1I3FA

Ribonuclease t1 v89s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGSITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i3fA00
1RN4A 1BNIA 1LOVA 1BNFA 1RGEA 3RNTA 3WR2A 2GSPA 7GSPA 1B2SA 2KF4A 2F4YA 1I3IA 1RTUA 1B20A 1B27A 4BIRA 1JBRA 1RNTA 3D4AA 1BSCA 1B2XA 6RNTA 1GMQA 4HAAA 1BRJA 1TRQA 2KF5A 3AHSA 1RGLA 2F56A 7RNTA 4J5KA 1R4YA 3AHWA 2BIRA 1LOYA 1BNSA 1FUTA 1X1YA 1RNBA 1RLSA 5BIRA 3KCHA 3AGNA 1BSEA 1I2GA 1MGRA 1UCKA 3HOHA 4RNTA 1FYSA 1RMSA 1PYLA 1RDSA 1RGCA 1BUJA 1A2PA 1JBTA 1BRGA 3A5EA 1BRIA 1AQZA 1FZUA 1RSNA 1UCLA 1BOXA 4J5GA 5BU4A 1FUSA 1GSPA 1I2EA 1B2UA 1ZGXA 1BU4A 2AADA 2KF6A 3D5IA 1BVIA 1RGKA 1RCLA 5GSPA 6GSPA 2SARA 1HYFA 1LNIA 1RGFA 2BU4A 8RNTA 2AAEA 2RBIA 1BRNL 1UCJA 1GMPA 3SYUA 1BNRA 1RN1A 1X1WA 1LOWA 1I8VA 1UCIA 9RNTA 1JBSA 1T2IA 1BIRA 3URPA 1TTOA 1B2MA 1BNJA 1PY3A 1RCKA 1BNEA 1RHLA 1B21A 1DETA 1BRKA 3AGOA 1I0VA 2RNTA 2KF3A 1SARA 1DE3A 3DH2A 3DGYA 3BU4A 1B2ZA 3D5GA 1LRAA 1BSBA 1BRSA 1G02A 5HOHA 3Q3FA 1TRPA 1FW7A 3WHOA 1BSDA 1MGWA 1GOUA 4GSPA 1BSAA 1RGHA 5RNTA 1BRHA 1YVSA 1IYYA 3BIRA 2ZA4A 1YNVX 1Q9EA 1X1XA 1I2FA 1B3SA 1BAOA 2F5MA 1GOYA 1X1UA 2KAAA 1HZ1A 1RGAA 1I70A 3GSPA 4BU4A 1BGSA 1BNGA 1I3FA 1C54A 1GMRA 1GOVA 1T2HA 2F5WA 1CH0A 1YGWA 4GHOA 4HOHA 1I0XA 1RGGA 2HOHA 1AY7A 1BANA 2C4BA
chains in the Genus database with same CATH superfamily
1UUVB 1VQP3 5LC6A 3DGOA 2HMLB 2P09A 3CC23 4HJLB 5IF6A 3ER7A 2KF4A 1AVKA 3G16A 1RTUA 1VQ43 1B27A 4XBTA 4XDWA 1YIJ3 1G0TA 4ZM8A 4WHAA 4HZBB 3JUPA 6RNTA 2F56A 4O3VA 4WYKB 5AYRB 3SLUA 2CG1A 1VQ53 1VQ93 2YFLB 1IT8A 2L1SA 2R4IA 3X42A 5AYSC 3K0ZA 3OWYA 1W6CA 1LVNA 3CNXA 4I5QA 5BIRA 4X2OA 3DZLA 3G713 2CFLA 1QALA 3FH1A 1MGRA 1OCVA 3X3XA 4RBNA 1L5GB 3FZWA 1ROVA 3PCSA 1GYBA 1K41A 3V98A 3ZG5A 5CF2A 1BRGA 3FSDA 5IW9A 4KFEA 1AQZA 2H0HA 1YJW3 3FG1A 1RSNA 5BU4A 1NB3I 3DXOA 1I2EA 3FKAA 1B2UA 1OH0A 3M8CA 3GRDA 1AV4A 3X3ZA 3I553 3D5IA 2XFSA 5AIHA 2RGQA 5AEWB 3JUMA 2IUJA 1T3BA 2RSXA 4LMIA 1RCLA 1KD14 1FGMA 4K1UA 2C11A 2SARA 3FG3A 1W7CA 1LNIA 2CKFB 3CPOA 1LOXA 4AEQA 2BU4A 3AMOB 2AAEA 3HK4A 3LZAA 3F40A 5G1LA 1W2B2 1BRNL 3BLZA 2P05A 5FGOA 3F7XA 2P0XA 2XRXB 1N8R4 5IG3A 2HMJB 9RNTA 4N6OB 2CWVA 1Y4KA 2CFKA 1KQS2 1Q40B 4IPBA 3CCS3 3OWUA 3LH4A 3V92A 2D42A 3NM7A 1OACA 1GY5A 5AIIA 1MWTA 3EE1A 4EYCA 1DETA 2O9UX 4K1VA 4NHFA 2F99A 2UGIA 3CPW2 1I0VA 3GZYB 3WODG 3G6E3 2HMNB 4GL6A 1B2ZA 3D5GA 2OTL3 2GXFA 5AI1A 1SIIA 1IK3A 4LYLB 1IQYA 1BRSA 3H3HA 1G02A 4N6NB 1YJ93 1GD3A 1K734 1MWSA 1N9EA 1OUNA 2W0QA 1ULJB 1BRHA 1YVSA 2HMKB 3VGNA 3NBJA 1SQWA 1V57A 3BNCA 3CU3A 2W56A 4L8OA 4R9KA 5M19A 4O8SA 1WMOA 5AIFA 1VQ63 1X1XA 3B4OA 1G96A 3JUNA 1X1UA 4OK0A 1HZ1A 3TDGA 3CMA3 1VQO3 1DMNA 3GSPA 1YI23 2JDIH 4L7KA 1BGSA 4KFDA 3FGYA 1LXEA 4TX4A 1O7WB 1K9M4 3SVAA 1C54A 1PFPA 1T2HA 1GMRA 3CME3 1STDA 4HOHA 1I0XA 3GWRA 1T5YA 2W03A 1RGGA 2HOHA 1V74A 3NQZA 2C4BA 1RN4A 1D6UA 4LGQA 1BNFA 3NHXA 3KN4A 4Q53A 2UUGC 1FGTA 3WR2A 3LMLA 2XGLA 1MNLA 7GSPA 1B2SA 2XR8B 2F4YA 4HVNA 5DRVA 3U97A 2QEX3 1VZZA 4BIRA 3F8XA 1VQ73 1JBRA 1RNTA 1TFOA 1FGRA 1BSCA 1B2XA 2H0GA 4MMYB 2KF5A 1W6GA 3AHSA 4OUQA 7RNTA 4J5KA 1R4YA 1IVVA 2BIRA 1LOYA 4XB5A 4HM5B 1FUTA 2STDA 1EA2A 2XSOB 3UL6A 1UW1A 2IA7A 1X1YA 1RNBA 3KE7A 2WOFA 3BNDA 1Q864 2XFTA 3B7CA 4XBXA 1M904 3AGNA 2C10A 2V1LA 1CEWI 3S27A 1EQKA 3WDGB 2OQEA 1UCKA 2BT3A 3HOHA 4RNTA 1W4NA 3WMDA 1PYLA 3UNLA 1TP6A 2Y74A 3IMAB 3I563 1NJI4 3EN8A 4HM7B 3A5EA 4J9AA 2WGOA 1J2BA 1FZUA 1BOXA 1FUSA 2CFWA 2KXGA 2O3OA 1HKXA 1M9GA 1BU4A 2AADA 2OWPA 4IT7A 2R41A 1WMPA 2OOVA 1VQQA 1RGKA 6GSPA 3OWSA 3OX9A 4FCMA 1NU3A 3NV0B 3EHCA 3IJEB 2OTJ3 2D1WA 3LOYA 2INXA 1N9JA 8RNTA 4WFOA 2BMQB 1UCJA 4HM4B 5CXOA 1GMPA 1FUWA 5D81A 1S5AA 4G1MB 1BNRA 1SIHA 2XGNA 4HYZA 2P0MA 4N6UA 1FGOA 4MMZB 3CCU3 3MYTA 3BNEA 3KKGA 2W9QA 1JZOA 4BTXA 4FR9A 2BMRB 3LT9A 3URPA 5EVHA 4BL3A 1Q814 1TTOA 3FG4A 1IU7A 1PY3A 1EKMA 1W5ZA 1VQM3 2CX1A 1HU9A 3K7CA 1U5OA 3NBBA 1YIT3 3AGOA 5KP1A 1TUHA 1DE3A 1AR0A 3DGYA 3BU4A 2CK3H 3DH2A 3Q90A 4BTWA 2CIUA 3GZBA 4PEJA 2IMJA 3HZPA 1JJ22 2B24B 1BSBA 2CFDA 4RZMA 1VQ83 1IT7A 1W2ZA 2B1XB 3OW22 1A2VA 3VSYA 1NB5I 1DMQA 3Q3FA 4ORLA 2QA43 1OGZA 1MGWA 1GY6A 1OF5A 2FGTA 2WO0A 3DUKA 3LTDA 4FCJA 4R80A 5IEOA 1RJOA 3SEDA 2KRTA 2XSHB 1IYYA 3BIRA 3Q1CA 1VQK3 2Z76A 1M1K4 5BXQA 1UGHI 2YX9A 4R4KA 3T0UA 3PXMA 3HIIA 4KZ1A 3S28A 3X40A 3CCR3 1BAOA 3KSED 4CDLA 1TFKA 2IY2A 2CWTA 1C7HA 1UUGB 1I70A 1W02A 2FXTA 4NREA 3CC43 2HMOB 3MWZA 1US1A 5IERA 1WMNA 4XM4A 3RGRA 1TU5A 3E99A 1JN5A 4HM8B 1JKGA 1TJDA 2GEXA 1A2KA 1CH0A 5G1KA 5LC7A 1VQN3 2SBLA 3MG3A 1AY7A 3CCM3 3T8UA 1QVF2 3JUOA 1DVCA 3J7Yd 2BHMA 1SPUA 2CH9A 4ILFA 3RNTA 3S67A 4CPKA 3F14A 5ELUA 1WNHA 1I3IA 8CHOA 3ROBA 1KWIA 2QIYA 1Z1SA 2E2TA 4K61A 3D4AA 3WA3A 5CF1A 1MWUA 4IIAA 1GMQA 2Q07A 3JVCA 1BRJA 3G0KA 1RGLA 2BO9B 2Y73A 3ZFZA 3KZTA 1W6YA 3AHWA 1E97A 4O02B 1BNSA 1IV9A 5KP3A 1S723 5M1AA 3PYJA 4K90B 1N8QA 4KVHA 3N54B 1W00A 1O7GB 4LSOA 1E3RA 3KCHA 1YJN3 3L0RA 4HM6B 3CCV3 1M1XB 2GEYA 1E3VA 1RMSA 3S5CA 2ZDJA 3PZWA 3FLJA 4J8TA 1BRIA 1UCLA 3CNMA 1IQ8A 4HM2B 4OVMA 4R1KA 3I0YA 5CK6A 1ZGXA 4FMAA 2CWUA 2F86B 2KF6A 3DGNA 3D79A 3HIGA 1JB4A 4H61A 1DYUA 3K9MC 3EJVA 3SXXA 1DVDA 5JPPA 1ROAA 1OF5B 2A15A 3S29A 3N9HA 1CYVA 1GD4A 1O7NB 1A67A 3JUQA 2I9WA 1DMMA 3QRDA 4L8PA 3KIIA 3PS8A 3DMCA 3KFQC 2GBXB 3DGLA 2CHCA 2WGQA 3RGAA 1RN1A 1NWWA 1I8VA 4AKZA 4EW5A 3AMOA 3H51A 1D6ZA 1RKYA 7STDA 2OOVC 1ZS7A 5EEOA 3O8YA 5A0OB 4QWTA 1BIRA 3D9RA 2CG0A 2IYJA 5G2GA 1B2MA 1BNJA 3EQQB 4LZIA 3X41A 3K5TA 1BNEA 1RHLA 5ELJA 1B21A 2IUKA 1Q40A 1UUWB 3EBTA 4BL2A 2ML6A 3CCQ3 4AKYA 1WQLB 2KF3A 3LYGA 1NDOB 1RN7A 1IVUA 2BMOB 1GS3A 1ZO2A 1W01A 1YGEA 2H0IA 3EF8A 3HI7A 1LRAA 5EQLA 4EC6A 3WOEB 1LNHA 2ZHXB 4N6TA 3CCE3 1CQSA 3F8HA 3F9SA 1FW7A 2W56B 1BSDA 2K3DA 3OV4A 1QVG2 1BUQA 1GOUA 4GSPA 1BSAA 1RGHA 2CFGA 4EV2A 4O2HA 5RNTA 1Q42A 1ASKA 4FCZA 2XF3A 2ZA4A 5FW5A 2CX0A 5DREA 1YNVX 4EV5A 5IENA 3MHEA 3NUVA 3CC73 3CD63 1VQL3 1Q9EA 2WOHA 3NBRA 1I2FA 1B3SA 2W9PA 4N3VA 1GOYA 2LYXA 2KAAA 1QMAA 1RGAA 3EX9A 4CJNA 1OHSA 2ML5A 2LQVA 3Q2PA 3LTBA 5BVBA 1YHQ3 3CXC2 1Q7HA 4N6MA 1V58A 4RNZA 1O7MB 3UJMA 2YFJB 2F5WA 1O7PB 4XBYA 1LQMB 1YGWA 3B4PA 1NO3A 1O7HB 3PGBA 4GHOA 4KFFA 4STDA 3RDEA 2JQ5A 3T8NA 1BANA 1UI8A 3BB9A 3ECFA 1BNIA 3GZXB 1LOVA 5I97A 1OPYA 1RRLA 3ALAA 6STDA 4MJDA 1RGEA 1WTHA 3NM2A 3UB1A 1QAKA 2GSPA 4HKVB 3K63A 2E2VA 1PU4A 1B20A 2J8XB 4MEIA 3N8BA 3NXJA 2FNQA 2L4VA 1TRQA 3A76A 4HAAA 1KC84 3FF2A 3D3LA 1ZX2A 3VF1A 1JV2B 3WOFB 1IVWA 3MSOA 3MKIA 1GY7A 1STFI 2RCDA 4XDVA 4MMXB 3QK9A 1IV7A 2KCDA 2XEPA 1RLSA 4I4KA 3SX1A 1MOLA 1Q7Y4 1IQXA 1JB5A 3PCRA 4NPBA 5M18A 1JRQA 4LEHA 1BSEA 1I2GA 3EC9A 3EBYA 3SOAA 2GBWB 2P38A 4CCVA 4X2HA 1FA3A 1FYSA 4U13A 3V99A 1RDSA 1RGCA 1YVBI 2E2UA 1A2PA 3LXUX 1BUJA 3DM8A 1JBTA 1OHPA 1ISKA 1TIJA 4FMCA 3U1WA 3F7SA 1SJWA 1FGQA 2M7OA 2MF7A 2XH9A 3WA2X 2PNCA 1Q824 1QAFA 4J5GA 4JRFA 3FCSB 1GSPA 1OGXA 5AEUB 2W04A 4RNYA 4HM1B 2W2CA 1JZDA 1BVIA 4HBRA 2CC3A 4WWUC 4EXRA 5CLKA 2MC8A 5GSPA 5D82A 1UDII 5IEPA 2UX0A 1EG9B 1U8CB 1HYFA 1LQGC 5HGRA 3NX0A 5STDA 1RGFA 3GAXA 3MPHA 3BNBA 2RBIA 3GZRA 3ZG0A 4WYKA 5IG4A 5AIGA 3NV0A 1EEJA 1UGIA 4N6LA 5TGNA 3SOYA 3SYUA 4R9LA 2ZL8A 5JBSA 5KP4A 2F98A 1X1WA 1LOWA 1UCIA 1AVLA 4KT3B 3DGMA 1JB2A 2GU3A 1K28A 1JBSA 1T2IA 2RFRA 2K0MA 4FMBA 1CYUA 4BTYA 1RCKA 2QGUA 2Z6BA 5IG0A 3MG1A 3FF0A 1EUIC 1IDPA 2Z7AA 1BRKA 2BNGA 3IPTA 2RNTA 2OCTA 1SARA 3KSPA 5JPUA 1QJGA 2OQEC 1KSIA 3MG2A 4DKIA 1K8A4 5IG5A 1OHOA 3STDA 1ULIB 1UI7A 2YFIB 1D6YA 5HOHA 1TRPA 1IVXA 1F8NA 3WHOA 5D83A 1RRHA 3B8LA 4FMDA 3EN1B 4H3UA 1NNVA 1A90A 3LTAA 3G8ZA 2HMMB 3LTCA 3CCL3 1MWRA 3CCJ3 1N5HA 3NQYA 4HM0B 2GU1A 3DY5A 4GB5A 4N6V0 3UL5A 4EBGA 2F5MA 4HM3B 4HZ9B 2PZVA 1JN5B 1R4CA 4JF8A 1JKGB 2W6JH 4WP5A 4BU4A 1BNGA 3G4S3 2Z77A 3OXAA 3X3YA 1I3FA 1GOVA 1JNQA 2CW9A 1N5PA 3EB8A 3HX8A 3LT8A 2K54A
chains in the Genus database with same CATH topology
1RN4A 1BNIA 1LOVA 1BNFA 1RGEA 3RNTA 3WR2A 2GSPA 7GSPA 1B2SA 2KF4A 2F4YA 1I3IA 1RTUA 1B20A 1B27A 4BIRA 1JBRA 1RNTA 3D4AA 1BSCA 1B2XA 6RNTA 1GMQA 4HAAA 1BRJA 1TRQA 2KF5A 3AHSA 1RGLA 2F56A 7RNTA 4J5KA 1R4YA 3AHWA 2BIRA 1LOYA 1BNSA 1FUTA 1X1YA 1RNBA 1RLSA 5BIRA 3KCHA 3AGNA 1BSEA 1I2GA 1MGRA 1UCKA 3HOHA 4RNTA 1FYSA 1RMSA 1PYLA 1RDSA 1RGCA 1BUJA 1A2PA 1JBTA 1BRGA 3A5EA 1BRIA 1AQZA 1FZUA 1RSNA 1UCLA 1BOXA 4J5GA 5BU4A 1FUSA 1GSPA 1I2EA 1B2UA 1ZGXA 1BU4A 2AADA 2KF6A 3D5IA 1BVIA 1RGKA 1RCLA 5GSPA 6GSPA 2SARA 1HYFA 1LNIA 1RGFA 2BU4A 8RNTA 2AAEA 2RBIA 1BRNL 1UCJA 1GMPA 3SYUA 1BNRA 1RN1A 1X1WA 1LOWA 1I8VA 1UCIA 9RNTA 1JBSA 1T2IA 1BIRA 3URPA 1TTOA 1B2MA 1BNJA 1PY3A 1RCKA 1BNEA 1RHLA 1B21A 1DETA 1BRKA 3AGOA 1I0VA 2RNTA 2KF3A 1SARA 1DE3A 3DH2A 3DGYA 3BU4A 1B2ZA 3D5GA 1LRAA 1BSBA 1BRSA 1G02A 5HOHA 3Q3FA 1TRPA 1FW7A 3WHOA 1BSDA 1MGWA 1GOUA 4GSPA 1BSAA 1RGHA 5RNTA 1BRHA 1YVSA 1IYYA 3BIRA 2ZA4A 1YNVX 1Q9EA 1X1XA 1I2FA 1B3SA 1BAOA 2F5MA 1GOYA 1X1UA 2KAAA 1HZ1A 1RGAA 1I70A 3GSPA 4BU4A 1BGSA 1BNGA 1I3FA 1C54A 1GMRA 1GOVA 1T2HA 2F5WA 1CH0A 1YGWA 4GHOA 4HOHA 1I0XA 1RGGA 2HOHA 1AY7A 1BANA 2C4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RN4 A;  1BNI A;  1LOV A;  1BNF A;  1RGE A;  3RNT A;  3WR2 A;  2GSP A;  7GSP A;  1B2S A;  2KF4 A;  2F4Y A;  1I3I A;  1RTU A;  1B20 A;  1B27 A;  4BIR A;  1JBR A;  1RNT A;  3D4A A;  1BSC A;  1B2X A;  6RNT A;  1GMQ A;  4HAA A;  1BRJ A;  1TRQ A;  2KF5 A;  3AHS A;  1RGL A;  2F56 A;  7RNT A;  4J5K A;  1R4Y A;  3AHW A;  2BIR A;  1LOY A;  1BNS A;  1FUT A;  1X1Y A;  1RNB A;  1RLS A;  5BIR A;  3KCH A;  3AGN A;  1BSE A;  1I2G A;  1MGR A;  1UCK A;  3HOH A;  4RNT A;  1FYS A;  1RMS A;  1PYL A;  1RDS A;  1RGC A;  1BUJ A;  1A2P A;  1JBT A;  1BRG A;  3A5E A;  1BRI A;  1AQZ A;  1FZU A;  1RSN A;  1UCL A;  1BOX A;  4J5G A;  5BU4 A;  1FUS A;  1GSP A;  1I2E A;  1B2U A;  1ZGX A;  1BU4 A;  2AAD A;  2KF6 A;  3D5I A;  1BVI A;  1RGK A;  1RCL A;  5GSP A;  6GSP A;  2SAR A;  1HYF A;  1LNI A;  1RGF A;  2BU4 A;  8RNT A;  2AAE A;  2RBI A;  1BRN L;  1UCJ A;  1GMP A;  3SYU A;  1BNR A;  1RN1 A;  1X1W A;  1LOW A;  1I8V A;  1UCI A;  9RNT A;  1JBS A;  1T2I A;  1BIR A;  3URP A;  1TTO A;  1B2M A;  1BNJ A;  1PY3 A;  1RCK A;  1BNE A;  1RHL A;  1B21 A;  1DET A;  1BRK A;  3AGO A;  1I0V A;  2RNT A;  2KF3 A;  1SAR A;  1DE3 A;  3DH2 A;  3DGY A;  3BU4 A;  1B2Z A;  3D5G A;  1LRA A;  1BSB A;  1BRS A;  1G02 A;  5HOH A;  3Q3F A;  1TRP A;  1FW7 A;  3WHO A;  1BSD A;  1MGW A;  1GOU A;  4GSP A;  1BSA A;  1RGH A;  5RNT A;  1BRH A;  1YVS A;  1IYY A;  3BIR A;  2ZA4 A;  1YNV X;  1Q9E A;  1X1X A;  1I2F A;  1B3S A;  1BAO A;  2F5M A;  1GOY A;  1X1U A;  2KAA A;  1HZ1 A;  1RGA A;  1I70 A;  3GSP A;  4BU4 A;  1BGS A;  1BNG A;  1I3F A;  1C54 A;  1GMR A;  1GOV A;  1T2H A;  2F5W A;  1CH0 A;  1YGW A;  4GHO A;  4HOH A;  1I0X A;  1RGG A;  2HOH A;  1AY7 A;  1BAN A;  2C4B A; 
#chains in the Genus database with same CATH topology
 1UUV B;  1VQP 3;  5LC6 A;  3DGO A;  2HML B;  2P09 A;  3CC2 3;  4HJL B;  5IF6 A;  3ER7 A;  2KF4 A;  1AVK A;  3G16 A;  1RTU A;  1VQ4 3;  1B27 A;  4XBT A;  4XDW A;  1YIJ 3;  1G0T A;  4ZM8 A;  4WHA A;  4HZB B;  3JUP A;  6RNT A;  2F56 A;  4O3V A;  4WYK B;  5AYR B;  3SLU A;  2CG1 A;  1VQ5 3;  1VQ9 3;  2YFL B;  1IT8 A;  2L1S A;  2R4I A;  3X42 A;  5AYS C;  3K0Z A;  3OWY A;  1W6C A;  1LVN A;  3CNX A;  4I5Q A;  5BIR A;  4X2O A;  3DZL A;  3G71 3;  2CFL A;  1QAL A;  3FH1 A;  1MGR A;  1OCV A;  3X3X A;  4RBN A;  1L5G B;  3FZW A;  1ROV A;  3PCS A;  1GYB A;  1K41 A;  3V98 A;  3ZG5 A;  5CF2 A;  1BRG A;  3FSD A;  5IW9 A;  4KFE A;  1AQZ A;  2H0H A;  1YJW 3;  3FG1 A;  1RSN A;  5BU4 A;  1NB3 I;  3DXO A;  1I2E A;  3FKA A;  1B2U A;  1OH0 A;  3M8C A;  3GRD A;  1AV4 A;  3X3Z A;  3I55 3;  3D5I A;  2XFS A;  5AIH A;  2RGQ A;  5AEW B;  3JUM A;  2IUJ A;  1T3B A;  2RSX A;  4LMI A;  1RCL A;  1KD1 4;  1FGM A;  4K1U A;  2C11 A;  2SAR A;  3FG3 A;  1W7C A;  1LNI A;  2CKF B;  3CPO A;  1LOX A;  4AEQ A;  2BU4 A;  3AMO B;  2AAE A;  3HK4 A;  3LZA A;  3F40 A;  5G1L A;  1W2B 2;  1BRN L;  3BLZ A;  2P05 A;  5FGO A;  3F7X A;  2P0X A;  2XRX B;  1N8R 4;  5IG3 A;  2HMJ B;  9RNT A;  4N6O B;  2CWV A;  1Y4K A;  2CFK A;  1KQS 2;  1Q40 B;  4IPB A;  3CCS 3;  3OWU A;  3LH4 A;  3V92 A;  2D42 A;  3NM7 A;  1OAC A;  1GY5 A;  5AII A;  1MWT A;  3EE1 A;  4EYC A;  1DET A;  2O9U X;  4K1V A;  4NHF A;  2F99 A;  2UGI A;  3CPW 2;  1I0V A;  3GZY B;  3WOD G;  3G6E 3;  2HMN B;  4GL6 A;  1B2Z A;  3D5G A;  2OTL 3;  2GXF A;  5AI1 A;  1SII A;  1IK3 A;  4LYL B;  1IQY A;  1BRS A;  3H3H A;  1G02 A;  4N6N B;  1YJ9 3;  1GD3 A;  1K73 4;  1MWS A;  1N9E A;  1OUN A;  2W0Q A;  1ULJ B;  1BRH A;  1YVS A;  2HMK B;  3VGN A;  3NBJ A;  1SQW A;  1V57 A;  3BNC A;  3CU3 A;  2W56 A;  4L8O A;  4R9K A;  5M19 A;  4O8S A;  1WMO A;  5AIF A;  1VQ6 3;  1X1X A;  3B4O A;  1G96 A;  3JUN A;  1X1U A;  4OK0 A;  1HZ1 A;  3TDG A;  3CMA 3;  1VQO 3;  1DMN A;  3GSP A;  1YI2 3;  2JDI H;  4L7K A;  1BGS A;  4KFD A;  3FGY A;  1LXE A;  4TX4 A;  1O7W B;  1K9M 4;  3SVA A;  1C54 A;  1PFP A;  1T2H A;  1GMR A;  3CME 3;  1STD A;  4HOH A;  1I0X A;  3GWR A;  1T5Y A;  2W03 A;  1RGG A;  2HOH A;  1V74 A;  3NQZ A;  2C4B A;  1RN4 A;  1D6U A;  4LGQ A;  1BNF A;  3NHX A;  3KN4 A;  4Q53 A;  2UUG C;  1FGT A;  3WR2 A;  3LML A;  2XGL A;  1MNL A;  7GSP A;  1B2S A;  2XR8 B;  2F4Y A;  4HVN A;  5DRV A;  3U97 A;  2QEX 3;  1VZZ A;  4BIR A;  3F8X A;  1VQ7 3;  1JBR A;  1RNT A;  1TFO A;  1FGR A;  1BSC A;  1B2X A;  2H0G A;  4MMY B;  2KF5 A;  1W6G A;  3AHS A;  4OUQ A;  7RNT A;  4J5K A;  1R4Y A;  1IVV A;  2BIR A;  1LOY A;  4XB5 A;  4HM5 B;  1FUT A;  2STD A;  1EA2 A;  2XSO B;  3UL6 A;  1UW1 A;  2IA7 A;  1X1Y A;  1RNB A;  3KE7 A;  2WOF A;  3BND A;  1Q86 4;  2XFT A;  3B7C A;  4XBX A;  1M90 4;  3AGN A;  2C10 A;  2V1L A;  1CEW I;  3S27 A;  1EQK A;  3WDG B;  2OQE A;  1UCK A;  2BT3 A;  3HOH A;  4RNT A;  1W4N A;  3WMD A;  1PYL A;  3UNL A;  1TP6 A;  2Y74 A;  3IMA B;  3I56 3;  1NJI 4;  3EN8 A;  4HM7 B;  3A5E A;  4J9A A;  2WGO A;  1J2B A;  1FZU A;  1BOX A;  1FUS A;  2CFW A;  2KXG A;  2O3O A;  1HKX A;  1M9G A;  1BU4 A;  2AAD A;  2OWP A;  4IT7 A;  2R41 A;  1WMP A;  2OOV A;  1VQQ A;  1RGK A;  6GSP A;  3OWS A;  3OX9 A;  4FCM A;  1NU3 A;  3NV0 B;  3EHC A;  3IJE B;  2OTJ 3;  2D1W A;  3LOY A;  2INX A;  1N9J A;  8RNT A;  4WFO A;  2BMQ B;  1UCJ A;  4HM4 B;  5CXO A;  1GMP A;  1FUW A;  5D81 A;  1S5A A;  4G1M B;  1BNR A;  1SIH A;  2XGN A;  4HYZ A;  2P0M A;  4N6U A;  1FGO A;  4MMZ B;  3CCU 3;  3MYT A;  3BNE A;  3KKG A;  2W9Q A;  1JZO A;  4BTX A;  4FR9 A;  2BMR B;  3LT9 A;  3URP A;  5EVH A;  4BL3 A;  1Q81 4;  1TTO A;  3FG4 A;  1IU7 A;  1PY3 A;  1EKM A;  1W5Z A;  1VQM 3;  2CX1 A;  1HU9 A;  3K7C A;  1U5O A;  3NBB A;  1YIT 3;  3AGO A;  5KP1 A;  1TUH A;  1DE3 A;  1AR0 A;  3DGY A;  3BU4 A;  2CK3 H;  3DH2 A;  3Q90 A;  4BTW A;  2CIU A;  3GZB A;  4PEJ A;  2IMJ A;  3HZP A;  1JJ2 2;  2B24 B;  1BSB A;  2CFD A;  4RZM A;  1VQ8 3;  1IT7 A;  1W2Z A;  2B1X B;  3OW2 2;  1A2V A;  3VSY A;  1NB5 I;  1DMQ A;  3Q3F A;  4ORL A;  2QA4 3;  1OGZ A;  1MGW A;  1GY6 A;  1OF5 A;  2FGT A;  2WO0 A;  3DUK A;  3LTD A;  4FCJ A;  4R80 A;  5IEO A;  1RJO A;  3SED A;  2KRT A;  2XSH B;  1IYY A;  3BIR A;  3Q1C A;  1VQK 3;  2Z76 A;  1M1K 4;  5BXQ A;  1UGH I;  2YX9 A;  4R4K A;  3T0U A;  3PXM A;  3HII A;  4KZ1 A;  3S28 A;  3X40 A;  3CCR 3;  1BAO A;  3KSE D;  4CDL A;  1TFK A;  2IY2 A;  2CWT A;  1C7H A;  1UUG B;  1I70 A;  1W02 A;  2FXT A;  4NRE A;  3CC4 3;  2HMO B;  3MWZ A;  1US1 A;  5IER A;  1WMN A;  4XM4 A;  3RGR A;  1TU5 A;  3E99 A;  1JN5 A;  4HM8 B;  1JKG A;  1TJD A;  2GEX A;  1A2K A;  1CH0 A;  5G1K A;  5LC7 A;  1VQN 3;  2SBL A;  3MG3 A;  1AY7 A;  3CCM 3;  3T8U A;  1QVF 2;  3JUO A;  1DVC A;  3J7Y d;  2BHM A;  1SPU A;  2CH9 A;  4ILF A;  3RNT A;  3S67 A;  4CPK A;  3F14 A;  5ELU A;  1WNH A;  1I3I A;  8CHO A;  3ROB A;  1KWI A;  2QIY A;  1Z1S A;  2E2T A;  4K61 A;  3D4A A;  3WA3 A;  5CF1 A;  1MWU A;  4IIA A;  1GMQ A;  2Q07 A;  3JVC A;  1BRJ A;  3G0K A;  1RGL A;  2BO9 B;  2Y73 A;  3ZFZ A;  3KZT A;  1W6Y A;  3AHW A;  1E97 A;  4O02 B;  1BNS A;  1IV9 A;  5KP3 A;  1S72 3;  5M1A A;  3PYJ A;  4K90 B;  1N8Q A;  4KVH A;  3N54 B;  1W00 A;  1O7G B;  4LSO A;  1E3R A;  3KCH A;  1YJN 3;  3L0R A;  4HM6 B;  3CCV 3;  1M1X B;  2GEY A;  1E3V A;  1RMS A;  3S5C A;  2ZDJ A;  3PZW A;  3FLJ A;  4J8T A;  1BRI A;  1UCL A;  3CNM A;  1IQ8 A;  4HM2 B;  4OVM A;  4R1K A;  3I0Y A;  5CK6 A;  1ZGX A;  4FMA A;  2CWU A;  2F86 B;  2KF6 A;  3DGN A;  3D79 A;  3HIG A;  1JB4 A;  4H61 A;  1DYU A;  3K9M C;  3EJV A;  3SXX A;  1DVD A;  5JPP A;  1ROA A;  1OF5 B;  2A15 A;  3S29 A;  3N9H A;  1CYV A;  1GD4 A;  1O7N B;  1A67 A;  3JUQ A;  2I9W A;  1DMM A;  3QRD A;  4L8P A;  3KII A;  3PS8 A;  3DMC A;  3KFQ C;  2GBX B;  3DGL A;  2CHC A;  2WGQ A;  3RGA A;  1RN1 A;  1NWW A;  1I8V A;  4AKZ A;  4EW5 A;  3AMO A;  3H51 A;  1D6Z A;  1RKY A;  7STD A;  2OOV C;  1ZS7 A;  5EEO A;  3O8Y A;  5A0O B;  4QWT A;  1BIR A;  3D9R A;  2CG0 A;  2IYJ A;  5G2G A;  1B2M A;  1BNJ A;  3EQQ B;  4LZI A;  3X41 A;  3K5T A;  1BNE A;  1RHL A;  5ELJ A;  1B21 A;  2IUK A;  1Q40 A;  1UUW B;  3EBT A;  4BL2 A;  2ML6 A;  3CCQ 3;  4AKY A;  1WQL B;  2KF3 A;  3LYG A;  1NDO B;  1RN7 A;  1IVU A;  2BMO B;  1GS3 A;  1ZO2 A;  1W01 A;  1YGE A;  2H0I A;  3EF8 A;  3HI7 A;  1LRA A;  5EQL A;  4EC6 A;  3WOE B;  1LNH A;  2ZHX B;  4N6T A;  3CCE 3;  1CQS A;  3F8H A;  3F9S A;  1FW7 A;  2W56 B;  1BSD A;  2K3D A;  3OV4 A;  1QVG 2;  1BUQ A;  1GOU A;  4GSP A;  1BSA A;  1RGH A;  2CFG A;  4EV2 A;  4O2H A;  5RNT A;  1Q42 A;  1ASK A;  4FCZ A;  2XF3 A;  2ZA4 A;  5FW5 A;  2CX0 A;  5DRE A;  1YNV X;  4EV5 A;  5IEN A;  3MHE A;  3NUV A;  3CC7 3;  3CD6 3;  1VQL 3;  1Q9E A;  2WOH A;  3NBR A;  1I2F A;  1B3S A;  2W9P A;  4N3V A;  1GOY A;  2LYX A;  2KAA A;  1QMA A;  1RGA A;  3EX9 A;  4CJN A;  1OHS A;  2ML5 A;  2LQV A;  3Q2P A;  3LTB A;  5BVB A;  1YHQ 3;  3CXC 2;  1Q7H A;  4N6M A;  1V58 A;  4RNZ A;  1O7M B;  3UJM A;  2YFJ B;  2F5W A;  1O7P B;  4XBY A;  1LQM B;  1YGW A;  3B4P A;  1NO3 A;  1O7H B;  3PGB A;  4GHO A;  4KFF A;  4STD A;  3RDE A;  2JQ5 A;  3T8N A;  1BAN A;  1UI8 A;  3BB9 A;  3ECF A;  1BNI A;  3GZX B;  1LOV A;  5I97 A;  1OPY A;  1RRL A;  3ALA A;  6STD A;  4MJD A;  1RGE A;  1WTH A;  3NM2 A;  3UB1 A;  1QAK A;  2GSP A;  4HKV B;  3K63 A;  2E2V A;  1PU4 A;  1B20 A;  2J8X B;  4MEI A;  3N8B A;  3NXJ A;  2FNQ A;  2L4V A;  1TRQ A;  3A76 A;  4HAA A;  1KC8 4;  3FF2 A;  3D3L A;  1ZX2 A;  3VF1 A;  1JV2 B;  3WOF B;  1IVW A;  3MSO A;  3MKI A;  1GY7 A;  1STF I;  2RCD A;  4XDV A;  4MMX B;  3QK9 A;  1IV7 A;  2KCD A;  2XEP A;  1RLS A;  4I4K A;  3SX1 A;  1MOL A;  1Q7Y 4;  1IQX A;  1JB5 A;  3PCR A;  4NPB A;  5M18 A;  1JRQ A;  4LEH A;  1BSE A;  1I2G A;  3EC9 A;  3EBY A;  3SOA A;  2GBW B;  2P38 A;  4CCV A;  4X2H A;  1FA3 A;  1FYS A;  4U13 A;  3V99 A;  1RDS A;  1RGC A;  1YVB I;  2E2U A;  1A2P A;  3LXU X;  1BUJ A;  3DM8 A;  1JBT A;  1OHP A;  1ISK A;  1TIJ A;  4FMC A;  3U1W A;  3F7S A;  1SJW A;  1FGQ A;  2M7O A;  2MF7 A;  2XH9 A;  3WA2 X;  2PNC A;  1Q82 4;  1QAF A;  4J5G A;  4JRF A;  3FCS B;  1GSP A;  1OGX A;  5AEU B;  2W04 A;  4RNY A;  4HM1 B;  2W2C A;  1JZD A;  1BVI A;  4HBR A;  2CC3 A;  4WWU C;  4EXR A;  5CLK A;  2MC8 A;  5GSP A;  5D82 A;  1UDI I;  5IEP A;  2UX0 A;  1EG9 B;  1U8C B;  1HYF A;  1LQG C;  5HGR A;  3NX0 A;  5STD A;  1RGF A;  3GAX A;  3MPH A;  3BNB A;  2RBI A;  3GZR A;  3ZG0 A;  4WYK A;  5IG4 A;  5AIG A;  3NV0 A;  1EEJ A;  1UGI A;  4N6L A;  5TGN A;  3SOY A;  3SYU A;  4R9L A;  2ZL8 A;  5JBS A;  5KP4 A;  2F98 A;  1X1W A;  1LOW A;  1UCI A;  1AVL A;  4KT3 B;  3DGM A;  1JB2 A;  2GU3 A;  1K28 A;  1JBS A;  1T2I A;  2RFR A;  2K0M A;  4FMB A;  1CYU A;  4BTY A;  1RCK A;  2QGU A;  2Z6B A;  5IG0 A;  3MG1 A;  3FF0 A;  1EUI C;  1IDP A;  2Z7A A;  1BRK A;  2BNG A;  3IPT A;  2RNT A;  2OCT A;  1SAR A;  3KSP A;  5JPU A;  1QJG A;  2OQE C;  1KSI A;  3MG2 A;  4DKI A;  1K8A 4;  5IG5 A;  1OHO A;  3STD A;  1ULI B;  1UI7 A;  2YFI B;  1D6Y A;  5HOH A;  1TRP A;  1IVX A;  1F8N A;  3WHO A;  5D83 A;  1RRH A;  3B8L A;  4FMD A;  3EN1 B;  4H3U A;  1NNV A;  1A90 A;  3LTA A;  3G8Z A;  2HMM B;  3LTC A;  3CCL 3;  1MWR A;  3CCJ 3;  1N5H A;  3NQY A;  4HM0 B;  2GU1 A;  3DY5 A;  4GB5 A;  4N6V 0;  3UL5 A;  4EBG A;  2F5M A;  4HM3 B;  4HZ9 B;  2PZV A;  1JN5 B;  1R4C A;  4JF8 A;  1JKG B;  2W6J H;  4WP5 A;  4BU4 A;  1BNG A;  3G4S 3;  2Z77 A;  3OXA A;  3X3Y A;  1I3F A;  1GOV A;  1JNQ A;  2CW9 A;  1N5P A;  3EB8 A;  3HX8 A;  3LT8 A;  2K54 A; 
#chains in the Genus database with same CATH homology
 1RN4 A;  1BNI A;  1LOV A;  1BNF A;  1RGE A;  3RNT A;  3WR2 A;  2GSP A;  7GSP A;  1B2S A;  2KF4 A;  2F4Y A;  1I3I A;  1RTU A;  1B20 A;  1B27 A;  4BIR A;  1JBR A;  1RNT A;  3D4A A;  1BSC A;  1B2X A;  6RNT A;  1GMQ A;  4HAA A;  1BRJ A;  1TRQ A;  2KF5 A;  3AHS A;  1RGL A;  2F56 A;  7RNT A;  4J5K A;  1R4Y A;  3AHW A;  2BIR A;  1LOY A;  1BNS A;  1FUT A;  1X1Y A;  1RNB A;  1RLS A;  5BIR A;  3KCH A;  3AGN A;  1BSE A;  1I2G A;  1MGR A;  1UCK A;  3HOH A;  4RNT A;  1FYS A;  1RMS A;  1PYL A;  1RDS A;  1RGC A;  1BUJ A;  1A2P A;  1JBT A;  1BRG A;  3A5E A;  1BRI A;  1AQZ A;  1FZU A;  1RSN A;  1UCL A;  1BOX A;  4J5G A;  5BU4 A;  1FUS A;  1GSP A;  1I2E A;  1B2U A;  1ZGX A;  1BU4 A;  2AAD A;  2KF6 A;  3D5I A;  1BVI A;  1RGK A;  1RCL A;  5GSP A;  6GSP A;  2SAR A;  1HYF A;  1LNI A;  1RGF A;  2BU4 A;  8RNT A;  2AAE A;  2RBI A;  1BRN L;  1UCJ A;  1GMP A;  3SYU A;  1BNR A;  1RN1 A;  1X1W A;  1LOW A;  1I8V A;  1UCI A;  9RNT A;  1JBS A;  1T2I A;  1BIR A;  3URP A;  1TTO A;  1B2M A;  1BNJ A;  1PY3 A;  1RCK A;  1BNE A;  1RHL A;  1B21 A;  1DET A;  1BRK A;  3AGO A;  1I0V A;  2RNT A;  2KF3 A;  1SAR A;  1DE3 A;  3DH2 A;  3DGY A;  3BU4 A;  1B2Z A;  3D5G A;  1LRA A;  1BSB A;  1BRS A;  1G02 A;  5HOH A;  3Q3F A;  1TRP A;  1FW7 A;  3WHO A;  1BSD A;  1MGW A;  1GOU A;  4GSP A;  1BSA A;  1RGH A;  5RNT A;  1BRH A;  1YVS A;  1IYY A;  3BIR A;  2ZA4 A;  1YNV X;  1Q9E A;  1X1X A;  1I2F A;  1B3S A;  1BAO A;  2F5M A;  1GOY A;  1X1U A;  2KAA A;  1HZ1 A;  1RGA A;  1I70 A;  3GSP A;  4BU4 A;  1BGS A;  1BNG A;  1I3F A;  1C54 A;  1GMR A;  1GOV A;  1T2H A;  2F5W A;  1CH0 A;  1YGW A;  4GHO A;  4HOH A;  1I0X A;  1RGG A;  2HOH A;  1AY7 A;  1BAN A;  2C4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...