1I3FA

Ribonuclease t1 v89s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGSITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i3fA00
1RLSA 1BRHA 1RNTA 1RTUA 1AY7A 1AQZA 1RGGA 1X1WA 2F56A 2ZA4A 1I0XA 1FW7A 1BGSA 2RNTA 1RGAA 1BSEA 1X1XA 1BNIA 1T2IA 2AAEA 6RNTA 1CH0A 2C4BA 2BU4A 1LOWA 1I70A 2HOHA 1MGWA 1RGLA 3AHWA 1B2SA 1UCLA 3GSPA 1RN4A 4GHOA 1BUJA 1FZUA 1RSNA 1B2XA 1B27A 1SARA 3AGNA 3KCHA 4GSPA 1R4YA 2KF4A 4BU4A 1IYYA 1B2MA 3AHSA 1RN1A 1MGRA 1YGWA 3DH2A 1JBTA 1YNVX 1BANA 1C54A 1BRIA 1GMRA 1PYLA 4HAAA 1BIRA 1BSDA 1HYFA 4BIRA 3D4AA 1FUSA 1X1UA 2GSPA 3D5IA 1GOUA 1I2EA 1TRPA 1X1YA 1RCLA 5GSPA 1RHLA 1B2ZA 1I3FA 1LOVA 2SARA 1BVIA 2KF6A 1RGEA 1TRQA 1LOYA 1DE3A 1BNRA 1I3IA 2KAAA 1I2GA 3SYUA 1BSAA 2F5MA 3AGOA 1RDSA 1T2HA 3Q3FA 1RGHA 1I0VA 1PY3A 1FYSA 8RNTA 1GOYA 1LRAA 5RNTA 3RNTA 2F5WA 1LNIA 1B20A 1UCIA 2F4YA 1TTOA 5BU4A 1RMSA 3D5GA 1RGFA 1I8VA 1RCKA 1A2PA 1BSBA 5HOHA 1BRGA 3BIRA 1BNEA 3WHOA 1BAOA 1BNFA 4RNTA 1BSCA 1HZ1A 1UCKA 1Q9EA 4J5GA 3URPA 1BRNL 3DGYA 1JBRA 1YVSA 1UCJA 3WR2A 2KF3A 5BIRA 1I2FA 9RNTA 7RNTA 1GSPA 2AADA 1G02A 1BNGA 1DETA 1BRJA 1GMPA 2KF5A 6GSPA 1RNBA 1B2UA 1JBSA 4HOHA 1B3SA 1RGKA 3HOHA 2RBIA 1BOXA 1BRKA 1RGCA 1BNSA 1BRSA 1GMQA 3BU4A 1ZGXA 1BNJA 2BIRA 7GSPA 4J5KA 1BU4A 1FUTA 1GOVA 1B21A 3A5EA
chains in the Genus database with same CATH superfamily
1YJW3 1YIJ3 1AQZA 1RGGA 3DGMA 1U5OA 3CNMA 3EC9A 3S28A 5IF6A 2UX0A 4L7KA 1OGZA 2OOVC 3NXJA 1W00A 2ML6A 1W2ZA 1AVLA 3K5TA 3B7CA 3LXUX 1YJ93 1W6CA 4NREA 1VQ53 1BNIA 1MWSA 2AAEA 4FR9A 3QRDA 2BU4A 2P0XA 1I70A 4IPBA 3I553 3SXXA 2HOHA 1YIT3 3T8NA 4Q53A 3ER7A 1Q864 4XB5A 1B2SA 1JV2B 1K28A 1OHOA 1RN4A 3EBTA 3D3LA 1B27A 3MG1A 4HM7B 1K8A4 4WHAA 2ZL8A 1OGXA 4LEHA 4KFDA 1MWTA 4J8TA 3BB9A 2CG0A 3FG3A 3S27A 5IG5A 1B2MA 4K61A 2HMKB 2BNGA 5KP4A 1KC84 1TP6A 2K54A 4AKZA 1J2BA 1JNQA 4K1VA 1KWIA 4EBGA 4HAAA 2Z76A 3HIIA 5KP1A 3OWYA 3CCJ3 1X1UA 3G713 4FMDA 3J7Yd 2FXTA 2QGUA 4I5QA 1R4CA 3PZWA 1T5YA 4EYCA 3KFQC 5M18A 1RHLA 1B2ZA 1GY6A 3PS8A 3G6E3 1BVIA 3B4OA 3CCE3 2Q07A 1WTHA 1OACA 1DE3A 3CC73 3CCL3 4FCMA 3K0ZA 4MMYB 3SOAA 3CD63 3Q3FA 1IQXA 5TGNA 4HYZA 2CW9A 4R1KA 7STDA 8RNTA 1D6UA 5LC7A 1Z1SA 3CMA3 3GRDA 3IPTA 1Y4KA 1EUIC 1TTOA 1RGFA 3PCRA 4HM3B 1ASKA 3D79A 3GAXA 5IERA 1BSBA 4RBNA 5IG4A 1IV7A 3F14A 3NM7A 2UUGC 1V74A 2LYXA 1BAOA 1BNFA 4WP5A 3UJMA 3JVCA 3SX1A 2WOHA 5BXQA 4KT3B 3KSPA 1BRNL 1IQYA 2SBLA 3EQQB 1N5PA 3HK4A 3S67A 1N9JA 4LZIA 1A2VA 5FW5A 3WR2A 1G0TA 3ZFZA 2AADA 3FGYA 1DETA 1BRJA 1GS3A 1TUHA 1GMPA 4N6MA 2XFSA 4CPKA 3LZAA 1KD14 1UUVB 4WFOA 4HOHA 5CF1A 1IV9A 2BMQB 3KZTA 3EBYA 2JDIH 4HJLB 1BRSA 2FNQA 2IYJA 1DVDA 2GEXA 1ZGXA 3PCSA 4HM4B 4NHFA 1STDA 4WWUC 3V98A 1M904 5BVBA 2BO9B 1RRHA 5IEPA 3B8LA 4LGQA 1ROAA 2P05A 3FSDA 4KVHA 2W2CA 3ROBA 2HMLB 1RLSA 1BRHA 1RTUA 2ZA4A 1AY7A 1X1WA 4KFEA 5AIGA 3DGNA 4BTXA 1OCVA 2OQEC 1I0XA 1N5HA 1MNLA 3CC43 2WGOA 3LTDA 1BSEA 4EXRA 1AV4A 3DUKA 3FF2A 4EW5A 1O7PB 1GD3A 1T2IA 2E2UA 1EQKA 1LOWA 1RJOA 5IW9A 1JJ22 1VQ83 1CQSA 2W03A 5M1AA 2I9WA 1RGLA 3F7XA 1FGQA 1RSNA 1AVKA 3LMLA 2ZDJA 4N6NB 2KF4A 1IYYA 3LTAA 2GU3A 3FZWA 1FUWA 5AEUB 5EQLA 1W4NA 1PFPA 4K90B 3AHSA 1RN1A 4MMZB 1MGRA 1NB3I 5JPPA 3MG3A 4LYLB 3BNCA 1JBTA 3UL5A 1BANA 1VQM3 1GMRA 1PYLA 3OWSA 1C54A 3VSYA 1DMNA 3NM2A 1BIRA 1BSDA 1MWUA 1UDII 1HYFA 2INXA 4WYKA 1FUSA 1JB2A 1A2KA 3MHEA 1ZO2A 2B24B 4CCVA 4R80A 1ZS7A 1NWWA 1I2EA 1TRPA 3S29A 3SEDA 2XEPA 1RCLA 4KFFA 5CF2A 3RGRA 1QVF2 4HZBB 1YHQ3 1I3FA 4AKYA 3NV0B 2B1XB 2KF6A 2CH9A 1Q42A 2CX1A 1LOYA 3NUVA 2CFLA 2CX0A 3CCM3 1IVWA 1BNRA 1E3VA 3A76A 3EF8A 4FMBA 4CJNA 1VQ73 1DVCA 4O8SA 3AGOA 3BNEA 4HVNA 1VQO3 2XSHB 4HBRA 5ELUA 1IK3A 2ZHXB 3IMAB 4O2HA 1VQK3 1FYSA 1JB4A 3WMDA 4XDVA 5AYSC 2K3DA 1LRAA 2MF7A 3ECFA 3O8YA 3RNTA 4LSOA 3GWRA 3WOFB 3T0UA 1TU5A 3BLZA 3V99A 1LNIA 1UCIA 4FCJA 5DRVA 3Q90A 3X3YA 2E2VA 1RMSA 2H0HA 1MWRA 5BU4A 1RKYA 1K734 1RCKA 3OV4A 1LQMB 2H0GA 1E3RA 5D81A 3JUMA 3BIRA 3CU3A 1VQQA 3WHOA 1HU9A 1IDPA 1O7GB 1OHPA 3ZG5A 2QA43 4X2OA 3DY5A 5STDA 2OTL3 1U8CB 5CLKA 4ZM8A 3DGYA 4BL2A 1V57A 5IEOA 1QALA 3PYJA 1UCJA 4HZ9B 2W6JH 1LNHA 3CCR3 1I2FA 3OWUA 9RNTA 1S5AA 2FGTA 2Y74A 7RNTA 1G02A 2YFJB 1NNVA 2UGIA 2L1SA 1W7CA 1JKGB 3OXAA 1Q824 3FG4A 2CWVA 3OX9A 6GSPA 2Z6BA 5JBSA 1N8R4 1RNBA 2KXGA 4R9LA 2C10A 5A0OB 1RGKA 3MKIA 3LTCA 1YVBI 5IG3A 2CHCA 2D42A 3N9HA 3TDGA 1GMQA 3NQZA 3Q1CA 1Q40B 3RGAA 1BNJA 1JN5B 2QIYA 1OF5B 3PXMA 2E2TA 1BUQA 1IU7A 3AMOB 3FLJA 4LMIA 2M7OA 3STDA 4FMCA 1GY5A 3FF0A 4RNYA 1GOVA 1B21A 1G96A 3HIGA 1JRQA 2XR8B 4RNZA 3LOYA 4OVMA 1RNTA 2F56A 3BNBA 1O7NB 1D6ZA 1O7WB 2CIUA 3FH1A 3FKAA 5AIFA 2W0QA 4G1MB 1TIJA 1VQL3 1EKMA 3LTBA 5CK6A 1JKGA 3KIIA 3EB8A 5AIIA 3WA3A 1BGSA 2C11A 1UW1A 2HMJB 2RNTA 1UI8A 4XM4A 2W04A 1UI7A 2QEX3 1CH0A 2C4BA 4MJDA 3FG1A 1W02A 5IG0A 1Q40A 2WO0A 3U1WA 1QAFA 1JN5A 1V58A 4FCZA 1M1K4 1OF5A 3MWZA 4EV5A 1UCLA 3GSPA 3AMOA 1FZUA 4H61A 4HM5B 1SARA 2BT3A 3AGNA 3KCHA 3GZRA 1R4YA 2W9QA 3X41A 1M1XB 3CNXA 3N8BA 3VF1A 3SOYA 1GD4A 3MSOA 2J8XB 1AR0A 3DH2A 3EX9A 1CEWI 2CG1A 3CCQ3 4TX4A 1JB5A 1OPYA 3EN1B 3WA2X 2GBWB 4BIRA 3D4AA 2GSPA 3DGLA 3F8HA 1GOUA 4EV2A 3KE7A 4JRFA 1SJWA 1C7HA 5GSPA 2F86B 2IY2A 4BTYA 4KZ1A 5G1LA 2LQVA 1OHSA 1RGEA 1QAKA 1TRQA 2ML5A 2F98A 4ILFA 4ORLA 3G0KA 1FGOA 3G16A 1FGTA 3WDGB 3X42A 3UL6A 3SYUA 1BSAA 2R41A 1VQ63 3S5CA 1OUNA 2F5MA 3NQYA 1EA2A 3K63A 1A90A 3T8UA 2XRXB 4HM6B 1ULJB 1I0VA 1TJDA 3F9SA 1ISKA 4I4KA 3CPW2 1YJN3 1GOYA 3H51A 3LH4A 1UGHI 3K9MC 3D5GA 1STFI 1I8VA 2XSOB 1KSIA 3DM8A 5HOHA 3WODG 3NHXA 1BRGA 2RFRA 8CHOA 1EG9B 1N9EA 2W56B 3D9RA 2GEYA 3EHCA 1IT7A 5D83A 1VZZA 1WMNA 2CFWA 1VQN3 1HZ1A 2HMMB 3URPA 4XBXA 1JBRA 3KN4A 1T3BA 3L0RA 1ROVA 3DXOA 1NJI4 3DZLA 1ZX2A 2RGQA 5BIRA 3UB1A 1CYVA 1BNGA 3SLUA 1K9M4 3H3HA 2O3OA 3PGBA 4HM0B 3FCSB 4HM8B 2IUKA 4N6LA 2P0MA 2OOVA 2KF5A 2IUJA 1NB5I 4JF8A 1B2UA 2RCDA 1JZOA 1US1A 2A15A 2HMNB 1B3SA 4R4KA 5AI1A 3CCS3 2RBIA 1BOXA 1NU3A 1BRKA 3LYGA 1GY7A 2W56A 4U13A 3NV0A 4GB5A 4XBYA 1D6YA 3GZBA 1BNSA 2YX9A 1IVXA 3BU4A 3G8ZA 5JPUA 1W6GA 1O7MB 1LQGC 2BIRA 1DYUA 2CC3A 3ZG0A 3EN8A 2PNCA 7GSPA 1PU4A 1F8NA 1FUTA 2K0MA 1QMAA 4OK0A 4PEJA 4N3VA 2WOFA 1DMQA 4HKVB 1WQLB 4L8OA 2OTJ3 4N6OB 3A5EA 5AIHA 1LVNA 4R9KA 1L5GB 4J9AA 2IMJA 2Z7AA 3GZYB 3ALAA 3NBRA 3LT9A 1VQ43 1IVVA 1FGRA 1IVUA 1SPUA 5HGRA 1IT8A 3K7CA 4STDA 1FW7A 2STDA 1RGAA 3BNDA 4XDWA 1Q7Y4 1X1XA 3DGOA 4X2HA 6RNTA 1W5ZA 3G4S3 1K41A 1WMPA 4OUQA 4HM2B 4RZMA 1OH0A 3SVAA 1EEJA 1TFKA 3DMCA 3JUOA 3UNLA 2P09A 1MGWA 4N6TA 3AHWA 5IENA 4GHOA 3EE1A 1BUJA 3B4PA 1B2XA 1MOLA 4GSPA 2CWUA 2XGNA 1S723 4AEQA 2YFLB 4BU4A 2PZVA 4O3VA 2P38A 5DREA 4BL3A 2CFGA 1QVG2 2MC8A 2GXFA 3EJVA 5FGOA 4CDLA 1YGWA 4GL6A 1WMOA 2D1WA 4FMAA 4N6UA 3CC23 1YNVX 1GYBA 1BRIA 1W2B2 2KCDA 1YI23 2BHMA 2CFKA 2CKFB 6STDA 2OCTA 4XBTA 2CFDA 3NBJA 2XGLA 3D5IA 2OWPA 4HM1B 2XF3A 4MEIA 5EVHA 5EEOA 1KQS2 2Z77A 3HX8A 4N6V0 3IJEB 2HMOB 1X1YA 3LT8A 4EC6A 1Q814 2IA7A 2W9PA 3NX0A 1LOVA 4IIAA 5I97A 3HZPA 2SARA 3CXC2 2CK3H 1ULIB 5KP3A 2GU1A 1FGMA 1M9GA 1DMMA 1I3IA 2KAAA 1I2GA 2GBXB 2BMOB 5G2GA 4DKIA 1WNHA 1NDOB 1LOXA 1RDSA 1T2HA 1UUWB 3CME3 3OW22 1RGHA 1PY3A 1SIIA 1A67A 3RDEA 1FA3A 5AEWB 1RN7A 2XFTA 2RSXA 5RNTA 3U97A 3CCV3 1Q7HA 2F5WA 3X3XA 4O02B 3I0YA 1N8QA 3JUQA 3M8CA 5M19A 3VGNA 1B20A 2F4YA 2V1LA 3JUPA 4BTWA 2BMRB 1E97A 5LC6A 3I563 5G1KA 3F7SA 1A2PA 1HKXA 1JZDA 1W01A 3MYTA 3CPOA 1YGEA 1RRLA 3NBBA 1IQ8A 1BNEA 1VQP3 3F40A 5CXOA 2F99A 4RNTA 3GZXB 1BSCA 3X40A 1UCKA 3F8XA 1Q9EA 2Y73A 4J5GA 1SIHA 3V92A 3WOEB 1UUGB 3MPHA 3X3ZA 1YVSA 5ELJA 3KSED 3Q2PA 2KRTA 4K1UA 2H0IA 1W6YA 4H3UA 4MMXB 2KF3A 2WGQA 1QJGA 2R4IA 1GSPA 1UGIA 1VQ93 3MG2A 2OQEA 2O9UX 1CYUA 2L4VA 4QWTA 4WYKB 3KKGA 5AYRB 1SQWA 1O7HB 1JBSA 2YFIB 3HOHA 2JQ5A 4IT7A 1RGCA 2CWTA 3N54B 3CCU3 4NPBA 1TFOA 3E99A 3HI7A 4J5KA 1BU4A 4L8PA 1NO3A 2XH9A 5D82A 3JUNA 3QK9A 1LXEA
chains in the Genus database with same CATH topology
1RLSA 1BRHA 1RNTA 1RTUA 1AY7A 1AQZA 1RGGA 1X1WA 2F56A 2ZA4A 1I0XA 1FW7A 1BGSA 2RNTA 1RGAA 1BSEA 1X1XA 1BNIA 1T2IA 2AAEA 6RNTA 1CH0A 2C4BA 2BU4A 1LOWA 1I70A 2HOHA 1MGWA 1RGLA 3AHWA 1B2SA 1UCLA 3GSPA 1RN4A 4GHOA 1BUJA 1FZUA 1RSNA 1B2XA 1B27A 1SARA 3AGNA 3KCHA 4GSPA 1R4YA 2KF4A 4BU4A 1IYYA 1B2MA 3AHSA 1RN1A 1MGRA 1YGWA 3DH2A 1JBTA 1YNVX 1BANA 1C54A 1BRIA 1GMRA 1PYLA 4HAAA 1BIRA 1BSDA 1HYFA 4BIRA 3D4AA 1FUSA 1X1UA 2GSPA 3D5IA 1GOUA 1I2EA 1TRPA 1X1YA 1RCLA 5GSPA 1RHLA 1B2ZA 1I3FA 1LOVA 2SARA 1BVIA 2KF6A 1RGEA 1TRQA 1LOYA 1DE3A 1BNRA 1I3IA 2KAAA 1I2GA 3SYUA 1BSAA 2F5MA 3AGOA 1RDSA 1T2HA 3Q3FA 1RGHA 1I0VA 1PY3A 1FYSA 8RNTA 1GOYA 1LRAA 5RNTA 3RNTA 2F5WA 1LNIA 1B20A 1UCIA 2F4YA 1TTOA 5BU4A 1RMSA 3D5GA 1RGFA 1I8VA 1RCKA 1A2PA 1BSBA 5HOHA 1BRGA 3BIRA 1BNEA 3WHOA 1BAOA 1BNFA 4RNTA 1BSCA 1HZ1A 1UCKA 1Q9EA 4J5GA 3URPA 1BRNL 3DGYA 1JBRA 1YVSA 1UCJA 3WR2A 2KF3A 5BIRA 1I2FA 9RNTA 7RNTA 1GSPA 2AADA 1G02A 1BNGA 1DETA 1BRJA 1GMPA 2KF5A 6GSPA 1RNBA 1B2UA 1JBSA 4HOHA 1B3SA 1RGKA 3HOHA 2RBIA 1BOXA 1BRKA 1RGCA 1BNSA 1BRSA 1GMQA 3BU4A 1ZGXA 1BNJA 2BIRA 7GSPA 4J5KA 1BU4A 1FUTA 1GOVA 1B21A 3A5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLS A;  1BRH A;  1RNT A;  1RTU A;  1AY7 A;  1AQZ A;  1RGG A;  1X1W A;  2F56 A;  2ZA4 A;  1I0X A;  1FW7 A;  1BGS A;  2RNT A;  1RGA A;  1BSE A;  1X1X A;  1BNI A;  1T2I A;  2AAE A;  6RNT A;  1CH0 A;  2C4B A;  2BU4 A;  1LOW A;  1I70 A;  2HOH A;  1MGW A;  1RGL A;  3AHW A;  1B2S A;  1UCL A;  3GSP A;  1RN4 A;  4GHO A;  1BUJ A;  1FZU A;  1RSN A;  1B2X A;  1B27 A;  1SAR A;  3AGN A;  3KCH A;  4GSP A;  1R4Y A;  2KF4 A;  4BU4 A;  1IYY A;  1B2M A;  3AHS A;  1RN1 A;  1MGR A;  1YGW A;  3DH2 A;  1JBT A;  1YNV X;  1BAN A;  1C54 A;  1BRI A;  1GMR A;  1PYL A;  4HAA A;  1BIR A;  1BSD A;  1HYF A;  4BIR A;  3D4A A;  1FUS A;  1X1U A;  2GSP A;  3D5I A;  1GOU A;  1I2E A;  1TRP A;  1X1Y A;  1RCL A;  5GSP A;  1RHL A;  1B2Z A;  1I3F A;  1LOV A;  2SAR A;  1BVI A;  2KF6 A;  1RGE A;  1TRQ A;  1LOY A;  1DE3 A;  1BNR A;  1I3I A;  2KAA A;  1I2G A;  3SYU A;  1BSA A;  2F5M A;  3AGO A;  1RDS A;  1T2H A;  3Q3F A;  1RGH A;  1I0V A;  1PY3 A;  1FYS A;  8RNT A;  1GOY A;  1LRA A;  5RNT A;  3RNT A;  2F5W A;  1LNI A;  1B20 A;  1UCI A;  2F4Y A;  1TTO A;  5BU4 A;  1RMS A;  3D5G A;  1RGF A;  1I8V A;  1RCK A;  1A2P A;  1BSB A;  5HOH A;  1BRG A;  3BIR A;  1BNE A;  3WHO A;  1BAO A;  1BNF A;  4RNT A;  1BSC A;  1HZ1 A;  1UCK A;  1Q9E A;  4J5G A;  3URP A;  1BRN L;  3DGY A;  1JBR A;  1YVS A;  1UCJ A;  3WR2 A;  2KF3 A;  5BIR A;  1I2F A;  9RNT A;  7RNT A;  1GSP A;  2AAD A;  1G02 A;  1BNG A;  1DET A;  1BRJ A;  1GMP A;  2KF5 A;  6GSP A;  1RNB A;  1B2U A;  1JBS A;  4HOH A;  1B3S A;  1RGK A;  3HOH A;  2RBI A;  1BOX A;  1BRK A;  1RGC A;  1BNS A;  1BRS A;  1GMQ A;  3BU4 A;  1ZGX A;  1BNJ A;  2BIR A;  7GSP A;  4J5K A;  1BU4 A;  1FUT A;  1GOV A;  1B21 A;  3A5E A; 
#chains in the Genus database with same CATH topology
 1YJW 3;  1YIJ 3;  1AQZ A;  1RGG A;  3DGM A;  1U5O A;  3CNM A;  3EC9 A;  3S28 A;  5IF6 A;  2UX0 A;  4L7K A;  1OGZ A;  2OOV C;  3NXJ A;  1W00 A;  2ML6 A;  1W2Z A;  1AVL A;  3K5T A;  3B7C A;  3LXU X;  1YJ9 3;  1W6C A;  4NRE A;  1VQ5 3;  1BNI A;  1MWS A;  2AAE A;  4FR9 A;  3QRD A;  2BU4 A;  2P0X A;  1I70 A;  4IPB A;  3I55 3;  3SXX A;  2HOH A;  1YIT 3;  3T8N A;  4Q53 A;  3ER7 A;  1Q86 4;  4XB5 A;  1B2S A;  1JV2 B;  1K28 A;  1OHO A;  1RN4 A;  3EBT A;  3D3L A;  1B27 A;  3MG1 A;  4HM7 B;  1K8A 4;  4WHA A;  2ZL8 A;  1OGX A;  4LEH A;  4KFD A;  1MWT A;  4J8T A;  3BB9 A;  2CG0 A;  3FG3 A;  3S27 A;  5IG5 A;  1B2M A;  4K61 A;  2HMK B;  2BNG A;  5KP4 A;  1KC8 4;  1TP6 A;  2K54 A;  4AKZ A;  1J2B A;  1JNQ A;  4K1V A;  1KWI A;  4EBG A;  4HAA A;  2Z76 A;  3HII A;  5KP1 A;  3OWY A;  3CCJ 3;  1X1U A;  3G71 3;  4FMD A;  3J7Y d;  2FXT A;  2QGU A;  4I5Q A;  1R4C A;  3PZW A;  1T5Y A;  4EYC A;  3KFQ C;  5M18 A;  1RHL A;  1B2Z A;  1GY6 A;  3PS8 A;  3G6E 3;  1BVI A;  3B4O A;  3CCE 3;  2Q07 A;  1WTH A;  1OAC A;  1DE3 A;  3CC7 3;  3CCL 3;  4FCM A;  3K0Z A;  4MMY B;  3SOA A;  3CD6 3;  3Q3F A;  1IQX A;  5TGN A;  4HYZ A;  2CW9 A;  4R1K A;  7STD A;  8RNT A;  1D6U A;  5LC7 A;  1Z1S A;  3CMA 3;  3GRD A;  3IPT A;  1Y4K A;  1EUI C;  1TTO A;  1RGF A;  3PCR A;  4HM3 B;  1ASK A;  3D79 A;  3GAX A;  5IER A;  1BSB A;  4RBN A;  5IG4 A;  1IV7 A;  3F14 A;  3NM7 A;  2UUG C;  1V74 A;  2LYX A;  1BAO A;  1BNF A;  4WP5 A;  3UJM A;  3JVC A;  3SX1 A;  2WOH A;  5BXQ A;  4KT3 B;  3KSP A;  1BRN L;  1IQY A;  2SBL A;  3EQQ B;  1N5P A;  3HK4 A;  3S67 A;  1N9J A;  4LZI A;  1A2V A;  5FW5 A;  3WR2 A;  1G0T A;  3ZFZ A;  2AAD A;  3FGY A;  1DET A;  1BRJ A;  1GS3 A;  1TUH A;  1GMP A;  4N6M A;  2XFS A;  4CPK A;  3LZA A;  1KD1 4;  1UUV B;  4WFO A;  4HOH A;  5CF1 A;  1IV9 A;  2BMQ B;  3KZT A;  3EBY A;  2JDI H;  4HJL B;  1BRS A;  2FNQ A;  2IYJ A;  1DVD A;  2GEX A;  1ZGX A;  3PCS A;  4HM4 B;  4NHF A;  1STD A;  4WWU C;  3V98 A;  1M90 4;  5BVB A;  2BO9 B;  1RRH A;  5IEP A;  3B8L A;  4LGQ A;  1ROA A;  2P05 A;  3FSD A;  4KVH A;  2W2C A;  3ROB A;  2HML B;  1RLS A;  1BRH A;  1RTU A;  2ZA4 A;  1AY7 A;  1X1W A;  4KFE A;  5AIG A;  3DGN A;  4BTX A;  1OCV A;  2OQE C;  1I0X A;  1N5H A;  1MNL A;  3CC4 3;  2WGO A;  3LTD A;  1BSE A;  4EXR A;  1AV4 A;  3DUK A;  3FF2 A;  4EW5 A;  1O7P B;  1GD3 A;  1T2I A;  2E2U A;  1EQK A;  1LOW A;  1RJO A;  5IW9 A;  1JJ2 2;  1VQ8 3;  1CQS A;  2W03 A;  5M1A A;  2I9W A;  1RGL A;  3F7X A;  1FGQ A;  1RSN A;  1AVK A;  3LML A;  2ZDJ A;  4N6N B;  2KF4 A;  1IYY A;  3LTA A;  2GU3 A;  3FZW A;  1FUW A;  5AEU B;  5EQL A;  1W4N A;  1PFP A;  4K90 B;  3AHS A;  1RN1 A;  4MMZ B;  1MGR A;  1NB3 I;  5JPP A;  3MG3 A;  4LYL B;  3BNC A;  1JBT A;  3UL5 A;  1BAN A;  1VQM 3;  1GMR A;  1PYL A;  3OWS A;  1C54 A;  3VSY A;  1DMN A;  3NM2 A;  1BIR A;  1BSD A;  1MWU A;  1UDI I;  1HYF A;  2INX A;  4WYK A;  1FUS A;  1JB2 A;  1A2K A;  3MHE A;  1ZO2 A;  2B24 B;  4CCV A;  4R80 A;  1ZS7 A;  1NWW A;  1I2E A;  1TRP A;  3S29 A;  3SED A;  2XEP A;  1RCL A;  4KFF A;  5CF2 A;  3RGR A;  1QVF 2;  4HZB B;  1YHQ 3;  1I3F A;  4AKY A;  3NV0 B;  2B1X B;  2KF6 A;  2CH9 A;  1Q42 A;  2CX1 A;  1LOY A;  3NUV A;  2CFL A;  2CX0 A;  3CCM 3;  1IVW A;  1BNR A;  1E3V A;  3A76 A;  3EF8 A;  4FMB A;  4CJN A;  1VQ7 3;  1DVC A;  4O8S A;  3AGO A;  3BNE A;  4HVN A;  1VQO 3;  2XSH B;  4HBR A;  5ELU A;  1IK3 A;  2ZHX B;  3IMA B;  4O2H A;  1VQK 3;  1FYS A;  1JB4 A;  3WMD A;  4XDV A;  5AYS C;  2K3D A;  1LRA A;  2MF7 A;  3ECF A;  3O8Y A;  3RNT A;  4LSO A;  3GWR A;  3WOF B;  3T0U A;  1TU5 A;  3BLZ A;  3V99 A;  1LNI A;  1UCI A;  4FCJ A;  5DRV A;  3Q90 A;  3X3Y A;  2E2V A;  1RMS A;  2H0H A;  1MWR A;  5BU4 A;  1RKY A;  1K73 4;  1RCK A;  3OV4 A;  1LQM B;  2H0G A;  1E3R A;  5D81 A;  3JUM A;  3BIR A;  3CU3 A;  1VQQ A;  3WHO A;  1HU9 A;  1IDP A;  1O7G B;  1OHP A;  3ZG5 A;  2QA4 3;  4X2O A;  3DY5 A;  5STD A;  2OTL 3;  1U8C B;  5CLK A;  4ZM8 A;  3DGY A;  4BL2 A;  1V57 A;  5IEO A;  1QAL A;  3PYJ A;  1UCJ A;  4HZ9 B;  2W6J H;  1LNH A;  3CCR 3;  1I2F A;  3OWU A;  9RNT A;  1S5A A;  2FGT A;  2Y74 A;  7RNT A;  1G02 A;  2YFJ B;  1NNV A;  2UGI A;  2L1S A;  1W7C A;  1JKG B;  3OXA A;  1Q82 4;  3FG4 A;  2CWV A;  3OX9 A;  6GSP A;  2Z6B A;  5JBS A;  1N8R 4;  1RNB A;  2KXG A;  4R9L A;  2C10 A;  5A0O B;  1RGK A;  3MKI A;  3LTC A;  1YVB I;  5IG3 A;  2CHC A;  2D42 A;  3N9H A;  3TDG A;  1GMQ A;  3NQZ A;  3Q1C A;  1Q40 B;  3RGA A;  1BNJ A;  1JN5 B;  2QIY A;  1OF5 B;  3PXM A;  2E2T A;  1BUQ A;  1IU7 A;  3AMO B;  3FLJ A;  4LMI A;  2M7O A;  3STD A;  4FMC A;  1GY5 A;  3FF0 A;  4RNY A;  1GOV A;  1B21 A;  1G96 A;  3HIG A;  1JRQ A;  2XR8 B;  4RNZ A;  3LOY A;  4OVM A;  1RNT A;  2F56 A;  3BNB A;  1O7N B;  1D6Z A;  1O7W B;  2CIU A;  3FH1 A;  3FKA A;  5AIF A;  2W0Q A;  4G1M B;  1TIJ A;  1VQL 3;  1EKM A;  3LTB A;  5CK6 A;  1JKG A;  3KII A;  3EB8 A;  5AII A;  3WA3 A;  1BGS A;  2C11 A;  1UW1 A;  2HMJ B;  2RNT A;  1UI8 A;  4XM4 A;  2W04 A;  1UI7 A;  2QEX 3;  1CH0 A;  2C4B A;  4MJD A;  3FG1 A;  1W02 A;  5IG0 A;  1Q40 A;  2WO0 A;  3U1W A;  1QAF A;  1JN5 A;  1V58 A;  4FCZ A;  1M1K 4;  1OF5 A;  3MWZ A;  4EV5 A;  1UCL A;  3GSP A;  3AMO A;  1FZU A;  4H61 A;  4HM5 B;  1SAR A;  2BT3 A;  3AGN A;  3KCH A;  3GZR A;  1R4Y A;  2W9Q A;  3X41 A;  1M1X B;  3CNX A;  3N8B A;  3VF1 A;  3SOY A;  1GD4 A;  3MSO A;  2J8X B;  1AR0 A;  3DH2 A;  3EX9 A;  1CEW I;  2CG1 A;  3CCQ 3;  4TX4 A;  1JB5 A;  1OPY A;  3EN1 B;  3WA2 X;  2GBW B;  4BIR A;  3D4A A;  2GSP A;  3DGL A;  3F8H A;  1GOU A;  4EV2 A;  3KE7 A;  4JRF A;  1SJW A;  1C7H A;  5GSP A;  2F86 B;  2IY2 A;  4BTY A;  4KZ1 A;  5G1L A;  2LQV A;  1OHS A;  1RGE A;  1QAK A;  1TRQ A;  2ML5 A;  2F98 A;  4ILF A;  4ORL A;  3G0K A;  1FGO A;  3G16 A;  1FGT A;  3WDG B;  3X42 A;  3UL6 A;  3SYU A;  1BSA A;  2R41 A;  1VQ6 3;  3S5C A;  1OUN A;  2F5M A;  3NQY A;  1EA2 A;  3K63 A;  1A90 A;  3T8U A;  2XRX B;  4HM6 B;  1ULJ B;  1I0V A;  1TJD A;  3F9S A;  1ISK A;  4I4K A;  3CPW 2;  1YJN 3;  1GOY A;  3H51 A;  3LH4 A;  1UGH I;  3K9M C;  3D5G A;  1STF I;  1I8V A;  2XSO B;  1KSI A;  3DM8 A;  5HOH A;  3WOD G;  3NHX A;  1BRG A;  2RFR A;  8CHO A;  1EG9 B;  1N9E A;  2W56 B;  3D9R A;  2GEY A;  3EHC A;  1IT7 A;  5D83 A;  1VZZ A;  1WMN A;  2CFW A;  1VQN 3;  1HZ1 A;  2HMM B;  3URP A;  4XBX A;  1JBR A;  3KN4 A;  1T3B A;  3L0R A;  1ROV A;  3DXO A;  1NJI 4;  3DZL A;  1ZX2 A;  2RGQ A;  5BIR A;  3UB1 A;  1CYV A;  1BNG A;  3SLU A;  1K9M 4;  3H3H A;  2O3O A;  3PGB A;  4HM0 B;  3FCS B;  4HM8 B;  2IUK A;  4N6L A;  2P0M A;  2OOV A;  2KF5 A;  2IUJ A;  1NB5 I;  4JF8 A;  1B2U A;  2RCD A;  1JZO A;  1US1 A;  2A15 A;  2HMN B;  1B3S A;  4R4K A;  5AI1 A;  3CCS 3;  2RBI A;  1BOX A;  1NU3 A;  1BRK A;  3LYG A;  1GY7 A;  2W56 A;  4U13 A;  3NV0 A;  4GB5 A;  4XBY A;  1D6Y A;  3GZB A;  1BNS A;  2YX9 A;  1IVX A;  3BU4 A;  3G8Z A;  5JPU A;  1W6G A;  1O7M B;  1LQG C;  2BIR A;  1DYU A;  2CC3 A;  3ZG0 A;  3EN8 A;  2PNC A;  7GSP A;  1PU4 A;  1F8N A;  1FUT A;  2K0M A;  1QMA A;  4OK0 A;  4PEJ A;  4N3V A;  2WOF A;  1DMQ A;  4HKV B;  1WQL B;  4L8O A;  2OTJ 3;  4N6O B;  3A5E A;  5AIH A;  1LVN A;  4R9K A;  1L5G B;  4J9A A;  2IMJ A;  2Z7A A;  3GZY B;  3ALA A;  3NBR A;  3LT9 A;  1VQ4 3;  1IVV A;  1FGR A;  1IVU A;  1SPU A;  5HGR A;  1IT8 A;  3K7C A;  4STD A;  1FW7 A;  2STD A;  1RGA A;  3BND A;  4XDW A;  1Q7Y 4;  1X1X A;  3DGO A;  4X2H A;  6RNT A;  1W5Z A;  3G4S 3;  1K41 A;  1WMP A;  4OUQ A;  4HM2 B;  4RZM A;  1OH0 A;  3SVA A;  1EEJ A;  1TFK A;  3DMC A;  3JUO A;  3UNL A;  2P09 A;  1MGW A;  4N6T A;  3AHW A;  5IEN A;  4GHO A;  3EE1 A;  1BUJ A;  3B4P A;  1B2X A;  1MOL A;  4GSP A;  2CWU A;  2XGN A;  1S72 3;  4AEQ A;  2YFL B;  4BU4 A;  2PZV A;  4O3V A;  2P38 A;  5DRE A;  4BL3 A;  2CFG A;  1QVG 2;  2MC8 A;  2GXF A;  3EJV A;  5FGO A;  4CDL A;  1YGW A;  4GL6 A;  1WMO A;  2D1W A;  4FMA A;  4N6U A;  3CC2 3;  1YNV X;  1GYB A;  1BRI A;  1W2B 2;  2KCD A;  1YI2 3;  2BHM A;  2CFK A;  2CKF B;  6STD A;  2OCT A;  4XBT A;  2CFD A;  3NBJ A;  2XGL A;  3D5I A;  2OWP A;  4HM1 B;  2XF3 A;  4MEI A;  5EVH A;  5EEO A;  1KQS 2;  2Z77 A;  3HX8 A;  4N6V 0;  3IJE B;  2HMO B;  1X1Y A;  3LT8 A;  4EC6 A;  1Q81 4;  2IA7 A;  2W9P A;  3NX0 A;  1LOV A;  4IIA A;  5I97 A;  3HZP A;  2SAR A;  3CXC 2;  2CK3 H;  1ULI B;  5KP3 A;  2GU1 A;  1FGM A;  1M9G A;  1DMM A;  1I3I A;  2KAA A;  1I2G A;  2GBX B;  2BMO B;  5G2G A;  4DKI A;  1WNH A;  1NDO B;  1LOX A;  1RDS A;  1T2H A;  1UUW B;  3CME 3;  3OW2 2;  1RGH A;  1PY3 A;  1SII A;  1A67 A;  3RDE A;  1FA3 A;  5AEW B;  1RN7 A;  2XFT A;  2RSX A;  5RNT A;  3U97 A;  3CCV 3;  1Q7H A;  2F5W A;  3X3X A;  4O02 B;  3I0Y A;  1N8Q A;  3JUQ A;  3M8C A;  5M19 A;  3VGN A;  1B20 A;  2F4Y A;  2V1L A;  3JUP A;  4BTW A;  2BMR B;  1E97 A;  5LC6 A;  3I56 3;  5G1K A;  3F7S A;  1A2P A;  1HKX A;  1JZD A;  1W01 A;  3MYT A;  3CPO A;  1YGE A;  1RRL A;  3NBB A;  1IQ8 A;  1BNE A;  1VQP 3;  3F40 A;  5CXO A;  2F99 A;  4RNT A;  3GZX B;  1BSC A;  3X40 A;  1UCK A;  3F8X A;  1Q9E A;  2Y73 A;  4J5G A;  1SIH A;  3V92 A;  3WOE B;  1UUG B;  3MPH A;  3X3Z A;  1YVS A;  5ELJ A;  3KSE D;  3Q2P A;  2KRT A;  4K1U A;  2H0I A;  1W6Y A;  4H3U A;  4MMX B;  2KF3 A;  2WGQ A;  1QJG A;  2R4I A;  1GSP A;  1UGI A;  1VQ9 3;  3MG2 A;  2OQE A;  2O9U X;  1CYU A;  2L4V A;  4QWT A;  4WYK B;  3KKG A;  5AYR B;  1SQW A;  1O7H B;  1JBS A;  2YFI B;  3HOH A;  2JQ5 A;  4IT7 A;  1RGC A;  2CWT A;  3N54 B;  3CCU 3;  4NPB A;  1TFO A;  3E99 A;  3HI7 A;  4J5K A;  1BU4 A;  4L8P A;  1NO3 A;  2XH9 A;  5D82 A;  3JUN A;  3QK9 A;  1LXE A; 
#chains in the Genus database with same CATH homology
 1RLS A;  1BRH A;  1RNT A;  1RTU A;  1AY7 A;  1AQZ A;  1RGG A;  1X1W A;  2F56 A;  2ZA4 A;  1I0X A;  1FW7 A;  1BGS A;  2RNT A;  1RGA A;  1BSE A;  1X1X A;  1BNI A;  1T2I A;  2AAE A;  6RNT A;  1CH0 A;  2C4B A;  2BU4 A;  1LOW A;  1I70 A;  2HOH A;  1MGW A;  1RGL A;  3AHW A;  1B2S A;  1UCL A;  3GSP A;  1RN4 A;  4GHO A;  1BUJ A;  1FZU A;  1RSN A;  1B2X A;  1B27 A;  1SAR A;  3AGN A;  3KCH A;  4GSP A;  1R4Y A;  2KF4 A;  4BU4 A;  1IYY A;  1B2M A;  3AHS A;  1RN1 A;  1MGR A;  1YGW A;  3DH2 A;  1JBT A;  1YNV X;  1BAN A;  1C54 A;  1BRI A;  1GMR A;  1PYL A;  4HAA A;  1BIR A;  1BSD A;  1HYF A;  4BIR A;  3D4A A;  1FUS A;  1X1U A;  2GSP A;  3D5I A;  1GOU A;  1I2E A;  1TRP A;  1X1Y A;  1RCL A;  5GSP A;  1RHL A;  1B2Z A;  1I3F A;  1LOV A;  2SAR A;  1BVI A;  2KF6 A;  1RGE A;  1TRQ A;  1LOY A;  1DE3 A;  1BNR A;  1I3I A;  2KAA A;  1I2G A;  3SYU A;  1BSA A;  2F5M A;  3AGO A;  1RDS A;  1T2H A;  3Q3F A;  1RGH A;  1I0V A;  1PY3 A;  1FYS A;  8RNT A;  1GOY A;  1LRA A;  5RNT A;  3RNT A;  2F5W A;  1LNI A;  1B20 A;  1UCI A;  2F4Y A;  1TTO A;  5BU4 A;  1RMS A;  3D5G A;  1RGF A;  1I8V A;  1RCK A;  1A2P A;  1BSB A;  5HOH A;  1BRG A;  3BIR A;  1BNE A;  3WHO A;  1BAO A;  1BNF A;  4RNT A;  1BSC A;  1HZ1 A;  1UCK A;  1Q9E A;  4J5G A;  3URP A;  1BRN L;  3DGY A;  1JBR A;  1YVS A;  1UCJ A;  3WR2 A;  2KF3 A;  5BIR A;  1I2F A;  9RNT A;  7RNT A;  1GSP A;  2AAD A;  1G02 A;  1BNG A;  1DET A;  1BRJ A;  1GMP A;  2KF5 A;  6GSP A;  1RNB A;  1B2U A;  1JBS A;  4HOH A;  1B3S A;  1RGK A;  3HOH A;  2RBI A;  1BOX A;  1BRK A;  1RGC A;  1BNS A;  1BRS A;  1GMQ A;  3BU4 A;  1ZGX A;  1BNJ A;  2BIR A;  7GSP A;  4J5K A;  1BU4 A;  1FUT A;  1GOV A;  1B21 A;  3A5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...