 2GEXA 5IG5A 4XDWA 3EE1A 2HMOB 4PEJA 3SXXA 1DVCA 1NNVA 4O02B 2CK3H 1ULIB 5BXQA 3NQZA 5JBSA 1EKMA 2O3OA 2H0HA 3NHXA 1TUHA 2Z7AA 1TRQA 3LOYA 1BNJA 1NU3A 3KSED 3STDA 3NBBA 2V1LA 3UNLA 1O7GB 4Q53A 4OK0A 4RZMA 4BTYA 1KQS2 2CWUA 2BMQB 4LGQA 1R4CA 1J2BA 4HM6B 1RSNA 3BNDA 3Q90A 3EX9A 3UJMA 3GZRA 2FGTA 1DYUA 5HGRA 1LRAA 2OTL3 1IQYA 2W9QA 3BNEA 3CNMA 3MWZA 1MWRA 3D5IA 1MGRA 1EUIC 2YFJB 3X40A 4BU4A 1OGXA 3KZTA 1W6GA 1LNIA 5HOHA 1B20A 3H51A 3ALAA 1BNFA 4K61A 1BNRA 4K1UA 2IY2A 1BUQA 4CDLA 1BOXA 1SPUA 2HMNB 5IF6A 1A67A 2XGLA 1HKXA 1US1A 1KWIA 1I8VA 2A15A 1F8NA 3FSDA 3F7SA 2MC8A 3CXC2 1MWSA 1Q40B 2MF7A 1W2B2 2BIRA 3F8HA 1K734 4X2HA 1RTUA 2AAEA 3IPTA 3HX8A 1DE3A 4EW5A 1Z1SA 1WTHA 2YX9A 2F98A 1YGWA 1LOVA 1T5YA 3HI7A 3A76A 4FCZA 1O7PB 2CFKA 2GU3A 2XSHB 1BSEA 4STDA 3FF0A 1Q864 2XF3A 1N9JA 3LMLA 2RSXA 4N6OB 3CCM3 4GB5A 1BRNL 1GOUA 2KF4A 4N6LA 1RKYA 1TIJA 1PFPA 2CWTA 1RGEA 1N8R4 2O9UX 1Q814 5AIFA 2XSOB 1X1XA 2F86B 3Q3FA 7RNTA 1PYLA 2PNCA 5IG0A 4EBGA 2GXFA 5DREA 2WOFA 1RRHA 1UUGB 1OPYA 1RGGA 3G4S3 1BNIA 2SARA 1JBSA 1LOXA 2BO9B 1FGRA 3IJEB 2LYXA 2KRTA 1NB5I 1BSBA 5LC7A 2QEX3 2XEPA 4LSOA 4O8SA 3T8NA 3JVCA 1GOVA 2OCTA 3SX1A 1EA2A 4HBRA 5AIIA 2K0MA 4FMCA 5AIHA 1VQN3 1DVDA 4MMXB 2P09A 1V57A 4BIRA 1RCLA 3G8ZA 5LC6A 1EEJA 1QALA 4HM2B 4HOHA 2GU1A 2GEYA 2Z6BA 4XBYA 3N9HA 1NO3A 3EQQB 1GS3A 1MGWA 1N9EA 2KF3A 2J8XB 1BU4A 5EQLA 1FGQA 1HU9A 1GY7A 2E2UA 2KF6A 2Y74A 2ML6A 3ZG5A 2XGNA 1ASKA 1W6YA 2CG1A 4NPBA 2BT3A 3SYUA 2RCDA 3WA3A 1QMAA 1UUWB 1YVBI 5IG3A 3G6E3 1E97A 3CCU3 5IG4A 1KC84 2W2CA 3EHCA 3JUMA 1JBTA 5M18A 4IIAA 2CWVA 2IMJA 1M1K4 2SBLA 3MG1A 1ZO2A 3I553 4WP5A 4WYKA 4O2HA 3L0RA 3Q1CA 1RN4A 1UGHI 4AEQA 4ZM8A 1BNEA 1GY6A 1TRPA 1IV9A 3D79A 6STDA 1IU7A 1AY7A 1D6UA 1UUVB 2ZDJA 1W4NA 1MNLA 1GD4A 1SQWA 1O7HB 1OHSA 3O8YA 1I3IA 3X42A 3FG4A 4J8TA 3FZWA 1Q9EA 3EBYA 1GSPA 1UDII 1AQZA 5AI1A 1HYFA 1A2PA 1KD14 1X1WA 5AEWB 4U13A 1B3SA 4XBTA 2C4BA 3OWSA 3K0ZA 2M7OA 2L4VA 1B2ZA 5D83A 3KE7A 1A2VA 1FUSA 1RGCA 1W7CA 2BU4A 2L1SA 2LQVA 2I9WA 3FKAA 1B2UA 4XBXA 3CD63 4DKIA 4WWUC 1W00A 2JQ5A 4HZBB 3EC9A 1W2ZA 1SJWA 3X3YA 4KFDA 1O7NB 2W56A 3G713 5FGOA 3GZXB 1HZ1A 2PZVA 3SOYA 3F14A 1RGHA 1STFI 4BL2A 1IQ8A 1K41A 3BLZA 4KZ1A 1S723 4EV5A 2IYJA 5M1AA 2WGOA 3M8CA 1FGOA 3GAXA 1JRQA 1BVIA 1TJDA 5RNTA 2K54A 3FCSB 1I0VA 5ELJA 1TFKA 2H0IA 3U97A 1YNVX 1W6CA 3NBRA 4FMAA 3RDEA 3ZFZA 4KVHA 5JPUA 1QVF2 1K8A4 1OHPA 1RN7A 3DM8A 3NUVA 2P05A 3BNCA 1Q40A 1BIRA 3PCRA 5ELUA 3MG2A 3WODG 3VGNA 3ECFA 4HYZA 1RLSA 2W56B 1GD3A 1JZOA 1UI7A 1GOYA 1V74A 2W04A 1IV7A 2CH9A 6GSPA 5IENA 1I2FA 4R4KA 3CNXA 3OWUA 2QA43 1VQ73 4FCMA 4FMBA 2CX1A 2HOHA 2GBXB 1DMNA 3DGMA 3GZBA 4JF8A 1NJI4 5BVBA 1OCVA 3PCSA 1BRJA 3PS8A 4LMIA 4BTXA 2R4IA 3IMAB 3HOHA 3WMDA 4G1MB 3GZYB 9RNTA 4GHOA 1VQP3 3G0KA 1G96A 4R1KA 3CMA3 3DGLA 1O7WB 1ROVA 5AYRB 5M19A 2BMOB 1JB4A 5CLKA 1Q824 5CF1A 2CFWA 4K90B 4N3VA 1ROAA 3RGAA 2B24B 1CYUA 3S28A 1IT8A 3NM2A 3SLUA 3N8BA 2Q07A 1BSCA 1AVLA 2WGQA 1K9M4 3JUQA 1BRGA 4L8PA 3MPHA 3B7CA 3EJVA 2RBIA 1E3RA 3CU3A 1VQ63 1U5OA 2C10A 4HM4B 4EXRA 3LH4A 4N6TA 1LNHA 2W6JH 5G1LA 1IVVA 3QK9A 4HM1B 4N6NB 2KXGA 1VQ43 1YI23 5AEUB 1AV4A 2AADA 2CFGA 5BIRA 1VQK3 3E99A 1IDPA 3S5CA 3F40A 4J5GA 1CYVA 4RNZA 1GMPA 4R9KA 2F56A 1ZX2A 3GRDA 4XM4A 1BSAA 5KP3A 3D4AA 3X3XA 1YGEA 3LXUX 1B21A 1RDSA 4HM5B 3WR2A 4MJDA 1W01A 1ISKA 1BSDA 3S27A 2F5WA 3DGNA 2KCDA 3EN8A 1V58A 3N54B 5KP1A 2XH9A 2F4YA 1BRIA 3RNTA 5BU4A 1YJ93 1LOWA 3OW22 1D6YA 1Y4KA 3MYTA 1X1UA 4HZ9B 1BRSA 3NX0A 3MSOA 3JUNA 1JN5A 1I2EA 5AYSC 4CPKA 1VQM3 1WMNA 5EEOA 1OUNA 1VQL3 1VQ93 3DUKA 3LT8A 5D82A 1M1XB 1C54A 3AGNA 1VZZA 4OUQA 3GSPA 1I3FA 3ER7A 2H0GA 5IW9A 1LOYA 1MWUA 3SEDA 2KF5A 3MG3A 3ZG0A 2BHMA 3H3HA 1RGLA 3BB9A 2FXTA 1RGAA 4X2OA 2D1WA 2UUGC 2P0MA 2HMJB 3HZPA 4LZIA 2ML5A 1EQKA 1GMRA 5EVHA 4J9AA 1BNSA 1STDA 3FG1A 4EC6A 2ZHXB 2D42A 4RBNA 1JN5B 1TTOA 1OACA 2BMRB 5IEPA 3KCHA 4ILFA 2XFSA 5A0OB 4MEIA 1DMQA 5G1KA 1NB3I 3EBTA 3S67A 8CHOA 2HMKB 3GWRA 4JRFA 4EV2A 1I0XA 1KSIA 1WMPA 3RGRA 4AKYA 1FZUA 1JZDA 2GBWB 3BNBA 4O3VA 4L8OA 5DRVA 1TU5A 4GSPA 1Q7HA 3LTBA 2R41A 1OF5B 3CME3 1GY5A 4N6V0 2K3DA 3V98A 3F8XA 1RN1A 3WDGB 1CH0A 1M9GA 1RCKA 2W03A 2CFDA 4BTWA 2E2VA 3HIIA 2RFRA 1A90A 3K5TA 2W0QA 1PU4A 1W5ZA 2QGUA 1AR0A 1DMMA 4IPBA 3I563 3FF2A 1IVUA 3NXJA 4RNTA 1PY3A 3K7CA 5IEOA 1Q42A 1BRHA 2XR8B 3EN1B 3SVAA 2CIUA 1BRKA 4XDVA 1UCJA 3SOAA 2STDA 3WHOA 2OOVC 3CCV3 3WOEB 4KFEA 3HIGA 3F9SA 4HM8B 3UL5A 1YIJ3 3LTCA 4NHFA 1RHLA
chains in the Genus database with same CATH topology
1R4YA 1T2HA 4HOHA 1I70A 1B2MA 1BSCA 3URPA 1I2GA 1RGKA 4J5KA 1MGWA 1BRGA 2KF3A 3A5EA 1BU4A 2RNTA 1BGSA 3AHSA 1G02A 2ZA4A 2RBIA 2KF6A 1FUTA 1RNTA 8RNTA 1SARA 3SYUA 1B2SA 1FW7A 3RNTA 1UCLA 1IYYA 1B2XA 1DETA 1JBTA 2AADA 4HAAA 5BIRA 1T2IA 4J5GA 3AGOA 1X1YA 1BUJA 1RNBA 1FYSA 1GMPA 2F56A 1BSAA 3D4AA 1RN4A 1BAOA 2KAAA 1BNGA 6RNTA 1BNEA 1TRPA 1YVSA 1B21A 3D5GA 7GSPA 1RDSA 1RMSA 1AY7A 3WR2A 3BIRA 1BSDA 1I3IA 2F5WA 1Q9EA 1GSPA 1AQZA 2F4YA 1BRIA 3BU4A 1HYFA 1ZGXA 3DH2A 1A2PA 1LOWA 1TRQA 1BNJA 5BU4A 1X1WA 1B3SA 1X1UA 2C4BA 1BRSA 1I2EA 1B2ZA 1FUSA 1RGCA 1BANA 2BU4A 1RSNA 1B2UA 1UCKA 1UCIA 1C54A 3AGNA 1LRAA 3GSPA 1I3FA 1HZ1A 3D5IA 1MGRA 1LOYA 1RGHA 2KF5A 4BU4A 1LNIA 2F5MA 1B20A 5HOHA 1RGLA 1RGAA 1BNFA 1BNRA 1GMRA 1BOXA 1BVIA 5RNTA 1BNSA 1I0VA 5GSPA 1YNVX 1I8VA 1TTOA 3KCHA 2BIRA 1JBRA 1RTUA 2AAEA 1BIRA 1DE3A 1I0XA 1FZUA 1YGWA 1LOVA 1RLSA 4GSPA 1BSEA 1GOYA 6GSPA 1GMQA 1BRNL 1I2FA 1GOUA 1RN1A 2KF4A 1CH0A 1RCKA 1RGEA 2HOHA 3Q3FA 1X1XA 7RNTA 1PYLA 1B27A 1BRJA 3HOHA 1RGGA 1BNIA 2SARA 1JBSA 3DGYA 9RNTA 2GSPA 1PY3A 4RNTA 4GHOA 1BRHA 1BSBA 3AHWA 1BRKA 3WHOA 1UCJA 1GOVA 1RGFA 4BIRA 1RCLA 1RHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4Y A;  1T2H A;  4HOH A;  1I70 A;  1B2M A;  1BSC A;  3URP A;  1I2G A;  1RGK A;  4J5K A;  1MGW A;  1BRG A;  2KF3 A;  3A5E A;  1BU4 A;  2RNT A;  1BGS A;  3AHS A;  1G02 A;  2ZA4 A;  2RBI A;  2KF6 A;  1FUT A;  1RNT A;  8RNT A;  1SAR A;  3SYU A;  1B2S A;  1FW7 A;  3RNT A;  1UCL A;  1IYY A;  1B2X A;  1DET A;  1JBT A;  2AAD A;  4HAA A;  5BIR A;  1T2I A;  4J5G A;  3AGO A;  1X1Y A;  1BUJ A;  1RNB A;  1FYS A;  1GMP A;  2F56 A;  1BSA A;  3D4A A;  1RN4 A;  1BAO A;  2KAA A;  1BNG A;  6RNT A;  1BNE A;  1TRP A;  1YVS A;  1B21 A;  3D5G A;  7GSP A;  1RDS A;  1RMS A;  1AY7 A;  3WR2 A;  3BIR A;  1BSD A;  1I3I A;  2F5W A;  1Q9E A;  1GSP A;  1AQZ A;  2F4Y A;  1BRI A;  3BU4 A;  1HYF A;  1ZGX A;  3DH2 A;  1A2P A;  1LOW A;  1TRQ A;  1BNJ A;  5BU4 A;  1X1W A;  1B3S A;  1X1U A;  2C4B A;  1BRS A;  1I2E A;  1B2Z A;  1FUS A;  1RGC A;  1BAN A;  2BU4 A;  1RSN A;  1B2U A;  1UCK A;  1UCI A;  1C54 A;  3AGN A;  1LRA A;  3GSP A;  1I3F A;  1HZ1 A;  3D5I A;  1MGR A;  1LOY A;  1RGH A;  2KF5 A;  4BU4 A;  1LNI A;  2F5M A;  1B20 A;  5HOH A;  1RGL A;  1RGA A;  1BNF A;  1BNR A;  1GMR A;  1BOX A;  1BVI A;  5RNT A;  1BNS A;  1I0V A;  5GSP A;  1YNV X;  1I8V A;  1TTO A;  3KCH A;  2BIR A;  1JBR A;  1RTU A;  2AAE A;  1BIR A;  1DE3 A;  1I0X A;  1FZU A;  1YGW A;  1LOV A;  1RLS A;  4GSP A;  1BSE A;  1GOY A;  6GSP A;  1GMQ A;  1BRN L;  1I2F A;  1GOU A;  1RN1 A;  2KF4 A;  1CH0 A;  1RCK A;  1RGE A;  2HOH A;  3Q3F A;  1X1X A;  7RNT A;  1PYL A;  1B27 A;  1BRJ A;  3HOH A;  1RGG A;  1BNI A;  2SAR A;  1JBS A;  3DGY A;  9RNT A;  2GSP A;  1PY3 A;  4RNT A;  4GHO A;  1BRH A;  1BSB A;  3AHW A;  1BRK A;  3WHO A;  1UCJ A;  1GOV A;  1RGF A;  4BIR A;  1RCL A;  1RHL A; 
#chains in the Genus database with same CATH topology
 1VQQ A;  3CCJ 3;  1R4Y A;  3NBJ A;  1NDO B;  3CC7 3;  3PXM A;  2CKF B;  1B2M A;  2CHC A;  3URP A;  1IVW A;  4HM3 B;  2E2T A;  2OOV A;  3EB8 A;  4I4K A;  1D6Z A;  2RNT A;  1BGS A;  1EG9 B;  2P0X A;  8RNT A;  5G2G A;  5KP4 A;  4OVM A;  3T8U A;  2CG0 A;  3OXA A;  1ZS7 A;  1LQM B;  2Z77 A;  3FGY A;  2CFL A;  1K28 A;  1FGM A;  3WA2 X;  4WHA A;  1YHQ 3;  4NRE A;  1CQS A;  4HAA A;  1VQ5 3;  1W02 A;  1X1Y A;  1JB5 A;  3D3L A;  3FG3 A;  3CCL 3;  3PGB A;  3T0U A;  3KFQ C;  2Z76 A;  1BNG A;  6RNT A;  7GSP A;  1RMS A;  2INX A;  5STD A;  1Q7Y 4;  3BIR A;  1CEW I;  1JB2 A;  1SII A;  1RRL A;  3OX9 A;  3NQY A;  1TP6 A;  5AIG A;  1A2K A;  3Q2P A;  1NWW A;  1LXE A;  1QAF A;  5D81 A;  3BU4 A;  1YJN 3;  3DH2 A;  1ZGX A;  2WO0 A;  3AMO A;  3EF8 A;  1AVK A;  4BL3 A;  3DGO A;  3FH1 A;  1GYB A;  1N5H A;  1IQX A;  4AKZ A;  1FGT A;  4WFO A;  3WOF B;  2BNG A;  1LQG C;  1OHO A;  2UGI A;  4FMD A;  3KKG A;  4LYL B;  4GL6 A;  1BAN A;  1QJG A;  2QIY A;  3V99 A;  3LTA A;  3X41 A;  4CJN A;  3UL6 A;  3B4P A;  1UCK A;  3UB1 A;  3B4O A;  3OV4 A;  5TGN A;  1UCI A;  2F99 A;  4FCJ A;  5CF2 A;  3DMC A;  3S29 A;  1UW1 A;  1MWT A;  3ROB A;  2F5M A;  3JUO A;  3KII A;  3NV0 A;  5CXO A;  1FUW A;  1VQ8 3;  2P38 A;  4CCV A;  3LTD A;  3D9R A;  4HM0 B;  3VF1 A;  3CC4 3;  1IVX A;  3AMO B;  3J7Y d;  4KFF A;  3CCS 3;  1JNQ A;  2RGQ A;  3K9M C;  2CX0 A;  5GSP A;  3LYG A;  1E3V A;  1UI8 A;  1S5A A;  2B1X B;  4MMZ B;  1VQO 3;  1RJO A;  1YJW 3;  4HKV B;  3DZL A;  4MMY B;  1JBR A;  1OH0 A;  1LVN A;  1N8Q A;  1SIH A;  1JJ2 2;  2IUK A;  2C11 A;  2WOH A;  3DY5 A;  4R80 A;  1YIT 3;  1ULJ B;  4HM7 B;  3PYJ A;  3LT9 A;  3MKI A;  1FA3 A;  3K63 A;  3TDG A;  3X3Z A;  1G0T A;  3NV0 B;  1GMQ A;  1M90 4;  1OF5 A;  3CCQ 3;  1IT7 A;  4KT3 B;  2HML B;  5CK6 A;  4L7K A;  1JV2 B;  2W9P A;  1B27 A;  2HMM B;  2UX0 A;  3CC2 3;  3MHE A;  2XFT A;  4FR9 A;  3DGY A;  2GSP A;  3NM7 A;  4LEH A;  2CC3 A;  1UGI A;  4N6U A;  4EYC A;  2IA7 A;  3AHW A;  2IUJ A;  3CCE 3;  1WQL B;  3U1W A;  2Y73 A;  1WMO A;  4H3U A;  1IK3 A;  3CPO A;  3PZW A;  4XB5 A;  1RGF A;  1WNH A;  2XRX B;  2YFI B;  3DXO A;  3KN4 A;  4HJL B;  4J5K A;  3HK4 A;  1JKG A;  3G16 A;  1T2H A;  1T3B A;  4I5Q A;  5FW5 A;  1I70 A;  3JUP A;  4TX4 A;  1L5G B;  4RNY A;  1I2G A;  1RGK A;  5I97 A;  2OQE C;  3V92 A;  4QWT A;  3A5E A;  3AHS A;  1MOL A;  1G02 A;  3LZA A;  2ZA4 A;  3QRD A;  4IT7 A;  4R9L A;  1O7M B;  1FUT A;  1RNT A;  3B8L A;  3F7X A;  3OWY A;  1SAR A;  4H61 A;  5IER A;  7STD A;  4ORL A;  1C7H A;  1B2S A;  2ZL8 A;  1TFO A;  4HVN A;  1FW7 A;  1UCL A;  2OWP A;  2YFL B;  1IYY A;  2CW9 A;  1OGZ A;  4K1V A;  1B2X A;  1DET A;  3KSP A;  3CPW 2;  3CCR 3;  1QAK A;  4WYK B;  2OQE A;  3FLJ A;  1T2I A;  2JDI H;  3AGO A;  1U8C B;  1BUJ A;  1RNB A;  1FYS A;  2OTJ 3;  1N5P A;  1QVG 2;  5JPP A;  1JKG B;  2FNQ A;  1BAO A;  2KAA A;  3D5G A;  1YVS A;  4N6M A;  3VSY A;  3I0Y A;  2GEX A;  5IG5 A;  4XDW A;  3EE1 A;  2HMO B;  4PEJ A;  3SXX A;  1DVC A;  1NNV A;  4O02 B;  2CK3 H;  1ULI B;  5BXQ A;  3NQZ A;  5JBS A;  1EKM A;  2O3O A;  2H0H A;  3NHX A;  1TUH A;  2Z7A A;  1TRQ A;  3LOY A;  1BNJ A;  1NU3 A;  3KSE D;  3STD A;  3NBB A;  2V1L A;  3UNL A;  1O7G B;  4Q53 A;  4OK0 A;  4RZM A;  4BTY A;  1KQS 2;  2CWU A;  2BMQ B;  4LGQ A;  1R4C A;  1J2B A;  4HM6 B;  1RSN A;  3BND A;  3Q90 A;  3EX9 A;  3UJM A;  3GZR A;  2FGT A;  1DYU A;  5HGR A;  1LRA A;  2OTL 3;  1IQY A;  2W9Q A;  3BNE A;  3CNM A;  3MWZ A;  1MWR A;  3D5I A;  1MGR A;  1EUI C;  2YFJ B;  3X40 A;  4BU4 A;  1OGX A;  3KZT A;  1W6G A;  1LNI A;  5HOH A;  1B20 A;  3H51 A;  3ALA A;  1BNF A;  4K61 A;  1BNR A;  4K1U A;  2IY2 A;  1BUQ A;  4CDL A;  1BOX A;  1SPU A;  2HMN B;  5IF6 A;  1A67 A;  2XGL A;  1HKX A;  1US1 A;  1KWI A;  1I8V A;  2A15 A;  1F8N A;  3FSD A;  3F7S A;  2MC8 A;  3CXC 2;  1MWS A;  1Q40 B;  2MF7 A;  1W2B 2;  2BIR A;  3F8H A;  1K73 4;  4X2H A;  1RTU A;  2AAE A;  3IPT A;  3HX8 A;  1DE3 A;  4EW5 A;  1Z1S A;  1WTH A;  2YX9 A;  2F98 A;  1YGW A;  1LOV A;  1T5Y A;  3HI7 A;  3A76 A;  4FCZ A;  1O7P B;  2CFK A;  2GU3 A;  2XSH B;  1BSE A;  4STD A;  3FF0 A;  1Q86 4;  2XF3 A;  1N9J A;  3LML A;  2RSX A;  4N6O B;  3CCM 3;  4GB5 A;  1BRN L;  1GOU A;  2KF4 A;  4N6L A;  1RKY A;  1TIJ A;  1PFP A;  2CWT A;  1RGE A;  1N8R 4;  2O9U X;  1Q81 4;  5AIF A;  2XSO B;  1X1X A;  2F86 B;  3Q3F A;  7RNT A;  1PYL A;  2PNC A;  5IG0 A;  4EBG A;  2GXF A;  5DRE A;  2WOF A;  1RRH A;  1UUG B;  1OPY A;  1RGG A;  3G4S 3;  1BNI A;  2SAR A;  1JBS A;  1LOX A;  2BO9 B;  1FGR A;  3IJE B;  2LYX A;  2KRT A;  1NB5 I;  1BSB A;  5LC7 A;  2QEX 3;  2XEP A;  4LSO A;  4O8S A;  3T8N A;  3JVC A;  1GOV A;  2OCT A;  3SX1 A;  1EA2 A;  4HBR A;  5AII A;  2K0M A;  4FMC A;  5AIH A;  1VQN 3;  1DVD A;  4MMX B;  2P09 A;  1V57 A;  4BIR A;  1RCL A;  3G8Z A;  5LC6 A;  1EEJ A;  1QAL A;  4HM2 B;  4HOH A;  2GU1 A;  2GEY A;  2Z6B A;  4XBY A;  3N9H A;  1NO3 A;  3EQQ B;  1GS3 A;  1MGW A;  1N9E A;  2KF3 A;  2J8X B;  1BU4 A;  5EQL A;  1FGQ A;  1HU9 A;  1GY7 A;  2E2U A;  2KF6 A;  2Y74 A;  2ML6 A;  3ZG5 A;  2XGN A;  1ASK A;  1W6Y A;  2CG1 A;  4NPB A;  2BT3 A;  3SYU A;  2RCD A;  3WA3 A;  1QMA A;  1UUW B;  1YVB I;  5IG3 A;  3G6E 3;  1E97 A;  3CCU 3;  5IG4 A;  1KC8 4;  2W2C A;  3EHC A;  3JUM A;  1JBT A;  5M18 A;  4IIA A;  2CWV A;  2IMJ A;  1M1K 4;  2SBL A;  3MG1 A;  1ZO2 A;  3I55 3;  4WP5 A;  4WYK A;  4O2H A;  3L0R A;  3Q1C A;  1RN4 A;  1UGH I;  4AEQ A;  4ZM8 A;  1BNE A;  1GY6 A;  1TRP A;  1IV9 A;  3D79 A;  6STD A;  1IU7 A;  1AY7 A;  1D6U A;  1UUV B;  2ZDJ A;  1W4N A;  1MNL A;  1GD4 A;  1SQW A;  1O7H B;  1OHS A;  3O8Y A;  1I3I A;  3X42 A;  3FG4 A;  4J8T A;  3FZW A;  1Q9E A;  3EBY A;  1GSP A;  1UDI I;  1AQZ A;  5AI1 A;  1HYF A;  1A2P A;  1KD1 4;  1X1W A;  5AEW B;  4U13 A;  1B3S A;  4XBT A;  2C4B A;  3OWS A;  3K0Z A;  2M7O A;  2L4V A;  1B2Z A;  5D83 A;  3KE7 A;  1A2V A;  1FUS A;  1RGC A;  1W7C A;  2BU4 A;  2L1S A;  2LQV A;  2I9W A;  3FKA A;  1B2U A;  4XBX A;  3CD6 3;  4DKI A;  4WWU C;  1W00 A;  2JQ5 A;  4HZB B;  3EC9 A;  1W2Z A;  1SJW A;  3X3Y A;  4KFD A;  1O7N B;  2W56 A;  3G71 3;  5FGO A;  3GZX B;  1HZ1 A;  2PZV A;  3SOY A;  3F14 A;  1RGH A;  1STF I;  4BL2 A;  1IQ8 A;  1K41 A;  3BLZ A;  4KZ1 A;  1S72 3;  4EV5 A;  2IYJ A;  5M1A A;  2WGO A;  3M8C A;  1FGO A;  3GAX A;  1JRQ A;  1BVI A;  1TJD A;  5RNT A;  2K54 A;  3FCS B;  1I0V A;  5ELJ A;  1TFK A;  2H0I A;  3U97 A;  1YNV X;  1W6C A;  3NBR A;  4FMA A;  3RDE A;  3ZFZ A;  4KVH A;  5JPU A;  1QVF 2;  1K8A 4;  1OHP A;  1RN7 A;  3DM8 A;  3NUV A;  2P05 A;  3BNC A;  1Q40 A;  1BIR A;  3PCR A;  5ELU A;  3MG2 A;  3WOD G;  3VGN A;  3ECF A;  4HYZ A;  1RLS A;  2W56 B;  1GD3 A;  1JZO A;  1UI7 A;  1GOY A;  1V74 A;  2W04 A;  1IV7 A;  2CH9 A;  6GSP A;  5IEN A;  1I2F A;  4R4K A;  3CNX A;  3OWU A;  2QA4 3;  1VQ7 3;  4FCM A;  4FMB A;  2CX1 A;  2HOH A;  2GBX B;  1DMN A;  3DGM A;  3GZB A;  4JF8 A;  1NJI 4;  5BVB A;  1OCV A;  3PCS A;  1BRJ A;  3PS8 A;  4LMI A;  4BTX A;  2R4I A;  3IMA B;  3HOH A;  3WMD A;  4G1M B;  3GZY B;  9RNT A;  4GHO A;  1VQP 3;  3G0K A;  1G96 A;  4R1K A;  3CMA 3;  3DGL A;  1O7W B;  1ROV A;  5AYR B;  5M19 A;  2BMO B;  1JB4 A;  5CLK A;  1Q82 4;  5CF1 A;  2CFW A;  4K90 B;  4N3V A;  1ROA A;  3RGA A;  2B24 B;  1CYU A;  3S28 A;  1IT8 A;  3NM2 A;  3SLU A;  3N8B A;  2Q07 A;  1BSC A;  1AVL A;  2WGQ A;  1K9M 4;  3JUQ A;  1BRG A;  4L8P A;  3MPH A;  3B7C A;  3EJV A;  2RBI A;  1E3R A;  3CU3 A;  1VQ6 3;  1U5O A;  2C10 A;  4HM4 B;  4EXR A;  3LH4 A;  4N6T A;  1LNH A;  2W6J H;  5G1L A;  1IVV A;  3QK9 A;  4HM1 B;  4N6N B;  2KXG A;  1VQ4 3;  1YI2 3;  5AEU B;  1AV4 A;  2AAD A;  2CFG A;  5BIR A;  1VQK 3;  3E99 A;  1IDP A;  3S5C A;  3F40 A;  4J5G A;  1CYV A;  4RNZ A;  1GMP A;  4R9K A;  2F56 A;  1ZX2 A;  3GRD A;  4XM4 A;  1BSA A;  5KP3 A;  3D4A A;  3X3X A;  1YGE A;  3LXU X;  1B21 A;  1RDS A;  4HM5 B;  3WR2 A;  4MJD A;  1W01 A;  1ISK A;  1BSD A;  3S27 A;  2F5W A;  3DGN A;  2KCD A;  3EN8 A;  1V58 A;  3N54 B;  5KP1 A;  2XH9 A;  2F4Y A;  1BRI A;  3RNT A;  5BU4 A;  1YJ9 3;  1LOW A;  3OW2 2;  1D6Y A;  1Y4K A;  3MYT A;  1X1U A;  4HZ9 B;  1BRS A;  3NX0 A;  3MSO A;  3JUN A;  1JN5 A;  1I2E A;  5AYS C;  4CPK A;  1VQM 3;  1WMN A;  5EEO A;  1OUN A;  1VQL 3;  1VQ9 3;  3DUK A;  3LT8 A;  5D82 A;  1M1X B;  1C54 A;  3AGN A;  1VZZ A;  4OUQ A;  3GSP A;  1I3F A;  3ER7 A;  2H0G A;  5IW9 A;  1LOY A;  1MWU A;  3SED A;  2KF5 A;  3MG3 A;  3ZG0 A;  2BHM A;  3H3H A;  1RGL A;  3BB9 A;  2FXT A;  1RGA A;  4X2O A;  2D1W A;  2UUG C;  2P0M A;  2HMJ B;  3HZP A;  4LZI A;  2ML5 A;  1EQK A;  1GMR A;  5EVH A;  4J9A A;  1BNS A;  1STD A;  3FG1 A;  4EC6 A;  2ZHX B;  2D42 A;  4RBN A;  1JN5 B;  1TTO A;  1OAC A;  2BMR B;  5IEP A;  3KCH A;  4ILF A;  2XFS A;  5A0O B;  4MEI A;  1DMQ A;  5G1K A;  1NB3 I;  3EBT A;  3S67 A;  8CHO A;  2HMK B;  3GWR A;  4JRF A;  4EV2 A;  1I0X A;  1KSI A;  1WMP A;  3RGR A;  4AKY A;  1FZU A;  1JZD A;  2GBW B;  3BNB A;  4O3V A;  4L8O A;  5DRV A;  1TU5 A;  4GSP A;  1Q7H A;  3LTB A;  2R41 A;  1OF5 B;  3CME 3;  1GY5 A;  4N6V 0;  2K3D A;  3V98 A;  3F8X A;  1RN1 A;  3WDG B;  1CH0 A;  1M9G A;  1RCK A;  2W03 A;  2CFD A;  4BTW A;  2E2V A;  3HII A;  2RFR A;  1A90 A;  3K5T A;  2W0Q A;  1PU4 A;  1W5Z A;  2QGU A;  1AR0 A;  1DMM A;  4IPB A;  3I56 3;  3FF2 A;  1IVU A;  3NXJ A;  4RNT A;  1PY3 A;  3K7C A;  5IEO A;  1Q42 A;  1BRH A;  2XR8 B;  3EN1 B;  3SVA A;  2CIU A;  1BRK A;  4XDV A;  1UCJ A;  3SOA A;  2STD A;  3WHO A;  2OOV C;  3CCV 3;  3WOE B;  4KFE A;  3HIG A;  3F9S A;  4HM8 B;  3UL5 A;  1YIJ 3;  3LTC A;  4NHF A;  1RHL A; 
#chains in the Genus database with same CATH homology
 1R4Y A;  1T2H A;  4HOH A;  1I70 A;  1B2M A;  1BSC A;  3URP A;  1I2G A;  1RGK A;  4J5K A;  1MGW A;  1BRG A;  2KF3 A;  3A5E A;  1BU4 A;  2RNT A;  1BGS A;  3AHS A;  1G02 A;  2ZA4 A;  2RBI A;  2KF6 A;  1FUT A;  1RNT A;  8RNT A;  1SAR A;  3SYU A;  1B2S A;  1FW7 A;  3RNT A;  1UCL A;  1IYY A;  1B2X A;  1DET A;  1JBT A;  2AAD A;  4HAA A;  5BIR A;  1T2I A;  4J5G A;  3AGO A;  1X1Y A;  1BUJ A;  1RNB A;  1FYS A;  1GMP A;  2F56 A;  1BSA A;  3D4A A;  1RN4 A;  1BAO A;  2KAA A;  1BNG A;  6RNT A;  1BNE A;  1TRP A;  1YVS A;  1B21 A;  3D5G A;  7GSP A;  1RDS A;  1RMS A;  1AY7 A;  3WR2 A;  3BIR A;  1BSD A;  1I3I A;  2F5W A;  1Q9E A;  1GSP A;  1AQZ A;  2F4Y A;  1BRI A;  3BU4 A;  1HYF A;  1ZGX A;  3DH2 A;  1A2P A;  1LOW A;  1TRQ A;  1BNJ A;  5BU4 A;  1X1W A;  1B3S A;  1X1U A;  2C4B A;  1BRS A;  1I2E A;  1B2Z A;  1FUS A;  1RGC A;  1BAN A;  2BU4 A;  1RSN A;  1B2U A;  1UCK A;  1UCI A;  1C54 A;  3AGN A;  1LRA A;  3GSP A;  1I3F A;  1HZ1 A;  3D5I A;  1MGR A;  1LOY A;  1RGH A;  2KF5 A;  4BU4 A;  1LNI A;  2F5M A;  1B20 A;  5HOH A;  1RGL A;  1RGA A;  1BNF A;  1BNR A;  1GMR A;  1BOX A;  1BVI A;  5RNT A;  1BNS A;  1I0V A;  5GSP A;  1YNV X;  1I8V A;  1TTO A;  3KCH A;  2BIR A;  1JBR A;  1RTU A;  2AAE A;  1BIR A;  1DE3 A;  1I0X A;  1FZU A;  1YGW A;  1LOV A;  1RLS A;  4GSP A;  1BSE A;  1GOY A;  6GSP A;  1GMQ A;  1BRN L;  1I2F A;  1GOU A;  1RN1 A;  2KF4 A;  1CH0 A;  1RCK A;  1RGE A;  2HOH A;  3Q3F A;  1X1X A;  7RNT A;  1PYL A;  1B27 A;  1BRJ A;  3HOH A;  1RGG A;  1BNI A;  2SAR A;  1JBS A;  3DGY A;  9RNT A;  2GSP A;  1PY3 A;  4RNT A;  4GHO A;  1BRH A;  1BSB A;  3AHW A;  1BRK A;  3WHO A;  1UCJ A;  1GOV A;  1RGF A;  4BIR A;  1RCL A;  1RHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...