1I3FA

Ribonuclease t1 v89s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGSITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i3fA00
1B2MA 1BSBA 1B2UA 1BSCA 1ZGXA 1JBTA 1YNVX 1GOVA 4GSPA 4BIRA 1JBSA 1B3SA 1GMRA 1BRJA 1BNGA 1RGKA 4J5GA 1RSNA 5HOHA 1B21A 1Q9EA 1TTOA 2C4BA 1B2XA 1FUSA 1G02A 2RBIA 3AGNA 2RNTA 3WHOA 3AGOA 1CH0A 5BIRA 1BNIA 1BANA 1RGHA 1RMSA 1RNTA 1RTUA 9RNTA 2BIRA 1GMPA 1RGLA 3WR2A 3AHSA 1GSPA 1RN4A 1I3FA 2SARA 2HOHA 1UCKA 1MGWA 1BNSA 2AAEA 2GSPA 1RHLA 1FYSA 3BU4A 4HAAA 3DH2A 3DGYA 5BU4A 1BOXA 1AY7A 1HYFA 3D5GA 1MGRA 1I2GA 1R4YA 1LNIA 1C54A 7GSPA 2F5MA 1A2PA 2ZA4A 1I0XA 2KF6A 3GSPA 1TRQA 2KF5A 4RNTA 5RNTA 4BU4A 1LOVA 1B2ZA 2BU4A 1FUTA 1X1WA 1BRIA 1RGFA 1BNRA 1I70A 3KCHA 1BNJA 4GHOA 1FW7A 1RDSA 1RCKA 3Q3FA 1I3IA 1BAOA 1PY3A 1RGCA 1T2IA 1B20A 1I8VA 2KF3A 1DETA 3D4AA 1GOYA 1BSAA 1UCJA 1SARA 1LOWA 1RN1A 1X1XA 1YVSA 1BU4A 1AQZA 1GMQA 3AHWA 1BRGA 7RNTA 1IYYA 1UCLA 1BRKA 2F4YA 1BGSA 1HZ1A 2KAAA 1I2EA 1TRPA 1BVIA 1BRNL 1BRSA 3SYUA 8RNTA 6RNTA 1LRAA 1BRHA 1BSDA 1GOUA 1B27A 2KF4A 5GSPA 1T2HA 1JBRA 2AADA 1RGGA 1DE3A 1RGAA 1BIRA 1FZUA 1B2SA 1YGWA 1BNFA 3A5EA 1I2FA 1RGEA 2F56A 1RNBA 4HOHA 4J5KA 1RLSA 3D5IA 3RNTA 1LOYA 1PYLA 1RCLA 1BNEA 1BUJA 1BSEA 3HOHA 3URPA 3BIRA 1UCIA 2F5WA 6GSPA 1X1UA 1X1YA 1I0VA
chains in the Genus database with same CATH superfamily
1B2MA 3RDEA 1B2UA 1BSCA 3QRDA 2YFIB 3GZRA 1JBTA 4BIRA 3MG1A 2OOVC 1JBSA 3DMCA 1W02A 1LOXA 4JRFA 1RSNA 1TIJA 3JUOA 3EX9A 2GU3A 3CME3 2C4BA 1B2XA 1VQ43 2O3OA 3EJVA 2STDA 2W2CA 2CFGA 5AI1A 5ELUA 2XH9A 2HMMB 4EV2A 1DYUA 2OWPA 3M8CA 3NXJA 1BANA 1RGHA 3QK9A 4HM1B 3F40A 5AYSC 3WR2A 5A0OB 1RN4A 5I97A 3CCV3 1SPUA 2HOHA 1E3RA 1VQK3 3O8YA 1IT7A 1YJW3 3LXUX 4HAAA 4IT7A 3WODG 3CU3A 3DH2A 1L5GB 1EEJA 2YFJB 1HYFA 2IY2A 4ORLA 2YX9A 1PU4A 4R9KA 2CG1A 1MGRA 4MMZB 1EQKA 3KFQC 7GSPA 2M7OA 1T5YA 3ZG5A 3AMOB 5IEPA 2ZA4A 4K1VA 1I0XA 5AEWB 1SIHA 3NBBA 3B7CA 4RNTA 3V92A 4FMDA 2P05A 1HU9A 4WWUC 5RNTA 1IU7A 2BU4A 1FUTA 1VQ93 1QMAA 3HI7A 4HM0B 4WHAA 2P09A 4O3VA 2OTL3 1BNJA 3BNBA 2H0GA 3JUMA 1FW7A 2RCDA 1WTHA 1N8QA 1RCKA 5LC7A 3HK4A 1I3IA 2OQEC 1PY3A 2CIUA 4ILFA 1I8VA 3ZFZA 2KF3A 3PXMA 5IG4A 3CCE3 2UX0A 1V74A 1ZX2A 2WGOA 1BSAA 1LOWA 1QAFA 2ZDJA 3EQQB 2CHCA 1ULJB 3DY5A 3DGNA 3SXXA 1BU4A 1BRGA 4FCZA 1GS3A 5IG0A 3U97A 1BRKA 3CPOA 1MWRA 3FH1A 1BGSA 1SQWA 3K0ZA 3I553 1JV2B 3CCR3 1TFKA 5FGOA 2JQ5A 1N9EA 2GBXB 3KSED 5EEOA 3LOYA 3ZG0A 1FGOA 4BTWA 1UDII 1BRSA 5IENA 1M9GA 2W56A 1UI7A 4EBGA 1KD14 3B4PA 1DVDA 5AIHA 3SEDA 1NDOB 3L0RA 1JKGA 5AIIA 3KN4A 1RGGA 4K61A 1DE3A 8CHOA 2RSXA 1FZUA 3FGYA 1WQLB 1YGWA 4O02B 5FW5A 1BNFA 3V99A 3A5EA 4R4KA 1MNLA 3F9SA 1W4NA 5G1LA 1RNBA 1RRLA 1WMOA 1ROAA 2O9UX 3RGRA 4CDLA 1GY7A 1OH0A 2IYJA 3DUKA 1W01A 1N8R4 1RCLA 4NHFA 4HBRA 4HJLB 3UL6A 3HOHA 4O8SA 3OV4A 2ZL8A 1JZDA 4QWTA 3SOYA 1AR0A 5EQLA 1O7WB 6GSPA 4TX4A 2CFWA 2W9QA 1X1YA 4LGQA 3SOAA 1ZGXA 1S5AA 1YNVX 3NQZA 1Z1SA 4EW5A 1U5OA 4GSPA 2B1XB 2P0XA 3MYTA 2OOVA 1JN5A 4L8OA 1B3SA 1RRHA 1GMRA 3G8ZA 3VGNA 1BNGA 1RGKA 4N6TA 2W56B 1DMQA 3FKAA 3BB9A 1TTOA 3LTBA 2HMLB 2XF3A 3G16A 3LTDA 1NB5I 3LZAA 4OK0A 2I9WA 1WMPA 2CFKA 2FXTA 3F7SA 3HX8A 5EVHA 2E2TA 3TDGA 1JKGB 3D79A 1YGEA 1BNIA 3K63A 9RNTA 1T3BA 2Z6BA 3GZBA 1SIIA 1GD4A 2SARA 3OW22 1TFOA 1UCKA 1MGWA 1YI23 1VQ83 2GSPA 2CWVA 3K7CA 1RHLA 1FYSA 3BU4A 3DXOA 3FG3A 3HIIA 1MWTA 5D82A 3CC73 3N54B 4HVNA 1MWSA 2ML5A 4EC6A 2IUJA 3V98A 3B4OA 3FCSB 3MSOA 1Q814 1I2GA 5KP1A 1C54A 2HMKB 3FZWA 3GAXA 1N5PA 1O7PB 3BNDA 4MMXB 3D3LA 1NJI4 1VQ63 2KF5A 5IEOA 2BNGA 1IVXA 1S723 3MWZA 5BVBA 2HMOB 2HMJB 1LOVA 1B2ZA 3ECFA 2SBLA 1JN5B 4L7KA 3T0UA 1RGFA 4X2HA 4EV5A 3LTCA 4FCJA 1UUWB 4KT3B 3S29A 3X40A 1VQ73 3CCU3 1DVCA 2IUKA 1IQ8A 1JRQA 4K1UA 3X3XA 5AEUB 1YIJ3 3T8NA 1B20A 4PEJA 5CLKA 2OTJ3 2FNQA 1A2KA 1W7CA 5KP4A 1VQQA 2E2UA 4CJNA 1DETA 5D81A 1HKXA 1BUQA 1RN1A 4Q53A 1TP6A 3CC43 1QAKA 3EBTA 5AIFA 5HGRA 1AQZA 1GMQA 1QJGA 2C10A 7RNTA 5M18A 1TU5A 1K734 2J8XB 2R4IA 1WNHA 2BMQB 1JZOA 3CCL3 2PZVA 3GWRA 7STDA 5D83A 1HZ1A 4FMCA 4X2OA 2CX1A 1NU3A 4ZM8A 1RN7A 3KE7A 3PCRA 4CPKA 3EBYA 3X41A 3JUPA 3PGBA 1TRPA 3Q90A 1NB3I 1A90A 5ELJA 1FUWA 3WOFB 4XBTA 2XRXB 3MKIA 1G0TA 2XGNA 1GOUA 2P0MA 3STDA 3IJEB 1T2HA 2AADA 5DRVA 3Q1CA 1K28A 1UUGB 2H0HA 2L4VA 2Y73A 1US1A 1LXEA 4BL2A 1VZZA 3FG1A 2V1LA 1OHOA 4HM2B 5M19A 1A2VA 4HOHA 3G0KA 4RNZA 1RLSA 3DM8A 3EB8A 4OUQA 4GB5A 4IIAA 4H3UA 1KQS2 1C7HA 3GZXB 3B8LA 3WA2X 1BSEA 3NM2A 1W2ZA 1IT8A 1CYVA 2W03A 1JB2A 3OWUA 2F5WA 4JF8A 1CYUA 2CK3H 4MMYB 1JB4A 1IQXA 3PYJA 1OHPA 2K0MA 2PNCA 1BSBA 3D9RA 2RGQA 3WOEB 1A67A 1G96A 2W6JH 3LH4A 1GOVA 3K9MC 1CQSA 4NPBA 5STDA 4DKIA 3BLZA 1VQ53 4J5GA 2INXA 5HOHA 1B21A 2GEXA 4XM4A 1Q7Y4 1FUSA 1G02A 3E99A 3U1WA 1V58A 1R4CA 2CFLA 2K54A 3AGNA 4N6MA 3WHOA 3S28A 3CXC2 3AGOA 1QVG2 3T8UA 3IMAB 1AVKA 4J9AA 5TGNA 1RTUA 5CXOA 1WMNA 2BIRA 2GBWB 3NBRA 1NNVA 4R9LA 3GRDA 2BT3A 5IG5A 1OHSA 1BNSA 1SJWA 1STFI 2YFLB 3KZTA 2AAEA 3LT8A 3FF2A 3EN8A 4KFEA 1LNHA 1ASKA 3MHEA 1J2BA 1EKMA 5BU4A 4FMBA 3CCJ3 2R41A 2Z7AA 5CF1A 2XFTA 1ZS7A 5IERA 1MWUA 3D5GA 4HM7B 4K90B 5JPUA 3EHCA 4J8TA 3CCM3 2GEYA 1FGQA 1ZO2A 1KSIA 2F5MA 1AVLA 1LQGC 4HM6B 4WFOA 2Z77A 4I5QA 3G713 5LC6A 3NUVA 1UGHI 4RBNA 1IV7A 1GD3A 3N8BA 2BMOB 1BNRA 1TJDA 2XSHB 4XBXA 1Q864 3HZPA 2D42A 1I70A 3KCHA 3CNXA 3UJMA 2QA43 4GHOA 6STDA 2LYXA 4R80A 1NWWA 1RDSA 1KC84 1YVBI 3MPHA 1QVF2 2CKFB 3MG2A 1M1XB 3Q3FA 1BAOA 3F7XA 4HM8B 5M1AA 1RGCA 1PFPA 1T2IA 3CNMA 3FG4A 2W0QA 3H51A 3NX0A 3OXAA 2KXGA 1N9JA 1SARA 2LQVA 1X1XA 5JBSA 2IMJA 1YVSA 4LZIA 3DGMA 4N3VA 1RJOA 4XB5A 3F8HA 3AHWA 3NQYA 1STDA 3CMA3 1IYYA 1UCLA 3NM7A 2Q07A 4EXRA 1Q42A 5AIGA 1VQP3 3HIGA 1IVVA 3EC9A 2CH9A 2CFDA 1F8NA 1KWIA 3BNEA 3FSDA 3JVCA 1BRNL 4N6V0 1IQYA 1AV4A 6RNTA 1MOLA 1YJN3 2IA7A 1M904 3VSYA 1BSDA 2D1WA 1V57A 2OQEA 2K3DA 2Z76A 1IDPA 3S67A 4G1MB 1O7HB 2HMNB 3I0YA 4HM3B 5G1KA 1OF5B 1RGAA 1O7NB 1B2SA 2MF7A 3LYGA 4L8PA 4BTYA 2XGLA 3F14A 1I2FA 3H3HA 1Q40A 1GYBA 3OX9A 2QGUA 2WO0A 1FGRA 4J5KA 1YJ93 3D5IA 3IPTA 3KKGA 4O2HA 3UL5A 3WMDA 3X3ZA 1DMMA 4FR9A 4KFDA 1OGXA 4MJDA 4U13A 1BNEA 1OGZA 1OPYA 3LMLA 3EE1A 2CC3A 4XDWA 1YIT3 3BNCA 1NO3A 4FCMA 3URPA 5CF2A 3CD63 3BIRA 1GY5A 1UCIA 4OVMA 3RGAA 3OWSA 1UUVB 4STDA 4LEHA 4HYZA 2WOFA 1I0VA 2F86B 4KZ1A 2KCDA 1BRJA 1EA2A 2MC8A 4AEQA 2CWTA 3S5CA 1Q824 1IK3A 1Q9EA 4HKVB 3SLUA 2RBIA 2WGQA 4HM5B 4WYKA 5CK6A 4AKZA 3DGLA 5IG3A 2RNTA 3EF8A 3EN1B 3CCS3 4HZ9B 1CH0A 1ROVA 1Y4KA 5BIRA 4BTXA 1RMSA 1RNTA 1OACA 2UUGC 1GY6A 4KVHA 1GMPA 1RGLA 2WOHA 3AHSA 1GSPA 2UGIA 2H0IA 1I3FA 3PCSA 5JPPA 1CEWI 3WA3A 2A15A 3G6E3 3JUQA 3K5TA 4N6OB 1IV9A 1Q40B 5G2GA 1IVWA 1Q7HA 3LTAA 3A76A 2Y74A 3I563 1VQM3 4GL6A 2P38A 1W2B2 3DGYA 3F8XA 1VQO3 1BOXA 1W6CA 4BL3A 3CPW2 1AY7A 3VF1A 2ML6A 1IVUA 2JDIH 3KSPA 5BXQA 4LSOA 1R4YA 2KRTA 1LNIA 2FGTA 1OCVA 1FA3A 4WP5A 2CWUA 1A2PA 2GU1A 1EUIC 2KF6A 1DMNA 3GSPA 1TRQA 3UNLA 3CC23 3CCQ3 1RKYA 2QIYA 4BU4A 1D6UA 1O7GB 3FF0A 1K8A4 2W9PA 4RZMA 1X1WA 2F98A 1BRIA 3NHXA 4N6UA 1EG9B 1UW1A 2BHMA 5KP3A 3DGOA 4CCVA 3G4S3 4AKYA 4WYKB 4H61A 5AYRB 3UB1A 1W00A 1LVNA 3NV0A 3MG3A 2BMRB 3Q2PA 1VQL3 5IF6A 1JNQA 1YHQ3 2C11A 3WDGB 2GXFA 1ISKA 3D4AA 3DZLA 1GOYA 1LQMB 1UCJA 1FGMA 4EYCA 4RNYA 1JJ22 4XBYA 1K41A 4NREA 1ULIB 2XEPA 1VQN3 2ZHXB 3FLJA 3NBJA 2RFRA 3X42A 1W5ZA 2F4YA 2CW9A 1E97A 1O7MB 3N9HA 2KAAA 1UI8A 1W6GA 5IW9A 2W04A 1I2EA 1W6YA 1FGTA 1M1K4 3S27A 4FMAA 1BVIA 1OF5A 3SYUA 8RNTA 2F99A 1QALA 2B24B 1LRAA 3ER7A 1BRHA 3X3YA 2L1SA 4R1KA 4N6LA 1B27A 2KF4A 3OWYA 5GSPA 1JBRA 4MEIA 2CG0A 2XFSA 3GZYB 2E2VA 1E3VA 2CX0A 1BIRA 1JB5A 4LYLB 2BO9B 4N6NB 4HM4B 3SX1A 3JUNA 3KIIA 1OUNA 1RGEA 2F56A 3NV0B 4XDVA 3ROBA 1D6YA 3LT9A 2QEX3 3PS8A 5DREA 2XR8B 3SVAA 3RNTA 2XSOB 1LOYA 1U8CB 1PYLA 4HZBB 1BUJA 3PZWA 4I4KA 1TUHA 3J7Yd 4IPBA 4LMIA 1D6ZA 1UGIA 1K9M4 3AMOA 4KFFA 2OCTA 3ALAA 1N5HA 1X1UA
chains in the Genus database with same CATH topology
1B2MA 1BSBA 1B2UA 1BSCA 1ZGXA 1JBTA 1YNVX 1GOVA 4GSPA 4BIRA 1JBSA 1B3SA 1GMRA 1BRJA 1BNGA 1RGKA 4J5GA 1RSNA 5HOHA 1B21A 1Q9EA 1TTOA 2C4BA 1B2XA 1FUSA 1G02A 2RBIA 3AGNA 2RNTA 3WHOA 3AGOA 1CH0A 5BIRA 1BNIA 1BANA 1RGHA 1RMSA 1RNTA 1RTUA 9RNTA 2BIRA 1GMPA 1RGLA 3WR2A 3AHSA 1GSPA 1RN4A 1I3FA 2SARA 2HOHA 1UCKA 1MGWA 1BNSA 2AAEA 2GSPA 1RHLA 1FYSA 3BU4A 4HAAA 3DH2A 3DGYA 5BU4A 1BOXA 1AY7A 1HYFA 3D5GA 1MGRA 1I2GA 1R4YA 1LNIA 1C54A 7GSPA 2F5MA 1A2PA 2ZA4A 1I0XA 2KF6A 3GSPA 1TRQA 2KF5A 4RNTA 5RNTA 4BU4A 1LOVA 1B2ZA 2BU4A 1FUTA 1X1WA 1BRIA 1RGFA 1BNRA 1I70A 3KCHA 1BNJA 4GHOA 1FW7A 1RDSA 1RCKA 3Q3FA 1I3IA 1BAOA 1PY3A 1RGCA 1T2IA 1B20A 1I8VA 2KF3A 1DETA 3D4AA 1GOYA 1BSAA 1UCJA 1SARA 1LOWA 1RN1A 1X1XA 1YVSA 1BU4A 1AQZA 1GMQA 3AHWA 1BRGA 7RNTA 1IYYA 1UCLA 1BRKA 2F4YA 1BGSA 1HZ1A 2KAAA 1I2EA 1TRPA 1BVIA 1BRNL 1BRSA 3SYUA 8RNTA 6RNTA 1LRAA 1BRHA 1BSDA 1GOUA 1B27A 2KF4A 5GSPA 1T2HA 1JBRA 2AADA 1RGGA 1DE3A 1RGAA 1BIRA 1FZUA 1B2SA 1YGWA 1BNFA 3A5EA 1I2FA 1RGEA 2F56A 1RNBA 4HOHA 4J5KA 1RLSA 3D5IA 3RNTA 1LOYA 1PYLA 1RCLA 1BNEA 1BUJA 1BSEA 3HOHA 3URPA 3BIRA 1UCIA 2F5WA 6GSPA 1X1UA 1X1YA 1I0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2M A;  1BSB A;  1B2U A;  1BSC A;  1ZGX A;  1JBT A;  1YNV X;  1GOV A;  4GSP A;  4BIR A;  1JBS A;  1B3S A;  1GMR A;  1BRJ A;  1BNG A;  1RGK A;  4J5G A;  1RSN A;  5HOH A;  1B21 A;  1Q9E A;  1TTO A;  2C4B A;  1B2X A;  1FUS A;  1G02 A;  2RBI A;  3AGN A;  2RNT A;  3WHO A;  3AGO A;  1CH0 A;  5BIR A;  1BNI A;  1BAN A;  1RGH A;  1RMS A;  1RNT A;  1RTU A;  9RNT A;  2BIR A;  1GMP A;  1RGL A;  3WR2 A;  3AHS A;  1GSP A;  1RN4 A;  1I3F A;  2SAR A;  2HOH A;  1UCK A;  1MGW A;  1BNS A;  2AAE A;  2GSP A;  1RHL A;  1FYS A;  3BU4 A;  4HAA A;  3DH2 A;  3DGY A;  5BU4 A;  1BOX A;  1AY7 A;  1HYF A;  3D5G A;  1MGR A;  1I2G A;  1R4Y A;  1LNI A;  1C54 A;  7GSP A;  2F5M A;  1A2P A;  2ZA4 A;  1I0X A;  2KF6 A;  3GSP A;  1TRQ A;  2KF5 A;  4RNT A;  5RNT A;  4BU4 A;  1LOV A;  1B2Z A;  2BU4 A;  1FUT A;  1X1W A;  1BRI A;  1RGF A;  1BNR A;  1I70 A;  3KCH A;  1BNJ A;  4GHO A;  1FW7 A;  1RDS A;  1RCK A;  3Q3F A;  1I3I A;  1BAO A;  1PY3 A;  1RGC A;  1T2I A;  1B20 A;  1I8V A;  2KF3 A;  1DET A;  3D4A A;  1GOY A;  1BSA A;  1UCJ A;  1SAR A;  1LOW A;  1RN1 A;  1X1X A;  1YVS A;  1BU4 A;  1AQZ A;  1GMQ A;  3AHW A;  1BRG A;  7RNT A;  1IYY A;  1UCL A;  1BRK A;  2F4Y A;  1BGS A;  1HZ1 A;  2KAA A;  1I2E A;  1TRP A;  1BVI A;  1BRN L;  1BRS A;  3SYU A;  8RNT A;  6RNT A;  1LRA A;  1BRH A;  1BSD A;  1GOU A;  1B27 A;  2KF4 A;  5GSP A;  1T2H A;  1JBR A;  2AAD A;  1RGG A;  1DE3 A;  1RGA A;  1BIR A;  1FZU A;  1B2S A;  1YGW A;  1BNF A;  3A5E A;  1I2F A;  1RGE A;  2F56 A;  1RNB A;  4HOH A;  4J5K A;  1RLS A;  3D5I A;  3RNT A;  1LOY A;  1PYL A;  1RCL A;  1BNE A;  1BUJ A;  1BSE A;  3HOH A;  3URP A;  3BIR A;  1UCI A;  2F5W A;  6GSP A;  1X1U A;  1X1Y A;  1I0V A; 
#chains in the Genus database with same CATH topology
 1B2M A;  3RDE A;  1B2U A;  1BSC A;  3QRD A;  2YFI B;  3GZR A;  1JBT A;  4BIR A;  3MG1 A;  2OOV C;  1JBS A;  3DMC A;  1W02 A;  1LOX A;  4JRF A;  1RSN A;  1TIJ A;  3JUO A;  3EX9 A;  2GU3 A;  3CME 3;  2C4B A;  1B2X A;  1VQ4 3;  2O3O A;  3EJV A;  2STD A;  2W2C A;  2CFG A;  5AI1 A;  5ELU A;  2XH9 A;  2HMM B;  4EV2 A;  1DYU A;  2OWP A;  3M8C A;  3NXJ A;  1BAN A;  1RGH A;  3QK9 A;  4HM1 B;  3F40 A;  5AYS C;  3WR2 A;  5A0O B;  1RN4 A;  5I97 A;  3CCV 3;  1SPU A;  2HOH A;  1E3R A;  1VQK 3;  3O8Y A;  1IT7 A;  1YJW 3;  3LXU X;  4HAA A;  4IT7 A;  3WOD G;  3CU3 A;  3DH2 A;  1L5G B;  1EEJ A;  2YFJ B;  1HYF A;  2IY2 A;  4ORL A;  2YX9 A;  1PU4 A;  4R9K A;  2CG1 A;  1MGR A;  4MMZ B;  1EQK A;  3KFQ C;  7GSP A;  2M7O A;  1T5Y A;  3ZG5 A;  3AMO B;  5IEP A;  2ZA4 A;  4K1V A;  1I0X A;  5AEW B;  1SIH A;  3NBB A;  3B7C A;  4RNT A;  3V92 A;  4FMD A;  2P05 A;  1HU9 A;  4WWU C;  5RNT A;  1IU7 A;  2BU4 A;  1FUT A;  1VQ9 3;  1QMA A;  3HI7 A;  4HM0 B;  4WHA A;  2P09 A;  4O3V A;  2OTL 3;  1BNJ A;  3BNB A;  2H0G A;  3JUM A;  1FW7 A;  2RCD A;  1WTH A;  1N8Q A;  1RCK A;  5LC7 A;  3HK4 A;  1I3I A;  2OQE C;  1PY3 A;  2CIU A;  4ILF A;  1I8V A;  3ZFZ A;  2KF3 A;  3PXM A;  5IG4 A;  3CCE 3;  2UX0 A;  1V74 A;  1ZX2 A;  2WGO A;  1BSA A;  1LOW A;  1QAF A;  2ZDJ A;  3EQQ B;  2CHC A;  1ULJ B;  3DY5 A;  3DGN A;  3SXX A;  1BU4 A;  1BRG A;  4FCZ A;  1GS3 A;  5IG0 A;  3U97 A;  1BRK A;  3CPO A;  1MWR A;  3FH1 A;  1BGS A;  1SQW A;  3K0Z A;  3I55 3;  1JV2 B;  3CCR 3;  1TFK A;  5FGO A;  2JQ5 A;  1N9E A;  2GBX B;  3KSE D;  5EEO A;  3LOY A;  3ZG0 A;  1FGO A;  4BTW A;  1UDI I;  1BRS A;  5IEN A;  1M9G A;  2W56 A;  1UI7 A;  4EBG A;  1KD1 4;  3B4P A;  1DVD A;  5AIH A;  3SED A;  1NDO B;  3L0R A;  1JKG A;  5AII A;  3KN4 A;  1RGG A;  4K61 A;  1DE3 A;  8CHO A;  2RSX A;  1FZU A;  3FGY A;  1WQL B;  1YGW A;  4O02 B;  5FW5 A;  1BNF A;  3V99 A;  3A5E A;  4R4K A;  1MNL A;  3F9S A;  1W4N A;  5G1L A;  1RNB A;  1RRL A;  1WMO A;  1ROA A;  2O9U X;  3RGR A;  4CDL A;  1GY7 A;  1OH0 A;  2IYJ A;  3DUK A;  1W01 A;  1N8R 4;  1RCL A;  4NHF A;  4HBR A;  4HJL B;  3UL6 A;  3HOH A;  4O8S A;  3OV4 A;  2ZL8 A;  1JZD A;  4QWT A;  3SOY A;  1AR0 A;  5EQL A;  1O7W B;  6GSP A;  4TX4 A;  2CFW A;  2W9Q A;  1X1Y A;  4LGQ A;  3SOA A;  1ZGX A;  1S5A A;  1YNV X;  3NQZ A;  1Z1S A;  4EW5 A;  1U5O A;  4GSP A;  2B1X B;  2P0X A;  3MYT A;  2OOV A;  1JN5 A;  4L8O A;  1B3S A;  1RRH A;  1GMR A;  3G8Z A;  3VGN A;  1BNG A;  1RGK A;  4N6T A;  2W56 B;  1DMQ A;  3FKA A;  3BB9 A;  1TTO A;  3LTB A;  2HML B;  2XF3 A;  3G16 A;  3LTD A;  1NB5 I;  3LZA A;  4OK0 A;  2I9W A;  1WMP A;  2CFK A;  2FXT A;  3F7S A;  3HX8 A;  5EVH A;  2E2T A;  3TDG A;  1JKG B;  3D79 A;  1YGE A;  1BNI A;  3K63 A;  9RNT A;  1T3B A;  2Z6B A;  3GZB A;  1SII A;  1GD4 A;  2SAR A;  3OW2 2;  1TFO A;  1UCK A;  1MGW A;  1YI2 3;  1VQ8 3;  2GSP A;  2CWV A;  3K7C A;  1RHL A;  1FYS A;  3BU4 A;  3DXO A;  3FG3 A;  3HII A;  1MWT A;  5D82 A;  3CC7 3;  3N54 B;  4HVN A;  1MWS A;  2ML5 A;  4EC6 A;  2IUJ A;  3V98 A;  3B4O A;  3FCS B;  3MSO A;  1Q81 4;  1I2G A;  5KP1 A;  1C54 A;  2HMK B;  3FZW A;  3GAX A;  1N5P A;  1O7P B;  3BND A;  4MMX B;  3D3L A;  1NJI 4;  1VQ6 3;  2KF5 A;  5IEO A;  2BNG A;  1IVX A;  1S72 3;  3MWZ A;  5BVB A;  2HMO B;  2HMJ B;  1LOV A;  1B2Z A;  3ECF A;  2SBL A;  1JN5 B;  4L7K A;  3T0U A;  1RGF A;  4X2H A;  4EV5 A;  3LTC A;  4FCJ A;  1UUW B;  4KT3 B;  3S29 A;  3X40 A;  1VQ7 3;  3CCU 3;  1DVC A;  2IUK A;  1IQ8 A;  1JRQ A;  4K1U A;  3X3X A;  5AEU B;  1YIJ 3;  3T8N A;  1B20 A;  4PEJ A;  5CLK A;  2OTJ 3;  2FNQ A;  1A2K A;  1W7C A;  5KP4 A;  1VQQ A;  2E2U A;  4CJN A;  1DET A;  5D81 A;  1HKX A;  1BUQ A;  1RN1 A;  4Q53 A;  1TP6 A;  3CC4 3;  1QAK A;  3EBT A;  5AIF A;  5HGR A;  1AQZ A;  1GMQ A;  1QJG A;  2C10 A;  7RNT A;  5M18 A;  1TU5 A;  1K73 4;  2J8X B;  2R4I A;  1WNH A;  2BMQ B;  1JZO A;  3CCL 3;  2PZV A;  3GWR A;  7STD A;  5D83 A;  1HZ1 A;  4FMC A;  4X2O A;  2CX1 A;  1NU3 A;  4ZM8 A;  1RN7 A;  3KE7 A;  3PCR A;  4CPK A;  3EBY A;  3X41 A;  3JUP A;  3PGB A;  1TRP A;  3Q90 A;  1NB3 I;  1A90 A;  5ELJ A;  1FUW A;  3WOF B;  4XBT A;  2XRX B;  3MKI A;  1G0T A;  2XGN A;  1GOU A;  2P0M A;  3STD A;  3IJE B;  1T2H A;  2AAD A;  5DRV A;  3Q1C A;  1K28 A;  1UUG B;  2H0H A;  2L4V A;  2Y73 A;  1US1 A;  1LXE A;  4BL2 A;  1VZZ A;  3FG1 A;  2V1L A;  1OHO A;  4HM2 B;  5M19 A;  1A2V A;  4HOH A;  3G0K A;  4RNZ A;  1RLS A;  3DM8 A;  3EB8 A;  4OUQ A;  4GB5 A;  4IIA A;  4H3U A;  1KQS 2;  1C7H A;  3GZX B;  3B8L A;  3WA2 X;  1BSE A;  3NM2 A;  1W2Z A;  1IT8 A;  1CYV A;  2W03 A;  1JB2 A;  3OWU A;  2F5W A;  4JF8 A;  1CYU A;  2CK3 H;  4MMY B;  1JB4 A;  1IQX A;  3PYJ A;  1OHP A;  2K0M A;  2PNC A;  1BSB A;  3D9R A;  2RGQ A;  3WOE B;  1A67 A;  1G96 A;  2W6J H;  3LH4 A;  1GOV A;  3K9M C;  1CQS A;  4NPB A;  5STD A;  4DKI A;  3BLZ A;  1VQ5 3;  4J5G A;  2INX A;  5HOH A;  1B21 A;  2GEX A;  4XM4 A;  1Q7Y 4;  1FUS A;  1G02 A;  3E99 A;  3U1W A;  1V58 A;  1R4C A;  2CFL A;  2K54 A;  3AGN A;  4N6M A;  3WHO A;  3S28 A;  3CXC 2;  3AGO A;  1QVG 2;  3T8U A;  3IMA B;  1AVK A;  4J9A A;  5TGN A;  1RTU A;  5CXO A;  1WMN A;  2BIR A;  2GBW B;  3NBR A;  1NNV A;  4R9L A;  3GRD A;  2BT3 A;  5IG5 A;  1OHS A;  1BNS A;  1SJW A;  1STF I;  2YFL B;  3KZT A;  2AAE A;  3LT8 A;  3FF2 A;  3EN8 A;  4KFE A;  1LNH A;  1ASK A;  3MHE A;  1J2B A;  1EKM A;  5BU4 A;  4FMB A;  3CCJ 3;  2R41 A;  2Z7A A;  5CF1 A;  2XFT A;  1ZS7 A;  5IER A;  1MWU A;  3D5G A;  4HM7 B;  4K90 B;  5JPU A;  3EHC A;  4J8T A;  3CCM 3;  2GEY A;  1FGQ A;  1ZO2 A;  1KSI A;  2F5M A;  1AVL A;  1LQG C;  4HM6 B;  4WFO A;  2Z77 A;  4I5Q A;  3G71 3;  5LC6 A;  3NUV A;  1UGH I;  4RBN A;  1IV7 A;  1GD3 A;  3N8B A;  2BMO B;  1BNR A;  1TJD A;  2XSH B;  4XBX A;  1Q86 4;  3HZP A;  2D42 A;  1I70 A;  3KCH A;  3CNX A;  3UJM A;  2QA4 3;  4GHO A;  6STD A;  2LYX A;  4R80 A;  1NWW A;  1RDS A;  1KC8 4;  1YVB I;  3MPH A;  1QVF 2;  2CKF B;  3MG2 A;  1M1X B;  3Q3F A;  1BAO A;  3F7X A;  4HM8 B;  5M1A A;  1RGC A;  1PFP A;  1T2I A;  3CNM A;  3FG4 A;  2W0Q A;  3H51 A;  3NX0 A;  3OXA A;  2KXG A;  1N9J A;  1SAR A;  2LQV A;  1X1X A;  5JBS A;  2IMJ A;  1YVS A;  4LZI A;  3DGM A;  4N3V A;  1RJO A;  4XB5 A;  3F8H A;  3AHW A;  3NQY A;  1STD A;  3CMA 3;  1IYY A;  1UCL A;  3NM7 A;  2Q07 A;  4EXR A;  1Q42 A;  5AIG A;  1VQP 3;  3HIG A;  1IVV A;  3EC9 A;  2CH9 A;  2CFD A;  1F8N A;  1KWI A;  3BNE A;  3FSD A;  3JVC A;  1BRN L;  4N6V 0;  1IQY A;  1AV4 A;  6RNT A;  1MOL A;  1YJN 3;  2IA7 A;  1M90 4;  3VSY A;  1BSD A;  2D1W A;  1V57 A;  2OQE A;  2K3D A;  2Z76 A;  1IDP A;  3S67 A;  4G1M B;  1O7H B;  2HMN B;  3I0Y A;  4HM3 B;  5G1K A;  1OF5 B;  1RGA A;  1O7N B;  1B2S A;  2MF7 A;  3LYG A;  4L8P A;  4BTY A;  2XGL A;  3F14 A;  1I2F A;  3H3H A;  1Q40 A;  1GYB A;  3OX9 A;  2QGU A;  2WO0 A;  1FGR A;  4J5K A;  1YJ9 3;  3D5I A;  3IPT A;  3KKG A;  4O2H A;  3UL5 A;  3WMD A;  3X3Z A;  1DMM A;  4FR9 A;  4KFD A;  1OGX A;  4MJD A;  4U13 A;  1BNE A;  1OGZ A;  1OPY A;  3LML A;  3EE1 A;  2CC3 A;  4XDW A;  1YIT 3;  3BNC A;  1NO3 A;  4FCM A;  3URP A;  5CF2 A;  3CD6 3;  3BIR A;  1GY5 A;  1UCI A;  4OVM A;  3RGA A;  3OWS A;  1UUV B;  4STD A;  4LEH A;  4HYZ A;  2WOF A;  1I0V A;  2F86 B;  4KZ1 A;  2KCD A;  1BRJ A;  1EA2 A;  2MC8 A;  4AEQ A;  2CWT A;  3S5C A;  1Q82 4;  1IK3 A;  1Q9E A;  4HKV B;  3SLU A;  2RBI A;  2WGQ A;  4HM5 B;  4WYK A;  5CK6 A;  4AKZ A;  3DGL A;  5IG3 A;  2RNT A;  3EF8 A;  3EN1 B;  3CCS 3;  4HZ9 B;  1CH0 A;  1ROV A;  1Y4K A;  5BIR A;  4BTX A;  1RMS A;  1RNT A;  1OAC A;  2UUG C;  1GY6 A;  4KVH A;  1GMP A;  1RGL A;  2WOH A;  3AHS A;  1GSP A;  2UGI A;  2H0I A;  1I3F A;  3PCS A;  5JPP A;  1CEW I;  3WA3 A;  2A15 A;  3G6E 3;  3JUQ A;  3K5T A;  4N6O B;  1IV9 A;  1Q40 B;  5G2G A;  1IVW A;  1Q7H A;  3LTA A;  3A76 A;  2Y74 A;  3I56 3;  1VQM 3;  4GL6 A;  2P38 A;  1W2B 2;  3DGY A;  3F8X A;  1VQO 3;  1BOX A;  1W6C A;  4BL3 A;  3CPW 2;  1AY7 A;  3VF1 A;  2ML6 A;  1IVU A;  2JDI H;  3KSP A;  5BXQ A;  4LSO A;  1R4Y A;  2KRT A;  1LNI A;  2FGT A;  1OCV A;  1FA3 A;  4WP5 A;  2CWU A;  1A2P A;  2GU1 A;  1EUI C;  2KF6 A;  1DMN A;  3GSP A;  1TRQ A;  3UNL A;  3CC2 3;  3CCQ 3;  1RKY A;  2QIY A;  4BU4 A;  1D6U A;  1O7G B;  3FF0 A;  1K8A 4;  2W9P A;  4RZM A;  1X1W A;  2F98 A;  1BRI A;  3NHX A;  4N6U A;  1EG9 B;  1UW1 A;  2BHM A;  5KP3 A;  3DGO A;  4CCV A;  3G4S 3;  4AKY A;  4WYK B;  4H61 A;  5AYR B;  3UB1 A;  1W00 A;  1LVN A;  3NV0 A;  3MG3 A;  2BMR B;  3Q2P A;  1VQL 3;  5IF6 A;  1JNQ A;  1YHQ 3;  2C11 A;  3WDG B;  2GXF A;  1ISK A;  3D4A A;  3DZL A;  1GOY A;  1LQM B;  1UCJ A;  1FGM A;  4EYC A;  4RNY A;  1JJ2 2;  4XBY A;  1K41 A;  4NRE A;  1ULI B;  2XEP A;  1VQN 3;  2ZHX B;  3FLJ A;  3NBJ A;  2RFR A;  3X42 A;  1W5Z A;  2F4Y A;  2CW9 A;  1E97 A;  1O7M B;  3N9H A;  2KAA A;  1UI8 A;  1W6G A;  5IW9 A;  2W04 A;  1I2E A;  1W6Y A;  1FGT A;  1M1K 4;  3S27 A;  4FMA A;  1BVI A;  1OF5 A;  3SYU A;  8RNT A;  2F99 A;  1QAL A;  2B24 B;  1LRA A;  3ER7 A;  1BRH A;  3X3Y A;  2L1S A;  4R1K A;  4N6L A;  1B27 A;  2KF4 A;  3OWY A;  5GSP A;  1JBR A;  4MEI A;  2CG0 A;  2XFS A;  3GZY B;  2E2V A;  1E3V A;  2CX0 A;  1BIR A;  1JB5 A;  4LYL B;  2BO9 B;  4N6N B;  4HM4 B;  3SX1 A;  3JUN A;  3KII A;  1OUN A;  1RGE A;  2F56 A;  3NV0 B;  4XDV A;  3ROB A;  1D6Y A;  3LT9 A;  2QEX 3;  3PS8 A;  5DRE A;  2XR8 B;  3SVA A;  3RNT A;  2XSO B;  1LOY A;  1U8C B;  1PYL A;  4HZB B;  1BUJ A;  3PZW A;  4I4K A;  1TUH A;  3J7Y d;  4IPB A;  4LMI A;  1D6Z A;  1UGI A;  1K9M 4;  3AMO A;  4KFF A;  2OCT A;  3ALA A;  1N5H A;  1X1U A; 
#chains in the Genus database with same CATH homology
 1B2M A;  1BSB A;  1B2U A;  1BSC A;  1ZGX A;  1JBT A;  1YNV X;  1GOV A;  4GSP A;  4BIR A;  1JBS A;  1B3S A;  1GMR A;  1BRJ A;  1BNG A;  1RGK A;  4J5G A;  1RSN A;  5HOH A;  1B21 A;  1Q9E A;  1TTO A;  2C4B A;  1B2X A;  1FUS A;  1G02 A;  2RBI A;  3AGN A;  2RNT A;  3WHO A;  3AGO A;  1CH0 A;  5BIR A;  1BNI A;  1BAN A;  1RGH A;  1RMS A;  1RNT A;  1RTU A;  9RNT A;  2BIR A;  1GMP A;  1RGL A;  3WR2 A;  3AHS A;  1GSP A;  1RN4 A;  1I3F A;  2SAR A;  2HOH A;  1UCK A;  1MGW A;  1BNS A;  2AAE A;  2GSP A;  1RHL A;  1FYS A;  3BU4 A;  4HAA A;  3DH2 A;  3DGY A;  5BU4 A;  1BOX A;  1AY7 A;  1HYF A;  3D5G A;  1MGR A;  1I2G A;  1R4Y A;  1LNI A;  1C54 A;  7GSP A;  2F5M A;  1A2P A;  2ZA4 A;  1I0X A;  2KF6 A;  3GSP A;  1TRQ A;  2KF5 A;  4RNT A;  5RNT A;  4BU4 A;  1LOV A;  1B2Z A;  2BU4 A;  1FUT A;  1X1W A;  1BRI A;  1RGF A;  1BNR A;  1I70 A;  3KCH A;  1BNJ A;  4GHO A;  1FW7 A;  1RDS A;  1RCK A;  3Q3F A;  1I3I A;  1BAO A;  1PY3 A;  1RGC A;  1T2I A;  1B20 A;  1I8V A;  2KF3 A;  1DET A;  3D4A A;  1GOY A;  1BSA A;  1UCJ A;  1SAR A;  1LOW A;  1RN1 A;  1X1X A;  1YVS A;  1BU4 A;  1AQZ A;  1GMQ A;  3AHW A;  1BRG A;  7RNT A;  1IYY A;  1UCL A;  1BRK A;  2F4Y A;  1BGS A;  1HZ1 A;  2KAA A;  1I2E A;  1TRP A;  1BVI A;  1BRN L;  1BRS A;  3SYU A;  8RNT A;  6RNT A;  1LRA A;  1BRH A;  1BSD A;  1GOU A;  1B27 A;  2KF4 A;  5GSP A;  1T2H A;  1JBR A;  2AAD A;  1RGG A;  1DE3 A;  1RGA A;  1BIR A;  1FZU A;  1B2S A;  1YGW A;  1BNF A;  3A5E A;  1I2F A;  1RGE A;  2F56 A;  1RNB A;  4HOH A;  4J5K A;  1RLS A;  3D5I A;  3RNT A;  1LOY A;  1PYL A;  1RCL A;  1BNE A;  1BUJ A;  1BSE A;  3HOH A;  3URP A;  3BIR A;  1UCI A;  2F5W A;  6GSP A;  1X1U A;  1X1Y A;  1I0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...