1I3FA

Ribonuclease t1 v89s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGSITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i3fA00
1BUJA 1BVIA 3D4AA 1BSCA 1BNIA 3KCHA 1G02A 2BIRA 1I0VA 1AY7A 1UCLA 1BRHA 1X1WA 1RCLA 2F5MA 1RGAA 1MGWA 1RGHA 1B27A 1BU4A 4J5GA 1BIRA 1GMQA 1BRSA 5BIRA 1RLSA 1X1XA 1B20A 4BIRA 1PY3A 1DE3A 8RNTA 2AAEA 1AQZA 1TRPA 1B2SA 3AGNA 4HAAA 1GSPA 4GHOA 1FUSA 1BNRA 1PYLA 2RBIA 1BNGA 2F56A 1I2GA 1BRJA 1RGEA 3GSPA 1BNSA 1I70A 1R4YA 7GSPA 1BRGA 1RTUA 1B3SA 1TRQA 1RGLA 7RNTA 2ZA4A 1DETA 1GOUA 4J5KA 1BSBA 2BU4A 1X1UA 1HYFA 3AGOA 1BNEA 1Q9EA 1UCKA 1X1YA 1MGRA 1FZUA 3SYUA 1HZ1A 1RN1A 3D5IA 1RGGA 1RNBA 1BRKA 1BNJA 3BIRA 1BNFA 1LOWA 2HOHA 5HOHA 1FW7A 2KF4A 1I3FA 1I2EA 1JBSA 1YNVX 1TTOA 1RCKA 4RNTA 1B21A 2KAAA 6GSPA 1GOYA 2F4YA 1LOVA 1UCIA 1LNIA 1LRAA 1UCJA 1FYSA 1I3IA 3A5EA 1BSDA 3WR2A 4HOHA 3URPA 1JBTA 1B2MA 1BRNL 1RNTA 1C54A 3D5GA 4BU4A 1BGSA 1RDSA 1YVSA 4GSPA 3AHWA 3AHSA 2KF6A 3Q3FA 1YGWA 9RNTA 2KF5A 1BSEA 1RGCA 2C4BA 3HOHA 1RMSA 3DGYA 1B2XA 1ZGXA 2KF3A 1CH0A 1I8VA 1A2PA 1GOVA 1B2ZA 3RNTA 3BU4A 1SARA 1RSNA 1T2HA 1GMPA 2F5WA 1T2IA 5RNTA 2AADA 2GSPA 3WHOA 1RGKA 1RHLA 2RNTA 1IYYA 1JBRA 1GMRA 1BSAA 1LOYA 6RNTA 1BAOA 3DH2A 1I0XA 1BOXA 1RGFA 1FUTA 1I2FA 2SARA 5GSPA 1B2UA 5BU4A 1BANA 1BRIA 1RN4A
chains in the Genus database with same CATH superfamily
1BUJA 1BVIA 3D4AA 4EW5A 5I97A 1BNIA 3KCHA 3SEDA 4WHAA 2GU1A 1VQP3 2F5MA 1AY7A 3JVCA 5IG0A 1NU3A 1RGHA 4O3VA 1JZOA 4K1VA 3ER7A 5EQLA 1YHQ3 3LTAA 5AIHA 2R41A 1GMQA 1SIHA 1SIIA 1MWTA 2H0HA 5BVBA 1B20A 3DY5A 1Q7HA 3DZLA 4HZ9B 4L7KA 4LZIA 4N6TA 3ZG0A 5CF1A 2Z76A 2QGUA 3HIIA 2BO9B 1QJGA 1DE3A 2AAEA 1VQL3 3WA2X 1AQZA 1YGEA 1TRPA 1B2SA 5IW9A 4HAAA 2W0QA 3CC43 3CCS3 2UX0A 4STDA 3CME3 3X3YA 4IIAA 3G8ZA 1J2BA 1MWRA 1SJWA 5JPUA 3SOYA 3X41A 2ZA4A 5ELJA 2INXA 1NWWA 2HMKB 2OCTA 3D79A 3LOYA 3FCSB 4J5KA 5IG4A 1HYFA 4R80A 1KWIA 3D9RA 1HU9A 3SOAA 5M18A 1IVWA 1OACA 1X1YA 2RGQA 1MGRA 1RN1A 3WOEB 2CIUA 5HGRA 1BNJA 3BIRA 1LOWA 2XR8B 2WOHA 2KF4A 1OF5A 1I3FA 1YNVX 1TTOA 2XGLA 1RCKA 4WYKA 1E97A 3GZYB 1B21A 2CKFB 3FLJA 4N6OB 1GOYA 4FMBA 5FW5A 5AEWB 2IYJA 1LNIA 1LRAA 3LTBA 2CG0A 4HM3B 4OK0A 2RSXA 3AMOA 1IQXA 3NV0A 4I4KA 1CEWI 2O9UX 2MC8A 3NBRA 4LSOA 2FXTA 2UUGC 1JBTA 2OOVC 1RNTA 3K7CA 3D5GA 3WA3A 4BU4A 1IU7A 1BGSA 1RDSA 4RZMA 3EC9A 4TX4A 4GSPA 3ZG5A 1OGXA 3CCV3 1K734 3FGYA 3HX8A 1IT7A 3SLUA 3Q3FA 9RNTA 3MHEA 3PCSA 4KVHA 1MOLA 4XB5A 1IVVA 3KIIA 3RGRA 1TJDA 3PZWA 5G1LA 2W2CA 2GBXB 1LQMB 3F7XA 5IG5A 1A2VA 3FF0A 1CH0A 1OHPA 3PS8A 3RGAA 3EQQB 4HBRA 4LGQA 2XFTA 2IUJA 2GBWB 2ZDJA 3JUPA 4X2HA 3K9MC 3BU4A 1T2HA 5KP1A 4BTYA 2F5WA 1T2IA 3H51A 4LEHA 3VSYA 2AADA 2GSPA 3CXC2 1UGIA 1W4NA 2CFWA 1RHLA 1IYYA 2F99A 2CFGA 1NB3I 5EVHA 1BSAA 1EKMA 4AKZA 3CCU3 4KZ1A 1LOYA 1BAOA 2RFRA 2C11A 1RGFA 2CHCA 1R4CA 3V98A 1K9M4 3S5CA 3DGOA 1OUNA 2WGQA 2YFLB 3G16A 1N9JA 1G0TA 4JRFA 2ML6A 2E2UA 3LTDA 4NHFA 3B4OA 3DXOA 3UNLA 1DVDA 2SBLA 3I553 1EEJA 1RN4A 2J8XB 1M9GA 1ISKA 1VQQA 1K41A 2CX1A 1BSCA 1GY6A 2BMRB 1O7MB 3FSDA 1EG9B 4N3VA 1G02A 2GEYA 1ZS7A 1UI7A 4LMIA 1RCLA 1RKYA 1RGAA 3EN8A 4RNYA 1OCVA 1B27A 3TDGA 4J5GA 1BRSA 5BIRA 5KP3A 1RLSA 1VQ83 1WQLB 4CCVA 4XBYA 1M1XB 5CF2A 3NM7A 2ZHXB 5JBSA 2IA7A 1VQO3 4BTXA 1QAFA 2CK3H 2P09A 1DYUA 1AVLA 3U1WA 3NV0B 4FCMA 3F7SA 2HMLB 1GY7A 5D83A 3LT9A 4EV5A 1PYLA 1YIJ3 1WMOA 3L0RA 4MMXB 5LC6A 1W6GA 1D6ZA 3IMAB 1WMNA 7GSPA 3KN4A 3I563 1TRQA 3KSPA 4MJDA 1RGLA 1W01A 3MWZA 3NQZA 1W2B2 3FKAA 4Q53A 1BSBA 1QVF2 3B8LA 1X1UA 1O7HB 3BNCA 3CPW2 2HMOB 1QMAA 1Q9EA 1JB4A 3CU3A 3NBJA 5IENA 5IEPA 3LT8A 1UCKA 1ZO2A 3HI7A 4MEIA 1RRHA 3CCE3 4IPBA 2K0MA 3SYUA 1TFKA 2HMNB 3MG3A 2W04A 3N8BA 1RNBA 2JDIH 3U97A 3OWSA 3BB9A 3UJMA 3S28A 3GRDA 3KE7A 1FW7A 4ILFA 1FGQA 4DKIA 5IG3A 4KFFA 1D6YA 3F8HA 3ECFA 2CFLA 1Q40B 2BNGA 3K5TA 1V74A 5CLKA 1GS3A 6GSPA 2KXGA 4XDVA 3FG1A 3ROBA 1IK3A 1UCIA 1AR0A 1W2ZA 5AYSC 3STDA 1UCJA 2XF3A 3LXUX 1EUIC 3DGNA 1UUWB 3MSOA 2OOVA 3S27A 5DRVA 1BRNL 1C54A 4HKVB 2IUKA 1Y4KA 4O2HA 1JKGA 3B4PA 3KKGA 4G1MB 4LYLB 1YVSA 3MG2A 2W9PA 1QALA 2QIYA 1UUGB 3AHSA 1KD14 2KF6A 1IT8A 1JRQA 1T5YA 4HM4B 4HM2B 3ZFZA 3WDGB 3FG4A 2E2TA 1EQKA 3HIGA 1N9EA 1NDOB 3H3HA 2ML5A 2Z6BA 4EC6A 1N8QA 3ALAA 2C4BA 3HOHA 1RMSA 1OHOA 1JN5A 3DGYA 3GZXB 1WNHA 1ZGXA 4BTWA 2KF3A 4HM6B 2BMOB 1I8VA 1UDII 1A2PA 4KT3B 3HZPA 4H61A 3N54B 4ZM8A 1GOVA 3EN1B 3WMDA 1MWSA 3EBYA 1YJ93 2W56A 3SXXA 1U5OA 1DMNA 3BNEA 4HM8B 3VF1A 3NBBA 5G2GA 3GWRA 2V1LA 3EJVA 3EX9A 1S5AA 3B7CA 3G4S3 3T8NA 2CX0A 1F8NA 1NB5I 1FGTA 4EXRA 1PFPA 3MKIA 1US1A 2CWTA 6STDA 4BL3A 1Q42A 1V58A 1B2UA 5BU4A 2CWUA 1ZX2A 2JQ5A 5AIFA 4N6NB 2KCDA 1U8CB 3G6E3 1BRIA 5AEUB 1YIT3 4I5QA 1K28A 1STFI 1ULJB 3F40A 4R9LA 1JV2B 2B24B 2BIRA 1I0VA 1UCLA 1X1WA 1BRHA 4HVNA 4ORLA 1PU4A 2XRXB 1SQWA 3OX9A 3DMCA 2OQEA 2XSHB 1OHSA 3JUOA 3CMA3 3N9HA 7STDA 1UI8A 4XBXA 1X1XA 1Q40A 4BIRA 4O02B 1JB2A 1PY3A 2YX9A 4AEQA 1LVNA 4MMYB 3AGNA 1OH0A 4GHOA 1E3VA 3CCJ3 3CCQ3 2XH9A 1W5ZA 3Q2PA 1W02A 1OF5B 3GSPA 1BRJA 1RGEA 3S29A 2IY2A 1R4YA 3GAXA 4K90B 4WYKB 5DREA 1BRGA 1LXEA 1RTUA 1B3SA 5EEOA 3X3XA 4WFOA 1VQ43 3CNMA 1SPUA 4FMDA 4O8SA 1CYUA 3MG1A 5IF6A 1CQSA 3AGOA 4CPKA 1BNEA 2BMQB 1QVG2 2W6JH 2LQVA 3QRDA 4OUQA 4WP5A 5STDA 1HZ1A 3PYJA 2GU3A 1VQ63 1BRKA 3IPTA 4H3UA 3GZBA 4FR9A 1BNFA 2BT3A 1ULIB 2HOHA 3JUNA 2Y73A 5HOHA 1FUWA 1JBSA 1I2EA 1Q7Y4 2OQEC 2WOFA 1C7HA 1OGZA 3UL5A 3EB8A 4FMCA 2P0MA 2KAAA 2Q07A 1L5GB 2F4YA 5TGNA 5JPPA 4L8OA 1LOVA 1M904 1V57A 4IT7A 3Q90A 4FCZA 5AIGA 1VQ73 1FYSA 4FCJA 2IMJA 1JZDA 1A2KA 2PZVA 2XGNA 4EYCA 4PEJA 1BSDA 3WR2A 3K63A 2GXFA 2M7OA 3EF8A 3V92A 1OPYA 2XFSA 3IJEB 1B2MA 5ELUA 1IQYA 3FZWA 1FGRA 2OTJ3 3KZTA 1JKGB 4NPBA 2O3OA 3F14A 3LTCA 1NNVA 4XM4A 3EE1A 3UL6A 1YGWA 1G96A 4AKYA 4WWUC 4N6V0 4HJLB 2F86B 2E2VA 1FA3A 4EBGA 3NHXA 2WGOA 4OVMA 1B2XA 2OTL3 2P0XA 2XEPA 1LQGC 4FMAA 3HK4A 1QAKA 5D82A 3S67A 3CCL3 1IVUA 3LMLA 1B2ZA 3RNTA 1KQS2 4HM5B 1KSIA 1WTHA 2XSOB 1RSNA 1JNQA 2WO0A 3EBTA 3OWYA 4R4KA 5RNTA 1VQM3 4HYZA 1W00A 1TP6A 2RNTA 3NXJA 1UUVB 4J8TA 1JBRA 4CJNA 1GMRA 2FGTA 1GD4A 1STDA 3JUQA 1A90A 1DMMA 1DVCA 3BNBA 6RNTA 2CFDA 3NUVA 2CFKA 1I0XA 1BOXA 1O7NB 1EA2A 1ASKA 1O7WB 3DH2A 3F8XA 3CPOA 4N6MA 1K8A4 5GSPA 1N5PA 5G1KA 3V99A 1RN7A 3EHCA 5CXOA 3DM8A 3LYGA 1GD3A 4HM7B 1A67A 3LH4A 1Z1SA 1JB5A 5FGOA 1WMPA 3DGLA 2W56B 4RNZA 2BHMA 3NX0A 3UB1A 1MGWA 3DGMA 4KFDA 1W7CA 3CCM3 2F98A 3FG3A 1BU4A 4GL6A 1BIRA 1JN5B 2QA43 1VQN3 4J9AA 1IDPA 3KSED 3CD63 1LOXA 2RCDA 2A15A 3NM2A 3OXAA 4MMZB 5KP4A 8RNTA 1AV4A 2C10A 3T0UA 1M1K4 1GSPA 1NO3A 3DUKA 1FUSA 2OWPA 3K0ZA 4RBNA 3OW22 4R1KA 4K61A 2RBIA 1BNRA 2CH9A 1BNGA 2F56A 1T3BA 2I9WA 1I2GA 2Z77A 1YI23 1VQ93 1BNSA 1FGMA 1I70A 3M8CA 1W6YA 2CC3A 5AIIA 2QEX3 1MNLA 1TIJA 4L8PA 7RNTA 2D42A 1DETA 3MPHA 1CYVA 1GOUA 2BU4A 2HMJB 4NREA 3WOFB 2HMMB 5BXQA 5M19A 3OV4A 3BNDA 1RJOA 2PNCA 2YFIB 3KFQC 1Q814 1FZUA 2Y74A 3FH1A 1FGOA 1O7PB 1W6CA 3D5IA 1IV9A 1LNHA 1RGGA 5LC7A 4HM1B 3CC23 1IQ8A 5IERA 2CW9A 2W9QA 2W03A 4JF8A 5D81A 1BUQA 2LYXA 3LZAA 1N5HA 3SX1A 1Q864 1UW1A 4GB5A 1IV7A 4RNTA 5CK6A 2STDA 5IEOA 1RRLA 2L4VA 3I0YA 3E99A 5AYRB 1MWUA 3WODG 4CDLA 3O8YA 1TUHA 1N8R4 1KC84 3RDEA 4N6UA 2L1SA 1I3IA 2MF7A 3CC73 4HOHA 5A0OB 1UGHI 2K54A 3CCR3 2ZL8A 3URPA 2H0IA 4BL2A 4HZBB 2FNQA 1D6UA 1JJ22 2CG1A 3AHWA 3X42A 2CWVA 3F9SA 4XBTA 3JUMA 3G0KA 2H0GA 1ROAA 1DMQA 2B1XB 2Z7AA 1HKXA 2KF5A 1YJW3 3AMOB 1BSEA 3A76A 3G713 1YJN3 1YVBI 4QWTA 1RGCA 3CNXA 3SVAA 1VQ53 1IVXA 4K1UA 3NQYA 3PCRA 2KRTA 3PGBA 3FF2A 4KFEA 3D3LA 2P38A 2YFJB 1O7GB 3BLZA 3Q1CA 2D1WA 3QK9A 3T8UA 3J7Yd 1VQK3 1SARA 5M1AA 1E3RA 1VZZA 1GMPA 4EV2A 3VGNA 8CHOA 1TFOA 4XDWA 3MYTA 3WHOA 1RGKA 1ROVA 2P05A 4HM0B 5AI1A 2R4IA 4X2OA 2GEXA 1NJI4 3PXMA 4N6LA 3OWUA 3GZRA 1FUTA 1I2FA 1AVKA 1GY5A 2SARA 3X40A 2UGIA 4U13A 1GYBA 1Q824 1TU5A 1BANA 1S723 3A5EA 2K3DA 4R9KA 3X3ZA
chains in the Genus database with same CATH topology
1BUJA 1BVIA 3D4AA 1BSCA 1BNIA 3KCHA 1G02A 2BIRA 1I0VA 1AY7A 1UCLA 1BRHA 1X1WA 1RCLA 2F5MA 1RGAA 1MGWA 1RGHA 1B27A 1BU4A 4J5GA 1BIRA 1GMQA 1BRSA 5BIRA 1RLSA 1X1XA 1B20A 4BIRA 1PY3A 1DE3A 8RNTA 2AAEA 1AQZA 1TRPA 1B2SA 3AGNA 4HAAA 1GSPA 4GHOA 1FUSA 1BNRA 1PYLA 2RBIA 1BNGA 2F56A 1I2GA 1BRJA 1RGEA 3GSPA 1BNSA 1I70A 1R4YA 7GSPA 1BRGA 1RTUA 1B3SA 1TRQA 1RGLA 7RNTA 2ZA4A 1DETA 1GOUA 4J5KA 1BSBA 2BU4A 1X1UA 1HYFA 3AGOA 1BNEA 1Q9EA 1UCKA 1X1YA 1MGRA 1FZUA 3SYUA 1HZ1A 1RN1A 3D5IA 1RGGA 1RNBA 1BRKA 1BNJA 3BIRA 1BNFA 1LOWA 2HOHA 5HOHA 1FW7A 2KF4A 1I3FA 1I2EA 1JBSA 1YNVX 1TTOA 1RCKA 4RNTA 1B21A 2KAAA 6GSPA 1GOYA 2F4YA 1LOVA 1UCIA 1LNIA 1LRAA 1UCJA 1FYSA 1I3IA 3A5EA 1BSDA 3WR2A 4HOHA 3URPA 1JBTA 1B2MA 1BRNL 1RNTA 1C54A 3D5GA 4BU4A 1BGSA 1RDSA 1YVSA 4GSPA 3AHWA 3AHSA 2KF6A 3Q3FA 1YGWA 9RNTA 2KF5A 1BSEA 1RGCA 2C4BA 3HOHA 1RMSA 3DGYA 1B2XA 1ZGXA 2KF3A 1CH0A 1I8VA 1A2PA 1GOVA 1B2ZA 3RNTA 3BU4A 1SARA 1RSNA 1T2HA 1GMPA 2F5WA 1T2IA 5RNTA 2AADA 2GSPA 3WHOA 1RGKA 1RHLA 2RNTA 1IYYA 1JBRA 1GMRA 1BSAA 1LOYA 6RNTA 1BAOA 3DH2A 1I0XA 1BOXA 1RGFA 1FUTA 1I2FA 2SARA 5GSPA 1B2UA 5BU4A 1BANA 1BRIA 1RN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUJ A;  1BVI A;  3D4A A;  1BSC A;  1BNI A;  3KCH A;  1G02 A;  2BIR A;  1I0V A;  1AY7 A;  1UCL A;  1BRH A;  1X1W A;  1RCL A;  2F5M A;  1RGA A;  1MGW A;  1RGH A;  1B27 A;  1BU4 A;  4J5G A;  1BIR A;  1GMQ A;  1BRS A;  5BIR A;  1RLS A;  1X1X A;  1B20 A;  4BIR A;  1PY3 A;  1DE3 A;  8RNT A;  2AAE A;  1AQZ A;  1TRP A;  1B2S A;  3AGN A;  4HAA A;  1GSP A;  4GHO A;  1FUS A;  1BNR A;  1PYL A;  2RBI A;  1BNG A;  2F56 A;  1I2G A;  1BRJ A;  1RGE A;  3GSP A;  1BNS A;  1I70 A;  1R4Y A;  7GSP A;  1BRG A;  1RTU A;  1B3S A;  1TRQ A;  1RGL A;  7RNT A;  2ZA4 A;  1DET A;  1GOU A;  4J5K A;  1BSB A;  2BU4 A;  1X1U A;  1HYF A;  3AGO A;  1BNE A;  1Q9E A;  1UCK A;  1X1Y A;  1MGR A;  1FZU A;  3SYU A;  1HZ1 A;  1RN1 A;  3D5I A;  1RGG A;  1RNB A;  1BRK A;  1BNJ A;  3BIR A;  1BNF A;  1LOW A;  2HOH A;  5HOH A;  1FW7 A;  2KF4 A;  1I3F A;  1I2E A;  1JBS A;  1YNV X;  1TTO A;  1RCK A;  4RNT A;  1B21 A;  2KAA A;  6GSP A;  1GOY A;  2F4Y A;  1LOV A;  1UCI A;  1LNI A;  1LRA A;  1UCJ A;  1FYS A;  1I3I A;  3A5E A;  1BSD A;  3WR2 A;  4HOH A;  3URP A;  1JBT A;  1B2M A;  1BRN L;  1RNT A;  1C54 A;  3D5G A;  4BU4 A;  1BGS A;  1RDS A;  1YVS A;  4GSP A;  3AHW A;  3AHS A;  2KF6 A;  3Q3F A;  1YGW A;  9RNT A;  2KF5 A;  1BSE A;  1RGC A;  2C4B A;  3HOH A;  1RMS A;  3DGY A;  1B2X A;  1ZGX A;  2KF3 A;  1CH0 A;  1I8V A;  1A2P A;  1GOV A;  1B2Z A;  3RNT A;  3BU4 A;  1SAR A;  1RSN A;  1T2H A;  1GMP A;  2F5W A;  1T2I A;  5RNT A;  2AAD A;  2GSP A;  3WHO A;  1RGK A;  1RHL A;  2RNT A;  1IYY A;  1JBR A;  1GMR A;  1BSA A;  1LOY A;  6RNT A;  1BAO A;  3DH2 A;  1I0X A;  1BOX A;  1RGF A;  1FUT A;  1I2F A;  2SAR A;  5GSP A;  1B2U A;  5BU4 A;  1BAN A;  1BRI A;  1RN4 A; 
#chains in the Genus database with same CATH topology
 1BUJ A;  1BVI A;  3D4A A;  4EW5 A;  5I97 A;  1BNI A;  3KCH A;  3SED A;  4WHA A;  2GU1 A;  1VQP 3;  2F5M A;  1AY7 A;  3JVC A;  5IG0 A;  1NU3 A;  1RGH A;  4O3V A;  1JZO A;  4K1V A;  3ER7 A;  5EQL A;  1YHQ 3;  3LTA A;  5AIH A;  2R41 A;  1GMQ A;  1SIH A;  1SII A;  1MWT A;  2H0H A;  5BVB A;  1B20 A;  3DY5 A;  1Q7H A;  3DZL A;  4HZ9 B;  4L7K A;  4LZI A;  4N6T A;  3ZG0 A;  5CF1 A;  2Z76 A;  2QGU A;  3HII A;  2BO9 B;  1QJG A;  1DE3 A;  2AAE A;  1VQL 3;  3WA2 X;  1AQZ A;  1YGE A;  1TRP A;  1B2S A;  5IW9 A;  4HAA A;  2W0Q A;  3CC4 3;  3CCS 3;  2UX0 A;  4STD A;  3CME 3;  3X3Y A;  4IIA A;  3G8Z A;  1J2B A;  1MWR A;  1SJW A;  5JPU A;  3SOY A;  3X41 A;  2ZA4 A;  5ELJ A;  2INX A;  1NWW A;  2HMK B;  2OCT A;  3D79 A;  3LOY A;  3FCS B;  4J5K A;  5IG4 A;  1HYF A;  4R80 A;  1KWI A;  3D9R A;  1HU9 A;  3SOA A;  5M18 A;  1IVW A;  1OAC A;  1X1Y A;  2RGQ A;  1MGR A;  1RN1 A;  3WOE B;  2CIU A;  5HGR A;  1BNJ A;  3BIR A;  1LOW A;  2XR8 B;  2WOH A;  2KF4 A;  1OF5 A;  1I3F A;  1YNV X;  1TTO A;  2XGL A;  1RCK A;  4WYK A;  1E97 A;  3GZY B;  1B21 A;  2CKF B;  3FLJ A;  4N6O B;  1GOY A;  4FMB A;  5FW5 A;  5AEW B;  2IYJ A;  1LNI A;  1LRA A;  3LTB A;  2CG0 A;  4HM3 B;  4OK0 A;  2RSX A;  3AMO A;  1IQX A;  3NV0 A;  4I4K A;  1CEW I;  2O9U X;  2MC8 A;  3NBR A;  4LSO A;  2FXT A;  2UUG C;  1JBT A;  2OOV C;  1RNT A;  3K7C A;  3D5G A;  3WA3 A;  4BU4 A;  1IU7 A;  1BGS A;  1RDS A;  4RZM A;  3EC9 A;  4TX4 A;  4GSP A;  3ZG5 A;  1OGX A;  3CCV 3;  1K73 4;  3FGY A;  3HX8 A;  1IT7 A;  3SLU A;  3Q3F A;  9RNT A;  3MHE A;  3PCS A;  4KVH A;  1MOL A;  4XB5 A;  1IVV A;  3KII A;  3RGR A;  1TJD A;  3PZW A;  5G1L A;  2W2C A;  2GBX B;  1LQM B;  3F7X A;  5IG5 A;  1A2V A;  3FF0 A;  1CH0 A;  1OHP A;  3PS8 A;  3RGA A;  3EQQ B;  4HBR A;  4LGQ A;  2XFT A;  2IUJ A;  2GBW B;  2ZDJ A;  3JUP A;  4X2H A;  3K9M C;  3BU4 A;  1T2H A;  5KP1 A;  4BTY A;  2F5W A;  1T2I A;  3H51 A;  4LEH A;  3VSY A;  2AAD A;  2GSP A;  3CXC 2;  1UGI A;  1W4N A;  2CFW A;  1RHL A;  1IYY A;  2F99 A;  2CFG A;  1NB3 I;  5EVH A;  1BSA A;  1EKM A;  4AKZ A;  3CCU 3;  4KZ1 A;  1LOY A;  1BAO A;  2RFR A;  2C11 A;  1RGF A;  2CHC A;  1R4C A;  3V98 A;  1K9M 4;  3S5C A;  3DGO A;  1OUN A;  2WGQ A;  2YFL B;  3G16 A;  1N9J A;  1G0T A;  4JRF A;  2ML6 A;  2E2U A;  3LTD A;  4NHF A;  3B4O A;  3DXO A;  3UNL A;  1DVD A;  2SBL A;  3I55 3;  1EEJ A;  1RN4 A;  2J8X B;  1M9G A;  1ISK A;  1VQQ A;  1K41 A;  2CX1 A;  1BSC A;  1GY6 A;  2BMR B;  1O7M B;  3FSD A;  1EG9 B;  4N3V A;  1G02 A;  2GEY A;  1ZS7 A;  1UI7 A;  4LMI A;  1RCL A;  1RKY A;  1RGA A;  3EN8 A;  4RNY A;  1OCV A;  1B27 A;  3TDG A;  4J5G A;  1BRS A;  5BIR A;  5KP3 A;  1RLS A;  1VQ8 3;  1WQL B;  4CCV A;  4XBY A;  1M1X B;  5CF2 A;  3NM7 A;  2ZHX B;  5JBS A;  2IA7 A;  1VQO 3;  4BTX A;  1QAF A;  2CK3 H;  2P09 A;  1DYU A;  1AVL A;  3U1W A;  3NV0 B;  4FCM A;  3F7S A;  2HML B;  1GY7 A;  5D83 A;  3LT9 A;  4EV5 A;  1PYL A;  1YIJ 3;  1WMO A;  3L0R A;  4MMX B;  5LC6 A;  1W6G A;  1D6Z A;  3IMA B;  1WMN A;  7GSP A;  3KN4 A;  3I56 3;  1TRQ A;  3KSP A;  4MJD A;  1RGL A;  1W01 A;  3MWZ A;  3NQZ A;  1W2B 2;  3FKA A;  4Q53 A;  1BSB A;  1QVF 2;  3B8L A;  1X1U A;  1O7H B;  3BNC A;  3CPW 2;  2HMO B;  1QMA A;  1Q9E A;  1JB4 A;  3CU3 A;  3NBJ A;  5IEN A;  5IEP A;  3LT8 A;  1UCK A;  1ZO2 A;  3HI7 A;  4MEI A;  1RRH A;  3CCE 3;  4IPB A;  2K0M A;  3SYU A;  1TFK A;  2HMN B;  3MG3 A;  2W04 A;  3N8B A;  1RNB A;  2JDI H;  3U97 A;  3OWS A;  3BB9 A;  3UJM A;  3S28 A;  3GRD A;  3KE7 A;  1FW7 A;  4ILF A;  1FGQ A;  4DKI A;  5IG3 A;  4KFF A;  1D6Y A;  3F8H A;  3ECF A;  2CFL A;  1Q40 B;  2BNG A;  3K5T A;  1V74 A;  5CLK A;  1GS3 A;  6GSP A;  2KXG A;  4XDV A;  3FG1 A;  3ROB A;  1IK3 A;  1UCI A;  1AR0 A;  1W2Z A;  5AYS C;  3STD A;  1UCJ A;  2XF3 A;  3LXU X;  1EUI C;  3DGN A;  1UUW B;  3MSO A;  2OOV A;  3S27 A;  5DRV A;  1BRN L;  1C54 A;  4HKV B;  2IUK A;  1Y4K A;  4O2H A;  1JKG A;  3B4P A;  3KKG A;  4G1M B;  4LYL B;  1YVS A;  3MG2 A;  2W9P A;  1QAL A;  2QIY A;  1UUG B;  3AHS A;  1KD1 4;  2KF6 A;  1IT8 A;  1JRQ A;  1T5Y A;  4HM4 B;  4HM2 B;  3ZFZ A;  3WDG B;  3FG4 A;  2E2T A;  1EQK A;  3HIG A;  1N9E A;  1NDO B;  3H3H A;  2ML5 A;  2Z6B A;  4EC6 A;  1N8Q A;  3ALA A;  2C4B A;  3HOH A;  1RMS A;  1OHO A;  1JN5 A;  3DGY A;  3GZX B;  1WNH A;  1ZGX A;  4BTW A;  2KF3 A;  4HM6 B;  2BMO B;  1I8V A;  1UDI I;  1A2P A;  4KT3 B;  3HZP A;  4H61 A;  3N54 B;  4ZM8 A;  1GOV A;  3EN1 B;  3WMD A;  1MWS A;  3EBY A;  1YJ9 3;  2W56 A;  3SXX A;  1U5O A;  1DMN A;  3BNE A;  4HM8 B;  3VF1 A;  3NBB A;  5G2G A;  3GWR A;  2V1L A;  3EJV A;  3EX9 A;  1S5A A;  3B7C A;  3G4S 3;  3T8N A;  2CX0 A;  1F8N A;  1NB5 I;  1FGT A;  4EXR A;  1PFP A;  3MKI A;  1US1 A;  2CWT A;  6STD A;  4BL3 A;  1Q42 A;  1V58 A;  1B2U A;  5BU4 A;  2CWU A;  1ZX2 A;  2JQ5 A;  5AIF A;  4N6N B;  2KCD A;  1U8C B;  3G6E 3;  1BRI A;  5AEU B;  1YIT 3;  4I5Q A;  1K28 A;  1STF I;  1ULJ B;  3F40 A;  4R9L A;  1JV2 B;  2B24 B;  2BIR A;  1I0V A;  1UCL A;  1X1W A;  1BRH A;  4HVN A;  4ORL A;  1PU4 A;  2XRX B;  1SQW A;  3OX9 A;  3DMC A;  2OQE A;  2XSH B;  1OHS A;  3JUO A;  3CMA 3;  3N9H A;  7STD A;  1UI8 A;  4XBX A;  1X1X A;  1Q40 A;  4BIR A;  4O02 B;  1JB2 A;  1PY3 A;  2YX9 A;  4AEQ A;  1LVN A;  4MMY B;  3AGN A;  1OH0 A;  4GHO A;  1E3V A;  3CCJ 3;  3CCQ 3;  2XH9 A;  1W5Z A;  3Q2P A;  1W02 A;  1OF5 B;  3GSP A;  1BRJ A;  1RGE A;  3S29 A;  2IY2 A;  1R4Y A;  3GAX A;  4K90 B;  4WYK B;  5DRE A;  1BRG A;  1LXE A;  1RTU A;  1B3S A;  5EEO A;  3X3X A;  4WFO A;  1VQ4 3;  3CNM A;  1SPU A;  4FMD A;  4O8S A;  1CYU A;  3MG1 A;  5IF6 A;  1CQS A;  3AGO A;  4CPK A;  1BNE A;  2BMQ B;  1QVG 2;  2W6J H;  2LQV A;  3QRD A;  4OUQ A;  4WP5 A;  5STD A;  1HZ1 A;  3PYJ A;  2GU3 A;  1VQ6 3;  1BRK A;  3IPT A;  4H3U A;  3GZB A;  4FR9 A;  1BNF A;  2BT3 A;  1ULI B;  2HOH A;  3JUN A;  2Y73 A;  5HOH A;  1FUW A;  1JBS A;  1I2E A;  1Q7Y 4;  2OQE C;  2WOF A;  1C7H A;  1OGZ A;  3UL5 A;  3EB8 A;  4FMC A;  2P0M A;  2KAA A;  2Q07 A;  1L5G B;  2F4Y A;  5TGN A;  5JPP A;  4L8O A;  1LOV A;  1M90 4;  1V57 A;  4IT7 A;  3Q90 A;  4FCZ A;  5AIG A;  1VQ7 3;  1FYS A;  4FCJ A;  2IMJ A;  1JZD A;  1A2K A;  2PZV A;  2XGN A;  4EYC A;  4PEJ A;  1BSD A;  3WR2 A;  3K63 A;  2GXF A;  2M7O A;  3EF8 A;  3V92 A;  1OPY A;  2XFS A;  3IJE B;  1B2M A;  5ELU A;  1IQY A;  3FZW A;  1FGR A;  2OTJ 3;  3KZT A;  1JKG B;  4NPB A;  2O3O A;  3F14 A;  3LTC A;  1NNV A;  4XM4 A;  3EE1 A;  3UL6 A;  1YGW A;  1G96 A;  4AKY A;  4WWU C;  4N6V 0;  4HJL B;  2F86 B;  2E2V A;  1FA3 A;  4EBG A;  3NHX A;  2WGO A;  4OVM A;  1B2X A;  2OTL 3;  2P0X A;  2XEP A;  1LQG C;  4FMA A;  3HK4 A;  1QAK A;  5D82 A;  3S67 A;  3CCL 3;  1IVU A;  3LML A;  1B2Z A;  3RNT A;  1KQS 2;  4HM5 B;  1KSI A;  1WTH A;  2XSO B;  1RSN A;  1JNQ A;  2WO0 A;  3EBT A;  3OWY A;  4R4K A;  5RNT A;  1VQM 3;  4HYZ A;  1W00 A;  1TP6 A;  2RNT A;  3NXJ A;  1UUV B;  4J8T A;  1JBR A;  4CJN A;  1GMR A;  2FGT A;  1GD4 A;  1STD A;  3JUQ A;  1A90 A;  1DMM A;  1DVC A;  3BNB A;  6RNT A;  2CFD A;  3NUV A;  2CFK A;  1I0X A;  1BOX A;  1O7N B;  1EA2 A;  1ASK A;  1O7W B;  3DH2 A;  3F8X A;  3CPO A;  4N6M A;  1K8A 4;  5GSP A;  1N5P A;  5G1K A;  3V99 A;  1RN7 A;  3EHC A;  5CXO A;  3DM8 A;  3LYG A;  1GD3 A;  4HM7 B;  1A67 A;  3LH4 A;  1Z1S A;  1JB5 A;  5FGO A;  1WMP A;  3DGL A;  2W56 B;  4RNZ A;  2BHM A;  3NX0 A;  3UB1 A;  1MGW A;  3DGM A;  4KFD A;  1W7C A;  3CCM 3;  2F98 A;  3FG3 A;  1BU4 A;  4GL6 A;  1BIR A;  1JN5 B;  2QA4 3;  1VQN 3;  4J9A A;  1IDP A;  3KSE D;  3CD6 3;  1LOX A;  2RCD A;  2A15 A;  3NM2 A;  3OXA A;  4MMZ B;  5KP4 A;  8RNT A;  1AV4 A;  2C10 A;  3T0U A;  1M1K 4;  1GSP A;  1NO3 A;  3DUK A;  1FUS A;  2OWP A;  3K0Z A;  4RBN A;  3OW2 2;  4R1K A;  4K61 A;  2RBI A;  1BNR A;  2CH9 A;  1BNG A;  2F56 A;  1T3B A;  2I9W A;  1I2G A;  2Z77 A;  1YI2 3;  1VQ9 3;  1BNS A;  1FGM A;  1I70 A;  3M8C A;  1W6Y A;  2CC3 A;  5AII A;  2QEX 3;  1MNL A;  1TIJ A;  4L8P A;  7RNT A;  2D42 A;  1DET A;  3MPH A;  1CYV A;  1GOU A;  2BU4 A;  2HMJ B;  4NRE A;  3WOF B;  2HMM B;  5BXQ A;  5M19 A;  3OV4 A;  3BND A;  1RJO A;  2PNC A;  2YFI B;  3KFQ C;  1Q81 4;  1FZU A;  2Y74 A;  3FH1 A;  1FGO A;  1O7P B;  1W6C A;  3D5I A;  1IV9 A;  1LNH A;  1RGG A;  5LC7 A;  4HM1 B;  3CC2 3;  1IQ8 A;  5IER A;  2CW9 A;  2W9Q A;  2W03 A;  4JF8 A;  5D81 A;  1BUQ A;  2LYX A;  3LZA A;  1N5H A;  3SX1 A;  1Q86 4;  1UW1 A;  4GB5 A;  1IV7 A;  4RNT A;  5CK6 A;  2STD A;  5IEO A;  1RRL A;  2L4V A;  3I0Y A;  3E99 A;  5AYR B;  1MWU A;  3WOD G;  4CDL A;  3O8Y A;  1TUH A;  1N8R 4;  1KC8 4;  3RDE A;  4N6U A;  2L1S A;  1I3I A;  2MF7 A;  3CC7 3;  4HOH A;  5A0O B;  1UGH I;  2K54 A;  3CCR 3;  2ZL8 A;  3URP A;  2H0I A;  4BL2 A;  4HZB B;  2FNQ A;  1D6U A;  1JJ2 2;  2CG1 A;  3AHW A;  3X42 A;  2CWV A;  3F9S A;  4XBT A;  3JUM A;  3G0K A;  2H0G A;  1ROA A;  1DMQ A;  2B1X B;  2Z7A A;  1HKX A;  2KF5 A;  1YJW 3;  3AMO B;  1BSE A;  3A76 A;  3G71 3;  1YJN 3;  1YVB I;  4QWT A;  1RGC A;  3CNX A;  3SVA A;  1VQ5 3;  1IVX A;  4K1U A;  3NQY A;  3PCR A;  2KRT A;  3PGB A;  3FF2 A;  4KFE A;  3D3L A;  2P38 A;  2YFJ B;  1O7G B;  3BLZ A;  3Q1C A;  2D1W A;  3QK9 A;  3T8U A;  3J7Y d;  1VQK 3;  1SAR A;  5M1A A;  1E3R A;  1VZZ A;  1GMP A;  4EV2 A;  3VGN A;  8CHO A;  1TFO A;  4XDW A;  3MYT A;  3WHO A;  1RGK A;  1ROV A;  2P05 A;  4HM0 B;  5AI1 A;  2R4I A;  4X2O A;  2GEX A;  1NJI 4;  3PXM A;  4N6L A;  3OWU A;  3GZR A;  1FUT A;  1I2F A;  1AVK A;  1GY5 A;  2SAR A;  3X40 A;  2UGI A;  4U13 A;  1GYB A;  1Q82 4;  1TU5 A;  1BAN A;  1S72 3;  3A5E A;  2K3D A;  4R9K A;  3X3Z A; 
#chains in the Genus database with same CATH homology
 1BUJ A;  1BVI A;  3D4A A;  1BSC A;  1BNI A;  3KCH A;  1G02 A;  2BIR A;  1I0V A;  1AY7 A;  1UCL A;  1BRH A;  1X1W A;  1RCL A;  2F5M A;  1RGA A;  1MGW A;  1RGH A;  1B27 A;  1BU4 A;  4J5G A;  1BIR A;  1GMQ A;  1BRS A;  5BIR A;  1RLS A;  1X1X A;  1B20 A;  4BIR A;  1PY3 A;  1DE3 A;  8RNT A;  2AAE A;  1AQZ A;  1TRP A;  1B2S A;  3AGN A;  4HAA A;  1GSP A;  4GHO A;  1FUS A;  1BNR A;  1PYL A;  2RBI A;  1BNG A;  2F56 A;  1I2G A;  1BRJ A;  1RGE A;  3GSP A;  1BNS A;  1I70 A;  1R4Y A;  7GSP A;  1BRG A;  1RTU A;  1B3S A;  1TRQ A;  1RGL A;  7RNT A;  2ZA4 A;  1DET A;  1GOU A;  4J5K A;  1BSB A;  2BU4 A;  1X1U A;  1HYF A;  3AGO A;  1BNE A;  1Q9E A;  1UCK A;  1X1Y A;  1MGR A;  1FZU A;  3SYU A;  1HZ1 A;  1RN1 A;  3D5I A;  1RGG A;  1RNB A;  1BRK A;  1BNJ A;  3BIR A;  1BNF A;  1LOW A;  2HOH A;  5HOH A;  1FW7 A;  2KF4 A;  1I3F A;  1I2E A;  1JBS A;  1YNV X;  1TTO A;  1RCK A;  4RNT A;  1B21 A;  2KAA A;  6GSP A;  1GOY A;  2F4Y A;  1LOV A;  1UCI A;  1LNI A;  1LRA A;  1UCJ A;  1FYS A;  1I3I A;  3A5E A;  1BSD A;  3WR2 A;  4HOH A;  3URP A;  1JBT A;  1B2M A;  1BRN L;  1RNT A;  1C54 A;  3D5G A;  4BU4 A;  1BGS A;  1RDS A;  1YVS A;  4GSP A;  3AHW A;  3AHS A;  2KF6 A;  3Q3F A;  1YGW A;  9RNT A;  2KF5 A;  1BSE A;  1RGC A;  2C4B A;  3HOH A;  1RMS A;  3DGY A;  1B2X A;  1ZGX A;  2KF3 A;  1CH0 A;  1I8V A;  1A2P A;  1GOV A;  1B2Z A;  3RNT A;  3BU4 A;  1SAR A;  1RSN A;  1T2H A;  1GMP A;  2F5W A;  1T2I A;  5RNT A;  2AAD A;  2GSP A;  3WHO A;  1RGK A;  1RHL A;  2RNT A;  1IYY A;  1JBR A;  1GMR A;  1BSA A;  1LOY A;  6RNT A;  1BAO A;  3DH2 A;  1I0X A;  1BOX A;  1RGF A;  1FUT A;  1I2F A;  2SAR A;  5GSP A;  1B2U A;  5BU4 A;  1BAN A;  1BRI A;  1RN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...