4HM2B

Naphthalene 1,2-dioxygenase bound to ethylphenylsulfide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Naphthalene 1,2-Dioxygenase bound to ethylphenylsulfide
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
total genus 53
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm2B00
1EG9B 1JB4A 1ZX2A 3H51A 3OWSA 5IEOA 5AEUB 4WWUC 2QIYA 2Z77A 4HJLB 6STDA 3LZAA 4XDWA 4N3VA 4K1VA 1ISKA 3FSDA 4L8OA 5KP1A 4STDA 3VSYA 2INXA 1JKGB 3B7CA 1O7PB 2W2CA 2K54A 3EN1B 1Z1SA 3KKGA 5KP3A 2XSOB 4HM5B 1OUNA 4MJDA 3EX9A 3EBTA 3GZBA 4WYKB 3MYTA 5D83A 5KP4A 3VGNA 3HX8A 4HVNA 4KVHA 1DMMA 3B8LA 3CPOA 2B1XB 3NXJA 1A2KA 1OGXA 3GZRA 3OX9A 1NU3A 3RGRA 3STDA 1NDOB 3CNMA 2F98A 2GXFA 3DXOA 3GWRA 1JN5A 3BB9A 4H3UA 1WQLB 3EN8A 2IMJA 3F7XA 3JUOA 1TUHA 3NBRA 3UNLA 3SOAA 1BUQA 1OF5B 4OUQA 1JB2A 1VZZA 2BMQB 2Z76A 4L8PA 2F99A 2BMRB 1QJGA 3DUKA 3CU3A 3EBYA 1GYBA 1OHPA 3HK4A 3I0YA 2PZVA 3OWYA 1TP6A 4HM3B 3UJMA 5IG5A 1O7NB 2HMLB 3JUNA 3MKIA 3SOYA 1OHSA 3H3HA 3CNXA 1QMAA 3EC9A 3MSOA 3F14A 4HM6B 2GEYA 3FZWA 1OPYA 3A76A 4R1KA 4HM7B 3K0ZA 3F8XA 3DMCA 5IERA 4FCMA 1E3VA 1O7WB 5STDA 4HKVB 1W01A 4XBXA 3ROBA 4U13A 5AIGA 5IG0A 3DM8A 1OCVA 5IG4A 3ECFA 3LYGA 2JQ5A 5DRVA 3MG2A 3KZTA 1JKGA 3EF8A 3EHCA 4J9AA 2BMOB 3GRDA 1ULJB 3RGAA 5JPUA 3E99A 1SJWA 3NV0A 3G0KA 2GEXA 3DZLA 1NWWA 3ER7A 1W00A 1C7HA 5D81A 4PEJA 4LMIA 3FLJA 5D82A 4XDVA 1GY7A 5TGNA 2GBXB 2YFJB 5CK6A 4HZBB 3G8ZA 4K1UA 5DREA 5IG3A 3NUVA 4RZMA 3NM2A 1Q40A 4L7KA 3FH1A 4LEHA 5AIHA 3JUQA 3SEDA 1DMQA 2YFIB 3F7SA 4FCJA 4R9KA 5CXOA 4X2OA 4XB5A 2XR8B 3KE7A 5HGRA 3T8NA 4CDLA 3K7CA 3MG1A 5BXQA 1OF5A 1AR0A 1CQSA 2YFLB 4HM8B 4R9LA 5AIFA 5G2GA 3NHXA 1S5AA 5IEPA 2CKFB 1K41A 5BVBA 1OGZA 2HMJB 1JB5A 4J8TA 5AI1A 2XRXB 3FF2A 2A15A 2XSHB 3T8UA 2CHCA 1OH0A 3S5CA 2OWPA 5CLKA 8CHOA 1E3RA 1GS3A 2GBWB 2HMOB 2UX0A 3F9SA 2RFRA 4I4KA 5AIIA 3BLZA 5JPPA 1O7HB 3D9RA 3JUMA 1GY6A 2HMNB 3FGYA 1E97A 1U5OA 1ASKA 1UUVB 2HMKB 1W6YA 1ZO2A 1IDPA 3GZYB 3M8CA 3OV4A 2BNGA 4WYKA 2RCDA 3FF0A 5IENA 3B4PA 1ULIB 4HZ9B 3F8HA 4Q53A 4X2HA 4XM4A 3MHEA 4LGQA 3WMDA 4WP5A 2HMMB 2Z7AA 3NV0B 1HKXA 1Q42A 1STDA 3Q90A 3G16A 4HM4B 5EVHA 1DMNA 1Q40B 3IPTA 3OXAA 3JUPA 4IIAA 3B4OA 2QGUA 3EJVA 1OHOA 1W02A 2B24B 4GB5A 4HM0B 4HM1B 2I9WA 3EQQB 2STDA 4XBTA 1JN5B 2R4IA 4HM2B 3F40A 5AEWB 5CF2A 1EA2A 5FW5A 5CF1A 3MG3A 1GY5A 7STDA 4XBYA 1O7MB 1O7GB 3OWUA 2RGQA 5IF6A 4OVMA 3GZXB 4ORLA 3HZPA 1UUWB 2F86B 3FKAA 3KSPA
chains in the Genus database with same CATH superfamily
1B27A 5IEOA 4WWUC 2QIYA 2Z77A 2CFLA 1EEJA 1ISKA 1SIHA 4L8OA 3MWZA 1JKGB 1O7PB 5KP3A 3KKGA 4BTYA 3D4AA 2XSOB 1GMRA 2KRTA 1OUNA 1TFKA 3EBTA 3MYTA 3QRDA 3HIGA 1NO3A 3CME3 1BNIA 4HVNA 4KFFA 3SX1A 1RJOA 3D3LA 1JJ22 1JV2B 1NDOB 1PY3A 2WOHA 2F98A 1GOVA 1DVCA 3UNLA 1PU4A 3F7XA 1KWIA 3WOEB 1Q9EA 3LTBA 2BMQB 2D42A 3UL5A 4BL3A 1FGTA 2CWTA 3DUKA 3EBYA 3CU3A 3FG4A 3HK4A 3U1WA 3UJMA 2PZVA 1TP6A 2LQVA 1O7NB 1W6CA 3EC9A 2BU4A 3V99A 3S67A 3FZWA 1OPYA 3G6E3 1I0XA 5IERA 1E3VA 1O7WB 1M1XB 4XBXA 3ROBA 1AQZA 3ZFZA 3DM8A 1OCVA 1UGIA 1FUSA 3Q2PA 3CPW2 1JKGA 1CEWI 3WA2X 5G1LA 1JRQA 1D6ZA 3E99A 1SJWA 2ZHXB 3D79A 3G0KA 1IT7A 1NWWA 1MWUA 1C7HA 1UCKA 1A67A 4H61A 2AADA 3ALAA 1X1XA 4KFEA 4PEJA 1BNSA 4BTWA 4CPKA 1GY7A 3CCV3 5TGNA 4ILFA 2BIRA 1N8QA 2GBXB 2YFJB 1UCIA 4HZBB 4K61A 5DREA 3CXC2 2CIUA 4CCVA 3WHOA 5AIHA 3SEDA 1I3FA 5CXOA 4X2OA 4XB5A 2XR8B 1JBTA 3K7CA 3S28A 5BXQA 1Q7Y4 1YJN3 1CQSA 2YFLB 3BIRA 3KIIA 5AIFA 5G2GA 1IK3A 2CC3A 3GSPA 5BVBA 1OGZA 2HMJB 2QEX3 1FA3A 3SXXA 1SPUA 4TX4A 4EV5A 2CFKA 2XRXB 3LXUX 2FNQA 1BUJA 1RDSA 1OH0A 3S5CA 1LOWA 1Q864 1LVNA 1GS3A 3F9SA 7GSPA 1A2PA 1FYSA 1JBRA 2RFRA 2H0HA 3BLZA 1O7HB 4R4KA 4HM5B 4BU4A 1E97A 1UUVB 3N9HA 1NJI4 2ML6A 1UCJA 1FGMA 2RCDA 3FF0A 2LYXA 1UDII 3B4PA 1BNRA 3PS8A 3CCQ3 2Z7AA 1BSEA 1RGHA 1EKMA 1YI23 1DMNA 1MGWA 1Q40B 3HIIA 1BNGA 3JUPA 1VQ53 2QGUA 3EJVA 1QAKA 2W04A 4GB5A 4HM1B 3EQQB 1RGEA 4MEIA 5AEWB 3CMA3 5CF1A 1NNVA 5ELJA 3MG3A 3TDGA 3WOFB 1GY5A 7STDA 4XBYA 1O7MB 3FCSB 5IF6A 1TTOA 3CCJ3 2F86B 1YNVX 1M904 2XH9A 1N9JA 4IT7A 1EG9B 1JB4A 1ZX2A 3SYUA 1YVSA 1IVUA 4HJLB 2E2VA 3V98A 5JBSA 2ZL8A 1ZS7A 1X1YA 1BRGA 5AYSC 3G713 4R80A 3URPA 1RGKA 3EN1B 1BU4A 1Z1SA 2M7OA 1C54A 1M9GA 2MF7A 4MJDA 4WYKB 3GZBA 1YJW3 2IA7A 1EQKA 3DY5A 4AKZA 4LZIA 5KP4A 2CFWA 3VGNA 3HX8A 2W56B 4KVHA 1FUWA 2B1XB 3NXJA 1A2KA 3OX9A 4GHOA 2CWVA 3CCL3 3STDA 3BU4A 2HOHA 3CNMA 5GSPA 1RGLA 4EC6A 3GWRA 1JN5A 3BB9A 1WQLB 2CW9A 1LQMB 1IV9A 9RNTA 2OTL3 4OUQA 1JB2A 1LOYA 1UGHI 1IQXA 2MC8A 2Z76A 2W0QA 3FG3A 2F99A 2BMRB 2K0MA 3I0YA 1Q814 1BRNL 3CD63 1GOYA 3ZG0A 2P38A 4N6MA 2QA43 2E2UA 1I2FA 1TIJA 2HMLB 2SBLA 1N5HA 1OHSA 3H3HA 3CNXA 1QMAA 2CWUA 3JUNA 3F14A 2GEYA 3A76A 2ZDJA 4FMBA 1BSBA 4HM7B 4MMXB 3K0ZA 3F8XA 2FXTA 3BNEA 3CC43 1W01A 3AHSA 1AV4A 3LTDA 5IG4A 1Q824 2W03A 1VQL3 3LYGA 1QVG2 2JQ5A 4BL2A 3I563 1BSCA 3PZWA 4FMDA 3EHCA 1FGQA 4HBRA 1ULJB 3RGAA 1RN7A 5HOHA 3X42A 2GEXA 3DZLA 1B2ZA 1GSPA 3PCSA 1RLSA 1WMOA 1KC84 1AVKA 4KFDA 1BVIA 2KF4A 4J5KA 3DGMA 3U97A 3A5EA 2WGOA 3NM2A 3X3YA 4LEHA 1PFPA 3JUQA 4N6UA 1BRSA 1U8CB 2CG1A 4R9KA 3CC73 1TJDA 5ELUA 5HGRA 3KE7A 3T8NA 1SARA 4GSPA 1BRKA 3NHXA 2C10A 5IEPA 2XF3A 2CX1A 2K3DA 3K5TA 4J8TA 4O2HA 1RN1A 5AI1A 1RGAA 1M1K4 2XFSA 3KFQC 2CHCA 1VQ43 1RSNA 4N6OB 4G1MB 3LT9A 2KF5A 1F8NA 2HMOB 5JPPA 1WTHA 3VF1A 4MMZB 1GY6A 2HMNB 3FGYA 3GZYB 3RDEA 1ASKA 1BOXA 1GD4A 1LOXA 3OV4A 1K8A4 1B2SA 1IVVA 2C11A 2CFDA 1UW1A 3AHWA 4O02B 3UB1A 3CCU3 4HZ9B 3F8HA 3JVCA 4Q53A 1OACA 4WP5A 3MPHA 4JRFA 4JF8A 3O8YA 1HKXA 1STDA 2PNCA 2L4VA 2H0GA 3IPTA 1SQWA 2CG0A 1QAFA 3OXAA 1LNIA 5I97A 1W02A 1I2EA 2F5MA 2I9WA 1JN5B 2WGQA 4HM2B 1IVWA 2CK3H 2RBIA 3AMOB 3NM7A 3UL6A 2IUKA 3OWUA 1O7GB 1FZUA 2RGQA 1J2BA 3DGNA 1LRAA 3SVAA 3HOHA 1I8VA 5AEUB 2KCDA 3H51A 3OWSA 1X1WA 2P05A 1UI8A 3K9MC 2OOVC 4FMAA 4HOHA 5LC7A 5A0OB 4K1VA 6GSPA 6RNTA 2KAAA 2P0MA 1Y4KA 2D1WA 4STDA 1B21A 1LQGC 2OCTA 3VSYA 2OTJ3 3B7CA 3WR2A 1FGRA 2GU1A 3FKAA 4RNZA 4ZM8A 1R4YA 1RN4A 1UUGB 2GU3A 1MWTA 1IV7A 3WODG 1A2VA 3ZG5A 1BNFA 1GMPA 1DMMA 3CPOA 4AEQA 1OGXA 3EE1A 1K28A 3WDGB 2WO0A 2UGIA 1FW7A 3LTAA 2Y74A 1B2UA 2XGLA 3CCS3 1T3BA 1X1UA 2W9PA 4HYZA 1DYUA 1I0VA 2BO9B 3DXOA 3N8BA 3Q3FA 4H3UA 5BU4A 3JUOA 5M18A 3NBRA 8RNTA 1YIJ3 1BUQA 1OF5B 1VZZA 1N8R4 1QVF2 1BRIA 1MNLA 1JZDA 3DGOA 3SLUA 4GL6A 5IW9A 3X3XA 1WMPA 4OK0A 4BTXA 2H0IA 5RNTA 3MSOA 3L0RA 4HM6B 1YVBI 1B2MA 1RKYA 3IMAB 3X3ZA 3LTCA 2CX0A 1SIIA 1CYUA 1IVXA 4RNTA 3DMCA 3PYJA 2W6JH 3T0UA 1FUTA 4RBNA 2CFGA 5M19A 1STFI 1MOLA 1BRHA 3ECFA 2OQEC 1BSAA 3MG2A 3KZTA 3NX0A 5AYRB 3BNCA 4EV2A 3CCE3 3CCR3 5FGOA 1IU7A 2P09A 1TFOA 4EW5A 1UI7A 1NB5I 3CCM3 5D81A 1W2ZA 4LMIA 3FLJA 1LXEA 3Q1CA 3V92A 1KSIA 3G8ZA 4K1UA 5EEOA 1A90A 5IG3A 4RZMA 3D5GA 1Q40A 2ZA4A 3FH1A 3GAXA 4N6LA 1N9EA 1DMQA 1GOUA 2O9UX 3D5IA 1W7CA 4EXRA 1W5ZA 2JDIH 1HYFA 1VQM3 3X41A 4R9LA 1D6YA 1RTUA 2AAEA 1K41A 1RHLA 1IYYA 1JB5A 1RGGA 4EBGA 2UUGC 4MMYB 1TRQA 2A15A 2XSHB 3FF2A 5M1AA 2OWPA 5CLKA 1S723 1YIT3 1IT8A 2UX0A 3BNBA 4DKIA 4LSOA 3JUMA 4I4KA 2R41A 2W9QA 1VQO3 1U5OA 2HMKB 4NPBA 4QWTA 4WYKA 1T2HA 1ZO2A 5IENA 5LC6A 2BNGA 2ML5A 4BIRA 3WA3A 2CH9A 1YHQ3 4AKYA 2GSPA 4XM4A 1BAOA 4I5QA 4LGQA 2YX9A 2Y73A 2HMMB 4RNYA 1Q42A 2WOFA 3Q90A 2J8XB 1YGEA 2Q07A 1T5YA 3RNTA 2XEPA 2B24B 2RSXA 4XBTA 1V57A 4KT3B 3FG1A 3F40A 2BHMA 2KF3A 4J5GA 5FW5A 5CF2A 1DE3A 1YGWA 1AVLA 1VQQA 1VQK3 1RNBA 1EUIC 2C4BA 4OVMA 2IY2A 3GZXB 3HZPA 1YJ93 1I70A 1V74A 3CC23 3KSPA 1G02A 1HZ1A 1ZGXA 4N6NB 6STDA 3LZAA 4LYLB 4N3VA 4XDWA 3FSDA 5KP1A 3EB8A 3J7Yd 1W6GA 2INXA 2IUJA 1CH0A 3LMLA 2Z6BA 2W2CA 2K54A 1VQ63 4IPBA 3EX9A 3K63A 3LOYA 5G1KA 2O3OA 1L5GB 5D83A 1D6UA 1BIRA 3HI7A 1T2IA 4N6TA 3DGLA 3B8LA 3GZRA 3RGRA 1NU3A 1RNTA 4NREA 4HAAA 2GXFA 2OQEA 3MKIA 3EN8A 1MGRA 2IMJA 1VQ73 1TUHA 1KD14 3SOAA 2OOVA 1NB3I 5EQLA 1TRPA 1RRHA 4L8PA 8CHOA 1QJGA 2L1SA 1GYBA 1CYVA 1JZOA 1OHPA 3OWYA 4HM3B 3QK9A 5IG5A 1KQS2 3SOYA 1N5PA 1DVDA 3DH2A 2IYJA 1RCKA 1G0TA 3NBJA 3NQZA 4WFOA 4R1KA 1BNJA 1RGFA 1QALA 1K9M4 1JNQA 1BRJA 4FCMA 5STDA 4HKVB 5BIRA 3AGOA 1AY7A 3NQYA 3PGBA 4U13A 5AIGA 5IG0A 4O8SA 7RNTA 3S27A 5DRVA 2XGNA 1BSDA 3EF8A 4J9AA 1Q7HA 2BMOB 3GRDA 1FGOA 5JPUA 1LNHA 3NV0A 4KZ1A 4CJNA 3ER7A 1W00A 3LT8A 3KN4A 3LH4A 3NBBA 5D82A 4XDVA 2W56A 5CK6A 3S29A 1MWSA 3KCHA 4K90B 3NUVA 3PCRA 1IQYA 4L7KA 1RMSA 2SARA 3I553 3PXMA 3DGYA 2YFIB 3IJEB 3F7SA 4FCJA 1W4NA 2KF6A 4CDLA 1PYLA 1LOVA 1ROVA 3N54B 4FCZA 2RNTA 1V58A 3MG1A 1GMQA 1OF5A 1AR0A 3G4S3 2KXGA 2BT3A 1WMNA 1RCLA 4HM8B 3OW22 1S5AA 1RGCA 4N6V0 2CKFB 4FMCA 2F4YA 1HU9A 1RRLA 1UCLA 1TU5A 1G96A 1I3IA 4O3VA 3T8UA 2FGTA 1VQN3 1B2XA 1K734 1ROAA 1E3RA 1IQ8A 2GBWB 2V1LA 5AIIA 3AGNA 2XFTA 4FR9A 1BANA 1JBSA 3D9RA 1W2B2 1DETA 1B20A 3M8CA 1VQP3 1W6YA 1IDPA 1ULIB 4X2HA 3MHEA 3WMDA 2F5WA 3NV0B 4HM4B 3G16A 5EVHA 3X40A 1WNHA 2P0XA 3BNDA 1GD3A 3KSED 1VQ93 4IIAA 1BGSA 3B4OA 4NHFA 1OHOA 1VQ83 1I2GA 4HM0B 1MWRA 2STDA 2F56A 1BNEA 2R4IA 1R4CA 1EA2A 4EYCA 1B3SA 3AMOA 4ORLA 1UUWB 2E2TA 4WHAA 1US1A
chains in the Genus database with same CATH topology
5IEOA 4WWUC 2QIYA 2Z77A 2CFLA 1ISKA 1SIHA 4L8OA 3MWZA 1JKGB 1O7PB 5KP3A 3KKGA 4BTYA 2XSOB 2KRTA 1OUNA 1TFKA 3EBTA 3MYTA 3QRDA 3HIGA 1NO3A 3CME3 4HVNA 4KFFA 3SX1A 1RJOA 3D3LA 1JJ22 1NDOB 1JV2B 2WOHA 2F98A 1DVCA 3UNLA 1PU4A 3F7XA 1KWIA 3WOEB 3LTBA 2BMQB 2D42A 3UL5A 1FGTA 2CWTA 3DUKA 3EBYA 3CU3A 3FG4A 3HK4A 3U1WA 3UJMA 2PZVA 1TP6A 2LQVA 1O7NB 1W6CA 3EC9A 3V99A 3S67A 3FZWA 1OPYA 3G6E3 5IERA 1E3VA 1O7WB 1M1XB 4XBXA 3ROBA 3DM8A 1OCVA 3Q2PA 3CPW2 1JKGA 1CEWI 3WA2X 1JRQA 1D6ZA 3E99A 1SJWA 3G0KA 1NWWA 1IT7A 1A67A 1C7HA 4H61A 3ALAA 4PEJA 4KFEA 4BTWA 1GY7A 3CCV3 5TGNA 4K61A 2GBXB 1N8QA 2YFJB 4HZBB 5DREA 3CXC2 2CIUA 4CCVA 5AIHA 3SEDA 5CXOA 4X2OA 4XB5A 2XR8B 3K7CA 3S28A 5BXQA 1Q7Y4 1YJN3 1CQSA 2YFLB 5AIFA 3KIIA 5G2GA 1IK3A 2CC3A 5BVBA 1OGZA 2HMJB 2QEX3 1FA3A 3SXXA 1SPUA 4TX4A 4EV5A 2CFKA 2XRXB 3LXUX 2FNQA 1OH0A 3S5CA 1Q864 1LVNA 1GS3A 3F9SA 2RFRA 3BLZA 1O7HB 4R4KA 4HM5B 1E97A 1UUVB 3N9HA 1NJI4 2ML6A 1FGMA 2RCDA 3FF0A 2LYXA 3B4PA 3PS8A 3CCQ3 2Z7AA 1EKMA 1YI23 1DMNA 1Q40B 3HIIA 3JUPA 1VQ53 2QGUA 3EJVA 1QAKA 2W04A 4GB5A 4HM1B 3EQQB 4MEIA 3CMA3 5AEWB 5CF1A 5ELJA 3MG3A 3TDGA 3WOFB 1GY5A 7STDA 4XBYA 1O7MB 3FCSB 5IF6A 3CCJ3 2F86B 1M904 2XH9A 1N9JA 4IT7A 1EG9B 1JB4A 1ZX2A 1IVUA 4HJLB 2E2VA 3V98A 5JBSA 2ZL8A 5AYSC 3G713 4R80A 3EN1B 1Z1SA 2M7OA 1M9GA 2MF7A 4MJDA 4WYKB 3GZBA 1YJW3 2IA7A 1EQKA 3DY5A 4AKZA 4LZIA 5KP4A 2CFWA 3VGNA 3HX8A 2W56B 4KVHA 1FUWA 2B1XB 3NXJA 1A2KA 3OX9A 2CWVA 3CCL3 3STDA 3CNMA 4EC6A 3GWRA 1JN5A 3BB9A 1WQLB 2CW9A 1IV9A 2OTL3 4OUQA 1JB2A 1IQXA 2MC8A 2Z76A 2W0QA 3FG3A 2F99A 2BMRB 2K0MA 3I0YA 1Q814 3CD63 2P38A 4N6MA 2QA43 2E2UA 1TIJA 2HMLB 3JUNA 2SBLA 1N5HA 1OHSA 3H3HA 3CNXA 1QMAA 2CWUA 3MKIA 3F14A 2GEYA 3A76A 2ZDJA 4FMBA 4HM7B 4MMXB 3K0ZA 3F8XA 2FXTA 3BNEA 3CC43 1W01A 1AV4A 3LTDA 5IG4A 1Q824 2W03A 1VQL3 3LYGA 1QVG2 2JQ5A 3I563 4FMDA 3PZWA 3EHCA 1FGQA 4HBRA 1ULJB 3RGAA 1RN7A 3X42A 2GEXA 3DZLA 3PCSA 1WMOA 1KC84 1AVKA 4KFDA 3U97A 3X3YA 3DGMA 2WGOA 3NM2A 4LEHA 1PFPA 3JUQA 4N6UA 1U8CB 2CG1A 4R9KA 3CC73 5HGRA 5ELUA 3KE7A 3T8NA 3NHXA 2C10A 5IEPA 2XF3A 3K5TA 4J8TA 4O2HA 5AI1A 1M1K4 2XFSA 3KFQC 2CHCA 1VQ43 4N6OB 4G1MB 3LT9A 1F8NA 2HMOB 5JPPA 1WTHA 3VF1A 4MMZB 1GY6A 2HMNB 3FGYA 3GZYB 3RDEA 1ASKA 1GD4A 1LOXA 3OV4A 1K8A4 1IVVA 2C11A 2CFDA 3UB1A 1UW1A 4O02B 3CCU3 4HZ9B 3F8HA 3JVCA 4Q53A 1OACA 4WP5A 3MPHA 4JRFA 4JF8A 3O8YA 1HKXA 1STDA 2PNCA 2L4VA 3IPTA 1SQWA 2CG0A 1QAFA 3OXAA 5I97A 1W02A 2I9WA 1JN5B 2WGQA 4HM2B 1IVWA 2CK3H 3AMOB 3NM7A 3UL6A 2IUKA 3OWUA 1O7GB 1J2BA 2RGQA 3DGNA 3SVAA 5AEUB 2KCDA 3H51A 3OWSA 2P05A 4FMAA 1UI8A 3K9MC 2OOVC 5LC7A 5A0OB 4K1VA 2P0MA 1Y4KA 2D1WA 4STDA 3VSYA 2OTJ3 2OCTA 3B7CA 1FGRA 2GU1A 3FKAA 4RNZA 4ZM8A 2GU3A 1IV7A 1A2VA 1DMMA 3CPOA 4AEQA 1OGXA 3EE1A 1K28A 3WDGB 2WO0A 3LTAA 2Y74A 2XGLA 3CCS3 2W9PA 4HYZA 3WODG 1DYUA 2BO9B 3DXOA 4H3UA 3N8BA 3JUOA 3NBRA 1BUQA 1YIJ3 1OF5B 1VZZA 1N8R4 1QVF2 1MNLA 3DGOA 3SLUA 5IW9A 4GL6A 3X3XA 1WMPA 4OK0A 4BTXA 3MSOA 3L0RA 4HM6B 1YVBI 1RKYA 3IMAB 3X3ZA 3LTCA 1SIIA 1CYUA 1IVXA 3DMCA 3PYJA 2W6JH 3T0UA 4RBNA 2CFGA 1STFI 1MOLA 3ECFA 2OQEC 3MG2A 3NX0A 3KZTA 5AYRB 4EV2A 3BNCA 3CCE3 3CCR3 5FGOA 1IU7A 2P09A 1TFOA 1UI7A 1NB5I 3CCM3 5D81A 1W2ZA 4LMIA 3FLJA 1LXEA 3Q1CA 3V92A 1KSIA 3G8ZA 4K1UA 5EEOA 1A90A 5IG3A 4RZMA 1Q40A 3FH1A 3GAXA 4N6LA 1N9EA 1DMQA 2O9UX 4EXRA 1W7CA 1W5ZA 2JDIH 1VQM3 3X41A 4R9LA 1D6YA 1K41A 1JB5A 4EBGA 4MMYB 3FF2A 2A15A 2XSHB 2OWPA 5CLKA 1S723 1YIT3 1IT8A 2UX0A 3BNBA 4LSOA 3JUMA 4I4KA 2W9QA 1VQO3 1U5OA 2HMKB 4QWTA 4WYKA 1ZO2A 5IENA 5LC6A 2BNGA 2ML5A 3WA3A 1YHQ3 2CH9A 4AKYA 4XM4A 4LGQA 2YX9A 2Y73A 2HMMB 4RNYA 1Q42A 2WOFA 3Q90A 1YGEA 2Q07A 1T5YA 2XEPA 2B24B 2RSXA 4XBTA 5CF2A 3FG1A 3F40A 2BHMA 5FW5A 1AVLA 1VQK3 4OVMA 3GZXB 3HZPA 1YJ93 1V74A 3CC23 3KSPA 4N6NB 6STDA 3LZAA 4XDWA 4N3VA 3FSDA 5KP1A 3EB8A 3J7Yd 1W6GA 2INXA 2IUJA 3LMLA 2Z6BA 2W2CA 2K54A 1VQ63 4IPBA 3EX9A 3K63A 3LOYA 2O3OA 1L5GB 5D83A 1D6UA 3HI7A 4N6TA 3DGLA 3B8LA 3GZRA 3RGRA 1NU3A 4NREA 2GXFA 2OQEA 3EN8A 2IMJA 1VQ73 1KD14 1TUHA 3SOAA 2OOVA 1NB3I 5EQLA 1RRHA 4L8PA 8CHOA 1QJGA 1GYBA 1CYVA 1OHPA 3OWYA 4HM3B 5IG5A 3QK9A 1KQS2 3SOYA 1N5PA 1DVDA 3NBJA 3NQZA 4WFOA 4R1KA 1QALA 1K9M4 1JNQA 4FCMA 5STDA 4HKVB 3NQYA 3PGBA 4U13A 5AIGA 5IG0A 4O8SA 3S27A 5DRVA 2XGNA 3EF8A 4J9AA 2BMOB 3GRDA 1FGOA 5JPUA 1LNHA 3NV0A 4KZ1A 3ER7A 1W00A 3LT8A 3KN4A 3LH4A 3NBBA 5D82A 4XDVA 2W56A 5CK6A 3S29A 4K90B 3NUVA 3PCRA 1IQYA 4L7KA 3I553 3PXMA 2YFIB 3IJEB 3F7SA 4FCJA 1W4NA 4CDLA 1ROVA 3N54B 4FCZA 3MG1A 1OF5A 1AR0A 3G4S3 2KXGA 2BT3A 1WMNA 4HM8B 3OW22 1S5AA 4N6V0 2CKFB 4FMCA 1HU9A 1RRLA 1TU5A 1G96A 4O3VA 3T8UA 2FGTA 1VQN3 1K734 1ROAA 1E3RA 1IQ8A 2GBWB 2V1LA 5AIIA 2XFTA 4FR9A 3D9RA 1W2B2 3M8CA 1VQP3 1W6YA 1IDPA 1ULIB 4X2HA 3MHEA 3WMDA 3NV0B 4HM4B 3G16A 5EVHA 3X40A 2P0XA 1WNHA 3BNDA 1GD3A 3KSED 1VQ93 4IIAA 3B4OA 4NHFA 1VQ83 1OHOA 4HM0B 2STDA 2R4IA 1R4CA 1EA2A 4EYCA 3AMOA 4ORLA 1UUWB 2E2TA 4WHAA 1US1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG9 B;  1JB4 A;  1ZX2 A;  3H51 A;  3OWS A;  5IEO A;  5AEU B;  4WWU C;  2QIY A;  2Z77 A;  4HJL B;  6STD A;  3LZA A;  4XDW A;  4N3V A;  4K1V A;  1ISK A;  3FSD A;  4L8O A;  5KP1 A;  4STD A;  3VSY A;  2INX A;  1JKG B;  3B7C A;  1O7P B;  2W2C A;  2K54 A;  3EN1 B;  1Z1S A;  3KKG A;  5KP3 A;  2XSO B;  4HM5 B;  1OUN A;  4MJD A;  3EX9 A;  3EBT A;  3GZB A;  4WYK B;  3MYT A;  5D83 A;  5KP4 A;  3VGN A;  3HX8 A;  4HVN A;  4KVH A;  1DMM A;  3B8L A;  3CPO A;  2B1X B;  3NXJ A;  1A2K A;  1OGX A;  3GZR A;  3OX9 A;  1NU3 A;  3RGR A;  3STD A;  1NDO B;  3CNM A;  2F98 A;  2GXF A;  3DXO A;  3GWR A;  1JN5 A;  3BB9 A;  4H3U A;  1WQL B;  3EN8 A;  2IMJ A;  3F7X A;  3JUO A;  1TUH A;  3NBR A;  3UNL A;  3SOA A;  1BUQ A;  1OF5 B;  4OUQ A;  1JB2 A;  1VZZ A;  2BMQ B;  2Z76 A;  4L8P A;  2F99 A;  2BMR B;  1QJG A;  3DUK A;  3CU3 A;  3EBY A;  1GYB A;  1OHP A;  3HK4 A;  3I0Y A;  2PZV A;  3OWY A;  1TP6 A;  4HM3 B;  3UJM A;  5IG5 A;  1O7N B;  2HML B;  3JUN A;  3MKI A;  3SOY A;  1OHS A;  3H3H A;  3CNX A;  1QMA A;  3EC9 A;  3MSO A;  3F14 A;  4HM6 B;  2GEY A;  3FZW A;  1OPY A;  3A76 A;  4R1K A;  4HM7 B;  3K0Z A;  3F8X A;  3DMC A;  5IER A;  4FCM A;  1E3V A;  1O7W B;  5STD A;  4HKV B;  1W01 A;  4XBX A;  3ROB A;  4U13 A;  5AIG A;  5IG0 A;  3DM8 A;  1OCV A;  5IG4 A;  3ECF A;  3LYG A;  2JQ5 A;  5DRV A;  3MG2 A;  3KZT A;  1JKG A;  3EF8 A;  3EHC A;  4J9A A;  2BMO B;  3GRD A;  1ULJ B;  3RGA A;  5JPU A;  3E99 A;  1SJW A;  3NV0 A;  3G0K A;  2GEX A;  3DZL A;  1NWW A;  3ER7 A;  1W00 A;  1C7H A;  5D81 A;  4PEJ A;  4LMI A;  3FLJ A;  5D82 A;  4XDV A;  1GY7 A;  5TGN A;  2GBX B;  2YFJ B;  5CK6 A;  4HZB B;  3G8Z A;  4K1U A;  5DRE A;  5IG3 A;  3NUV A;  4RZM A;  3NM2 A;  1Q40 A;  4L7K A;  3FH1 A;  4LEH A;  5AIH A;  3JUQ A;  3SED A;  1DMQ A;  2YFI B;  3F7S A;  4FCJ A;  4R9K A;  5CXO A;  4X2O A;  4XB5 A;  2XR8 B;  3KE7 A;  5HGR A;  3T8N A;  4CDL A;  3K7C A;  3MG1 A;  5BXQ A;  1OF5 A;  1AR0 A;  1CQS A;  2YFL B;  4HM8 B;  4R9L A;  5AIF A;  5G2G A;  3NHX A;  1S5A A;  5IEP A;  2CKF B;  1K41 A;  5BVB A;  1OGZ A;  2HMJ B;  1JB5 A;  4J8T A;  5AI1 A;  2XRX B;  3FF2 A;  2A15 A;  2XSH B;  3T8U A;  2CHC A;  1OH0 A;  3S5C A;  2OWP A;  5CLK A;  8CHO A;  1E3R A;  1GS3 A;  2GBW B;  2HMO B;  2UX0 A;  3F9S A;  2RFR A;  4I4K A;  5AII A;  3BLZ A;  5JPP A;  1O7H B;  3D9R A;  3JUM A;  1GY6 A;  2HMN B;  3FGY A;  1E97 A;  1U5O A;  1ASK A;  1UUV B;  2HMK B;  1W6Y A;  1ZO2 A;  1IDP A;  3GZY B;  3M8C A;  3OV4 A;  2BNG A;  4WYK A;  2RCD A;  3FF0 A;  5IEN A;  3B4P A;  1ULI B;  4HZ9 B;  3F8H A;  4Q53 A;  4X2H A;  4XM4 A;  3MHE A;  4LGQ A;  3WMD A;  4WP5 A;  2HMM B;  2Z7A A;  3NV0 B;  1HKX A;  1Q42 A;  1STD A;  3Q90 A;  3G16 A;  4HM4 B;  5EVH A;  1DMN A;  1Q40 B;  3IPT A;  3OXA A;  3JUP A;  4IIA A;  3B4O A;  2QGU A;  3EJV A;  1OHO A;  1W02 A;  2B24 B;  4GB5 A;  4HM0 B;  4HM1 B;  2I9W A;  3EQQ B;  2STD A;  4XBT A;  1JN5 B;  2R4I A;  4HM2 B;  3F40 A;  5AEW B;  5CF2 A;  1EA2 A;  5FW5 A;  5CF1 A;  3MG3 A;  1GY5 A;  7STD A;  4XBY A;  1O7M B;  1O7G B;  3OWU A;  2RGQ A;  5IF6 A;  4OVM A;  3GZX B;  4ORL A;  3HZP A;  1UUW B;  2F86 B;  3FKA A;  3KSP A; 
#chains in the Genus database with same CATH topology
 1B27 A;  5IEO A;  4WWU C;  2QIY A;  2Z77 A;  2CFL A;  1EEJ A;  1ISK A;  1SIH A;  4L8O A;  3MWZ A;  1JKG B;  1O7P B;  5KP3 A;  3KKG A;  4BTY A;  3D4A A;  2XSO B;  1GMR A;  2KRT A;  1OUN A;  1TFK A;  3EBT A;  3MYT A;  3QRD A;  3HIG A;  1NO3 A;  3CME 3;  1BNI A;  4HVN A;  4KFF A;  3SX1 A;  1RJO A;  3D3L A;  1JJ2 2;  1JV2 B;  1NDO B;  1PY3 A;  2WOH A;  2F98 A;  1GOV A;  1DVC A;  3UNL A;  1PU4 A;  3F7X A;  1KWI A;  3WOE B;  1Q9E A;  3LTB A;  2BMQ B;  2D42 A;  3UL5 A;  4BL3 A;  1FGT A;  2CWT A;  3DUK A;  3EBY A;  3CU3 A;  3FG4 A;  3HK4 A;  3U1W A;  3UJM A;  2PZV A;  1TP6 A;  2LQV A;  1O7N B;  1W6C A;  3EC9 A;  2BU4 A;  3V99 A;  3S67 A;  3FZW A;  1OPY A;  3G6E 3;  1I0X A;  5IER A;  1E3V A;  1O7W B;  1M1X B;  4XBX A;  3ROB A;  1AQZ A;  3ZFZ A;  3DM8 A;  1OCV A;  1UGI A;  1FUS A;  3Q2P A;  3CPW 2;  1JKG A;  1CEW I;  3WA2 X;  5G1L A;  1JRQ A;  1D6Z A;  3E99 A;  1SJW A;  2ZHX B;  3D79 A;  3G0K A;  1IT7 A;  1NWW A;  1MWU A;  1C7H A;  1UCK A;  1A67 A;  4H61 A;  2AAD A;  3ALA A;  1X1X A;  4KFE A;  4PEJ A;  1BNS A;  4BTW A;  4CPK A;  1GY7 A;  3CCV 3;  5TGN A;  4ILF A;  2BIR A;  1N8Q A;  2GBX B;  2YFJ B;  1UCI A;  4HZB B;  4K61 A;  5DRE A;  3CXC 2;  2CIU A;  4CCV A;  3WHO A;  5AIH A;  3SED A;  1I3F A;  5CXO A;  4X2O A;  4XB5 A;  2XR8 B;  1JBT A;  3K7C A;  3S28 A;  5BXQ A;  1Q7Y 4;  1YJN 3;  1CQS A;  2YFL B;  3BIR A;  3KII A;  5AIF A;  5G2G A;  1IK3 A;  2CC3 A;  3GSP A;  5BVB A;  1OGZ A;  2HMJ B;  2QEX 3;  1FA3 A;  3SXX A;  1SPU A;  4TX4 A;  4EV5 A;  2CFK A;  2XRX B;  3LXU X;  2FNQ A;  1BUJ A;  1RDS A;  1OH0 A;  3S5C A;  1LOW A;  1Q86 4;  1LVN A;  1GS3 A;  3F9S A;  7GSP A;  1A2P A;  1FYS A;  1JBR A;  2RFR A;  2H0H A;  3BLZ A;  1O7H B;  4R4K A;  4HM5 B;  4BU4 A;  1E97 A;  1UUV B;  3N9H A;  1NJI 4;  2ML6 A;  1UCJ A;  1FGM A;  2RCD A;  3FF0 A;  2LYX A;  1UDI I;  3B4P A;  1BNR A;  3PS8 A;  3CCQ 3;  2Z7A A;  1BSE A;  1RGH A;  1EKM A;  1YI2 3;  1DMN A;  1MGW A;  1Q40 B;  3HII A;  1BNG A;  3JUP A;  1VQ5 3;  2QGU A;  3EJV A;  1QAK A;  2W04 A;  4GB5 A;  4HM1 B;  3EQQ B;  1RGE A;  4MEI A;  5AEW B;  3CMA 3;  5CF1 A;  1NNV A;  5ELJ A;  3MG3 A;  3TDG A;  3WOF B;  1GY5 A;  7STD A;  4XBY A;  1O7M B;  3FCS B;  5IF6 A;  1TTO A;  3CCJ 3;  2F86 B;  1YNV X;  1M90 4;  2XH9 A;  1N9J A;  4IT7 A;  1EG9 B;  1JB4 A;  1ZX2 A;  3SYU A;  1YVS A;  1IVU A;  4HJL B;  2E2V A;  3V98 A;  5JBS A;  2ZL8 A;  1ZS7 A;  1X1Y A;  1BRG A;  5AYS C;  3G71 3;  4R80 A;  3URP A;  1RGK A;  3EN1 B;  1BU4 A;  1Z1S A;  2M7O A;  1C54 A;  1M9G A;  2MF7 A;  4MJD A;  4WYK B;  3GZB A;  1YJW 3;  2IA7 A;  1EQK A;  3DY5 A;  4AKZ A;  4LZI A;  5KP4 A;  2CFW A;  3VGN A;  3HX8 A;  2W56 B;  4KVH A;  1FUW A;  2B1X B;  3NXJ A;  1A2K A;  3OX9 A;  4GHO A;  2CWV A;  3CCL 3;  3STD A;  3BU4 A;  2HOH A;  3CNM A;  5GSP A;  1RGL A;  4EC6 A;  3GWR A;  1JN5 A;  3BB9 A;  1WQL B;  2CW9 A;  1LQM B;  1IV9 A;  9RNT A;  2OTL 3;  4OUQ A;  1JB2 A;  1LOY A;  1UGH I;  1IQX A;  2MC8 A;  2Z76 A;  2W0Q A;  3FG3 A;  2F99 A;  2BMR B;  2K0M A;  3I0Y A;  1Q81 4;  1BRN L;  3CD6 3;  1GOY A;  3ZG0 A;  2P38 A;  4N6M A;  2QA4 3;  2E2U A;  1I2F A;  1TIJ A;  2HML B;  2SBL A;  1N5H A;  1OHS A;  3H3H A;  3CNX A;  1QMA A;  2CWU A;  3JUN A;  3F14 A;  2GEY A;  3A76 A;  2ZDJ A;  4FMB A;  1BSB A;  4HM7 B;  4MMX B;  3K0Z A;  3F8X A;  2FXT A;  3BNE A;  3CC4 3;  1W01 A;  3AHS A;  1AV4 A;  3LTD A;  5IG4 A;  1Q82 4;  2W03 A;  1VQL 3;  3LYG A;  1QVG 2;  2JQ5 A;  4BL2 A;  3I56 3;  1BSC A;  3PZW A;  4FMD A;  3EHC A;  1FGQ A;  4HBR A;  1ULJ B;  3RGA A;  1RN7 A;  5HOH A;  3X42 A;  2GEX A;  3DZL A;  1B2Z A;  1GSP A;  3PCS A;  1RLS A;  1WMO A;  1KC8 4;  1AVK A;  4KFD A;  1BVI A;  2KF4 A;  4J5K A;  3DGM A;  3U97 A;  3A5E A;  2WGO A;  3NM2 A;  3X3Y A;  4LEH A;  1PFP A;  3JUQ A;  4N6U A;  1BRS A;  1U8C B;  2CG1 A;  4R9K A;  3CC7 3;  1TJD A;  5ELU A;  5HGR A;  3KE7 A;  3T8N A;  1SAR A;  4GSP A;  1BRK A;  3NHX A;  2C10 A;  5IEP A;  2XF3 A;  2CX1 A;  2K3D A;  3K5T A;  4J8T A;  4O2H A;  1RN1 A;  5AI1 A;  1RGA A;  1M1K 4;  2XFS A;  3KFQ C;  2CHC A;  1VQ4 3;  1RSN A;  4N6O B;  4G1M B;  3LT9 A;  2KF5 A;  1F8N A;  2HMO B;  5JPP A;  1WTH A;  3VF1 A;  4MMZ B;  1GY6 A;  2HMN B;  3FGY A;  3GZY B;  3RDE A;  1ASK A;  1BOX A;  1GD4 A;  1LOX A;  3OV4 A;  1K8A 4;  1B2S A;  1IVV A;  2C11 A;  2CFD A;  1UW1 A;  3AHW A;  4O02 B;  3UB1 A;  3CCU 3;  4HZ9 B;  3F8H A;  3JVC A;  4Q53 A;  1OAC A;  4WP5 A;  3MPH A;  4JRF A;  4JF8 A;  3O8Y A;  1HKX A;  1STD A;  2PNC A;  2L4V A;  2H0G A;  3IPT A;  1SQW A;  2CG0 A;  1QAF A;  3OXA A;  1LNI A;  5I97 A;  1W02 A;  1I2E A;  2F5M A;  2I9W A;  1JN5 B;  2WGQ A;  4HM2 B;  1IVW A;  2CK3 H;  2RBI A;  3AMO B;  3NM7 A;  3UL6 A;  2IUK A;  3OWU A;  1O7G B;  1FZU A;  2RGQ A;  1J2B A;  3DGN A;  1LRA A;  3SVA A;  3HOH A;  1I8V A;  5AEU B;  2KCD A;  3H51 A;  3OWS A;  1X1W A;  2P05 A;  1UI8 A;  3K9M C;  2OOV C;  4FMA A;  4HOH A;  5LC7 A;  5A0O B;  4K1V A;  6GSP A;  6RNT A;  2KAA A;  2P0M A;  1Y4K A;  2D1W A;  4STD A;  1B21 A;  1LQG C;  2OCT A;  3VSY A;  2OTJ 3;  3B7C A;  3WR2 A;  1FGR A;  2GU1 A;  3FKA A;  4RNZ A;  4ZM8 A;  1R4Y A;  1RN4 A;  1UUG B;  2GU3 A;  1MWT A;  1IV7 A;  3WOD G;  1A2V A;  3ZG5 A;  1BNF A;  1GMP A;  1DMM A;  3CPO A;  4AEQ A;  1OGX A;  3EE1 A;  1K28 A;  3WDG B;  2WO0 A;  2UGI A;  1FW7 A;  3LTA A;  2Y74 A;  1B2U A;  2XGL A;  3CCS 3;  1T3B A;  1X1U A;  2W9P A;  4HYZ A;  1DYU A;  1I0V A;  2BO9 B;  3DXO A;  3N8B A;  3Q3F A;  4H3U A;  5BU4 A;  3JUO A;  5M18 A;  3NBR A;  8RNT A;  1YIJ 3;  1BUQ A;  1OF5 B;  1VZZ A;  1N8R 4;  1QVF 2;  1BRI A;  1MNL A;  1JZD A;  3DGO A;  3SLU A;  4GL6 A;  5IW9 A;  3X3X A;  1WMP A;  4OK0 A;  4BTX A;  2H0I A;  5RNT A;  3MSO A;  3L0R A;  4HM6 B;  1YVB I;  1B2M A;  1RKY A;  3IMA B;  3X3Z A;  3LTC A;  2CX0 A;  1SII A;  1CYU A;  1IVX A;  4RNT A;  3DMC A;  3PYJ A;  2W6J H;  3T0U A;  1FUT A;  4RBN A;  2CFG A;  5M19 A;  1STF I;  1MOL A;  1BRH A;  3ECF A;  2OQE C;  1BSA A;  3MG2 A;  3KZT A;  3NX0 A;  5AYR B;  3BNC A;  4EV2 A;  3CCE 3;  3CCR 3;  5FGO A;  1IU7 A;  2P09 A;  1TFO A;  4EW5 A;  1UI7 A;  1NB5 I;  3CCM 3;  5D81 A;  1W2Z A;  4LMI A;  3FLJ A;  1LXE A;  3Q1C A;  3V92 A;  1KSI A;  3G8Z A;  4K1U A;  5EEO A;  1A90 A;  5IG3 A;  4RZM A;  3D5G A;  1Q40 A;  2ZA4 A;  3FH1 A;  3GAX A;  4N6L A;  1N9E A;  1DMQ A;  1GOU A;  2O9U X;  3D5I A;  1W7C A;  4EXR A;  1W5Z A;  2JDI H;  1HYF A;  1VQM 3;  3X41 A;  4R9L A;  1D6Y A;  1RTU A;  2AAE A;  1K41 A;  1RHL A;  1IYY A;  1JB5 A;  1RGG A;  4EBG A;  2UUG C;  4MMY B;  1TRQ A;  2A15 A;  2XSH B;  3FF2 A;  5M1A A;  2OWP A;  5CLK A;  1S72 3;  1YIT 3;  1IT8 A;  2UX0 A;  3BNB A;  4DKI A;  4LSO A;  3JUM A;  4I4K A;  2R41 A;  2W9Q A;  1VQO 3;  1U5O A;  2HMK B;  4NPB A;  4QWT A;  4WYK A;  1T2H A;  1ZO2 A;  5IEN A;  5LC6 A;  2BNG A;  2ML5 A;  4BIR A;  3WA3 A;  2CH9 A;  1YHQ 3;  4AKY A;  2GSP A;  4XM4 A;  1BAO A;  4I5Q A;  4LGQ A;  2YX9 A;  2Y73 A;  2HMM B;  4RNY A;  1Q42 A;  2WOF A;  3Q90 A;  2J8X B;  1YGE A;  2Q07 A;  1T5Y A;  3RNT A;  2XEP A;  2B24 B;  2RSX A;  4XBT A;  1V57 A;  4KT3 B;  3FG1 A;  3F40 A;  2BHM A;  2KF3 A;  4J5G A;  5FW5 A;  5CF2 A;  1DE3 A;  1YGW A;  1AVL A;  1VQQ A;  1VQK 3;  1RNB A;  1EUI C;  2C4B A;  4OVM A;  2IY2 A;  3GZX B;  3HZP A;  1YJ9 3;  1I70 A;  1V74 A;  3CC2 3;  3KSP A;  1G02 A;  1HZ1 A;  1ZGX A;  4N6N B;  6STD A;  3LZA A;  4LYL B;  4N3V A;  4XDW A;  3FSD A;  5KP1 A;  3EB8 A;  3J7Y d;  1W6G A;  2INX A;  2IUJ A;  1CH0 A;  3LML A;  2Z6B A;  2W2C A;  2K54 A;  1VQ6 3;  4IPB A;  3EX9 A;  3K63 A;  3LOY A;  5G1K A;  2O3O A;  1L5G B;  5D83 A;  1D6U A;  1BIR A;  3HI7 A;  1T2I A;  4N6T A;  3DGL A;  3B8L A;  3GZR A;  3RGR A;  1NU3 A;  1RNT A;  4NRE A;  4HAA A;  2GXF A;  2OQE A;  3MKI A;  3EN8 A;  1MGR A;  2IMJ A;  1VQ7 3;  1TUH A;  1KD1 4;  3SOA A;  2OOV A;  1NB3 I;  5EQL A;  1TRP A;  1RRH A;  4L8P A;  8CHO A;  1QJG A;  2L1S A;  1GYB A;  1CYV A;  1JZO A;  1OHP A;  3OWY A;  4HM3 B;  3QK9 A;  5IG5 A;  1KQS 2;  3SOY A;  1N5P A;  1DVD A;  3DH2 A;  2IYJ A;  1RCK A;  1G0T A;  3NBJ A;  3NQZ A;  4WFO A;  4R1K A;  1BNJ A;  1RGF A;  1QAL A;  1K9M 4;  1JNQ A;  1BRJ A;  4FCM A;  5STD A;  4HKV B;  5BIR A;  3AGO A;  1AY7 A;  3NQY A;  3PGB A;  4U13 A;  5AIG A;  5IG0 A;  4O8S A;  7RNT A;  3S27 A;  5DRV A;  2XGN A;  1BSD A;  3EF8 A;  4J9A A;  1Q7H A;  2BMO B;  3GRD A;  1FGO A;  5JPU A;  1LNH A;  3NV0 A;  4KZ1 A;  4CJN A;  3ER7 A;  1W00 A;  3LT8 A;  3KN4 A;  3LH4 A;  3NBB A;  5D82 A;  4XDV A;  2W56 A;  5CK6 A;  3S29 A;  1MWS A;  3KCH A;  4K90 B;  3NUV A;  3PCR A;  1IQY A;  4L7K A;  1RMS A;  2SAR A;  3I55 3;  3PXM A;  3DGY A;  2YFI B;  3IJE B;  3F7S A;  4FCJ A;  1W4N A;  2KF6 A;  4CDL A;  1PYL A;  1LOV A;  1ROV A;  3N54 B;  4FCZ A;  2RNT A;  1V58 A;  3MG1 A;  1GMQ A;  1OF5 A;  1AR0 A;  3G4S 3;  2KXG A;  2BT3 A;  1WMN A;  1RCL A;  4HM8 B;  3OW2 2;  1S5A A;  1RGC A;  4N6V 0;  2CKF B;  4FMC A;  2F4Y A;  1HU9 A;  1RRL A;  1UCL A;  1TU5 A;  1G96 A;  1I3I A;  4O3V A;  3T8U A;  2FGT A;  1VQN 3;  1B2X A;  1K73 4;  1ROA A;  1E3R A;  1IQ8 A;  2GBW B;  2V1L A;  5AII A;  3AGN A;  2XFT A;  4FR9 A;  1BAN A;  1JBS A;  3D9R A;  1W2B 2;  1DET A;  1B20 A;  3M8C A;  1VQP 3;  1W6Y A;  1IDP A;  1ULI B;  4X2H A;  3MHE A;  3WMD A;  2F5W A;  3NV0 B;  4HM4 B;  3G16 A;  5EVH A;  3X40 A;  1WNH A;  2P0X A;  3BND A;  1GD3 A;  3KSE D;  1VQ9 3;  4IIA A;  1BGS A;  3B4O A;  4NHF A;  1OHO A;  1VQ8 3;  1I2G A;  4HM0 B;  1MWR A;  2STD A;  2F56 A;  1BNE A;  2R4I A;  1R4C A;  1EA2 A;  4EYC A;  1B3S A;  3AMO A;  4ORL A;  1UUW B;  2E2T A;  4WHA A;  1US1 A; 
#chains in the Genus database with same CATH homology
 5IEO A;  4WWU C;  2QIY A;  2Z77 A;  2CFL A;  1ISK A;  1SIH A;  4L8O A;  3MWZ A;  1JKG B;  1O7P B;  5KP3 A;  3KKG A;  4BTY A;  2XSO B;  2KRT A;  1OUN A;  1TFK A;  3EBT A;  3MYT A;  3QRD A;  3HIG A;  1NO3 A;  3CME 3;  4HVN A;  4KFF A;  3SX1 A;  1RJO A;  3D3L A;  1JJ2 2;  1NDO B;  1JV2 B;  2WOH A;  2F98 A;  1DVC A;  3UNL A;  1PU4 A;  3F7X A;  1KWI A;  3WOE B;  3LTB A;  2BMQ B;  2D42 A;  3UL5 A;  1FGT A;  2CWT A;  3DUK A;  3EBY A;  3CU3 A;  3FG4 A;  3HK4 A;  3U1W A;  3UJM A;  2PZV A;  1TP6 A;  2LQV A;  1O7N B;  1W6C A;  3EC9 A;  3V99 A;  3S67 A;  3FZW A;  1OPY A;  3G6E 3;  5IER A;  1E3V A;  1O7W B;  1M1X B;  4XBX A;  3ROB A;  3DM8 A;  1OCV A;  3Q2P A;  3CPW 2;  1JKG A;  1CEW I;  3WA2 X;  1JRQ A;  1D6Z A;  3E99 A;  1SJW A;  3G0K A;  1NWW A;  1IT7 A;  1A67 A;  1C7H A;  4H61 A;  3ALA A;  4PEJ A;  4KFE A;  4BTW A;  1GY7 A;  3CCV 3;  5TGN A;  4K61 A;  2GBX B;  1N8Q A;  2YFJ B;  4HZB B;  5DRE A;  3CXC 2;  2CIU A;  4CCV A;  5AIH A;  3SED A;  5CXO A;  4X2O A;  4XB5 A;  2XR8 B;  3K7C A;  3S28 A;  5BXQ A;  1Q7Y 4;  1YJN 3;  1CQS A;  2YFL B;  5AIF A;  3KII A;  5G2G A;  1IK3 A;  2CC3 A;  5BVB A;  1OGZ A;  2HMJ B;  2QEX 3;  1FA3 A;  3SXX A;  1SPU A;  4TX4 A;  4EV5 A;  2CFK A;  2XRX B;  3LXU X;  2FNQ A;  1OH0 A;  3S5C A;  1Q86 4;  1LVN A;  1GS3 A;  3F9S A;  2RFR A;  3BLZ A;  1O7H B;  4R4K A;  4HM5 B;  1E97 A;  1UUV B;  3N9H A;  1NJI 4;  2ML6 A;  1FGM A;  2RCD A;  3FF0 A;  2LYX A;  3B4P A;  3PS8 A;  3CCQ 3;  2Z7A A;  1EKM A;  1YI2 3;  1DMN A;  1Q40 B;  3HII A;  3JUP A;  1VQ5 3;  2QGU A;  3EJV A;  1QAK A;  2W04 A;  4GB5 A;  4HM1 B;  3EQQ B;  4MEI A;  3CMA 3;  5AEW B;  5CF1 A;  5ELJ A;  3MG3 A;  3TDG A;  3WOF B;  1GY5 A;  7STD A;  4XBY A;  1O7M B;  3FCS B;  5IF6 A;  3CCJ 3;  2F86 B;  1M90 4;  2XH9 A;  1N9J A;  4IT7 A;  1EG9 B;  1JB4 A;  1ZX2 A;  1IVU A;  4HJL B;  2E2V A;  3V98 A;  5JBS A;  2ZL8 A;  5AYS C;  3G71 3;  4R80 A;  3EN1 B;  1Z1S A;  2M7O A;  1M9G A;  2MF7 A;  4MJD A;  4WYK B;  3GZB A;  1YJW 3;  2IA7 A;  1EQK A;  3DY5 A;  4AKZ A;  4LZI A;  5KP4 A;  2CFW A;  3VGN A;  3HX8 A;  2W56 B;  4KVH A;  1FUW A;  2B1X B;  3NXJ A;  1A2K A;  3OX9 A;  2CWV A;  3CCL 3;  3STD A;  3CNM A;  4EC6 A;  3GWR A;  1JN5 A;  3BB9 A;  1WQL B;  2CW9 A;  1IV9 A;  2OTL 3;  4OUQ A;  1JB2 A;  1IQX A;  2MC8 A;  2Z76 A;  2W0Q A;  3FG3 A;  2F99 A;  2BMR B;  2K0M A;  3I0Y A;  1Q81 4;  3CD6 3;  2P38 A;  4N6M A;  2QA4 3;  2E2U A;  1TIJ A;  2HML B;  3JUN A;  2SBL A;  1N5H A;  1OHS A;  3H3H A;  3CNX A;  1QMA A;  2CWU A;  3MKI A;  3F14 A;  2GEY A;  3A76 A;  2ZDJ A;  4FMB A;  4HM7 B;  4MMX B;  3K0Z A;  3F8X A;  2FXT A;  3BNE A;  3CC4 3;  1W01 A;  1AV4 A;  3LTD A;  5IG4 A;  1Q82 4;  2W03 A;  1VQL 3;  3LYG A;  1QVG 2;  2JQ5 A;  3I56 3;  4FMD A;  3PZW A;  3EHC A;  1FGQ A;  4HBR A;  1ULJ B;  3RGA A;  1RN7 A;  3X42 A;  2GEX A;  3DZL A;  3PCS A;  1WMO A;  1KC8 4;  1AVK A;  4KFD A;  3U97 A;  3X3Y A;  3DGM A;  2WGO A;  3NM2 A;  4LEH A;  1PFP A;  3JUQ A;  4N6U A;  1U8C B;  2CG1 A;  4R9K A;  3CC7 3;  5HGR A;  5ELU A;  3KE7 A;  3T8N A;  3NHX A;  2C10 A;  5IEP A;  2XF3 A;  3K5T A;  4J8T A;  4O2H A;  5AI1 A;  1M1K 4;  2XFS A;  3KFQ C;  2CHC A;  1VQ4 3;  4N6O B;  4G1M B;  3LT9 A;  1F8N A;  2HMO B;  5JPP A;  1WTH A;  3VF1 A;  4MMZ B;  1GY6 A;  2HMN B;  3FGY A;  3GZY B;  3RDE A;  1ASK A;  1GD4 A;  1LOX A;  3OV4 A;  1K8A 4;  1IVV A;  2C11 A;  2CFD A;  3UB1 A;  1UW1 A;  4O02 B;  3CCU 3;  4HZ9 B;  3F8H A;  3JVC A;  4Q53 A;  1OAC A;  4WP5 A;  3MPH A;  4JRF A;  4JF8 A;  3O8Y A;  1HKX A;  1STD A;  2PNC A;  2L4V A;  3IPT A;  1SQW A;  2CG0 A;  1QAF A;  3OXA A;  5I97 A;  1W02 A;  2I9W A;  1JN5 B;  2WGQ A;  4HM2 B;  1IVW A;  2CK3 H;  3AMO B;  3NM7 A;  3UL6 A;  2IUK A;  3OWU A;  1O7G B;  1J2B A;  2RGQ A;  3DGN A;  3SVA A;  5AEU B;  2KCD A;  3H51 A;  3OWS A;  2P05 A;  4FMA A;  1UI8 A;  3K9M C;  2OOV C;  5LC7 A;  5A0O B;  4K1V A;  2P0M A;  1Y4K A;  2D1W A;  4STD A;  3VSY A;  2OTJ 3;  2OCT A;  3B7C A;  1FGR A;  2GU1 A;  3FKA A;  4RNZ A;  4ZM8 A;  2GU3 A;  1IV7 A;  1A2V A;  1DMM A;  3CPO A;  4AEQ A;  1OGX A;  3EE1 A;  1K28 A;  3WDG B;  2WO0 A;  3LTA A;  2Y74 A;  2XGL A;  3CCS 3;  2W9P A;  4HYZ A;  3WOD G;  1DYU A;  2BO9 B;  3DXO A;  4H3U A;  3N8B A;  3JUO A;  3NBR A;  1BUQ A;  1YIJ 3;  1OF5 B;  1VZZ A;  1N8R 4;  1QVF 2;  1MNL A;  3DGO A;  3SLU A;  5IW9 A;  4GL6 A;  3X3X A;  1WMP A;  4OK0 A;  4BTX A;  3MSO A;  3L0R A;  4HM6 B;  1YVB I;  1RKY A;  3IMA B;  3X3Z A;  3LTC A;  1SII A;  1CYU A;  1IVX A;  3DMC A;  3PYJ A;  2W6J H;  3T0U A;  4RBN A;  2CFG A;  1STF I;  1MOL A;  3ECF A;  2OQE C;  3MG2 A;  3NX0 A;  3KZT A;  5AYR B;  4EV2 A;  3BNC A;  3CCE 3;  3CCR 3;  5FGO A;  1IU7 A;  2P09 A;  1TFO A;  1UI7 A;  1NB5 I;  3CCM 3;  5D81 A;  1W2Z A;  4LMI A;  3FLJ A;  1LXE A;  3Q1C A;  3V92 A;  1KSI A;  3G8Z A;  4K1U A;  5EEO A;  1A90 A;  5IG3 A;  4RZM A;  1Q40 A;  3FH1 A;  3GAX A;  4N6L A;  1N9E A;  1DMQ A;  2O9U X;  4EXR A;  1W7C A;  1W5Z A;  2JDI H;  1VQM 3;  3X41 A;  4R9L A;  1D6Y A;  1K41 A;  1JB5 A;  4EBG A;  4MMY B;  3FF2 A;  2A15 A;  2XSH B;  2OWP A;  5CLK A;  1S72 3;  1YIT 3;  1IT8 A;  2UX0 A;  3BNB A;  4LSO A;  3JUM A;  4I4K A;  2W9Q A;  1VQO 3;  1U5O A;  2HMK B;  4QWT A;  4WYK A;  1ZO2 A;  5IEN A;  5LC6 A;  2BNG A;  2ML5 A;  3WA3 A;  1YHQ 3;  2CH9 A;  4AKY A;  4XM4 A;  4LGQ A;  2YX9 A;  2Y73 A;  2HMM B;  4RNY A;  1Q42 A;  2WOF A;  3Q90 A;  1YGE A;  2Q07 A;  1T5Y A;  2XEP A;  2B24 B;  2RSX A;  4XBT A;  5CF2 A;  3FG1 A;  3F40 A;  2BHM A;  5FW5 A;  1AVL A;  1VQK 3;  4OVM A;  3GZX B;  3HZP A;  1YJ9 3;  1V74 A;  3CC2 3;  3KSP A;  4N6N B;  6STD A;  3LZA A;  4XDW A;  4N3V A;  3FSD A;  5KP1 A;  3EB8 A;  3J7Y d;  1W6G A;  2INX A;  2IUJ A;  3LML A;  2Z6B A;  2W2C A;  2K54 A;  1VQ6 3;  4IPB A;  3EX9 A;  3K63 A;  3LOY A;  2O3O A;  1L5G B;  5D83 A;  1D6U A;  3HI7 A;  4N6T A;  3DGL A;  3B8L A;  3GZR A;  3RGR A;  1NU3 A;  4NRE A;  2GXF A;  2OQE A;  3EN8 A;  2IMJ A;  1VQ7 3;  1KD1 4;  1TUH A;  3SOA A;  2OOV A;  1NB3 I;  5EQL A;  1RRH A;  4L8P A;  8CHO A;  1QJG A;  1GYB A;  1CYV A;  1OHP A;  3OWY A;  4HM3 B;  5IG5 A;  3QK9 A;  1KQS 2;  3SOY A;  1N5P A;  1DVD A;  3NBJ A;  3NQZ A;  4WFO A;  4R1K A;  1QAL A;  1K9M 4;  1JNQ A;  4FCM A;  5STD A;  4HKV B;  3NQY A;  3PGB A;  4U13 A;  5AIG A;  5IG0 A;  4O8S A;  3S27 A;  5DRV A;  2XGN A;  3EF8 A;  4J9A A;  2BMO B;  3GRD A;  1FGO A;  5JPU A;  1LNH A;  3NV0 A;  4KZ1 A;  3ER7 A;  1W00 A;  3LT8 A;  3KN4 A;  3LH4 A;  3NBB A;  5D82 A;  4XDV A;  2W56 A;  5CK6 A;  3S29 A;  4K90 B;  3NUV A;  3PCR A;  1IQY A;  4L7K A;  3I55 3;  3PXM A;  2YFI B;  3IJE B;  3F7S A;  4FCJ A;  1W4N A;  4CDL A;  1ROV A;  3N54 B;  4FCZ A;  3MG1 A;  1OF5 A;  1AR0 A;  3G4S 3;  2KXG A;  2BT3 A;  1WMN A;  4HM8 B;  3OW2 2;  1S5A A;  4N6V 0;  2CKF B;  4FMC A;  1HU9 A;  1RRL A;  1TU5 A;  1G96 A;  4O3V A;  3T8U A;  2FGT A;  1VQN 3;  1K73 4;  1ROA A;  1E3R A;  1IQ8 A;  2GBW B;  2V1L A;  5AII A;  2XFT A;  4FR9 A;  3D9R A;  1W2B 2;  3M8C A;  1VQP 3;  1W6Y A;  1IDP A;  1ULI B;  4X2H A;  3MHE A;  3WMD A;  3NV0 B;  4HM4 B;  3G16 A;  5EVH A;  3X40 A;  2P0X A;  1WNH A;  3BND A;  1GD3 A;  3KSE D;  1VQ9 3;  4IIA A;  3B4O A;  4NHF A;  1VQ8 3;  1OHO A;  4HM0 B;  2STD A;  2R4I A;  1R4C A;  1EA2 A;  4EYC A;  3AMO A;  4ORL A;  1UUW B;  2E2T A;  4WHA A;  1US1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...