4HM2B

Naphthalene 1,2-dioxygenase bound to ethylphenylsulfide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Naphthalene 1,2-Dioxygenase bound to ethylphenylsulfide
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
total genus 53
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm2B00
5TGNA 3ROBA 3ECFA 1GY5A 1NDOB 2GBWB 2B1XB 3FH1A 3EHCA 3GRDA 3EN8A 4HM2B 3CNXA 4KVHA 3S5CA 3BLZA 3GWRA 3MG3A 5CXOA 1JN5B 3NUVA 4R1KA 7STDA 3FZWA 4MJDA 1UUVB 3JUNA 3T8UA 1ULIB 5JPUA 1OH0A 2YFLB 3NV0B 4WWUC 4RZMA 1IDPA 1U5OA 3B4OA 3GZRA 3B7CA 1ZX2A 1TP6A 3GZXB 3LYGA 1JB5A 3KKGA 1OHPA 3LZAA 4K1UA 1O7WB 3KZTA 1W01A 1W6YA 2W2CA 5BVBA 3SOYA 5IG3A 3MHEA 4GB5A 3F14A 4LMIA 3M8CA 4Q53A 5AIGA 2RFRA 5D82A 3UJMA 1STDA 5AEWB 1O7PB 4HM4B 6STDA 5KP4A 1S5AA 2JQ5A 5BXQA 3EC9A 2F86B 2Z7AA 3K7CA 5IF6A 4XB5A 1O7NB 2HMLB 4XDWA 1QMAA 3DM8A 5AI1A 3DXOA 1W00A 4HM8B 5IEOA 5IEPA 3KE7A 3F9SA 4HM6B 2XSOB 2HMKB 4HVNA 4WYKA 1E97A 1OF5B 3NXJA 3STDA 1CQSA 3MG2A 4HM7B 4CDLA 5IG0A 2STDA 3JUOA 4XBYA 1E3VA 2GBXB 1O7GB 4XBTA 5AEUB 1GS3A 1C7HA 1NU3A 1QJGA 2Z76A 3F8HA 3G8ZA 2YFIB 3VGNA 1ZO2A 3B4PA 4K1VA 5DRVA 1K41A 1GYBA 3DUKA 3SEDA 1GY7A 5JPPA 3FGYA 2GEYA 2BMRB 5D83A 1OGXA 3UNLA 4R9LA 5DREA 2RCDA 1OHSA 2PZVA 2R4IA 3GZYB 4L7KA 3K0ZA 4HM1B 3DZLA 1JB4A 2CKFB 2XRXB 3G0KA 3OWYA 4OUQA 3NM2A 1UUWB 3JUPA 3OV4A 1OPYA 2QGUA 3OWSA 2BNGA 4H3UA 4WYKB 4N3VA 1A2KA 1OF5A 5G2GA 1JKGB 2YFJB 1DMQA 1ULJB 1DMNA 3MKIA 4HM0B 1TUHA 1VZZA 1DMMA 3JUQA 3MYTA 2A15A 5AIHA 3H51A 5AIFA 3ER7A 1W02A 3OX9A 5HGRA 5IG5A 3F40A 5IERA 3B8LA 4ORLA 2K54A 3CNMA 1OCVA 4LEHA 5FW5A 2I9WA 4HM3B 1BUQA 3FLJA 3HX8A 1JB2A 2UX0A 3DMCA 4L8OA 4HKVB 4X2OA 1ASKA 5STDA 3RGAA 3RGRA 4R9KA 1AR0A 3FSDA 2BMQB 3JUMA 5KP3A 1JN5A 3EN1B 1Q40B 3KSPA 2GXFA 3MG1A 3BB9A 3NHXA 4HZBB 4X2HA 4J9AA 3HZPA 2XSHB 3EJVA 2HMOB 1EG9B 3GZBA 4LGQA 1OGZA 3D9RA 3EBYA 3EF8A 4HJLB 4J8TA 4XBXA 5AIIA 3WMDA 1GY6A 3I0YA 4XDVA 2CHCA 3NV0A 4FCJA 3T8NA 8CHOA 1OHOA 3EBTA 1HKXA 3G16A 3OWUA 2B24B 2QIYA 5CK6A 2RGQA 3OXAA 1OUNA 2XR8B 3HK4A 4HZ9B 3FKAA 5CF2A 1E3RA 2HMJB 3FF2A 4PEJA 3F7XA 1ISKA 5KP1A 3IPTA 4WP5A 5CF1A 1O7HB 2IMJA 3FF0A 3SOAA 1O7MB 1JKGA 3H3HA 3CU3A 3MSOA 4OVMA 5EVHA 4L8PA 2F99A 2GEXA 2Z77A 4IIAA 1SJWA 2HMMB 3EQQB 5CLKA 3Q90A 2INXA 2F98A 4FCMA 4U13A 1Z1SA 3VSYA 5IG4A 1EA2A 1Q42A 5IENA 3A76A 2HMNB 3NBRA 1NWWA 4XM4A 1Q40A 3CPOA 1WQLB 3E99A 3EX9A 5D81A 2OWPA 4HM5B 4STDA 3F7SA 2BMOB 4I4KA 3F8XA
chains in the Genus database with same CATH superfamily
1NNVA 2AAEA 3BNCA 1NDOB 1N5PA 2B1XB 2XFTA 3ECFA 3CXC2 1UCIA 2FGTA 2KF4A 3GWRA 3MG3A 1RJOA 5LC7A 4K90B 1CH0A 4R1KA 2PNCA 1BRGA 1X1XA 1UUVB 3URPA 1RN7A 2IY2A 1FZUA 3NV0B 1IVVA 1LOWA 2O3OA 5EEOA 1U5OA 1IVXA 1U8CB 2Y73A 2E2UA 1HZ1A 5M18A 3I563 2KXGA 3DGOA 2P09A 1RHLA 2ZL8A 3KKGA 1V58A 2IA7A 3D3LA 4HOHA 1B21A 1G96A 2W2CA 2CFLA 4GB5A 4LMIA 1BUJA 1IQYA 4N6TA 3UJMA 1STDA 6STDA 1UCLA 1V74A 4ZM8A 3FG4A 1FGRA 1PU4A 1N9EA 3EC9A 1VQQA 5AYSC 5IF6A 1T5YA 3GAXA 3DM8A 3U1WA 3DXOA 1W00A 1BRHA 2CX1A 1VQK3 2CFGA 4O8SA 4EC6A 1CQSA 1X1WA 3MG2A 1E3VA 1NJI4 1GS3A 1I3FA 1NU3A 1A90A 3F8HA 4R4KA 2YFIB 4U13A 3CCJ3 3I553 1ZS7A 3SX1A 3N8BA 1SIHA 3LTDA 1DVCA 2CG0A 3ZG5A 1Q7HA 2C11A 5M19A 1YIJ3 2P0XA 1W7CA 2GEYA 4KZ1A 3UNLA 1UGIA 1M1K4 5DREA 2RCDA 3GSPA 3GZYB 2CKFB 2XRXB 1RGCA 3KSED 3PYJA 4WYKB 4MMXB 5G2GA 5IW9A 3MKIA 3X42A 4CCVA 2XH9A 1DMMA 3JUQA 1BNFA 2A15A 3H51A 2CC3A 5BU4A 1K734 5HGRA 3F40A 4HAAA 3HIIA 2BT3A 3AHSA 4LEHA 1LOXA 4ORLA 4OK0A 1BUQA 4N6MA 1JB2A 1GOUA 2UX0A 5ELJA 2MC8A 1AQZA 4HKVB 4X2OA 1ASKA 5STDA 2KRTA 3PZWA 4AEQA 5HOHA 2P38A 1IV9A 2OQEC 3FSDA 1JN5A 3EN1B 3ZFZA 1N8QA 2GXFA 4X2HA 3X3YA 4J9AA 3KFQC 1D6YA 2V1LA 1FGQA 1OGZA 3D9RA 4J8TA 7GSPA 1EUIC 1BOXA 1MWTA 2M7OA 3D5IA 3I0YA 2CWUA 1OHOA 3EBTA 2B24B 2QIYA 3BNEA 4FCZA 2RGQA 1OUNA 3EB8A 1BSCA 2CFKA 3HK4A 2OQEA 3CC43 3F7XA 3DGYA 3IPTA 1O7HB 1FA3A 4HBRA 2OOVC 3AHWA 1O7MB 3N9HA 2OTJ3 1RMSA 4KFEA 4L8PA 1MNLA 5CLKA 2Z6BA 3EQQB 3DY5A 2D1WA 9RNTA 4WHAA 1YJN3 3Q3FA 3DH2A 4HYZA 1Q42A 4BL3A 5A0OB 1RGAA 4H61A 1BNEA 1NWWA 3CPOA 3D79A 4FMBA 4HM5B 4I4KA 3Q2PA 1RNBA 3UB1A 2GBWB 2OOVA 3FH1A 3EN8A 3S5CA 3L0RA 1IYYA 2BO9B 2IYJA 3BLZA 1TTOA 3X3ZA 4QWTA 4AKYA 3K5TA 1YVBI 3NUVA 3CC73 1VQ73 1K9M4 1T2IA 3FZWA 4BTYA 1TIJA 2WOHA 1UCKA 3JUNA 3T8UA 2W56A 3RDEA 1RGGA 2ML5A 4RZMA 1B2MA 3N54B 1W6GA 3B4OA 1KQS2 1RTUA 1TP6A 3K9MC 2SBLA 1O7WB 1LRAA 1W6YA 5IG3A 2RSXA 3CMA3 2L1SA 4AKZA 1TJDA 3PCSA 1RKYA 2CWVA 3PXMA 6RNTA 1I2GA 1MGRA 2JQ5A 1VQ53 1VQN3 2WO0A 2Z7AA 1BRSA 4XB5A 1O7NB 1BIRA 4XDWA 1CYVA 5AI1A 1JRQA 5IEOA 3S67A 2C10A 1YJW3 2Y74A 3KE7A 1DETA 4HM6B 2F5WA 2HMKB 2XSOB 2SARA 3LH4A 4WYKA 1VQ43 4CDLA 1EKMA 5IG0A 2KF5A 4XBTA 1BANA 2OTL3 3NQZA 4G1MB 1GD3A 4O02B 4I5QA 2CG1A 1X1UA 1GYBA 3PCRA 3S27A 3SYUA 3DUKA 4MEIA 1K8A4 2WGQA 1GMQA 4R80A 1FGTA 3FGYA 2E2TA 3PS8A 3MPHA 7RNTA 1G0TA 1YVSA 2BMRB 1I70A 1OGXA 3WDGB 1T3BA 1LNHA 2GU3A 1NB5I 4NREA 1OHSA 1BRJA 2W03A 3BNBA 1TFOA 1ROVA 3WA3A 4OUQA 3TDGA 3CCU3 2QA43 3NM2A 4RNTA 3OW22 2W0QA 4FR9A 4N3VA 1A2KA 1OF5A 2KF3A 2Q07A 2YFJB 4HM0B 1BNJA 1LOVA 1VZZA 4GL6A 2UUGC 3AMOB 4IPBA 1Q7Y4 1A2PA 1SARA 5RNTA 1RCKA 3LT9A 1BRIA 1I0VA 1LQGC 1BAOA 3CNMA 1OCVA 1M904 2P05A 2I9WA 1D6UA 1W2B2 3EE1A 1BNIA 1IQ8A 1UCJA 3RGAA 3ZG0A 1RGLA 3SVAA 2CWTA 1LOYA 1QALA 2BMQB 2FNQA 5AEUB 3NHXA 3BB9A 3D5GA 1BNSA 3EJVA 2HMOB 1EG9B 3GZBA 5I97A 3CCV3 1JBTA 1I0XA 1NO3A 2CHCA 3NV0A 1QAFA 4FCJA 5G1LA 4CPKA 8CHOA 1B2ZA 3OWUA 4O2HA 1GMRA 1GOVA 2CH9A 3FCSB 4HZ9B 1BSAA 4EV2A 3WA2X 5CF2A 1ISKA 1ZGXA 4N6V0 4N6UA 4LYLB 1IT8A 4WP5A 5CF1A 4KFDA 4NPBA 1JKGA 2IUJA 3G4S3 1MOLA 3CCL3 2GEXA 2Z77A 1SJWA 3O8YA 2INXA 1Q824 1QAKA 3A76A 4K61A 3CPW2 4XM4A 3E99A 1JBRA 3X41A 4FMCA 3F7SA 4N6LA 1FUWA 1R4YA 3LTAA 3F8XA 5TGNA 3ROBA 3EHCA 1FGOA 3GRDA 4KVHA 3A5EA 3CNXA 1LNIA 5CXOA 1D6ZA 1G02A 1STFI 3HI7A 1C54A 1Q864 3PGBA 2O9UX 2LYXA 1ULIB 5JPUA 1OH0A 3SXXA 3LT8A 3B7CA 1ZX2A 2F56A 3S28A 4FMAA 1JB5A 1RN4A 2J8XB 5BIRA 3LZAA 1WMPA 1MWRA 3HOHA 1KC84 3KZTA 4BL2A 1CYUA 1W01A 3MWZA 3BNDA 1I3IA 3MHEA 2QEX3 3F14A 2W6JH 3M8CA 4Q53A 4J5GA 5AIGA 3AGNA 1V57A 5AEWB 1O7PB 4DKIA 5KP4A 3T0UA 3UL5A 3K7CA 3CCQ3 3LTCA 2OCTA 1UI7A 1QMAA 5IEPA 1M9GA 5ELUA 3F9SA 1VQO3 1LQMB 4HVNA 1DE3A 1E97A 1OF5B 3DGLA 3STDA 1BSBA 4XBYA 3JUOA 3X40A 1QJGA 2Z76A 4BTXA 1DYUA 3B4PA 4K1VA 2CFWA 3J7Yd 1Y4KA 5JPPA 4TX4A 4EXRA 4GSPA 4BIRA 1IQXA 3IJEB 1WTHA 1SIIA 3KN4A 1BRKA 5D83A 3CC23 3Q1CA 2ML6A 2ZDJA 4R9LA 3K0ZA 5JBSA 3DZLA 1JB4A 3G0KA 3OWYA 3JUPA 4NHFA 1W5ZA 2QGUA 3OWSA 2BNGA 4H3UA 1KSIA 1IVUA 2W04A 1DMNA 3VF1A 4N6OB 4EV5A 1TUHA 4RNZA 1VQM3 2WOFA 2BU4A 1TRQA 4FMDA 5AIHA 4EW5A 5AIFA 8RNTA 1B2UA 1B2SA 3OX9A 5IG5A 5IERA 3B8LA 1WMNA 1YJ93 2AADA 3K63A 3LMLA 2D42A 2P0MA 4EBGA 1AVLA 3HX8A 1A67A 3D4AA 1HYFA 1TU5A 1B2XA 1IT7A 3DMCA 1EEJA 1FYSA 3V99A 3RGRA 1J2BA 1AR0A 3DGNA 4IT7A 5KP3A 3AGOA 1FW7A 1BSDA 4HJLB 4LGQA 3WMDA 3QK9A 2W56B 4XDVA 2CFDA 3V92A 1IK3A 2JDIH 3G713 1YI23 2KCDA 3CD63 1QVG2 1F8NA 2XR8B 3FKAA 1E3RA 3KIIA 3FF2A 4PEJA 1DVDA 3U97A 1N8R4 1RGKA 1UDII 3FF0A 3NX0A 3IMAB 3G6E3 4OVMA 5EVHA 1L5GB 1HU9A 3LOYA 2R41A 4IIAA 2KF6A 1Q814 3Q90A 4FCMA 1K28A 1PY3A 1RDSA 1X1YA 2UGIA 2W9PA 3BIRA 3FG3A 2HMNB 3HIGA 3NBRA 1S723 3NM7A 4O3VA 1Q40A 1WQLB 1A2VA 5D81A 2H0IA 2OWPA 2BMOB 1UI8A 5FW5A 1MWUA 3LXUX 3CCS3 1BSEA 1GY5A 1UW1A 4HM2B 2XEPA 2C4BA 2HOHA 1VQ93 1PFPA 1YIT3 1RNTA 1JN5B 4RNYA 1AY7A 1TFKA 1AV4A 1UUGB 1MGWA 2W9QA 3WODG 7STDA 1JZDA 2WGOA 4MJDA 4J5KA 4BTWA 1W6CA 2XGLA 2YFLB 4WWUC 3NBBA 1IDPA 4MMYB 3LTBA 3GZRA 1VQL3 1N9JA 2LQVA 2MF7A 4GHOA 2CK3H 3GZXB 3LYGA 1OHPA 3NQYA 3KCHA 3V98A 4K1UA 1US1A 1I2FA 3CCE3 5BVBA 2RFRA 2F5MA 4LZIA 5D82A 3WHOA 5FGOA 4HM4B 1S5AA 3WOFB 5BXQA 1RLSA 2F86B 1T2HA 2L4VA 4LSOA 2HMLB 2CIUA 4HM8B 1RRHA 1SPUA 1BNGA 1YGWA 1YNVX 1JBSA 3NXJA 3QRDA 1GMPA 1JNQA 1WNHA 4HM7B 2XF3A 1B27A 1WMOA 2STDA 3S29A 2GBXB 1O7GB 1C7HA 3NBJA 3G8ZA 1JV2B 1VQ83 3VGNA 1ZO2A 1JJ22 1BU4A 1GOYA 1YGEA 5DRVA 1K41A 2RBIA 1BGSA 1CEWI 1RSNA 2GSPA 3SEDA 1GY7A 1TRPA 3X3XA 3CCM3 1SQWA 1W2ZA 3BU4A 4EYCA 5G1KA 1VQP3 1GD4A 4L7KA 2BHMA 2K0MA 2PZVA 2R4IA 4MMZB 4ILFA 4HM1B 1M1XB 3RNTA 4CJNA 1IVWA 1BVIA 1UUWB 1Q9EA 1OPYA 3OV4A 1BNRA 2CW9A 4KT3B 1JKGB 2H0GA 1DMQA 1MWSA 1ULJB 4JF8A 3UL6A 3WOEB 1VQ63 1BRNL 3FG1A 3MYTA 3CME3 1KWIA 1B20A 1LXEA 1ROAA 1B3SA 2IUKA 1W02A 3ER7A 1FUTA 2K54A 1KD14 1OACA 4HM3B 1RGFA 3FLJA 4RBNA 3SLUA 2ZHXB 4L8OA 5GSPA 2ZA4A 1FUSA 1NB3I 4R9KA 1JZOA 5M1AA 2CX0A 1GSPA 2XGNA 3JUMA 4KFFA 2KAAA 1Q40B 3KSPA 4HZBB 3MG1A 5AYRB 3SOYA 1UGHI 2XSHB 3HZPA 5EQLA 3EF8A 2F4YA 3EBYA 5AIIA 4BU4A 4XBXA 1GY6A 1RCLA 3T8NA 3CCR3 1R4CA 3G16A 1HKXA 1YHQ3 1RN1A 5CK6A 3DGMA 2K3DA 3OXAA 6GSPA 2H0HA 1IU7A 3ALAA 1W4NA 1EQKA 2GU1A 1LVNA 2HMJB 1PYLA 1RRLA 1I8VA 5KP1A 2FXTA 2IMJA 3JVCA 3SOAA 1QVF2 3MSOA 3H3HA 3CU3A 1FGMA 1RGHA 2RNTA 2F99A 2E2VA 2HMMB 3AMOA 2XFSA 1IV7A 1AVKA 2F98A 1N5HA 1Z1SA 3VSYA 5IG4A 1EA2A 5IENA 1I2EA 5LC6A 3EX9A 1RGEA 4STDA 4JRFA 4WFOA 2BIRA 3WR2A 2YX9A 4N6NB
chains in the Genus database with same CATH topology
3ECFA 3CXC2 3BNCA 1NDOB 1N5PA 2B1XB 2XFTA 2FGTA 3GWRA 3MG3A 1RJOA 5LC7A 4K90B 4R1KA 2PNCA 1UUVB 1RN7A 3NV0B 1IVVA 2O3OA 5EEOA 1U5OA 1IVXA 1U8CB 2Y73A 2E2UA 3I563 2KXGA 3DGOA 2P09A 3KKGA 2ZL8A 2IA7A 3D3LA 1G96A 2W2CA 2CFLA 4GB5A 4LMIA 1IQYA 4N6TA 3UJMA 1STDA 6STDA 1V74A 4ZM8A 3FG4A 1FGRA 1PU4A 1N9EA 3EC9A 5AYSC 5IF6A 1T5YA 3GAXA 3DM8A 3U1WA 3DXOA 1W00A 1VQK3 2CFGA 4O8SA 4EC6A 1CQSA 3MG2A 1E3VA 1NJI4 1GS3A 1NU3A 1A90A 3F8HA 4R4KA 2YFIB 3CCJ3 3I553 3SX1A 3N8BA 1SIHA 3LTDA 1DVCA 2CG0A 2C11A 1YIJ3 2P0XA 1W7CA 2GEYA 4KZ1A 3UNLA 1M1K4 5DREA 2RCDA 3GZYB 2CKFB 2XRXB 3KSED 3PYJA 4WYKB 4MMXB 5G2GA 5IW9A 3MKIA 3X42A 4CCVA 2XH9A 1DMMA 3JUQA 2A15A 3H51A 2CC3A 1K734 5HGRA 3F40A 3HIIA 2BT3A 4ORLA 4LEHA 1LOXA 4OK0A 1BUQA 4N6MA 1JB2A 2UX0A 5ELJA 2MC8A 4HKVB 4X2OA 1ASKA 5STDA 2KRTA 3PZWA 4AEQA 2P38A 1IV9A 2OQEC 3FSDA 1JN5A 3EN1B 1N8QA 2GXFA 4X2HA 3X3YA 4J9AA 3KFQC 1D6YA 2V1LA 1FGQA 1OGZA 3D9RA 4J8TA 2M7OA 3I0YA 2CWUA 1OHOA 3EBTA 2B24B 2QIYA 3BNEA 4FCZA 2RGQA 1OUNA 3EB8A 2CFKA 3HK4A 2OQEA 3CC43 3F7XA 3IPTA 1O7HB 1FA3A 4HBRA 2OOVC 1O7MB 3N9HA 2OTJ3 4KFEA 4L8PA 1MNLA 5CLKA 2Z6BA 3EQQB 3DY5A 2D1WA 4WHAA 1YJN3 4HYZA 1Q42A 5A0OB 4H61A 1NWWA 3CPOA 4FMBA 4HM5B 4I4KA 3Q2PA 3UB1A 2GBWB 2OOVA 3FH1A 3EN8A 3S5CA 3L0RA 2BO9B 3BLZA 3X3ZA 4QWTA 4AKYA 3K5TA 1YVBI 3NUVA 3CC73 1VQ73 1K9M4 3FZWA 4BTYA 1TIJA 2WOHA 3JUNA 3T8UA 2W56A 3RDEA 2ML5A 4RZMA 3N54B 1W6GA 3B4OA 1KQS2 1TP6A 3K9MC 2SBLA 1O7WB 1W6YA 5IG3A 2RSXA 3CMA3 4AKZA 3PCSA 1RKYA 2CWVA 3PXMA 1VQ53 1VQN3 2JQ5A 2WO0A 2Z7AA 4XB5A 1O7NB 4XDWA 1CYVA 5AI1A 1JRQA 5IEOA 3S67A 2C10A 1YJW3 2Y74A 3KE7A 4HM6B 2XSOB 2HMKB 3LH4A 4WYKA 1VQ43 4CDLA 1EKMA 5IG0A 4XBTA 2OTL3 3NQZA 4G1MB 1GD3A 4O02B 2CG1A 3PCRA 1GYBA 3S27A 3DUKA 4MEIA 1K8A4 2WGQA 4R80A 1FGTA 3FGYA 2E2TA 3PS8A 3MPHA 2BMRB 1OGXA 3WDGB 1LNHA 2GU3A 1NB5I 4NREA 1OHSA 2W03A 3BNBA 1TFOA 1ROVA 3WA3A 4OUQA 3TDGA 3CCU3 2QA43 3NM2A 3OW22 2W0QA 4FR9A 4N3VA 1A2KA 1OF5A 2Q07A 2YFJB 4HM0B 1VZZA 4GL6A 3AMOB 1Q7Y4 4IPBA 3LT9A 3CNMA 1OCVA 1M904 2P05A 2I9WA 1D6UA 1W2B2 3EE1A 1IQ8A 3RGAA 3SVAA 2CWTA 1QALA 2BMQB 2FNQA 5AEUB 3NHXA 3BB9A 5I97A 3EJVA 2HMOB 1EG9B 3GZBA 3CCV3 1NO3A 2CHCA 3NV0A 1QAFA 4FCJA 8CHOA 3OWUA 4O2HA 4HZ9B 2CH9A 3FCSB 4EV2A 5CF2A 1ISKA 3WA2X 4N6V0 4N6UA 1IT8A 4WP5A 5CF1A 4KFDA 1JKGA 2IUJA 3G4S3 1MOLA 3CCL3 2GEXA 2Z77A 1SJWA 3O8YA 2INXA 1Q824 1QAKA 3A76A 4K61A 3CPW2 4XM4A 3E99A 3X41A 4FMCA 3F7SA 4N6LA 1FUWA 3LTAA 3F8XA 5TGNA 3ROBA 3EHCA 1FGOA 3GRDA 4KVHA 3CNXA 5CXOA 1D6ZA 1STFI 3HI7A 1Q864 3PGBA 2O9UX 2LYXA 1ULIB 5JPUA 1OH0A 3SXXA 3LT8A 3B7CA 1ZX2A 3S28A 4FMAA 1JB5A 3LZAA 1WMPA 1KC84 3KZTA 1CYUA 1W01A 3MWZA 3BNDA 3MHEA 2QEX3 3F14A 2W6JH 3M8CA 4Q53A 5AIGA 5AEWB 1O7PB 5KP4A 3T0UA 3UL5A 3K7CA 3CCQ3 3LTCA 2OCTA 1UI7A 1QMAA 5IEPA 1M9GA 5ELUA 3F9SA 1VQO3 4HVNA 1E97A 1OF5B 3DGLA 3STDA 4XBYA 3JUOA 3X40A 1QJGA 2Z76A 4BTXA 1DYUA 3B4PA 4K1VA 2CFWA 3J7Yd 1Y4KA 5JPPA 4TX4A 4EXRA 1IQXA 3IJEB 1WTHA 1SIIA 3KN4A 5D83A 3CC23 3Q1CA 2ML6A 2ZDJA 4R9LA 3K0ZA 5JBSA 3DZLA 1JB4A 3G0KA 3OWYA 3JUPA 4NHFA 1W5ZA 2QGUA 3OWSA 2BNGA 4H3UA 1KSIA 1IVUA 2W04A 1DMNA 3VF1A 4N6OB 4EV5A 1TUHA 4RNZA 1VQM3 2WOFA 4FMDA 5AIHA 5AIFA 3OX9A 5IG5A 5IERA 3B8LA 1WMNA 1YJ93 3K63A 3LMLA 2D42A 2P0MA 4EBGA 1AVLA 3HX8A 1A67A 1TU5A 1IT7A 3DMCA 1J2BA 3V99A 3RGRA 1AR0A 3DGNA 4IT7A 5KP3A 4LGQA 4HJLB 3WMDA 3QK9A 2W56B 4XDVA 2CFDA 3V92A 1IK3A 2JDIH 3G713 1YI23 2KCDA 3CD63 1QVG2 1F8NA 2XR8B 3FKAA 1E3RA 3KIIA 3FF2A 4PEJA 1DVDA 3U97A 1N8R4 3NX0A 3FF0A 3IMAB 3G6E3 4OVMA 5EVHA 1L5GB 1HU9A 3LOYA 4IIAA 1Q814 3Q90A 4FCMA 1K28A 4U13A 1VQ93 3HIGA 2W9PA 3FG3A 1S723 3NBRA 2HMNB 3NM7A 4O3VA 1Q40A 1WQLB 1A2VA 5D81A 2OWPA 2BMOB 1UI8A 5FW5A 3LXUX 3CCS3 1GY5A 1UW1A 4HM2B 2XEPA 1PFPA 1YIT3 1JN5B 4RNYA 1TFKA 2W9QA 1AV4A 3WODG 7STDA 2WGOA 4MJDA 4BTWA 1W6CA 2XGLA 2YFLB 4WWUC 3NBBA 1IDPA 4MMYB 3LTBA 3GZRA 1VQL3 1N9JA 2LQVA 2MF7A 2CK3H 3GZXB 3LYGA 1OHPA 3NQYA 3V98A 4K1UA 1US1A 3CCE3 5BVBA 2RFRA 4LZIA 5D82A 5FGOA 4HM4B 1S5AA 3WOFB 5BXQA 2F86B 2L4VA 4LSOA 2HMLB 2CIUA 4HM8B 1RRHA 1SPUA 3NXJA 3QRDA 1WNHA 1JNQA 4HM7B 2XF3A 3S29A 1WMOA 2STDA 2GBXB 1O7GB 1C7HA 3NBJA 3G8ZA 1JV2B 1VQ83 3VGNA 1ZO2A 1JJ22 1YGEA 5DRVA 1K41A 1CEWI 3SEDA 1GY7A 3X3XA 3CCM3 1SQWA 1W2ZA 4EYCA 1VQP3 1GD4A 4L7KA 2BHMA 2K0MA 2PZVA 2R4IA 4MMZB 4HM1B 1M1XB 1IVWA 1UUWB 3OV4A 1OPYA 2CW9A 1JKGB 1DMQA 1ULJB 4JF8A 3UL6A 3WOEB 1VQ63 3FG1A 3MYTA 3CME3 1KWIA 1LXEA 1ROAA 2IUKA 1W02A 3ER7A 2K54A 1KD14 1OACA 4HM3B 4RBNA 3FLJA 3SLUA 4L8OA 1NB3I 4R9KA 2XGNA 3JUMA 4KFFA 4HZBB 1Q40B 3KSPA 3MG1A 5AYRB 3SOYA 3HZPA 2XSHB 5EQLA 3EF8A 3EBYA 5AIIA 4XBXA 1GY6A 3T8NA 3CCR3 1R4CA 3G16A 1HKXA 1YHQ3 5CK6A 3DGMA 3OXAA 1IU7A 3ALAA 1W4NA 1EQKA 2GU1A 1LVNA 2HMJB 1RRLA 5KP1A 2FXTA 2IMJA 3JVCA 3SOAA 1QVF2 3MSOA 3H3HA 3CU3A 1FGMA 2F99A 2E2VA 2HMMB 3AMOA 2XFSA 1IV7A 1AVKA 2F98A 1N5HA 1Z1SA 3VSYA 5IG4A 1EA2A 5IENA 5LC6A 3EX9A 4STDA 4JRFA 4WFOA 2YX9A 4N6NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TGN A;  3ROB A;  3ECF A;  1GY5 A;  1NDO B;  2GBW B;  2B1X B;  3FH1 A;  3EHC A;  3GRD A;  3EN8 A;  4HM2 B;  3CNX A;  4KVH A;  3S5C A;  3BLZ A;  3GWR A;  3MG3 A;  5CXO A;  1JN5 B;  3NUV A;  4R1K A;  7STD A;  3FZW A;  4MJD A;  1UUV B;  3JUN A;  3T8U A;  1ULI B;  5JPU A;  1OH0 A;  2YFL B;  3NV0 B;  4WWU C;  4RZM A;  1IDP A;  1U5O A;  3B4O A;  3GZR A;  3B7C A;  1ZX2 A;  1TP6 A;  3GZX B;  3LYG A;  1JB5 A;  3KKG A;  1OHP A;  3LZA A;  4K1U A;  1O7W B;  3KZT A;  1W01 A;  1W6Y A;  2W2C A;  5BVB A;  3SOY A;  5IG3 A;  3MHE A;  4GB5 A;  3F14 A;  4LMI A;  3M8C A;  4Q53 A;  5AIG A;  2RFR A;  5D82 A;  3UJM A;  1STD A;  5AEW B;  1O7P B;  4HM4 B;  6STD A;  5KP4 A;  1S5A A;  2JQ5 A;  5BXQ A;  3EC9 A;  2F86 B;  2Z7A A;  3K7C A;  5IF6 A;  4XB5 A;  1O7N B;  2HML B;  4XDW A;  1QMA A;  3DM8 A;  5AI1 A;  3DXO A;  1W00 A;  4HM8 B;  5IEO A;  5IEP A;  3KE7 A;  3F9S A;  4HM6 B;  2XSO B;  2HMK B;  4HVN A;  4WYK A;  1E97 A;  1OF5 B;  3NXJ A;  3STD A;  1CQS A;  3MG2 A;  4HM7 B;  4CDL A;  5IG0 A;  2STD A;  3JUO A;  4XBY A;  1E3V A;  2GBX B;  1O7G B;  4XBT A;  5AEU B;  1GS3 A;  1C7H A;  1NU3 A;  1QJG A;  2Z76 A;  3F8H A;  3G8Z A;  2YFI B;  3VGN A;  1ZO2 A;  3B4P A;  4K1V A;  5DRV A;  1K41 A;  1GYB A;  3DUK A;  3SED A;  1GY7 A;  5JPP A;  3FGY A;  2GEY A;  2BMR B;  5D83 A;  1OGX A;  3UNL A;  4R9L A;  5DRE A;  2RCD A;  1OHS A;  2PZV A;  2R4I A;  3GZY B;  4L7K A;  3K0Z A;  4HM1 B;  3DZL A;  1JB4 A;  2CKF B;  2XRX B;  3G0K A;  3OWY A;  4OUQ A;  3NM2 A;  1UUW B;  3JUP A;  3OV4 A;  1OPY A;  2QGU A;  3OWS A;  2BNG A;  4H3U A;  4WYK B;  4N3V A;  1A2K A;  1OF5 A;  5G2G A;  1JKG B;  2YFJ B;  1DMQ A;  1ULJ B;  1DMN A;  3MKI A;  4HM0 B;  1TUH A;  1VZZ A;  1DMM A;  3JUQ A;  3MYT A;  2A15 A;  5AIH A;  3H51 A;  5AIF A;  3ER7 A;  1W02 A;  3OX9 A;  5HGR A;  5IG5 A;  3F40 A;  5IER A;  3B8L A;  4ORL A;  2K54 A;  3CNM A;  1OCV A;  4LEH A;  5FW5 A;  2I9W A;  4HM3 B;  1BUQ A;  3FLJ A;  3HX8 A;  1JB2 A;  2UX0 A;  3DMC A;  4L8O A;  4HKV B;  4X2O A;  1ASK A;  5STD A;  3RGA A;  3RGR A;  4R9K A;  1AR0 A;  3FSD A;  2BMQ B;  3JUM A;  5KP3 A;  1JN5 A;  3EN1 B;  1Q40 B;  3KSP A;  2GXF A;  3MG1 A;  3BB9 A;  3NHX A;  4HZB B;  4X2H A;  4J9A A;  3HZP A;  2XSH B;  3EJV A;  2HMO B;  1EG9 B;  3GZB A;  4LGQ A;  1OGZ A;  3D9R A;  3EBY A;  3EF8 A;  4HJL B;  4J8T A;  4XBX A;  5AII A;  3WMD A;  1GY6 A;  3I0Y A;  4XDV A;  2CHC A;  3NV0 A;  4FCJ A;  3T8N A;  8CHO A;  1OHO A;  3EBT A;  1HKX A;  3G16 A;  3OWU A;  2B24 B;  2QIY A;  5CK6 A;  2RGQ A;  3OXA A;  1OUN A;  2XR8 B;  3HK4 A;  4HZ9 B;  3FKA A;  5CF2 A;  1E3R A;  2HMJ B;  3FF2 A;  4PEJ A;  3F7X A;  1ISK A;  5KP1 A;  3IPT A;  4WP5 A;  5CF1 A;  1O7H B;  2IMJ A;  3FF0 A;  3SOA A;  1O7M B;  1JKG A;  3H3H A;  3CU3 A;  3MSO A;  4OVM A;  5EVH A;  4L8P A;  2F99 A;  2GEX A;  2Z77 A;  4IIA A;  1SJW A;  2HMM B;  3EQQ B;  5CLK A;  3Q90 A;  2INX A;  2F98 A;  4FCM A;  4U13 A;  1Z1S A;  3VSY A;  5IG4 A;  1EA2 A;  1Q42 A;  5IEN A;  3A76 A;  2HMN B;  3NBR A;  1NWW A;  4XM4 A;  1Q40 A;  3CPO A;  1WQL B;  3E99 A;  3EX9 A;  5D81 A;  2OWP A;  4HM5 B;  4STD A;  3F7S A;  2BMO B;  4I4K A;  3F8X A; 
#chains in the Genus database with same CATH topology
 1NNV A;  2AAE A;  3BNC A;  1NDO B;  1N5P A;  2B1X B;  2XFT A;  3ECF A;  3CXC 2;  1UCI A;  2FGT A;  2KF4 A;  3GWR A;  3MG3 A;  1RJO A;  5LC7 A;  4K90 B;  1CH0 A;  4R1K A;  2PNC A;  1BRG A;  1X1X A;  1UUV B;  3URP A;  1RN7 A;  2IY2 A;  1FZU A;  3NV0 B;  1IVV A;  1LOW A;  2O3O A;  5EEO A;  1U5O A;  1IVX A;  1U8C B;  2Y73 A;  2E2U A;  1HZ1 A;  5M18 A;  3I56 3;  2KXG A;  3DGO A;  2P09 A;  1RHL A;  2ZL8 A;  3KKG A;  1V58 A;  2IA7 A;  3D3L A;  4HOH A;  1B21 A;  1G96 A;  2W2C A;  2CFL A;  4GB5 A;  4LMI A;  1BUJ A;  1IQY A;  4N6T A;  3UJM A;  1STD A;  6STD A;  1UCL A;  1V74 A;  4ZM8 A;  3FG4 A;  1FGR A;  1PU4 A;  1N9E A;  3EC9 A;  1VQQ A;  5AYS C;  5IF6 A;  1T5Y A;  3GAX A;  3DM8 A;  3U1W A;  3DXO A;  1W00 A;  1BRH A;  2CX1 A;  1VQK 3;  2CFG A;  4O8S A;  4EC6 A;  1CQS A;  1X1W A;  3MG2 A;  1E3V A;  1NJI 4;  1GS3 A;  1I3F A;  1NU3 A;  1A90 A;  3F8H A;  4R4K A;  2YFI B;  4U13 A;  3CCJ 3;  3I55 3;  1ZS7 A;  3SX1 A;  3N8B A;  1SIH A;  3LTD A;  1DVC A;  2CG0 A;  3ZG5 A;  1Q7H A;  2C11 A;  5M19 A;  1YIJ 3;  2P0X A;  1W7C A;  2GEY A;  4KZ1 A;  3UNL A;  1UGI A;  1M1K 4;  5DRE A;  2RCD A;  3GSP A;  3GZY B;  2CKF B;  2XRX B;  1RGC A;  3KSE D;  3PYJ A;  4WYK B;  4MMX B;  5G2G A;  5IW9 A;  3MKI A;  3X42 A;  4CCV A;  2XH9 A;  1DMM A;  3JUQ A;  1BNF A;  2A15 A;  3H51 A;  2CC3 A;  5BU4 A;  1K73 4;  5HGR A;  3F40 A;  4HAA A;  3HII A;  2BT3 A;  3AHS A;  4LEH A;  1LOX A;  4ORL A;  4OK0 A;  1BUQ A;  4N6M A;  1JB2 A;  1GOU A;  2UX0 A;  5ELJ A;  2MC8 A;  1AQZ A;  4HKV B;  4X2O A;  1ASK A;  5STD A;  2KRT A;  3PZW A;  4AEQ A;  5HOH A;  2P38 A;  1IV9 A;  2OQE C;  3FSD A;  1JN5 A;  3EN1 B;  3ZFZ A;  1N8Q A;  2GXF A;  4X2H A;  3X3Y A;  4J9A A;  3KFQ C;  1D6Y A;  2V1L A;  1FGQ A;  1OGZ A;  3D9R A;  4J8T A;  7GSP A;  1EUI C;  1BOX A;  1MWT A;  2M7O A;  3D5I A;  3I0Y A;  2CWU A;  1OHO A;  3EBT A;  2B24 B;  2QIY A;  3BNE A;  4FCZ A;  2RGQ A;  1OUN A;  3EB8 A;  1BSC A;  2CFK A;  3HK4 A;  2OQE A;  3CC4 3;  3F7X A;  3DGY A;  3IPT A;  1O7H B;  1FA3 A;  4HBR A;  2OOV C;  3AHW A;  1O7M B;  3N9H A;  2OTJ 3;  1RMS A;  4KFE A;  4L8P A;  1MNL A;  5CLK A;  2Z6B A;  3EQQ B;  3DY5 A;  2D1W A;  9RNT A;  4WHA A;  1YJN 3;  3Q3F A;  3DH2 A;  4HYZ A;  1Q42 A;  4BL3 A;  5A0O B;  1RGA A;  4H61 A;  1BNE A;  1NWW A;  3CPO A;  3D79 A;  4FMB A;  4HM5 B;  4I4K A;  3Q2P A;  1RNB A;  3UB1 A;  2GBW B;  2OOV A;  3FH1 A;  3EN8 A;  3S5C A;  3L0R A;  1IYY A;  2BO9 B;  2IYJ A;  3BLZ A;  1TTO A;  3X3Z A;  4QWT A;  4AKY A;  3K5T A;  1YVB I;  3NUV A;  3CC7 3;  1VQ7 3;  1K9M 4;  1T2I A;  3FZW A;  4BTY A;  1TIJ A;  2WOH A;  1UCK A;  3JUN A;  3T8U A;  2W56 A;  3RDE A;  1RGG A;  2ML5 A;  4RZM A;  1B2M A;  3N54 B;  1W6G A;  3B4O A;  1KQS 2;  1RTU A;  1TP6 A;  3K9M C;  2SBL A;  1O7W B;  1LRA A;  1W6Y A;  5IG3 A;  2RSX A;  3CMA 3;  2L1S A;  4AKZ A;  1TJD A;  3PCS A;  1RKY A;  2CWV A;  3PXM A;  6RNT A;  1I2G A;  1MGR A;  2JQ5 A;  1VQ5 3;  1VQN 3;  2WO0 A;  2Z7A A;  1BRS A;  4XB5 A;  1O7N B;  1BIR A;  4XDW A;  1CYV A;  5AI1 A;  1JRQ A;  5IEO A;  3S67 A;  2C10 A;  1YJW 3;  2Y74 A;  3KE7 A;  1DET A;  4HM6 B;  2F5W A;  2HMK B;  2XSO B;  2SAR A;  3LH4 A;  4WYK A;  1VQ4 3;  4CDL A;  1EKM A;  5IG0 A;  2KF5 A;  4XBT A;  1BAN A;  2OTL 3;  3NQZ A;  4G1M B;  1GD3 A;  4O02 B;  4I5Q A;  2CG1 A;  1X1U A;  1GYB A;  3PCR A;  3S27 A;  3SYU A;  3DUK A;  4MEI A;  1K8A 4;  2WGQ A;  1GMQ A;  4R80 A;  1FGT A;  3FGY A;  2E2T A;  3PS8 A;  3MPH A;  7RNT A;  1G0T A;  1YVS A;  2BMR B;  1I70 A;  1OGX A;  3WDG B;  1T3B A;  1LNH A;  2GU3 A;  1NB5 I;  4NRE A;  1OHS A;  1BRJ A;  2W03 A;  3BNB A;  1TFO A;  1ROV A;  3WA3 A;  4OUQ A;  3TDG A;  3CCU 3;  2QA4 3;  3NM2 A;  4RNT A;  3OW2 2;  2W0Q A;  4FR9 A;  4N3V A;  1A2K A;  1OF5 A;  2KF3 A;  2Q07 A;  2YFJ B;  4HM0 B;  1BNJ A;  1LOV A;  1VZZ A;  4GL6 A;  2UUG C;  3AMO B;  4IPB A;  1Q7Y 4;  1A2P A;  1SAR A;  5RNT A;  1RCK A;  3LT9 A;  1BRI A;  1I0V A;  1LQG C;  1BAO A;  3CNM A;  1OCV A;  1M90 4;  2P05 A;  2I9W A;  1D6U A;  1W2B 2;  3EE1 A;  1BNI A;  1IQ8 A;  1UCJ A;  3RGA A;  3ZG0 A;  1RGL A;  3SVA A;  2CWT A;  1LOY A;  1QAL A;  2BMQ B;  2FNQ A;  5AEU B;  3NHX A;  3BB9 A;  3D5G A;  1BNS A;  3EJV A;  2HMO B;  1EG9 B;  3GZB A;  5I97 A;  3CCV 3;  1JBT A;  1I0X A;  1NO3 A;  2CHC A;  3NV0 A;  1QAF A;  4FCJ A;  5G1L A;  4CPK A;  8CHO A;  1B2Z A;  3OWU A;  4O2H A;  1GMR A;  1GOV A;  2CH9 A;  3FCS B;  4HZ9 B;  1BSA A;  4EV2 A;  3WA2 X;  5CF2 A;  1ISK A;  1ZGX A;  4N6V 0;  4N6U A;  4LYL B;  1IT8 A;  4WP5 A;  5CF1 A;  4KFD A;  4NPB A;  1JKG A;  2IUJ A;  3G4S 3;  1MOL A;  3CCL 3;  2GEX A;  2Z77 A;  1SJW A;  3O8Y A;  2INX A;  1Q82 4;  1QAK A;  3A76 A;  4K61 A;  3CPW 2;  4XM4 A;  3E99 A;  1JBR A;  3X41 A;  4FMC A;  3F7S A;  4N6L A;  1FUW A;  1R4Y A;  3LTA A;  3F8X A;  5TGN A;  3ROB A;  3EHC A;  1FGO A;  3GRD A;  4KVH A;  3A5E A;  3CNX A;  1LNI A;  5CXO A;  1D6Z A;  1G02 A;  1STF I;  3HI7 A;  1C54 A;  1Q86 4;  3PGB A;  2O9U X;  2LYX A;  1ULI B;  5JPU A;  1OH0 A;  3SXX A;  3LT8 A;  3B7C A;  1ZX2 A;  2F56 A;  3S28 A;  4FMA A;  1JB5 A;  1RN4 A;  2J8X B;  5BIR A;  3LZA A;  1WMP A;  1MWR A;  3HOH A;  1KC8 4;  3KZT A;  4BL2 A;  1CYU A;  1W01 A;  3MWZ A;  3BND A;  1I3I A;  3MHE A;  2QEX 3;  3F14 A;  2W6J H;  3M8C A;  4Q53 A;  4J5G A;  5AIG A;  3AGN A;  1V57 A;  5AEW B;  1O7P B;  4DKI A;  5KP4 A;  3T0U A;  3UL5 A;  3K7C A;  3CCQ 3;  3LTC A;  2OCT A;  1UI7 A;  1QMA A;  5IEP A;  1M9G A;  5ELU A;  3F9S A;  1VQO 3;  1LQM B;  4HVN A;  1DE3 A;  1E97 A;  1OF5 B;  3DGL A;  3STD A;  1BSB A;  4XBY A;  3JUO A;  3X40 A;  1QJG A;  2Z76 A;  4BTX A;  1DYU A;  3B4P A;  4K1V A;  2CFW A;  3J7Y d;  1Y4K A;  5JPP A;  4TX4 A;  4EXR A;  4GSP A;  4BIR A;  1IQX A;  3IJE B;  1WTH A;  1SII A;  3KN4 A;  1BRK A;  5D83 A;  3CC2 3;  3Q1C A;  2ML6 A;  2ZDJ A;  4R9L A;  3K0Z A;  5JBS A;  3DZL A;  1JB4 A;  3G0K A;  3OWY A;  3JUP A;  4NHF A;  1W5Z A;  2QGU A;  3OWS A;  2BNG A;  4H3U A;  1KSI A;  1IVU A;  2W04 A;  1DMN A;  3VF1 A;  4N6O B;  4EV5 A;  1TUH A;  4RNZ A;  1VQM 3;  2WOF A;  2BU4 A;  1TRQ A;  4FMD A;  5AIH A;  4EW5 A;  5AIF A;  8RNT A;  1B2U A;  1B2S A;  3OX9 A;  5IG5 A;  5IER A;  3B8L A;  1WMN A;  1YJ9 3;  2AAD A;  3K63 A;  3LML A;  2D42 A;  2P0M A;  4EBG A;  1AVL A;  3HX8 A;  1A67 A;  3D4A A;  1HYF A;  1TU5 A;  1B2X A;  1IT7 A;  3DMC A;  1EEJ A;  1FYS A;  3V99 A;  3RGR A;  1J2B A;  1AR0 A;  3DGN A;  4IT7 A;  5KP3 A;  3AGO A;  1FW7 A;  1BSD A;  4HJL B;  4LGQ A;  3WMD A;  3QK9 A;  2W56 B;  4XDV A;  2CFD A;  3V92 A;  1IK3 A;  2JDI H;  3G71 3;  1YI2 3;  2KCD A;  3CD6 3;  1QVG 2;  1F8N A;  2XR8 B;  3FKA A;  1E3R A;  3KII A;  3FF2 A;  4PEJ A;  1DVD A;  3U97 A;  1N8R 4;  1RGK A;  1UDI I;  3FF0 A;  3NX0 A;  3IMA B;  3G6E 3;  4OVM A;  5EVH A;  1L5G B;  1HU9 A;  3LOY A;  2R41 A;  4IIA A;  2KF6 A;  1Q81 4;  3Q90 A;  4FCM A;  1K28 A;  1PY3 A;  1RDS A;  1X1Y A;  2UGI A;  2W9P A;  3BIR A;  3FG3 A;  2HMN B;  3HIG A;  3NBR A;  1S72 3;  3NM7 A;  4O3V A;  1Q40 A;  1WQL B;  1A2V A;  5D81 A;  2H0I A;  2OWP A;  2BMO B;  1UI8 A;  5FW5 A;  1MWU A;  3LXU X;  3CCS 3;  1BSE A;  1GY5 A;  1UW1 A;  4HM2 B;  2XEP A;  2C4B A;  2HOH A;  1VQ9 3;  1PFP A;  1YIT 3;  1RNT A;  1JN5 B;  4RNY A;  1AY7 A;  1TFK A;  1AV4 A;  1UUG B;  1MGW A;  2W9Q A;  3WOD G;  7STD A;  1JZD A;  2WGO A;  4MJD A;  4J5K A;  4BTW A;  1W6C A;  2XGL A;  2YFL B;  4WWU C;  3NBB A;  1IDP A;  4MMY B;  3LTB A;  3GZR A;  1VQL 3;  1N9J A;  2LQV A;  2MF7 A;  4GHO A;  2CK3 H;  3GZX B;  3LYG A;  1OHP A;  3NQY A;  3KCH A;  3V98 A;  4K1U A;  1US1 A;  1I2F A;  3CCE 3;  5BVB A;  2RFR A;  2F5M A;  4LZI A;  5D82 A;  3WHO A;  5FGO A;  4HM4 B;  1S5A A;  3WOF B;  5BXQ A;  1RLS A;  2F86 B;  1T2H A;  2L4V A;  4LSO A;  2HML B;  2CIU A;  4HM8 B;  1RRH A;  1SPU A;  1BNG A;  1YGW A;  1YNV X;  1JBS A;  3NXJ A;  3QRD A;  1GMP A;  1JNQ A;  1WNH A;  4HM7 B;  2XF3 A;  1B27 A;  1WMO A;  2STD A;  3S29 A;  2GBX B;  1O7G B;  1C7H A;  3NBJ A;  3G8Z A;  1JV2 B;  1VQ8 3;  3VGN A;  1ZO2 A;  1JJ2 2;  1BU4 A;  1GOY A;  1YGE A;  5DRV A;  1K41 A;  2RBI A;  1BGS A;  1CEW I;  1RSN A;  2GSP A;  3SED A;  1GY7 A;  1TRP A;  3X3X A;  3CCM 3;  1SQW A;  1W2Z A;  3BU4 A;  4EYC A;  5G1K A;  1VQP 3;  1GD4 A;  4L7K A;  2BHM A;  2K0M A;  2PZV A;  2R4I A;  4MMZ B;  4ILF A;  4HM1 B;  1M1X B;  3RNT A;  4CJN A;  1IVW A;  1BVI A;  1UUW B;  1Q9E A;  1OPY A;  3OV4 A;  1BNR A;  2CW9 A;  4KT3 B;  1JKG B;  2H0G A;  1DMQ A;  1MWS A;  1ULJ B;  4JF8 A;  3UL6 A;  3WOE B;  1VQ6 3;  1BRN L;  3FG1 A;  3MYT A;  3CME 3;  1KWI A;  1B20 A;  1LXE A;  1ROA A;  1B3S A;  2IUK A;  1W02 A;  3ER7 A;  1FUT A;  2K54 A;  1KD1 4;  1OAC A;  4HM3 B;  1RGF A;  3FLJ A;  4RBN A;  3SLU A;  2ZHX B;  4L8O A;  5GSP A;  2ZA4 A;  1FUS A;  1NB3 I;  4R9K A;  1JZO A;  5M1A A;  2CX0 A;  1GSP A;  2XGN A;  3JUM A;  4KFF A;  2KAA A;  1Q40 B;  3KSP A;  4HZB B;  3MG1 A;  5AYR B;  3SOY A;  1UGH I;  2XSH B;  3HZP A;  5EQL A;  3EF8 A;  2F4Y A;  3EBY A;  5AII A;  4BU4 A;  4XBX A;  1GY6 A;  1RCL A;  3T8N A;  3CCR 3;  1R4C A;  3G16 A;  1HKX A;  1YHQ 3;  1RN1 A;  5CK6 A;  3DGM A;  2K3D A;  3OXA A;  6GSP A;  2H0H A;  1IU7 A;  3ALA A;  1W4N A;  1EQK A;  2GU1 A;  1LVN A;  2HMJ B;  1PYL A;  1RRL A;  1I8V A;  5KP1 A;  2FXT A;  2IMJ A;  3JVC A;  3SOA A;  1QVF 2;  3MSO A;  3H3H A;  3CU3 A;  1FGM A;  1RGH A;  2RNT A;  2F99 A;  2E2V A;  2HMM B;  3AMO A;  2XFS A;  1IV7 A;  1AVK A;  2F98 A;  1N5H A;  1Z1S A;  3VSY A;  5IG4 A;  1EA2 A;  5IEN A;  1I2E A;  5LC6 A;  3EX9 A;  1RGE A;  4STD A;  4JRF A;  4WFO A;  2BIR A;  3WR2 A;  2YX9 A;  4N6N B; 
#chains in the Genus database with same CATH homology
 3ECF A;  3CXC 2;  3BNC A;  1NDO B;  1N5P A;  2B1X B;  2XFT A;  2FGT A;  3GWR A;  3MG3 A;  1RJO A;  5LC7 A;  4K90 B;  4R1K A;  2PNC A;  1UUV B;  1RN7 A;  3NV0 B;  1IVV A;  2O3O A;  5EEO A;  1U5O A;  1IVX A;  1U8C B;  2Y73 A;  2E2U A;  3I56 3;  2KXG A;  3DGO A;  2P09 A;  3KKG A;  2ZL8 A;  2IA7 A;  3D3L A;  1G96 A;  2W2C A;  2CFL A;  4GB5 A;  4LMI A;  1IQY A;  4N6T A;  3UJM A;  1STD A;  6STD A;  1V74 A;  4ZM8 A;  3FG4 A;  1FGR A;  1PU4 A;  1N9E A;  3EC9 A;  5AYS C;  5IF6 A;  1T5Y A;  3GAX A;  3DM8 A;  3U1W A;  3DXO A;  1W00 A;  1VQK 3;  2CFG A;  4O8S A;  4EC6 A;  1CQS A;  3MG2 A;  1E3V A;  1NJI 4;  1GS3 A;  1NU3 A;  1A90 A;  3F8H A;  4R4K A;  2YFI B;  3CCJ 3;  3I55 3;  3SX1 A;  3N8B A;  1SIH A;  3LTD A;  1DVC A;  2CG0 A;  2C11 A;  1YIJ 3;  2P0X A;  1W7C A;  2GEY A;  4KZ1 A;  3UNL A;  1M1K 4;  5DRE A;  2RCD A;  3GZY B;  2CKF B;  2XRX B;  3KSE D;  3PYJ A;  4WYK B;  4MMX B;  5G2G A;  5IW9 A;  3MKI A;  3X42 A;  4CCV A;  2XH9 A;  1DMM A;  3JUQ A;  2A15 A;  3H51 A;  2CC3 A;  1K73 4;  5HGR A;  3F40 A;  3HII A;  2BT3 A;  4ORL A;  4LEH A;  1LOX A;  4OK0 A;  1BUQ A;  4N6M A;  1JB2 A;  2UX0 A;  5ELJ A;  2MC8 A;  4HKV B;  4X2O A;  1ASK A;  5STD A;  2KRT A;  3PZW A;  4AEQ A;  2P38 A;  1IV9 A;  2OQE C;  3FSD A;  1JN5 A;  3EN1 B;  1N8Q A;  2GXF A;  4X2H A;  3X3Y A;  4J9A A;  3KFQ C;  1D6Y A;  2V1L A;  1FGQ A;  1OGZ A;  3D9R A;  4J8T A;  2M7O A;  3I0Y A;  2CWU A;  1OHO A;  3EBT A;  2B24 B;  2QIY A;  3BNE A;  4FCZ A;  2RGQ A;  1OUN A;  3EB8 A;  2CFK A;  3HK4 A;  2OQE A;  3CC4 3;  3F7X A;  3IPT A;  1O7H B;  1FA3 A;  4HBR A;  2OOV C;  1O7M B;  3N9H A;  2OTJ 3;  4KFE A;  4L8P A;  1MNL A;  5CLK A;  2Z6B A;  3EQQ B;  3DY5 A;  2D1W A;  4WHA A;  1YJN 3;  4HYZ A;  1Q42 A;  5A0O B;  4H61 A;  1NWW A;  3CPO A;  4FMB A;  4HM5 B;  4I4K A;  3Q2P A;  3UB1 A;  2GBW B;  2OOV A;  3FH1 A;  3EN8 A;  3S5C A;  3L0R A;  2BO9 B;  3BLZ A;  3X3Z A;  4QWT A;  4AKY A;  3K5T A;  1YVB I;  3NUV A;  3CC7 3;  1VQ7 3;  1K9M 4;  3FZW A;  4BTY A;  1TIJ A;  2WOH A;  3JUN A;  3T8U A;  2W56 A;  3RDE A;  2ML5 A;  4RZM A;  3N54 B;  1W6G A;  3B4O A;  1KQS 2;  1TP6 A;  3K9M C;  2SBL A;  1O7W B;  1W6Y A;  5IG3 A;  2RSX A;  3CMA 3;  4AKZ A;  3PCS A;  1RKY A;  2CWV A;  3PXM A;  1VQ5 3;  1VQN 3;  2JQ5 A;  2WO0 A;  2Z7A A;  4XB5 A;  1O7N B;  4XDW A;  1CYV A;  5AI1 A;  1JRQ A;  5IEO A;  3S67 A;  2C10 A;  1YJW 3;  2Y74 A;  3KE7 A;  4HM6 B;  2XSO B;  2HMK B;  3LH4 A;  4WYK A;  1VQ4 3;  4CDL A;  1EKM A;  5IG0 A;  4XBT A;  2OTL 3;  3NQZ A;  4G1M B;  1GD3 A;  4O02 B;  2CG1 A;  3PCR A;  1GYB A;  3S27 A;  3DUK A;  4MEI A;  1K8A 4;  2WGQ A;  4R80 A;  1FGT A;  3FGY A;  2E2T A;  3PS8 A;  3MPH A;  2BMR B;  1OGX A;  3WDG B;  1LNH A;  2GU3 A;  1NB5 I;  4NRE A;  1OHS A;  2W03 A;  3BNB A;  1TFO A;  1ROV A;  3WA3 A;  4OUQ A;  3TDG A;  3CCU 3;  2QA4 3;  3NM2 A;  3OW2 2;  2W0Q A;  4FR9 A;  4N3V A;  1A2K A;  1OF5 A;  2Q07 A;  2YFJ B;  4HM0 B;  1VZZ A;  4GL6 A;  3AMO B;  1Q7Y 4;  4IPB A;  3LT9 A;  3CNM A;  1OCV A;  1M90 4;  2P05 A;  2I9W A;  1D6U A;  1W2B 2;  3EE1 A;  1IQ8 A;  3RGA A;  3SVA A;  2CWT A;  1QAL A;  2BMQ B;  2FNQ A;  5AEU B;  3NHX A;  3BB9 A;  5I97 A;  3EJV A;  2HMO B;  1EG9 B;  3GZB A;  3CCV 3;  1NO3 A;  2CHC A;  3NV0 A;  1QAF A;  4FCJ A;  8CHO A;  3OWU A;  4O2H A;  4HZ9 B;  2CH9 A;  3FCS B;  4EV2 A;  5CF2 A;  1ISK A;  3WA2 X;  4N6V 0;  4N6U A;  1IT8 A;  4WP5 A;  5CF1 A;  4KFD A;  1JKG A;  2IUJ A;  3G4S 3;  1MOL A;  3CCL 3;  2GEX A;  2Z77 A;  1SJW A;  3O8Y A;  2INX A;  1Q82 4;  1QAK A;  3A76 A;  4K61 A;  3CPW 2;  4XM4 A;  3E99 A;  3X41 A;  4FMC A;  3F7S A;  4N6L A;  1FUW A;  3LTA A;  3F8X A;  5TGN A;  3ROB A;  3EHC A;  1FGO A;  3GRD A;  4KVH A;  3CNX A;  5CXO A;  1D6Z A;  1STF I;  3HI7 A;  1Q86 4;  3PGB A;  2O9U X;  2LYX A;  1ULI B;  5JPU A;  1OH0 A;  3SXX A;  3LT8 A;  3B7C A;  1ZX2 A;  3S28 A;  4FMA A;  1JB5 A;  3LZA A;  1WMP A;  1KC8 4;  3KZT A;  1CYU A;  1W01 A;  3MWZ A;  3BND A;  3MHE A;  2QEX 3;  3F14 A;  2W6J H;  3M8C A;  4Q53 A;  5AIG A;  5AEW B;  1O7P B;  5KP4 A;  3T0U A;  3UL5 A;  3K7C A;  3CCQ 3;  3LTC A;  2OCT A;  1UI7 A;  1QMA A;  5IEP A;  1M9G A;  5ELU A;  3F9S A;  1VQO 3;  4HVN A;  1E97 A;  1OF5 B;  3DGL A;  3STD A;  4XBY A;  3JUO A;  3X40 A;  1QJG A;  2Z76 A;  4BTX A;  1DYU A;  3B4P A;  4K1V A;  2CFW A;  3J7Y d;  1Y4K A;  5JPP A;  4TX4 A;  4EXR A;  1IQX A;  3IJE B;  1WTH A;  1SII A;  3KN4 A;  5D83 A;  3CC2 3;  3Q1C A;  2ML6 A;  2ZDJ A;  4R9L A;  3K0Z A;  5JBS A;  3DZL A;  1JB4 A;  3G0K A;  3OWY A;  3JUP A;  4NHF A;  1W5Z A;  2QGU A;  3OWS A;  2BNG A;  4H3U A;  1KSI A;  1IVU A;  2W04 A;  1DMN A;  3VF1 A;  4N6O B;  4EV5 A;  1TUH A;  4RNZ A;  1VQM 3;  2WOF A;  4FMD A;  5AIH A;  5AIF A;  3OX9 A;  5IG5 A;  5IER A;  3B8L A;  1WMN A;  1YJ9 3;  3K63 A;  3LML A;  2D42 A;  2P0M A;  4EBG A;  1AVL A;  3HX8 A;  1A67 A;  1TU5 A;  1IT7 A;  3DMC A;  1J2B A;  3V99 A;  3RGR A;  1AR0 A;  3DGN A;  4IT7 A;  5KP3 A;  4LGQ A;  4HJL B;  3WMD A;  3QK9 A;  2W56 B;  4XDV A;  2CFD A;  3V92 A;  1IK3 A;  2JDI H;  3G71 3;  1YI2 3;  2KCD A;  3CD6 3;  1QVG 2;  1F8N A;  2XR8 B;  3FKA A;  1E3R A;  3KII A;  3FF2 A;  4PEJ A;  1DVD A;  3U97 A;  1N8R 4;  3NX0 A;  3FF0 A;  3IMA B;  3G6E 3;  4OVM A;  5EVH A;  1L5G B;  1HU9 A;  3LOY A;  4IIA A;  1Q81 4;  3Q90 A;  4FCM A;  1K28 A;  4U13 A;  1VQ9 3;  3HIG A;  2W9P A;  3FG3 A;  1S72 3;  3NBR A;  2HMN B;  3NM7 A;  4O3V A;  1Q40 A;  1WQL B;  1A2V A;  5D81 A;  2OWP A;  2BMO B;  1UI8 A;  5FW5 A;  3LXU X;  3CCS 3;  1GY5 A;  1UW1 A;  4HM2 B;  2XEP A;  1PFP A;  1YIT 3;  1JN5 B;  4RNY A;  1TFK A;  2W9Q A;  1AV4 A;  3WOD G;  7STD A;  2WGO A;  4MJD A;  4BTW A;  1W6C A;  2XGL A;  2YFL B;  4WWU C;  3NBB A;  1IDP A;  4MMY B;  3LTB A;  3GZR A;  1VQL 3;  1N9J A;  2LQV A;  2MF7 A;  2CK3 H;  3GZX B;  3LYG A;  1OHP A;  3NQY A;  3V98 A;  4K1U A;  1US1 A;  3CCE 3;  5BVB A;  2RFR A;  4LZI A;  5D82 A;  5FGO A;  4HM4 B;  1S5A A;  3WOF B;  5BXQ A;  2F86 B;  2L4V A;  4LSO A;  2HML B;  2CIU A;  4HM8 B;  1RRH A;  1SPU A;  3NXJ A;  3QRD A;  1WNH A;  1JNQ A;  4HM7 B;  2XF3 A;  3S29 A;  1WMO A;  2STD A;  2GBX B;  1O7G B;  1C7H A;  3NBJ A;  3G8Z A;  1JV2 B;  1VQ8 3;  3VGN A;  1ZO2 A;  1JJ2 2;  1YGE A;  5DRV A;  1K41 A;  1CEW I;  3SED A;  1GY7 A;  3X3X A;  3CCM 3;  1SQW A;  1W2Z A;  4EYC A;  1VQP 3;  1GD4 A;  4L7K A;  2BHM A;  2K0M A;  2PZV A;  2R4I A;  4MMZ B;  4HM1 B;  1M1X B;  1IVW A;  1UUW B;  3OV4 A;  1OPY A;  2CW9 A;  1JKG B;  1DMQ A;  1ULJ B;  4JF8 A;  3UL6 A;  3WOE B;  1VQ6 3;  3FG1 A;  3MYT A;  3CME 3;  1KWI A;  1LXE A;  1ROA A;  2IUK A;  1W02 A;  3ER7 A;  2K54 A;  1KD1 4;  1OAC A;  4HM3 B;  4RBN A;  3FLJ A;  3SLU A;  4L8O A;  1NB3 I;  4R9K A;  2XGN A;  3JUM A;  4KFF A;  4HZB B;  1Q40 B;  3KSP A;  3MG1 A;  5AYR B;  3SOY A;  3HZP A;  2XSH B;  5EQL A;  3EF8 A;  3EBY A;  5AII A;  4XBX A;  1GY6 A;  3T8N A;  3CCR 3;  1R4C A;  3G16 A;  1HKX A;  1YHQ 3;  5CK6 A;  3DGM A;  3OXA A;  1IU7 A;  3ALA A;  1W4N A;  1EQK A;  2GU1 A;  1LVN A;  2HMJ B;  1RRL A;  5KP1 A;  2FXT A;  2IMJ A;  3JVC A;  3SOA A;  1QVF 2;  3MSO A;  3H3H A;  3CU3 A;  1FGM A;  2F99 A;  2E2V A;  2HMM B;  3AMO A;  2XFS A;  1IV7 A;  1AVK A;  2F98 A;  1N5H A;  1Z1S A;  3VSY A;  5IG4 A;  1EA2 A;  5IEN A;  5LC6 A;  3EX9 A;  4STD A;  4JRF A;  4WFO A;  2YX9 A;  4N6N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...