4HM2B

Naphthalene 1,2-dioxygenase bound to ethylphenylsulfide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to ethylphenylsulfide
rcsb
source organism Pseudomonas sp. c18
total genus 53
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hm2B00
2F86B 4LGQA 1W6YA 3S5CA 2INXA 4XBTA 1JKGA 3NV0B 2B24B 4LMIA 3STDA 4GB5A 3F8XA 1Z1SA 2CHCA 3UNLA 2UX0A 1NU3A 1UUWB 3GZYB 4OUQA 2W2CA 1EG9B 3BLZA 3NHXA 2B1XB 4MJDA 1Q42A 5JPPA 1OF5B 3HX8A 5IF6A 2CKFB 2F99A 2HMMB 2YFIB 2GBXB 3NM2A 3T8NA 3GZXB 3CPOA 2GEXA 3MHEA 3GZRA 1NWWA 1K41A 3ER7A 3GRDA 5STDA 3JUNA 1Q40A 2RFRA 5KP1A 1JB4A 4L8OA 5HGRA 4X2HA 4N3VA 4X2OA 4FCMA 4H3UA 4J8TA 3F8HA 3B4PA 1QMAA 1NDOB 3JUPA 5CXOA 2XRXB 3GWRA 4HM5B 1DMMA 4L7KA 2F98A 1GY7A 2R4IA 3MKIA 1OPYA 1W02A 3F7XA 1ULIB 5IEPA 3EN8A 3KSPA 6STDA 3NXJA 4KVHA 1O7MB 5AIHA 1OH0A 1U5OA 3G8ZA 1GYBA 7STDA 3VGNA 5IG4A 1OHOA 5AIFA 3OV4A 4HZBB 3OX9A 3H51A 3EX9A 4OVMA 3T8UA 3NV0A 3JUOA 1O7WB 1SJWA 3MG2A 3JUMA 5AIIA 3RGRA 1ULJB 4WWUC 3MG1A 4I4KA 2HMOB 4ORLA 1WQLB 3Q90A 4XDVA 1OHSA 3CNMA 1EA2A 1OF5A 3FSDA 3DUKA 4HKVB 1ISKA 3M8CA 3EQQB 3G0KA 2Z77A 4CDLA 1O7PB 2GBWB 4XBYA 3HZPA 3SOYA 5D81A 3DZLA 3E99A 3NBRA 4HM7B 1TP6A 3EHCA 1ASKA 1W00A 1O7HB 1QJGA 1ZX2A 3RGAA 3OWYA 3KE7A 3FF2A 1OGZA 3LZAA 3FF0A 4PEJA 5D82A 4L8PA 2JQ5A 3EBYA 1S5AA 2HMJB 1GY5A 1JN5B 4HM1B 5AEUB 3OXAA 4HM0B 1E3VA 1UUVB 3B8LA 3CNXA 3I0YA 5CF1A 5FW5A 5IEOA 5IG0A 2YFLB 5BVBA 4HZ9B 2K54A 5IENA 3UJMA 2A15A 1O7NB 5KP3A 2BMRB 1JB5A 3DXOA 4R1KA 4WYKB 2XSHB 2BMOB 3FKAA 2RCDA 1CQSA 3OWUA 4HM4B 3H3HA 4XB5A 5IG3A 4K1VA 5D83A 5G2GA 1E97A 2Z76A 1A2KA 4U13A 5IERA 4HM6B 4Q53A 3EC9A 4XBXA 8CHOA 2GEYA 4RZMA 3ECFA 4LEHA 2QIYA 4R9LA 1HKXA 3K0ZA 5CK6A 5AI1A 3IPTA 5BXQA 2I9WA 3SOAA 2HMKB 1JKGB 5EVHA 2Z7AA 3MG3A 1VZZA 1AR0A 3F9SA 2BNGA 4WP5A 4J9AA 3MSOA 3B7CA 2BMQB 4XDWA 1IDPA 3KZTA 3EN1B 4XM4A 4HJLB 4HM2B 3SEDA 3K7CA 3F40A 1DMQA 3DMCA 2RGQA 5DREA 2YFJB 3DM8A 1GY6A 1JN5A 4HVNA 3B4OA 3OWSA 1Q40B 3JUQA 3MYTA 3EJVA 2GXFA 1O7GB 5JPUA 3EF8A 4FCJA 3FZWA 2HMLB 1OCVA 3F14A 4STDA 1ZO2A 3WMDA 2XR8B 5CF2A 2OWPA 1GS3A 3FH1A 1C7HA 5TGNA 4IIAA 2STDA 4R9KA 4K1UA 2QGUA 4WYKA 1W01A 3BB9A 1JB2A 1TUHA 3EBTA 5CLKA 1STDA 5AEWB 3KKGA 2HMNB 3LYGA 1OGXA 3CU3A 1DMNA 3VSYA 3NUVA 3F7SA 3A76A 1OHPA 3FLJA 4HM8B 3D9RA 5DRVA 2IMJA 1E3RA 3FGYA 5AIGA 1BUQA 3HK4A 3G16A 1OUNA 4HM3B 2XSOB 5KP4A 2PZVA 5IG5A 3ROBA 3GZBA
chains in the Genus database with same CATH superfamily
2F86B 4LGQA 1W6YA 3S5CA 4K61A 3V92A 1FUTA 1JRQA 1Q7Y4 3D79A 1RJOA 3HOHA 4NHFA 5AYSC 1BRHA 2INXA 4XBTA 1JKGA 3NV0B 3ZG0A 1DVCA 2B24B 4LMIA 1RSNA 3NBJA 3STDA 1K734 4GB5A 3F8XA 1STFI 1Z1SA 6GSPA 1TRQA 4FMBA 2CHCA 3UNLA 1VQ73 2UX0A 5HOHA 1NU3A 1BAOA 1UUWB 1IQYA 3GZYB 4OUQA 3X3ZA 2W2CA 3QK9A 1D6YA 1IT8A 1EG9B 1FZUA 1RLSA 2WGOA 2W0QA 1C54A 1RRLA 3LT8A 3BLZA 1ROVA 3NHXA 1RGAA 2B1XB 3ZFZA 1U8CB 1MWUA 4QWTA 1MWRA 3AGOA 4MJDA 2MC8A 1Q42A 5JPPA 3ZG5A 3G6E3 1OF5B 2P0XA 3GAXA 3HX8A 5IF6A 2CH9A 1WTHA 2CWUA 2CKFB 2F99A 3CME3 1GMPA 3T0UA 1LOVA 2HMMB 4RNYA 2YFIB 1K9M4 2CFLA 4MMYB 1M9GA 1BOXA 2GBXB 2LYXA 3AMOB 3D3LA 1GD3A 3NM2A 3T8NA 3GZXB 1AV4A 5ELUA 1VQ83 1BNIA 3CPOA 3D4AA 1GOYA 1FYSA 2GEXA 3MHEA 3O8YA 4FR9A 5M1AA 1VQ63 3GZRA 1YVSA 4GSPA 5A0OB 1NWWA 4H61A 1K41A 3ER7A 1JBSA 3SVAA 1BIRA 3GRDA 5STDA 4R80A 3QRDA 1YIT3 3JUNA 1PFPA 1Q40A 2CIUA 3L0RA 1A90A 2QA43 4EYCA 2P05A 2RFRA 3NX0A 1B3SA 3PZWA 3CCJ3 1JBRA 1BSDA 1RRHA 3KN4A 4KT3B 4BTYA 1WMOA 4HAAA 1BRGA 2O9UX 5KP1A 1B2SA 1JB4A 2K3DA 4L8OA 5HGRA 1PU4A 4HBRA 2ML6A 4X2HA 2H0HA 4N3VA 4X2OA 1JJ22 4FCMA 2IUJA 1EQKA 1N5PA 5JBSA 1RKYA 3URPA 4G1MB 4H3UA 1YJ93 4J8TA 3PCRA 1GOVA 1IYYA 1M1XB 3F8HA 4O8SA 3B4PA 3IMAB 1QMAA 2F56A 1IT7A 3BIRA 2F5WA 1NDOB 3JUPA 3V99A 5CXOA 2XRXB 3GWRA 1RGLA 4HM5B 3CCV3 1FGTA 1DMMA 2KF3A 4L7KA 2OOVA 2F98A 1R4CA 1GY7A 1IU7A 2KF6A 2R4IA 2W56A 3HIIA 3I563 1Q824 3MKIA 4HOHA 1B2XA 1LNIA 1OPYA 1W02A 2OQEC 3F7XA 5RNTA 1ULIB 3CCL3 1FA3A 1RGFA 5IEPA 1NB3I 3EN8A 3K9MC 1EUIC 2D42A 1SARA 3KSPA 4CCVA 1LNHA 3CCQ3 3DGOA 2KF5A 3X41A 1KSIA 2RNTA 1BSAA 6STDA 4GL6A 1VQL3 4N6NB 1N9EA 3CCE3 1Q7HA 2RSXA 2CFKA 1PYLA 3NXJA 2CFGA 2IY2A 2YX9A 2CX0A 2XGNA 2SBLA 4KVHA 3CC73 1FGMA 1O7MB 1T5YA 1OH0A 2CG0A 2KRTA 5AIHA 1JNQA 1LRAA 1TTOA 2V1LA 2XFSA 1U5OA 3BNDA 1GYBA 1TIJA 1YGWA 3G8ZA 3KCHA 3X42A 3WODG 7STDA 2FNQA 3VGNA 5IG4A 1OHOA 5AIFA 3OV4A 1BSBA 1LQGC 2FGTA 1CEWI 4HZBB 1BRSA 1VQP3 3PYJA 3OX9A 1MGWA 3CCR3 2PNCA 3H51A 4I5QA 3CCU3 1W4NA 2ZA4A 3EX9A 4EC6A 3GSPA 3UL5A 2Y74A 4OVMA 1W2ZA 1RGGA 3AHSA 3K63A 2D1WA 4RNTA 3T8UA 3NV0A 3JUOA 1O7WB 1RNTA 1SJWA 1I8VA 1Y4KA 3MG2A 1F8NA 1RN4A 2C10A 1V57A 5IW9A 2CFWA 1RGEA 3SYUA 3D5GA 3JUMA 5AIIA 1YI23 1I3IA 3RGRA 2CK3H 2C4BA 3LTDA 3NM7A 1M1K4 1ULJB 2W9QA 4WWUC 3MG1A 1RNBA 4I4KA 3NQZA 4BTWA 1WMNA 1DYUA 1N8QA 2HMOB 4ORLA 1UI7A 1WQLB 3Q90A 6RNTA 5FGOA 4XDVA 3KIIA 3MWZA 1A2PA 2CG1A 1OHSA 3CNMA 1EA2A 1OF5A 4KFFA 1BRNL 3CD63 3FSDA 3DUKA 1G02A 1I2EA 1YJN3 3CXC2 4HKVB 5GSPA 1ISKA 3DGLA 4N6MA 1Q864 3M8CA 2WOHA 3EQQB 1YVBI 3G0KA 1PY3A 2Z77A 2WOFA 3AMOA 2W04A 2BHMA 3BNEA 1O7PB 4OK0A 2GBWB 4CDLA 2F4YA 2XFTA 1AVKA 2BIRA 1RTUA 1UUGB 1VQO3 4XBYA 3HZPA 3SOYA 5D81A 3DZLA 1W6GA 3E99A 1JV2B 3PS8A 4KFEA 3NBRA 1S723 4HM7B 1K28A 1TP6A 1L5GB 5M19A 1UDII 3LTCA 3EHCA 1BVIA 1ASKA 1W00A 2R41A 1O7HB 1QJGA 1ZX2A 3G713 1RGHA 1GD4A 3RGAA 3WOEB 3OWYA 5EEOA 3KE7A 3MPHA 3FF2A 1HU9A 1OGZA 3D5IA 2GU1A 3NQYA 1LQMB 3RDEA 3LZAA 1WNHA 3CCM3 1YJW3 3FF0A 1BRIA 4PEJA 3X3YA 2ZHXB 5D82A 4L8PA 2JQ5A 3JVCA 3EBYA 1S5AA 2HMJB 1GY5A 1JN5B 4HM1B 4NPBA 3S67A 5AEUB 3OXAA 1RMSA 2BT3A 1VQ93 3CC43 3NBBA 1FUSA 4N6UA 2W03A 7GSPA 4HM0B 1BNEA 3J7Yd 1V74A 2E2TA 2XGLA 1BSEA 1LOXA 2CW9A 1RCKA 1E3VA 1FGRA 1NJI4 2SARA 1UUVB 3B8LA 3CNXA 3I0YA 2Q07A 5CF1A 1LXEA 1YNVX 5FW5A 5IEOA 1X1UA 5IG0A 1IK3A 4LSOA 1DETA 1X1YA 2RBIA 2YFLB 5BVBA 3DGYA 1IVVA 2FXTA 2C11A 1TFKA 3DH2A 2OQEA 2XF3A 3U97A 4HZ9B 3CMA3 1J2BA 2K54A 1IVXA 5IENA 3UJMA 2A15A 3S29A 1O7NB 2KXGA 5KP3A 1BNJA 1IV7A 3SXXA 1RCLA 3FG4A 1N5HA 1QALA 1WMPA 1NO3A 4KFDA 2XH9A 4RNZA 3CCS3 2BMRB 4CJNA 1W2B2 1JB5A 3IJEB 3DXOA 4R1KA 4WYKB 4WHAA 1Q9EA 2XSHB 1DVDA 4EBGA 3U1WA 2MF7A 9RNTA 3HI7A 2CWVA 2BMOB 3FKAA 1QVF2 1RGKA 2RCDA 3LOYA 3RNTA 1V58A 1CH0A 1CQSA 1UCLA 2J8XB 3BU4A 1BSCA 3OWUA 1MWTA 7RNTA 4HM4B 2ZL8A 4N6OB 4KZ1A 4TX4A 4N6V0 1R4YA 3H3HA 4XB5A 5IG3A 4DKIA 1UCKA 4K1VA 1UGIA 5D83A 1VQ43 3LTAA 1I3FA 5G2GA 1GMQA 1UGHI 4IT7A 1E97A 1I2GA 2WO0A 2Z76A 1MOLA 3SX1A 1A2KA 4U13A 1ROAA 2UGIA 5IERA 1VQK3 4HM6B 4HYZA 4O02B 4Q53A 1RGCA 1B2ZA 3EC9A 2IA7A 3OW22 4XBXA 2O3OA 4FMDA 1SPUA 8CHOA 3TDGA 1AQZA 1M904 2GEYA 1RN7A 5LC7A 1GMRA 4BL3A 3CPW2 2H0IA 2OTL3 3BNCA 3DGNA 2GU3A 4RZMA 2CX1A 4N6TA 1N9JA 2P0MA 1GOUA 3ECFA 2QIYA 4LEHA 5BIRA 4R9LA 1VQM3 1VQQA 2KF4A 4CPKA 1B21A 1HKXA 1QVG2 1MNLA 1FGOA 1FGQA 3K0ZA 2XEPA 5CK6A 5AI1A 2CC3A 3IPTA 3I553 2W9PA 2JDIH 5BXQA 2I9WA 4WFOA 3SOAA 1VQ53 3Q3FA 1TRPA 1IV9A 1DE3A 2HMKB 3KSED 1JKGB 5EVHA 2Z7AA 1RHLA 8RNTA 5M18A 1FUWA 3MG3A 2P09A 1VZZA 1B20A 3FCSB 2AADA 1AR0A 1ZGXA 3EE1A 3G4S3 3F9SA 1BNFA 1MGRA 2BNGA 4WP5A 3V98A 1YHQ3 1LVNA 4O2HA 1SIIA 4ILFA 4J9AA 5AYRB 2E2UA 5I97A 3MSOA 4RBNA 1A2VA 2F5MA 1BGSA 3S27A 4BL2A 3B7CA 3LXUX 1B2MA 3UL6A 3EB8A 2BMQB 1BNSA 2LQVA 4XDWA 1N8R4 1IDPA 3AHWA 3Q1CA 3KZTA 3EN1B 4BIRA 1IQXA 1A67A 3S28A 3UB1A 1AY7A 1BRJA 1I0VA 1T2HA 3LT9A 1X1WA 4EV5A 1X1XA 4XM4A 3AGNA 4HJLB 4HM2B 1VQN3 3SEDA 1ZS7A 1CYUA 1B2UA 4AEQA 1D6ZA 3F40A 3K7CA 3N9HA 4FMCA 1Q814 2CFDA 1DMQA 3DMCA 2RGQA 1YGEA 1QAKA 4JF8A 1B27A 2E2VA 3PXMA 5DREA 5LC6A 1EKMA 3X3XA 1TU5A 2ML5A 4JRFA 4EXRA 1HZ1A 2YFJB 3DM8A 1GY6A 1JZDA 4K90B 3X40A 3WOFB 3FG1A 1W5ZA 1JN5A 1OACA 4HVNA 1RN1A 1LOYA 1I70A 1IVUA 3B4OA 3PGBA 5EQLA 1BUJA 3OWSA 1Q40B 3DGMA 3A5EA 3JUQA 1BNRA 1UCIA 3LTBA 4MEIA 2OTJ3 3MYTA 1AVLA 1KWIA 2IYJA 4MMXB 3BNBA 3EJVA 3WDGB 2GXFA 1O7GB 5JPUA 3EF8A 4FCJA 4AKZA 1I2FA 2P38A 1TFOA 3WHOA 2QEX3 3FZWA 2HMLB 1CYVA 1OCVA 1SIHA 2Z6BA 3F14A 4GHOA 2ZDJA 2L1SA 2KAAA 4STDA 4J5KA 1D6UA 1ZO2A 4BU4A 3WMDA 3DY5A 2CWTA 1KQS2 1HYFA 2XR8B 4R4KA 3HIGA 3WA2X 5CF2A 1FW7A 1BU4A 2OWPA 1GS3A 3FH1A 1KC84 1T2IA 2GSPA 1RDSA 1GSPA 2KCDA 4EV2A 1I0XA 1C7HA 1G96A 1YIJ3 5TGNA 1G0TA 2Y73A 4IIAA 1BANA 2AAEA 1JBTA 2STDA 4R9KA 2UUGC 4K1UA 1UI8A 1W6CA 5ELJA 3SLUA 2QGUA 5G1LA 4WYKA 1W01A 3BB9A 4FCZA 1JB2A 1TUHA 4ZM8A 4MMZB 2OCTA 3EBTA 5CLKA 1JZOA 1STDA 5AEWB 4IPBA 2W56B 5BU4A 3ALAA 3KKGA 2K0MA 2WGQA 3PCSA 2HMNB 2M7OA 3LH4A 3LYGA 1OGXA 3CU3A 3VF1A 1DMNA 1SQWA 4FMAA 3VSYA 2OOVC 3NUVA 2BO9B 3F7SA 3FG3A 3WA3A 1MWSA 1NNVA 3A76A 1OHPA 3N54B 1BRKA 1UCJA 3FLJA 4HM8B 3WR2A 1KD14 2HOHA 1BNGA 3D9RA 4J5GA 3CC23 2H0GA 5DRVA 2L4VA 1UW1A 1IQ8A 2IMJA 1E3RA 1EEJA 4BTXA 1LOWA 1IVWA 3FGYA 3Q2PA 1QAFA 5AIGA 3KFQC 2W6JH 2BU4A 1TJDA 3N8BA 5G1KA 1BUQA 4O3VA 3HK4A 3G16A 1OUNA 4HM3B 4LZIA 2XSOB 4EW5A 1K8A4 3K5TA 5KP4A 2PZVA 4AKYA 4N6LA 2IUKA 5IG5A 3ROBA 3GZBA 1T3BA 1W7CA 4NREA 3LMLA 1NB5I 4LYLB 1US1A
chains in the Genus database with same CATH topology
2F86B 4LGQA 1W6YA 3S5CA 4K61A 3V92A 1JRQA 1Q7Y4 1RJOA 4NHFA 5AYSC 2INXA 4XBTA 1JKGA 3NV0B 1DVCA 2B24B 4LMIA 3NBJA 3STDA 1K734 4GB5A 3F8XA 1STFI 1Z1SA 4FMBA 2CHCA 3UNLA 1VQ73 2UX0A 1NU3A 1UUWB 1IQYA 3GZYB 4OUQA 3X3ZA 2W2CA 3QK9A 1D6YA 1IT8A 1EG9B 2WGOA 2W0QA 1RRLA 3LT8A 3BLZA 1ROVA 3NHXA 2B1XB 1U8CB 4QWTA 4MJDA 2MC8A 1Q42A 5JPPA 3G6E3 1OF5B 2P0XA 3GAXA 3HX8A 5IF6A 2CH9A 1WTHA 2CWUA 2CKFB 2F99A 3CME3 3T0UA 2HMMB 4RNYA 2YFIB 1K9M4 2CFLA 4MMYB 1M9GA 2GBXB 2LYXA 3AMOB 3D3LA 1GD3A 3NM2A 3T8NA 3GZXB 1AV4A 5ELUA 1VQ83 3CPOA 2GEXA 3O8YA 4FR9A 3MHEA 1VQ63 3GZRA 5A0OB 1NWWA 4H61A 1K41A 3ER7A 3SVAA 3GRDA 5STDA 4R80A 3QRDA 1YIT3 3JUNA 1PFPA 1Q40A 2CIUA 3L0RA 1A90A 2QA43 4EYCA 2P05A 2RFRA 3NX0A 3PZWA 3CCJ3 1RRHA 3KN4A 4BTYA 1WMOA 2O9UX 5KP1A 1JB4A 4L8OA 5HGRA 1PU4A 4HBRA 2ML6A 4X2HA 4N3VA 4X2OA 1JJ22 4FCMA 2IUJA 1EQKA 1N5PA 5JBSA 1RKYA 4G1MB 4H3UA 1YJ93 4J8TA 3PCRA 1M1XB 3F8HA 4O8SA 3B4PA 3IMAB 1QMAA 1IT7A 1NDOB 3JUPA 3V99A 5CXOA 2XRXB 3GWRA 4HM5B 3CCV3 1FGTA 1DMMA 4L7KA 2OOVA 2F98A 1R4CA 1GY7A 1IU7A 2R4IA 2W56A 3HIIA 3I563 1Q824 3MKIA 1OPYA 1W02A 2OQEC 3F7XA 3CCL3 1ULIB 1FA3A 5IEPA 1NB3I 3EN8A 3K9MC 2D42A 3KSPA 4CCVA 1LNHA 3CCQ3 3DGOA 3X41A 1KSIA 6STDA 4GL6A 1VQL3 4N6NB 1N9EA 3CCE3 2RSXA 2CFKA 3NXJA 2CFGA 2YX9A 4KVHA 2XGNA 2SBLA 3CC73 1FGMA 1O7MB 1T5YA 1OH0A 2CG0A 2KRTA 5AIHA 1JNQA 2V1LA 2XFSA 3CMA3 3BNDA 1U5OA 3G8ZA 1GYBA 1TIJA 3X42A 7STDA 3WODG 2FNQA 3VGNA 5IG4A 1OHOA 5AIFA 3OV4A 2FGTA 1CEWI 4HZBB 1VQP3 3PYJA 3OX9A 3CCR3 2PNCA 3H51A 3CCU3 1W4NA 3EX9A 4EC6A 3UL5A 2Y74A 4OVMA 1W2ZA 3K63A 2D1WA 3T8UA 3NV0A 3JUOA 1O7WB 1SJWA 1Y4KA 3MG2A 1F8NA 2C10A 5IW9A 2CFWA 3JUMA 5AIIA 1YI23 3RGRA 2CK3H 3LTDA 3NM7A 1M1K4 1ULJB 2W9QA 4WWUC 3MG1A 4I4KA 3NQZA 4BTWA 1WMNA 1DYUA 1N8QA 2HMOB 4ORLA 1UI7A 1WQLB 3Q90A 5FGOA 4XDVA 3KIIA 3MWZA 2CG1A 1OHSA 3CNMA 1EA2A 1OF5A 4KFFA 3CD63 3FSDA 3DUKA 1YJN3 3CXC2 4HKVB 1ISKA 3DGLA 4N6MA 1Q864 3M8CA 2WOHA 3EQQB 1YVBI 3G0KA 2Z77A 2WOFA 3AMOA 2W04A 2BHMA 3BNEA 1O7PB 4OK0A 2GBWB 4CDLA 2XFTA 1AVKA 1VQO3 4XBYA 3HZPA 3SOYA 5D81A 3DZLA 1W6GA 3E99A 1JV2B 3PS8A 4KFEA 3NBRA 1S723 4HM7B 1K28A 1TP6A 1L5GB 3LTCA 3EHCA 1ASKA 1W00A 1O7HB 1QJGA 1ZX2A 3G713 1GD4A 3RGAA 3WOEB 3OWYA 5EEOA 3KE7A 3MPHA 3FF2A 1HU9A 1OGZA 2GU1A 3NQYA 3RDEA 3LZAA 1WNHA 3CCM3 1YJW3 3FF0A 4PEJA 3X3YA 5D82A 4L8PA 2JQ5A 3JVCA 3EBYA 1S5AA 2HMJB 1GY5A 1JN5B 4HM1B 3S67A 1VQ93 5AEUB 3OXAA 3CC43 2BT3A 3NBBA 4N6UA 2W03A 4HM0B 3J7Yd 1V74A 2E2TA 2XGLA 1LOXA 2CW9A 1E3VA 1FGRA 1NJI4 1UUVB 3B8LA 3CNXA 3I0YA 2Q07A 5CF1A 1LXEA 5FW5A 5IEOA 5IG0A 1IK3A 4LSOA 2YFLB 5BVBA 1IVVA 2FXTA 2C11A 1TFKA 2OQEA 2XF3A 3U97A 4HZ9B 1J2BA 2K54A 1IVXA 5IENA 3UJMA 2A15A 3S29A 1O7NB 2KXGA 5KP3A 3SXXA 1IV7A 3FG4A 1N5HA 1QALA 1WMPA 1NO3A 4KFDA 2XH9A 4RNZA 3CCS3 2BMRB 1W2B2 1JB5A 3IJEB 3DXOA 4R1KA 4WYKB 4WHAA 2XSHB 1DVDA 4EBGA 3U1WA 2MF7A 3HI7A 2CWVA 2BMOB 3FKAA 1QVF2 2RCDA 3LOYA 1CQSA 3OWUA 4HM4B 2ZL8A 4N6OB 4KZ1A 4TX4A 4N6V0 3H3HA 4XB5A 5IG3A 4K1VA 5D83A 1VQ43 3LTAA 5G2GA 4IT7A 1E97A 2WO0A 2Z76A 3SX1A 1MOLA 1A2KA 4U13A 1ROAA 5IERA 1VQK3 4HM6B 4HYZA 4O02B 4Q53A 3EC9A 2IA7A 3OW22 4XBXA 2O3OA 4FMDA 1SPUA 8CHOA 3TDGA 1M904 2GEYA 1RN7A 5LC7A 3CPW2 2OTL3 3BNCA 3DGNA 2GU3A 4RZMA 4N6TA 1N9JA 2P0MA 3ECFA 4LEHA 2QIYA 4R9LA 1VQM3 1HKXA 1QVG2 1MNLA 1FGOA 1FGQA 3K0ZA 2XEPA 5CK6A 5AI1A 2CC3A 3IPTA 3I553 2W9PA 2JDIH 5BXQA 2I9WA 4WFOA 3SOAA 1VQ53 1IV9A 2HMKB 3KSED 1JKGB 5EVHA 2Z7AA 1FUWA 3MG3A 2P09A 1VZZA 3FCSB 1AR0A 3EE1A 3G4S3 3F9SA 2BNGA 3V98A 4WP5A 1YHQ3 1LVNA 4O2HA 1SIIA 5AYRB 4J9AA 2E2UA 5I97A 3MSOA 4RBNA 1A2VA 3S27A 3B7CA 3LXUX 3UL6A 3EB8A 2BMQB 4XDWA 2LQVA 1N8R4 1IDPA 3Q1CA 3KZTA 3EN1B 1A67A 1IQXA 3S28A 3UB1A 3LT9A 4EV5A 4XM4A 4HJLB 1VQN3 4HM2B 3SEDA 1CYUA 4AEQA 1D6ZA 3F40A 3K7CA 3N9HA 4FMCA 1Q814 2CFDA 1DMQA 3DMCA 2RGQA 1YGEA 1QAKA 4JF8A 2E2VA 3PXMA 5DREA 5LC6A 1EKMA 3X3XA 1TU5A 2ML5A 4JRFA 4EXRA 2YFJB 3DM8A 1GY6A 4K90B 3X40A 3WOFB 3FG1A 1W5ZA 1JN5A 1OACA 4HVNA 3B4OA 1IVUA 3PGBA 5EQLA 3OWSA 1Q40B 3DGMA 3JUQA 3LTBA 4MEIA 2OTJ3 3MYTA 1AVLA 1KWIA 4MMXB 3BNBA 3EJVA 3WDGB 2GXFA 1O7GB 5JPUA 3EF8A 4FCJA 4AKZA 2P38A 1TFOA 2QEX3 3FZWA 2HMLB 1CYVA 1OCVA 1SIHA 2Z6BA 3F14A 2ZDJA 4STDA 1D6UA 1ZO2A 3WMDA 3DY5A 2CWTA 1KQS2 2XR8B 4R4KA 3HIGA 3WA2X 5CF2A 2OWPA 1GS3A 3FH1A 1KC84 2KCDA 4EV2A 1C7HA 1G96A 1YIJ3 5TGNA 4IIAA 2Y73A 2STDA 4R9KA 4K1UA 5ELJA 1UI8A 1W6CA 3SLUA 2QGUA 4WYKA 1W01A 3BB9A 4FCZA 1JB2A 1TUHA 4ZM8A 4MMZB 2OCTA 3EBTA 5CLKA 1STDA 5AEWB 4IPBA 2W56B 3ALAA 3KKGA 2K0MA 2WGQA 3PCSA 2HMNB 2M7OA 3LH4A 3LYGA 1OGXA 3CU3A 3VF1A 1DMNA 1SQWA 4FMAA 3VSYA 2OOVC 3NUVA 2BO9B 3F7SA 3FG3A 3WA3A 3A76A 3N54B 1OHPA 3FLJA 4HM8B 1KD14 3D9RA 3CC23 5DRVA 2L4VA 1UW1A 1IQ8A 2IMJA 1E3RA 4BTXA 1IVWA 3FGYA 3Q2PA 1QAFA 5AIGA 3KFQC 2W6JH 3N8BA 1BUQA 4O3VA 3HK4A 3G16A 1OUNA 4HM3B 4LZIA 2XSOB 1K8A4 3K5TA 5KP4A 2PZVA 4AKYA 4N6LA 2IUKA 5IG5A 3ROBA 3GZBA 1W7CA 4NREA 3LMLA 1NB5I 1US1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F86 B;  4LGQ A;  1W6Y A;  3S5C A;  2INX A;  4XBT A;  1JKG A;  3NV0 B;  2B24 B;  4LMI A;  3STD A;  4GB5 A;  3F8X A;  1Z1S A;  2CHC A;  3UNL A;  2UX0 A;  1NU3 A;  1UUW B;  3GZY B;  4OUQ A;  2W2C A;  1EG9 B;  3BLZ A;  3NHX A;  2B1X B;  4MJD A;  1Q42 A;  5JPP A;  1OF5 B;  3HX8 A;  5IF6 A;  2CKF B;  2F99 A;  2HMM B;  2YFI B;  2GBX B;  3NM2 A;  3T8N A;  3GZX B;  3CPO A;  2GEX A;  3MHE A;  3GZR A;  1NWW A;  1K41 A;  3ER7 A;  3GRD A;  5STD A;  3JUN A;  1Q40 A;  2RFR A;  5KP1 A;  1JB4 A;  4L8O A;  5HGR A;  4X2H A;  4N3V A;  4X2O A;  4FCM A;  4H3U A;  4J8T A;  3F8H A;  3B4P A;  1QMA A;  1NDO B;  3JUP A;  5CXO A;  2XRX B;  3GWR A;  4HM5 B;  1DMM A;  4L7K A;  2F98 A;  1GY7 A;  2R4I A;  3MKI A;  1OPY A;  1W02 A;  3F7X A;  1ULI B;  5IEP A;  3EN8 A;  3KSP A;  6STD A;  3NXJ A;  4KVH A;  1O7M B;  5AIH A;  1OH0 A;  1U5O A;  3G8Z A;  1GYB A;  7STD A;  3VGN A;  5IG4 A;  1OHO A;  5AIF A;  3OV4 A;  4HZB B;  3OX9 A;  3H51 A;  3EX9 A;  4OVM A;  3T8U A;  3NV0 A;  3JUO A;  1O7W B;  1SJW A;  3MG2 A;  3JUM A;  5AII A;  3RGR A;  1ULJ B;  4WWU C;  3MG1 A;  4I4K A;  2HMO B;  4ORL A;  1WQL B;  3Q90 A;  4XDV A;  1OHS A;  3CNM A;  1EA2 A;  1OF5 A;  3FSD A;  3DUK A;  4HKV B;  1ISK A;  3M8C A;  3EQQ B;  3G0K A;  2Z77 A;  4CDL A;  1O7P B;  2GBW B;  4XBY A;  3HZP A;  3SOY A;  5D81 A;  3DZL A;  3E99 A;  3NBR A;  4HM7 B;  1TP6 A;  3EHC A;  1ASK A;  1W00 A;  1O7H B;  1QJG A;  1ZX2 A;  3RGA A;  3OWY A;  3KE7 A;  3FF2 A;  1OGZ A;  3LZA A;  3FF0 A;  4PEJ A;  5D82 A;  4L8P A;  2JQ5 A;  3EBY A;  1S5A A;  2HMJ B;  1GY5 A;  1JN5 B;  4HM1 B;  5AEU B;  3OXA A;  4HM0 B;  1E3V A;  1UUV B;  3B8L A;  3CNX A;  3I0Y A;  5CF1 A;  5FW5 A;  5IEO A;  5IG0 A;  2YFL B;  5BVB A;  4HZ9 B;  2K54 A;  5IEN A;  3UJM A;  2A15 A;  1O7N B;  5KP3 A;  2BMR B;  1JB5 A;  3DXO A;  4R1K A;  4WYK B;  2XSH B;  2BMO B;  3FKA A;  2RCD A;  1CQS A;  3OWU A;  4HM4 B;  3H3H A;  4XB5 A;  5IG3 A;  4K1V A;  5D83 A;  5G2G A;  1E97 A;  2Z76 A;  1A2K A;  4U13 A;  5IER A;  4HM6 B;  4Q53 A;  3EC9 A;  4XBX A;  8CHO A;  2GEY A;  4RZM A;  3ECF A;  4LEH A;  2QIY A;  4R9L A;  1HKX A;  3K0Z A;  5CK6 A;  5AI1 A;  3IPT A;  5BXQ A;  2I9W A;  3SOA A;  2HMK B;  1JKG B;  5EVH A;  2Z7A A;  3MG3 A;  1VZZ A;  1AR0 A;  3F9S A;  2BNG A;  4WP5 A;  4J9A A;  3MSO A;  3B7C A;  2BMQ B;  4XDW A;  1IDP A;  3KZT A;  3EN1 B;  4XM4 A;  4HJL B;  4HM2 B;  3SED A;  3K7C A;  3F40 A;  1DMQ A;  3DMC A;  2RGQ A;  5DRE A;  2YFJ B;  3DM8 A;  1GY6 A;  1JN5 A;  4HVN A;  3B4O A;  3OWS A;  1Q40 B;  3JUQ A;  3MYT A;  3EJV A;  2GXF A;  1O7G B;  5JPU A;  3EF8 A;  4FCJ A;  3FZW A;  2HML B;  1OCV A;  3F14 A;  4STD A;  1ZO2 A;  3WMD A;  2XR8 B;  5CF2 A;  2OWP A;  1GS3 A;  3FH1 A;  1C7H A;  5TGN A;  4IIA A;  2STD A;  4R9K A;  4K1U A;  2QGU A;  4WYK A;  1W01 A;  3BB9 A;  1JB2 A;  1TUH A;  3EBT A;  5CLK A;  1STD A;  5AEW B;  3KKG A;  2HMN B;  3LYG A;  1OGX A;  3CU3 A;  1DMN A;  3VSY A;  3NUV A;  3F7S A;  3A76 A;  1OHP A;  3FLJ A;  4HM8 B;  3D9R A;  5DRV A;  2IMJ A;  1E3R A;  3FGY A;  5AIG A;  1BUQ A;  3HK4 A;  3G16 A;  1OUN A;  4HM3 B;  2XSO B;  5KP4 A;  2PZV A;  5IG5 A;  3ROB A;  3GZB A; 
#chains in the Genus database with same CATH topology
 2F86 B;  4LGQ A;  1W6Y A;  3S5C A;  4K61 A;  3V92 A;  1FUT A;  1JRQ A;  1Q7Y 4;  3D79 A;  1RJO A;  3HOH A;  4NHF A;  5AYS C;  1BRH A;  2INX A;  4XBT A;  1JKG A;  3NV0 B;  3ZG0 A;  1DVC A;  2B24 B;  4LMI A;  1RSN A;  3NBJ A;  3STD A;  1K73 4;  4GB5 A;  3F8X A;  1STF I;  1Z1S A;  6GSP A;  1TRQ A;  4FMB A;  2CHC A;  3UNL A;  1VQ7 3;  2UX0 A;  5HOH A;  1NU3 A;  1BAO A;  1UUW B;  1IQY A;  3GZY B;  4OUQ A;  3X3Z A;  2W2C A;  3QK9 A;  1D6Y A;  1IT8 A;  1EG9 B;  1FZU A;  1RLS A;  2WGO A;  2W0Q A;  1C54 A;  1RRL A;  3LT8 A;  3BLZ A;  1ROV A;  3NHX A;  1RGA A;  2B1X B;  3ZFZ A;  1U8C B;  1MWU A;  4QWT A;  1MWR A;  3AGO A;  4MJD A;  2MC8 A;  1Q42 A;  5JPP A;  3ZG5 A;  3G6E 3;  1OF5 B;  2P0X A;  3GAX A;  3HX8 A;  5IF6 A;  2CH9 A;  1WTH A;  2CWU A;  2CKF B;  2F99 A;  3CME 3;  1GMP A;  3T0U A;  1LOV A;  2HMM B;  4RNY A;  2YFI B;  1K9M 4;  2CFL A;  4MMY B;  1M9G A;  1BOX A;  2GBX B;  2LYX A;  3AMO B;  3D3L A;  1GD3 A;  3NM2 A;  3T8N A;  3GZX B;  1AV4 A;  5ELU A;  1VQ8 3;  1BNI A;  3CPO A;  3D4A A;  1GOY A;  1FYS A;  2GEX A;  3MHE A;  3O8Y A;  4FR9 A;  5M1A A;  1VQ6 3;  3GZR A;  1YVS A;  4GSP A;  5A0O B;  1NWW A;  4H61 A;  1K41 A;  3ER7 A;  1JBS A;  3SVA A;  1BIR A;  3GRD A;  5STD A;  4R80 A;  3QRD A;  1YIT 3;  3JUN A;  1PFP A;  1Q40 A;  2CIU A;  3L0R A;  1A90 A;  2QA4 3;  4EYC A;  2P05 A;  2RFR A;  3NX0 A;  1B3S A;  3PZW A;  3CCJ 3;  1JBR A;  1BSD A;  1RRH A;  3KN4 A;  4KT3 B;  4BTY A;  1WMO A;  4HAA A;  1BRG A;  2O9U X;  5KP1 A;  1B2S A;  1JB4 A;  2K3D A;  4L8O A;  5HGR A;  1PU4 A;  4HBR A;  2ML6 A;  4X2H A;  2H0H A;  4N3V A;  4X2O A;  1JJ2 2;  4FCM A;  2IUJ A;  1EQK A;  1N5P A;  5JBS A;  1RKY A;  3URP A;  4G1M B;  4H3U A;  1YJ9 3;  4J8T A;  3PCR A;  1GOV A;  1IYY A;  1M1X B;  3F8H A;  4O8S A;  3B4P A;  3IMA B;  1QMA A;  2F56 A;  1IT7 A;  3BIR A;  2F5W A;  1NDO B;  3JUP A;  3V99 A;  5CXO A;  2XRX B;  3GWR A;  1RGL A;  4HM5 B;  3CCV 3;  1FGT A;  1DMM A;  2KF3 A;  4L7K A;  2OOV A;  2F98 A;  1R4C A;  1GY7 A;  1IU7 A;  2KF6 A;  2R4I A;  2W56 A;  3HII A;  3I56 3;  1Q82 4;  3MKI A;  4HOH A;  1B2X A;  1LNI A;  1OPY A;  1W02 A;  2OQE C;  3F7X A;  5RNT A;  1ULI B;  3CCL 3;  1FA3 A;  1RGF A;  5IEP A;  1NB3 I;  3EN8 A;  3K9M C;  1EUI C;  2D42 A;  1SAR A;  3KSP A;  4CCV A;  1LNH A;  3CCQ 3;  3DGO A;  2KF5 A;  3X41 A;  1KSI A;  2RNT A;  1BSA A;  6STD A;  4GL6 A;  1VQL 3;  4N6N B;  1N9E A;  3CCE 3;  1Q7H A;  2RSX A;  2CFK A;  1PYL A;  3NXJ A;  2CFG A;  2IY2 A;  2YX9 A;  2CX0 A;  2XGN A;  2SBL A;  4KVH A;  3CC7 3;  1FGM A;  1O7M B;  1T5Y A;  1OH0 A;  2CG0 A;  2KRT A;  5AIH A;  1JNQ A;  1LRA A;  1TTO A;  2V1L A;  2XFS A;  1U5O A;  3BND A;  1GYB A;  1TIJ A;  1YGW A;  3G8Z A;  3KCH A;  3X42 A;  3WOD G;  7STD A;  2FNQ A;  3VGN A;  5IG4 A;  1OHO A;  5AIF A;  3OV4 A;  1BSB A;  1LQG C;  2FGT A;  1CEW I;  4HZB B;  1BRS A;  1VQP 3;  3PYJ A;  3OX9 A;  1MGW A;  3CCR 3;  2PNC A;  3H51 A;  4I5Q A;  3CCU 3;  1W4N A;  2ZA4 A;  3EX9 A;  4EC6 A;  3GSP A;  3UL5 A;  2Y74 A;  4OVM A;  1W2Z A;  1RGG A;  3AHS A;  3K63 A;  2D1W A;  4RNT A;  3T8U A;  3NV0 A;  3JUO A;  1O7W B;  1RNT A;  1SJW A;  1I8V A;  1Y4K A;  3MG2 A;  1F8N A;  1RN4 A;  2C10 A;  1V57 A;  5IW9 A;  2CFW A;  1RGE A;  3SYU A;  3D5G A;  3JUM A;  5AII A;  1YI2 3;  1I3I A;  3RGR A;  2CK3 H;  2C4B A;  3LTD A;  3NM7 A;  1M1K 4;  1ULJ B;  2W9Q A;  4WWU C;  3MG1 A;  1RNB A;  4I4K A;  3NQZ A;  4BTW A;  1WMN A;  1DYU A;  1N8Q A;  2HMO B;  4ORL A;  1UI7 A;  1WQL B;  3Q90 A;  6RNT A;  5FGO A;  4XDV A;  3KII A;  3MWZ A;  1A2P A;  2CG1 A;  1OHS A;  3CNM A;  1EA2 A;  1OF5 A;  4KFF A;  1BRN L;  3CD6 3;  3FSD A;  3DUK A;  1G02 A;  1I2E A;  1YJN 3;  3CXC 2;  4HKV B;  5GSP A;  1ISK A;  3DGL A;  4N6M A;  1Q86 4;  3M8C A;  2WOH A;  3EQQ B;  1YVB I;  3G0K A;  1PY3 A;  2Z77 A;  2WOF A;  3AMO A;  2W04 A;  2BHM A;  3BNE A;  1O7P B;  4OK0 A;  2GBW B;  4CDL A;  2F4Y A;  2XFT A;  1AVK A;  2BIR A;  1RTU A;  1UUG B;  1VQO 3;  4XBY A;  3HZP A;  3SOY A;  5D81 A;  3DZL A;  1W6G A;  3E99 A;  1JV2 B;  3PS8 A;  4KFE A;  3NBR A;  1S72 3;  4HM7 B;  1K28 A;  1TP6 A;  1L5G B;  5M19 A;  1UDI I;  3LTC A;  3EHC A;  1BVI A;  1ASK A;  1W00 A;  2R41 A;  1O7H B;  1QJG A;  1ZX2 A;  3G71 3;  1RGH A;  1GD4 A;  3RGA A;  3WOE B;  3OWY A;  5EEO A;  3KE7 A;  3MPH A;  3FF2 A;  1HU9 A;  1OGZ A;  3D5I A;  2GU1 A;  3NQY A;  1LQM B;  3RDE A;  3LZA A;  1WNH A;  3CCM 3;  1YJW 3;  3FF0 A;  1BRI A;  4PEJ A;  3X3Y A;  2ZHX B;  5D82 A;  4L8P A;  2JQ5 A;  3JVC A;  3EBY A;  1S5A A;  2HMJ B;  1GY5 A;  1JN5 B;  4HM1 B;  4NPB A;  3S67 A;  5AEU B;  3OXA A;  1RMS A;  2BT3 A;  1VQ9 3;  3CC4 3;  3NBB A;  1FUS A;  4N6U A;  2W03 A;  7GSP A;  4HM0 B;  1BNE A;  3J7Y d;  1V74 A;  2E2T A;  2XGL A;  1BSE A;  1LOX A;  2CW9 A;  1RCK A;  1E3V A;  1FGR A;  1NJI 4;  2SAR A;  1UUV B;  3B8L A;  3CNX A;  3I0Y A;  2Q07 A;  5CF1 A;  1LXE A;  1YNV X;  5FW5 A;  5IEO A;  1X1U A;  5IG0 A;  1IK3 A;  4LSO A;  1DET A;  1X1Y A;  2RBI A;  2YFL B;  5BVB A;  3DGY A;  1IVV A;  2FXT A;  2C11 A;  1TFK A;  3DH2 A;  2OQE A;  2XF3 A;  3U97 A;  4HZ9 B;  3CMA 3;  1J2B A;  2K54 A;  1IVX A;  5IEN A;  3UJM A;  2A15 A;  3S29 A;  1O7N B;  2KXG A;  5KP3 A;  1BNJ A;  1IV7 A;  3SXX A;  1RCL A;  3FG4 A;  1N5H A;  1QAL A;  1WMP A;  1NO3 A;  4KFD A;  2XH9 A;  4RNZ A;  3CCS 3;  2BMR B;  4CJN A;  1W2B 2;  1JB5 A;  3IJE B;  3DXO A;  4R1K A;  4WYK B;  4WHA A;  1Q9E A;  2XSH B;  1DVD A;  4EBG A;  3U1W A;  2MF7 A;  9RNT A;  3HI7 A;  2CWV A;  2BMO B;  3FKA A;  1QVF 2;  1RGK A;  2RCD A;  3LOY A;  3RNT A;  1V58 A;  1CH0 A;  1CQS A;  1UCL A;  2J8X B;  3BU4 A;  1BSC A;  3OWU A;  1MWT A;  7RNT A;  4HM4 B;  2ZL8 A;  4N6O B;  4KZ1 A;  4TX4 A;  4N6V 0;  1R4Y A;  3H3H A;  4XB5 A;  5IG3 A;  4DKI A;  1UCK A;  4K1V A;  1UGI A;  5D83 A;  1VQ4 3;  3LTA A;  1I3F A;  5G2G A;  1GMQ A;  1UGH I;  4IT7 A;  1E97 A;  1I2G A;  2WO0 A;  2Z76 A;  1MOL A;  3SX1 A;  1A2K A;  4U13 A;  1ROA A;  2UGI A;  5IER A;  1VQK 3;  4HM6 B;  4HYZ A;  4O02 B;  4Q53 A;  1RGC A;  1B2Z A;  3EC9 A;  2IA7 A;  3OW2 2;  4XBX A;  2O3O A;  4FMD A;  1SPU A;  8CHO A;  3TDG A;  1AQZ A;  1M90 4;  2GEY A;  1RN7 A;  5LC7 A;  1GMR A;  4BL3 A;  3CPW 2;  2H0I A;  2OTL 3;  3BNC A;  3DGN A;  2GU3 A;  4RZM A;  2CX1 A;  4N6T A;  1N9J A;  2P0M A;  1GOU A;  3ECF A;  2QIY A;  4LEH A;  5BIR A;  4R9L A;  1VQM 3;  1VQQ A;  2KF4 A;  4CPK A;  1B21 A;  1HKX A;  1QVG 2;  1MNL A;  1FGO A;  1FGQ A;  3K0Z A;  2XEP A;  5CK6 A;  5AI1 A;  2CC3 A;  3IPT A;  3I55 3;  2W9P A;  2JDI H;  5BXQ A;  2I9W A;  4WFO A;  3SOA A;  1VQ5 3;  3Q3F A;  1TRP A;  1IV9 A;  1DE3 A;  2HMK B;  3KSE D;  1JKG B;  5EVH A;  2Z7A A;  1RHL A;  8RNT A;  5M18 A;  1FUW A;  3MG3 A;  2P09 A;  1VZZ A;  1B20 A;  3FCS B;  2AAD A;  1AR0 A;  1ZGX A;  3EE1 A;  3G4S 3;  3F9S A;  1BNF A;  1MGR A;  2BNG A;  4WP5 A;  3V98 A;  1YHQ 3;  1LVN A;  4O2H A;  1SII A;  4ILF A;  4J9A A;  5AYR B;  2E2U A;  5I97 A;  3MSO A;  4RBN A;  1A2V A;  2F5M A;  1BGS A;  3S27 A;  4BL2 A;  3B7C A;  3LXU X;  1B2M A;  3UL6 A;  3EB8 A;  2BMQ B;  1BNS A;  2LQV A;  4XDW A;  1N8R 4;  1IDP A;  3AHW A;  3Q1C A;  3KZT A;  3EN1 B;  4BIR A;  1IQX A;  1A67 A;  3S28 A;  3UB1 A;  1AY7 A;  1BRJ A;  1I0V A;  1T2H A;  3LT9 A;  1X1W A;  4EV5 A;  1X1X A;  4XM4 A;  3AGN A;  4HJL B;  4HM2 B;  1VQN 3;  3SED A;  1ZS7 A;  1CYU A;  1B2U A;  4AEQ A;  1D6Z A;  3F40 A;  3K7C A;  3N9H A;  4FMC A;  1Q81 4;  2CFD A;  1DMQ A;  3DMC A;  2RGQ A;  1YGE A;  1QAK A;  4JF8 A;  1B27 A;  2E2V A;  3PXM A;  5DRE A;  5LC6 A;  1EKM A;  3X3X A;  1TU5 A;  2ML5 A;  4JRF A;  4EXR A;  1HZ1 A;  2YFJ B;  3DM8 A;  1GY6 A;  1JZD A;  4K90 B;  3X40 A;  3WOF B;  3FG1 A;  1W5Z A;  1JN5 A;  1OAC A;  4HVN A;  1RN1 A;  1LOY A;  1I70 A;  1IVU A;  3B4O A;  3PGB A;  5EQL A;  1BUJ A;  3OWS A;  1Q40 B;  3DGM A;  3A5E A;  3JUQ A;  1BNR A;  1UCI A;  3LTB A;  4MEI A;  2OTJ 3;  3MYT A;  1AVL A;  1KWI A;  2IYJ A;  4MMX B;  3BNB A;  3EJV A;  3WDG B;  2GXF A;  1O7G B;  5JPU A;  3EF8 A;  4FCJ A;  4AKZ A;  1I2F A;  2P38 A;  1TFO A;  3WHO A;  2QEX 3;  3FZW A;  2HML B;  1CYV A;  1OCV A;  1SIH A;  2Z6B A;  3F14 A;  4GHO A;  2ZDJ A;  2L1S A;  2KAA A;  4STD A;  4J5K A;  1D6U A;  1ZO2 A;  4BU4 A;  3WMD A;  3DY5 A;  2CWT A;  1KQS 2;  1HYF A;  2XR8 B;  4R4K A;  3HIG A;  3WA2 X;  5CF2 A;  1FW7 A;  1BU4 A;  2OWP A;  1GS3 A;  3FH1 A;  1KC8 4;  1T2I A;  2GSP A;  1RDS A;  1GSP A;  2KCD A;  4EV2 A;  1I0X A;  1C7H A;  1G96 A;  1YIJ 3;  5TGN A;  1G0T A;  2Y73 A;  4IIA A;  1BAN A;  2AAE A;  1JBT A;  2STD A;  4R9K A;  2UUG C;  4K1U A;  1UI8 A;  1W6C A;  5ELJ A;  3SLU A;  2QGU A;  5G1L A;  4WYK A;  1W01 A;  3BB9 A;  4FCZ A;  1JB2 A;  1TUH A;  4ZM8 A;  4MMZ B;  2OCT A;  3EBT A;  5CLK A;  1JZO A;  1STD A;  5AEW B;  4IPB A;  2W56 B;  5BU4 A;  3ALA A;  3KKG A;  2K0M A;  2WGQ A;  3PCS A;  2HMN B;  2M7O A;  3LH4 A;  3LYG A;  1OGX A;  3CU3 A;  3VF1 A;  1DMN A;  1SQW A;  4FMA A;  3VSY A;  2OOV C;  3NUV A;  2BO9 B;  3F7S A;  3FG3 A;  3WA3 A;  1MWS A;  1NNV A;  3A76 A;  1OHP A;  3N54 B;  1BRK A;  1UCJ A;  3FLJ A;  4HM8 B;  3WR2 A;  1KD1 4;  2HOH A;  1BNG A;  3D9R A;  4J5G A;  3CC2 3;  2H0G A;  5DRV A;  2L4V A;  1UW1 A;  1IQ8 A;  2IMJ A;  1E3R A;  1EEJ A;  4BTX A;  1LOW A;  1IVW A;  3FGY A;  3Q2P A;  1QAF A;  5AIG A;  3KFQ C;  2W6J H;  2BU4 A;  1TJD A;  3N8B A;  5G1K A;  1BUQ A;  4O3V A;  3HK4 A;  3G16 A;  1OUN A;  4HM3 B;  4LZI A;  2XSO B;  4EW5 A;  1K8A 4;  3K5T A;  5KP4 A;  2PZV A;  4AKY A;  4N6L A;  2IUK A;  5IG5 A;  3ROB A;  3GZB A;  1T3B A;  1W7C A;  4NRE A;  3LML A;  1NB5 I;  4LYL B;  1US1 A; 
#chains in the Genus database with same CATH homology
 2F86 B;  4LGQ A;  1W6Y A;  3S5C A;  4K61 A;  3V92 A;  1JRQ A;  1Q7Y 4;  1RJO A;  4NHF A;  5AYS C;  2INX A;  4XBT A;  1JKG A;  3NV0 B;  1DVC A;  2B24 B;  4LMI A;  3NBJ A;  3STD A;  1K73 4;  4GB5 A;  3F8X A;  1STF I;  1Z1S A;  4FMB A;  2CHC A;  3UNL A;  1VQ7 3;  2UX0 A;  1NU3 A;  1UUW B;  1IQY A;  3GZY B;  4OUQ A;  3X3Z A;  2W2C A;  3QK9 A;  1D6Y A;  1IT8 A;  1EG9 B;  2WGO A;  2W0Q A;  1RRL A;  3LT8 A;  3BLZ A;  1ROV A;  3NHX A;  2B1X B;  1U8C B;  4QWT A;  4MJD A;  2MC8 A;  1Q42 A;  5JPP A;  3G6E 3;  1OF5 B;  2P0X A;  3GAX A;  3HX8 A;  5IF6 A;  2CH9 A;  1WTH A;  2CWU A;  2CKF B;  2F99 A;  3CME 3;  3T0U A;  2HMM B;  4RNY A;  2YFI B;  1K9M 4;  2CFL A;  4MMY B;  1M9G A;  2GBX B;  2LYX A;  3AMO B;  3D3L A;  1GD3 A;  3NM2 A;  3T8N A;  3GZX B;  1AV4 A;  5ELU A;  1VQ8 3;  3CPO A;  2GEX A;  3O8Y A;  4FR9 A;  3MHE A;  1VQ6 3;  3GZR A;  5A0O B;  1NWW A;  4H61 A;  1K41 A;  3ER7 A;  3SVA A;  3GRD A;  5STD A;  4R80 A;  3QRD A;  1YIT 3;  3JUN A;  1PFP A;  1Q40 A;  2CIU A;  3L0R A;  1A90 A;  2QA4 3;  4EYC A;  2P05 A;  2RFR A;  3NX0 A;  3PZW A;  3CCJ 3;  1RRH A;  3KN4 A;  4BTY A;  1WMO A;  2O9U X;  5KP1 A;  1JB4 A;  4L8O A;  5HGR A;  1PU4 A;  4HBR A;  2ML6 A;  4X2H A;  4N3V A;  4X2O A;  1JJ2 2;  4FCM A;  2IUJ A;  1EQK A;  1N5P A;  5JBS A;  1RKY A;  4G1M B;  4H3U A;  1YJ9 3;  4J8T A;  3PCR A;  1M1X B;  3F8H A;  4O8S A;  3B4P A;  3IMA B;  1QMA A;  1IT7 A;  1NDO B;  3JUP A;  3V99 A;  5CXO A;  2XRX B;  3GWR A;  4HM5 B;  3CCV 3;  1FGT A;  1DMM A;  4L7K A;  2OOV A;  2F98 A;  1R4C A;  1GY7 A;  1IU7 A;  2R4I A;  2W56 A;  3HII A;  3I56 3;  1Q82 4;  3MKI A;  1OPY A;  1W02 A;  2OQE C;  3F7X A;  3CCL 3;  1ULI B;  1FA3 A;  5IEP A;  1NB3 I;  3EN8 A;  3K9M C;  2D42 A;  3KSP A;  4CCV A;  1LNH A;  3CCQ 3;  3DGO A;  3X41 A;  1KSI A;  6STD A;  4GL6 A;  1VQL 3;  4N6N B;  1N9E A;  3CCE 3;  2RSX A;  2CFK A;  3NXJ A;  2CFG A;  2YX9 A;  4KVH A;  2XGN A;  2SBL A;  3CC7 3;  1FGM A;  1O7M B;  1T5Y A;  1OH0 A;  2CG0 A;  2KRT A;  5AIH A;  1JNQ A;  2V1L A;  2XFS A;  3CMA 3;  3BND A;  1U5O A;  3G8Z A;  1GYB A;  1TIJ A;  3X42 A;  7STD A;  3WOD G;  2FNQ A;  3VGN A;  5IG4 A;  1OHO A;  5AIF A;  3OV4 A;  2FGT A;  1CEW I;  4HZB B;  1VQP 3;  3PYJ A;  3OX9 A;  3CCR 3;  2PNC A;  3H51 A;  3CCU 3;  1W4N A;  3EX9 A;  4EC6 A;  3UL5 A;  2Y74 A;  4OVM A;  1W2Z A;  3K63 A;  2D1W A;  3T8U A;  3NV0 A;  3JUO A;  1O7W B;  1SJW A;  1Y4K A;  3MG2 A;  1F8N A;  2C10 A;  5IW9 A;  2CFW A;  3JUM A;  5AII A;  1YI2 3;  3RGR A;  2CK3 H;  3LTD A;  3NM7 A;  1M1K 4;  1ULJ B;  2W9Q A;  4WWU C;  3MG1 A;  4I4K A;  3NQZ A;  4BTW A;  1WMN A;  1DYU A;  1N8Q A;  2HMO B;  4ORL A;  1UI7 A;  1WQL B;  3Q90 A;  5FGO A;  4XDV A;  3KII A;  3MWZ A;  2CG1 A;  1OHS A;  3CNM A;  1EA2 A;  1OF5 A;  4KFF A;  3CD6 3;  3FSD A;  3DUK A;  1YJN 3;  3CXC 2;  4HKV B;  1ISK A;  3DGL A;  4N6M A;  1Q86 4;  3M8C A;  2WOH A;  3EQQ B;  1YVB I;  3G0K A;  2Z77 A;  2WOF A;  3AMO A;  2W04 A;  2BHM A;  3BNE A;  1O7P B;  4OK0 A;  2GBW B;  4CDL A;  2XFT A;  1AVK A;  1VQO 3;  4XBY A;  3HZP A;  3SOY A;  5D81 A;  3DZL A;  1W6G A;  3E99 A;  1JV2 B;  3PS8 A;  4KFE A;  3NBR A;  1S72 3;  4HM7 B;  1K28 A;  1TP6 A;  1L5G B;  3LTC A;  3EHC A;  1ASK A;  1W00 A;  1O7H B;  1QJG A;  1ZX2 A;  3G71 3;  1GD4 A;  3RGA A;  3WOE B;  3OWY A;  5EEO A;  3KE7 A;  3MPH A;  3FF2 A;  1HU9 A;  1OGZ A;  2GU1 A;  3NQY A;  3RDE A;  3LZA A;  1WNH A;  3CCM 3;  1YJW 3;  3FF0 A;  4PEJ A;  3X3Y A;  5D82 A;  4L8P A;  2JQ5 A;  3JVC A;  3EBY A;  1S5A A;  2HMJ B;  1GY5 A;  1JN5 B;  4HM1 B;  3S67 A;  1VQ9 3;  5AEU B;  3OXA A;  3CC4 3;  2BT3 A;  3NBB A;  4N6U A;  2W03 A;  4HM0 B;  3J7Y d;  1V74 A;  2E2T A;  2XGL A;  1LOX A;  2CW9 A;  1E3V A;  1FGR A;  1NJI 4;  1UUV B;  3B8L A;  3CNX A;  3I0Y A;  2Q07 A;  5CF1 A;  1LXE A;  5FW5 A;  5IEO A;  5IG0 A;  1IK3 A;  4LSO A;  2YFL B;  5BVB A;  1IVV A;  2FXT A;  2C11 A;  1TFK A;  2OQE A;  2XF3 A;  3U97 A;  4HZ9 B;  1J2B A;  2K54 A;  1IVX A;  5IEN A;  3UJM A;  2A15 A;  3S29 A;  1O7N B;  2KXG A;  5KP3 A;  3SXX A;  1IV7 A;  3FG4 A;  1N5H A;  1QAL A;  1WMP A;  1NO3 A;  4KFD A;  2XH9 A;  4RNZ A;  3CCS 3;  2BMR B;  1W2B 2;  1JB5 A;  3IJE B;  3DXO A;  4R1K A;  4WYK B;  4WHA A;  2XSH B;  1DVD A;  4EBG A;  3U1W A;  2MF7 A;  3HI7 A;  2CWV A;  2BMO B;  3FKA A;  1QVF 2;  2RCD A;  3LOY A;  1CQS A;  3OWU A;  4HM4 B;  2ZL8 A;  4N6O B;  4KZ1 A;  4TX4 A;  4N6V 0;  3H3H A;  4XB5 A;  5IG3 A;  4K1V A;  5D83 A;  1VQ4 3;  3LTA A;  5G2G A;  4IT7 A;  1E97 A;  2WO0 A;  2Z76 A;  3SX1 A;  1MOL A;  1A2K A;  4U13 A;  1ROA A;  5IER A;  1VQK 3;  4HM6 B;  4HYZ A;  4O02 B;  4Q53 A;  3EC9 A;  2IA7 A;  3OW2 2;  4XBX A;  2O3O A;  4FMD A;  1SPU A;  8CHO A;  3TDG A;  1M90 4;  2GEY A;  1RN7 A;  5LC7 A;  3CPW 2;  2OTL 3;  3BNC A;  3DGN A;  2GU3 A;  4RZM A;  4N6T A;  1N9J A;  2P0M A;  3ECF A;  4LEH A;  2QIY A;  4R9L A;  1VQM 3;  1HKX A;  1QVG 2;  1MNL A;  1FGO A;  1FGQ A;  3K0Z A;  2XEP A;  5CK6 A;  5AI1 A;  2CC3 A;  3IPT A;  3I55 3;  2W9P A;  2JDI H;  5BXQ A;  2I9W A;  4WFO A;  3SOA A;  1VQ5 3;  1IV9 A;  2HMK B;  3KSE D;  1JKG B;  5EVH A;  2Z7A A;  1FUW A;  3MG3 A;  2P09 A;  1VZZ A;  3FCS B;  1AR0 A;  3EE1 A;  3G4S 3;  3F9S A;  2BNG A;  3V98 A;  4WP5 A;  1YHQ 3;  1LVN A;  4O2H A;  1SII A;  5AYR B;  4J9A A;  2E2U A;  5I97 A;  3MSO A;  4RBN A;  1A2V A;  3S27 A;  3B7C A;  3LXU X;  3UL6 A;  3EB8 A;  2BMQ B;  4XDW A;  2LQV A;  1N8R 4;  1IDP A;  3Q1C A;  3KZT A;  3EN1 B;  1A67 A;  1IQX A;  3S28 A;  3UB1 A;  3LT9 A;  4EV5 A;  4XM4 A;  4HJL B;  1VQN 3;  4HM2 B;  3SED A;  1CYU A;  4AEQ A;  1D6Z A;  3F40 A;  3K7C A;  3N9H A;  4FMC A;  1Q81 4;  2CFD A;  1DMQ A;  3DMC A;  2RGQ A;  1YGE A;  1QAK A;  4JF8 A;  2E2V A;  3PXM A;  5DRE A;  5LC6 A;  1EKM A;  3X3X A;  1TU5 A;  2ML5 A;  4JRF A;  4EXR A;  2YFJ B;  3DM8 A;  1GY6 A;  4K90 B;  3X40 A;  3WOF B;  3FG1 A;  1W5Z A;  1JN5 A;  1OAC A;  4HVN A;  3B4O A;  1IVU A;  3PGB A;  5EQL A;  3OWS A;  1Q40 B;  3DGM A;  3JUQ A;  3LTB A;  4MEI A;  2OTJ 3;  3MYT A;  1AVL A;  1KWI A;  4MMX B;  3BNB A;  3EJV A;  3WDG B;  2GXF A;  1O7G B;  5JPU A;  3EF8 A;  4FCJ A;  4AKZ A;  2P38 A;  1TFO A;  2QEX 3;  3FZW A;  2HML B;  1CYV A;  1OCV A;  1SIH A;  2Z6B A;  3F14 A;  2ZDJ A;  4STD A;  1D6U A;  1ZO2 A;  3WMD A;  3DY5 A;  2CWT A;  1KQS 2;  2XR8 B;  4R4K A;  3HIG A;  3WA2 X;  5CF2 A;  2OWP A;  1GS3 A;  3FH1 A;  1KC8 4;  2KCD A;  4EV2 A;  1C7H A;  1G96 A;  1YIJ 3;  5TGN A;  4IIA A;  2Y73 A;  2STD A;  4R9K A;  4K1U A;  5ELJ A;  1UI8 A;  1W6C A;  3SLU A;  2QGU A;  4WYK A;  1W01 A;  3BB9 A;  4FCZ A;  1JB2 A;  1TUH A;  4ZM8 A;  4MMZ B;  2OCT A;  3EBT A;  5CLK A;  1STD A;  5AEW B;  4IPB A;  2W56 B;  3ALA A;  3KKG A;  2K0M A;  2WGQ A;  3PCS A;  2HMN B;  2M7O A;  3LH4 A;  3LYG A;  1OGX A;  3CU3 A;  3VF1 A;  1DMN A;  1SQW A;  4FMA A;  3VSY A;  2OOV C;  3NUV A;  2BO9 B;  3F7S A;  3FG3 A;  3WA3 A;  3A76 A;  3N54 B;  1OHP A;  3FLJ A;  4HM8 B;  1KD1 4;  3D9R A;  3CC2 3;  5DRV A;  2L4V A;  1UW1 A;  1IQ8 A;  2IMJ A;  1E3R A;  4BTX A;  1IVW A;  3FGY A;  3Q2P A;  1QAF A;  5AIG A;  3KFQ C;  2W6J H;  3N8B A;  1BUQ A;  4O3V A;  3HK4 A;  3G16 A;  1OUN A;  4HM3 B;  4LZI A;  2XSO B;  1K8A 4;  3K5T A;  5KP4 A;  2PZV A;  4AKY A;  4N6L A;  2IUK A;  5IG5 A;  3ROB A;  3GZB A;  1W7C A;  4NRE A;  3LML A;  1NB5 I;  1US1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...