3CCM3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccm300
1YIJ3 1K8A4 1YJ93 1W2B2 1Q864 3CCM3 1YIT3 1YJW3 3CME3 1QVG2 2OTJ3 1Q7Y4 3CC43 1Q814 1NJI4 1VQ73 1VQK3 1Q824 3CC23 1K734 3CMA3 1VQL3 1VQN3 1QVF2 3CCV3 1K9M4 3I563 3CCR3 1VQ83 3CCS3 1VQO3 1M904 1M1K4 3CXC2 1VQ93 3CPW2 1VQ63 2OTL3 3G4S3 3CCE3 3CCQ3 3OW22 2QA43 1N8R4 1KC84 1KD14 1JJ22 3CD63 3CC73 1VQM3 3I553 1YJN3 1YHQ3 3CCU3 1VQP3 3G713 1VQ43 3CCL3 1VQ53 1KQS2 1YI23 3CCJ3 3G6E3 2QEX3 1S723
chains in the Genus database with same CATH superfamily
3GZRA 1LRAA 1W2B2 1NWWA 3PZWA 3CCM3 2GEXA 3DUKA 1MGRA 5STDA 2CG1A 3MKIA 3KSPA 2K3DA 2CK3H 3IPTA 4LZIA 4XBYA 5G2GA 2CIUA 3H3HA 3OV4A 1CEWI 1RLSA 3WA2X 2W56A 1BRJA 3HIGA 2XRXB 1M1K4 1RDSA 1DMMA 2IA7A 3EF8A 5JPPA 3JUNA 1Q42A 1D6UA 1OGZA 1RGHA 6GSPA 3ALAA 3SOAA 2KF6A 1AVLA 1BRHA 1CYVA 1YGWA 3NBBA 3G713 1B21A 4HM5B 1RRHA 4BL3A 3X3YA 5I97A 2XH9A 3FZWA 3HIIA 1FYSA 4HYZA 4EC6A 3NUVA 4BIRA 1GOVA 1I2FA 1PFPA 2FXTA 1IK3A 1DETA 2HMOB 2IUKA 3N54B 5IW9A 2CHCA 1DMNA 3OX9A 1UCIA 1UGHI 1IU7A 1GSPA 1O7NB 1JZOA 1STFI 2H0GA 3Q2PA 1R4YA 1VQN3 1KSIA 3D5GA 3JUPA 1J2BA 5CF2A 1GYBA 3LTDA 4L8OA 3CCS3 1YVBI 2BU4A 4R4KA 3CPW2 1M1XB 4O8SA 2B1XB 4WWUC 3CCE3 4ORLA 4CDLA 1Q40A 3GRDA 2D1WA 2QA43 8RNTA 3T8UA 1X1YA 1LNHA 1IV7A 3LXUX 1IT7A 2P38A 3PCSA 4X2HA 3EE1A 3WMDA 1ASKA 1UCLA 4XDVA 5D81A 1R4CA 2IY2A 2W03A 4N6LA 2ZL8A 1ZGXA 3GSPA 1LQMB 4PEJA 4RZMA 1JKGB 5D83A 6STDA 1A2KA 4WYKB 3NBRA 5CLKA 3S67A 3FGYA 1D6ZA 3WHOA 1GOUA 1JN5B 2Z6BA 4CJNA 1NB5I 1I3IA 3DGNA 1VQ63 1VQ93 2GU1A 1O7WB 4LSOA 1BRNL 3CPOA 1N8R4 1UGIA 3SYUA 1ZO2A 2C10A 1YJN3 4O2HA 3OXAA 1A67A 1T2IA 4XDWA 1UI8A 1BSBA 1VQ43 1S5AA 2K0MA 1W7CA 4HAAA 1RN1A 3G6E3 3VF1A 4GL6A 2O9UX 3RDEA 1IVVA 1O7GB 1BNFA 3B4PA 4O02B 1DVCA 2CW9A 3EB8A 4JRFA 2ZA4A 3D4AA 4EBGA 3NV0B 2OTJ3 1NJI4 1VQ73 3B7CA 3CC23 3U97A 3UJMA 1QAKA 4R9LA 1E3RA 1B27A 2GXFA 4DKIA 2CG0A 3EX9A 3UNLA 1VQ83 1M9GA 2E2TA 5IERA 4EW5A 1I8VA 7GSPA 5BXQA 2A15A 2GBWB 1G0TA 4J5KA 4WP5A 4I4KA 1B2ZA 1UUWB 4O3VA 2AAEA 1JBSA 4KFEA 1VQ53 3DY5A 2BHMA 4L8PA 2W2CA 5AIHA 3NM7A 1GS3A 3K0ZA 2ZHXB 1OH0A 4ILFA 5KP3A 1B2SA 1YVSA 3PCRA 2BMRB 4MMZB 3D9RA 4EV5A 3HK4A 3MSOA 4OVMA 2YX9A 3SEDA 2JQ5A 1EUIC 2PNCA 2STDA 4KFFA 4OK0A 4N3VA 1W6CA 2KAAA 3LT8A 2MF7A 1EG9B 1ROVA 2P05A 2ML5A 2W04A 4HKVB 5AYSC 1JBRA 1D6YA 3GAXA 4NHFA 4WYKA 3KE7A 3VSYA 1ROAA 4XBTA 2WO0A 4AEQA 5JPUA 1BVIA 2F98A 4X2OA 3MG2A 3GZYB 1FGRA 3X40A 3DXOA 1TP6A 5A0OB 1S723 5IEPA 1FGQA 3A5EA 1GD4A 1SQWA 1V58A 1B2XA 1SJWA 2UUGC 4KVHA 3MPHA 3BIRA 1W02A 4RNTA 3FG3A 2CKFB 4BTYA 5G1KA 4HM8B 1TRPA 3JUQA 2HOHA 5AEUB 1RGFA 1MGWA 1I3FA 1B3SA 1FUTA 2WGOA 2F86B 3LTCA 2SARA 1OF5B 3FG1A 4K1UA 3DGLA 3MG3A 5JBSA 4K90B 1RRLA 3NV0A 1BIRA 2Q07A 3RNTA 3OW22 2PZVA 2V1LA 5FW5A 1JJ22 3CD63 3SXXA 4FMAA 3FF0A 1JB2A 2YFIB 1Z1SA 4G1MB 3PS8A 3X42A 1QVF2 1BRGA 1V74A 1UW1A 3V98A 1GY5A 2BMQB 1GY7A 1BAOA 4N6V0 3HOHA 5HGRA 2P0MA 1OPYA 3MG1A 3QK9A 1FGOA 5IG4A 1OCVA 2L4VA 1Q814 1DE3A 1QAFA 1WMPA 4FR9A 3LZAA 1LVNA 1IVXA 2H0HA 2JDIH 4HVNA 3CCV3 1VQL3 1OACA 3F8XA 4RNYA 2W9PA 5M1AA 1SARA 3CXC2 5BVBA 3BLZA 5BU4A 3G4S3 5GSPA 3T8NA 3LYGA 4N6UA 1RGKA 5EEOA 2Y73A 1X1XA 1X1UA 1BGSA 3S27A 4NREA 1SIIA 1B20A 1ULJB 2SBLA 5EVHA 3CCL3 4HM3B 4HZ9B 1US1A 2XGLA 1EQKA 1BSEA 1FA3A 2HMJB 4RNZA 3UB1A 4KZ1A 2E2UA 1JBTA 5LC6A 1LOXA 1RCKA 3NM2A 1N8QA 3S29A 3WDGB 1QVG2 3KKGA 1RGLA 2UX0A 1UCJA 4EV2A 1BNSA 2HMNB 1Y4KA 2HMLB 3WOEB 2K54A 3D5IA 3NX0A 1VQK3 1YNVX 2F4YA 4OUQA 1K9M4 2RFRA 3D79A 3TDGA 2C11A 4HM0B 1RMSA 2XGNA 2CFDA 3SX1A 1VZZA 4QWTA 1I0VA 1W2ZA 4U13A 4EYCA 1MNLA 1KC84 1RNTA 1KD14 1O7HB 4ZM8A 3FG4A 1C7HA 1NNVA 5AI1A 5AEWB 1W6GA 1YHQ3 3ZG5A 4FCMA 3DGMA 5KP1A 2FNQA 2H0IA 3LMLA 3KSED 1IYYA 1RGAA 1OF5A 1ZS7A 3EN8A 3FCSB 1F8NA 1YIJ3 4LEHA 1ISKA 4N6MA 7RNTA 1QMAA 1UUGB 2D42A 1BUJA 1AVKA 1FGMA 1UDII 3CNXA 3J7Yd 1BNRA 1N5PA 2KCDA 4LGQA 2M7OA 2OWPA 4HM4B 3CC43 1FUSA 1BNIA 2Y74A 1AR0A 4K61A 1IDPA 2J8XB 3BNBA 2UGIA 4BTXA 1QJGA 1W4NA 4NPBA 3JUOA 1ZX2A 1G02A 3GWRA 2OOVC 3IJEB 3QRDA 3CCQ3 3EBYA 1OGXA 5ELUA 1HU9A 1PY3A 2F5WA 3K5TA 4HM1B 4KFDA 1WMNA 1RGGA 5RNTA 5IG5A 2BMOB 2HMMB 1EKMA 3DMCA 2I9WA 2LYXA 4HBRA 4KT3B 1Q864 2Z77A 1IQXA 4BU4A 1TIJA 1GY6A 3B8LA 5DRVA 1A2VA 3G8ZA 2XEPA 8CHOA 3I0YA 1W6YA 4BL2A 4IPBA 5IG0A 1AY7A 1FGTA 5M18A 4MMXB 1C54A 1GOYA 3AMOB 3LH4A 5IF6A 5IG3A 1TRQA 2IYJA 2OQEC 3PYJA 4RBNA 1DMQA 2C4BA 2CX1A 3F40A 3LOYA 5DREA 1MWUA 1IQYA 2RSXA 1VQO3 1M904 4N6OB 1BANA 2KXGA 1TFKA 3EBTA 2RBIA 3ER7A 4JF8A 1UI7A 3LT9A 1MWRA 1TTOA 1IVWA 4FMBA 4GSPA 6RNTA 4GB5A 2P09A 3AGNA 3OWSA 3FSDA 4R80A 1UUVB 1WQLB 2KF5A 1B2UA 3NXJA 4FMDA 5IENA 4STDA 1RN4A 2B24B 1LOWA 1RJOA 4H61A 1K41A 1YGEA 3EQQB 4AKZA 1PU4A 1N9EA 1DVDA 3SOYA 1IV9A 1SPUA 4WHAA 1MOLA 2XSHB 4FCJA 1CH0A 1MWTA 3N8BA 1LNIA 2E2VA 2F56A 1Q824 1NDOB 3F7SA 1I0XA 1HYFA 2XFTA 2R4IA 5TGNA 2L1SA 2CWUA 3NQYA 3SVAA 2OTL3 2CWVA 3N9HA 1LOVA 1BOXA 2P0XA 3BNEA 3UL5A 1TJDA 2Z76A 4XM4A 1E97A 3Q90A 1GMPA 3URPA 4LMIA 4IIAA 1RTUA 3KFQC 1L5GB 1CYUA 1BNEA 1YJ93 3CNMA 4J8TA 3M8CA 3FLJA 3JVCA 3KCHA 3WA3A 2CFKA 4MJDA 1Q7Y4 2FGTA 1BSAA 4BTWA 3FF2A 2KRTA 2CFWA 5CK6A 1I2GA 3S5CA 3I563 1X1WA 1B2MA 2OOVA 1G96A 2RCDA 3K63A 3ECFA 3EHCA 1RGCA 1N9JA 3ZFZA 1VQQA 4HZBB 2WGQA 1O7PB 3F9SA 3AMOA 1VQP3 1W5ZA 3F7XA 1TU5A 3RGRA 1KQS2 4FCZA 3F14A 3SLUA 1O7MB 5CF1A 4HM2B 2CFLA 1FZUA 3KN4A 1HZ1A 2IUJA 3X3XA 1AQZA 1TUHA 2HMKB 1T5YA 4MEIA 3S28A 4J5GA 2OQEA 2INXA 1IT8A 1DYUA 1K734 4I5QA 3U1WA 1E3VA 4H3UA 1IQ8A 3FKAA 1OUNA 1IVUA 2RNTA 3BNDA 1RHLA 1N5HA 1KWIA 1WMOA 2W6JH 2Z7AA 3V99A 1OHOA 4AKYA 1K28A 3MYTA 4HM6B 2WOFA 1T2HA 3K9MC 3AGOA 3CCU3 3G16A 1BSCA 2W0QA 4LYLB 1MWSA 3LTBA 2GSPA 4R9KA 5FGOA 2OCTA 3WR2A 9RNTA 4IT7A 2QEX3 2WOHA 4L7KA 5AIFA 3VGNA 3UL6A 1UCKA 2LQVA 2XF3A 3HI7A 1NO3A 3CME3 3EJVA 4J9AA 3DGYA 1RKYA 1NB3I 1JV2B 2R41A 2CX0A 1BSDA 3OWUA 1WNHA 2CC3A 2F5MA 3D3LA 4HM7B 5ELJA 3DGOA 3PGBA 5AIIA 3A76A 2KF3A 1A2PA 5IEOA 3X41A 5CXOA 1U5OA 3IMAB 1BRSA 2XR8B 1BRIA 1SIHA 2IMJA 3HZPA 2CWTA 1EA2A 3LTAA 1QALA 1BNJA 1W01A 2BO9B 3NHXA 1RGEA 2GEYA 1ULIB 3BU4A 3G0KA 3JUMA 5HOHA 5D82A 1K8A4 2W56B 3B4OA 1I70A 3GZXB 3L0RA 1PYLA 3T0UA 4HJLB 2O3OA 3GZBA 3O8YA 5AIGA 5AYRB 1CQSA 4XB5A 3RGAA 3Q3FA 3DH2A 3H51A 3MHEA 1W00A 5M19A 1Q7HA 1JNQA 3AHSA 2BNGA 1OHPA 3BNCA 3ZG0A 5EQLA 2CH9A 1RSNA 4TX4A 1BUQA 4XBXA 1AV4A 1NU3A 1Q9EA 4EXRA 2ML6A 4K1VA 3BB9A 1GMRA 1BNGA 1JZDA 1JRQA 3WOFB 3CU3A 1EEJA 3CC73 3I553 1VQM3 4N6NB 1JB4A 3EN1B 2QGUA 2ZDJA 1I2EA 4MMYB 1A90A 3KIIA 3OWYA 3CCJ3 1LXEA 1GMQA 1RNBA 3PXMA 4Q53A 1GD3A 3X3ZA 4FMCA 3Q1CA 4CCVA 3KZTA 3STDA 4CPKA 1BRKA 1BU4A 2BT3A 1YIT3 3MWZA 4N6TA 1T3BA 1YJW3 3F8HA 5LC7A 3V92A 1JB5A 5G1LA 3DM8A 1Q40B 3HX8A 5BIRA 1V57A 3FH1A 4R1KA 2AADA 2F99A 2XFSA 1LOYA 2YFJB 3NBJA 3NQZA 3CMA3 1TFOA 3CCR3 2KF4A 1JKGA 1LQGC 1STDA 7STDA 3DZLA 2QIYA 5KP4A 1RN7A 3WODG 1RCLA 3E99A 1FW7A 1HKXA 4GHOA 4WFOA 2GU3A 2MC8A 3EC9A 1OHSA 1JN5A 1WTHA 2RGQA 3AHWA 2CFGA 2W9QA 2BIRA 1FUWA 3ROBA 1YI23 3K7CA 2XSOB 2GBXB 2YFLB 1U8CB 4HOHA
chains in the Genus database with same CATH topology
3GZRA 1W2B2 1NWWA 3PZWA 3CCM3 2GEXA 3DUKA 5STDA 2CG1A 3MKIA 3KSPA 2CK3H 3IPTA 4LZIA 4XBYA 5G2GA 2CIUA 3H3HA 3OV4A 1CEWI 3WA2X 2W56A 3HIGA 2XRXB 1M1K4 1DMMA 2IA7A 3EF8A 5JPPA 3JUNA 1Q42A 1D6UA 1OGZA 3ALAA 3SOAA 1AVLA 1CYVA 3NBBA 3G713 4HM5B 1RRHA 3X3YA 5I97A 2XH9A 3FZWA 3HIIA 4HYZA 4EC6A 3NUVA 1IK3A 1PFPA 2FXTA 2HMOB 3N54B 2IUKA 5IW9A 2CHCA 1DMNA 3OX9A 1IU7A 1O7NB 1STFI 3Q2PA 1VQN3 1KSIA 3JUPA 1J2BA 5CF2A 1GYBA 3LTDA 4L8OA 3CCS3 1YVBI 4R4KA 3CPW2 1M1XB 4O8SA 2B1XB 4WWUC 3CCE3 4ORLA 4CDLA 1Q40A 3GRDA 2D1WA 2QA43 3T8UA 1LNHA 1IV7A 3LXUX 1IT7A 2P38A 3PCSA 4X2HA 3EE1A 3WMDA 1ASKA 4XDVA 5D81A 1R4CA 2W03A 4N6LA 2ZL8A 4PEJA 4RZMA 1JKGB 5D83A 6STDA 1A2KA 4WYKB 3NBRA 5CLKA 3S67A 3FGYA 1D6ZA 1JN5B 2Z6BA 1NB5I 3DGNA 1VQ63 1VQ93 2GU1A 1O7WB 4LSOA 3CPOA 1N8R4 1ZO2A 2C10A 1YJN3 4O2HA 3OXAA 1A67A 4XDWA 1UI8A 1VQ43 1S5AA 2K0MA 1W7CA 3G6E3 3VF1A 4GL6A 2O9UX 3RDEA 1IVVA 1O7GB 3B4PA 4O02B 1DVCA 2CW9A 3EB8A 4JRFA 4EBGA 3NV0B 2OTJ3 1NJI4 1VQ73 3B7CA 3CC23 3U97A 3UJMA 1QAKA 4R9LA 1E3RA 2GXFA 2CG0A 3EX9A 3UNLA 1VQ83 1M9GA 2E2TA 5IERA 5BXQA 2A15A 2GBWB 4WP5A 4I4KA 1UUWB 4O3VA 4KFEA 1VQ53 3DY5A 2BHMA 4L8PA 2W2CA 5AIHA 3NM7A 1GS3A 3K0ZA 1OH0A 5KP3A 3PCRA 4MMZB 2BMRB 3D9RA 4EV5A 3HK4A 3MSOA 4OVMA 2YX9A 3SEDA 2JQ5A 2STDA 2PNCA 4KFFA 4OK0A 4N3VA 1W6CA 3LT8A 2MF7A 1EG9B 1ROVA 2W04A 2ML5A 2P05A 4HKVB 5AYSC 1D6YA 3GAXA 4NHFA 4WYKA 3KE7A 3VSYA 1ROAA 4XBTA 2WO0A 4AEQA 5JPUA 2F98A 4X2OA 3MG2A 3GZYB 1FGRA 3X40A 3DXOA 1TP6A 5A0OB 1S723 5IEPA 1FGQA 1GD4A 1SQWA 1SJWA 4KVHA 3MPHA 1W02A 4BTYA 3FG3A 2CKFB 4HM8B 3JUQA 5AEUB 3LTCA 2WGOA 2F86B 3FG1A 1OF5B 4K1UA 3DGLA 3MG3A 5JBSA 4K90B 1RRLA 3NV0A 2Q07A 3OW22 2PZVA 2V1LA 5FW5A 1JJ22 3CD63 3SXXA 4FMAA 3FF0A 1JB2A 2YFIB 1Z1SA 4G1MB 3PS8A 3X42A 1QVF2 1V74A 1UW1A 3V98A 1GY5A 2BMQB 1GY7A 4N6V0 5HGRA 2P0MA 1OPYA 3MG1A 3QK9A 1FGOA 5IG4A 1OCVA 2L4VA 1Q814 1QAFA 1WMPA 4FR9A 3LZAA 1LVNA 1IVXA 2JDIH 4HVNA 3CCV3 1VQL3 1OACA 3F8XA 4RNYA 2W9PA 3CXC2 5BVBA 3BLZA 3G4S3 3T8NA 3LYGA 4N6UA 5EEOA 2Y73A 3S27A 4NREA 1SIIA 1ULJB 2SBLA 5EVHA 3CCL3 4HM3B 4HZ9B 1US1A 2XGLA 1EQKA 1FA3A 2HMJB 4RNZA 3UB1A 4KZ1A 2E2UA 5LC6A 1LOXA 3NM2A 1QVG2 1N8QA 3S29A 3WDGB 3KKGA 4EV2A 2UX0A 3CC43 2HMNB 1VQK3 1Y4KA 2HMLB 3WOEB 2K54A 3NX0A 4OUQA 1K9M4 2RFRA 3TDGA 2C11A 4HM0B 2XGNA 2CFDA 3SX1A 1VZZA 4QWTA 1W2ZA 4U13A 4EYCA 1MNLA 1KC84 1KD14 1O7HB 4ZM8A 3FG4A 1C7HA 5AI1A 5AEWB 1YHQ3 1W6GA 4FCMA 3DGMA 5KP1A 2FNQA 3LMLA 3KSED 1OF5A 1YIJ3 3EN8A 3FCSB 1F8NA 4LEHA 1ISKA 4N6MA 1QMAA 2D42A 1AVKA 1FGMA 3CNXA 3J7Yd 1N5PA 2KCDA 4LGQA 2M7OA 2OWPA 4HM4B 2Y74A 4K61A 1AR0A 1IDPA 3BNBA 4BTXA 1QJGA 1W4NA 3JUOA 1ZX2A 3IJEB 3GWRA 2OOVC 3QRDA 3CCQ3 3EBYA 1OGXA 5ELUA 1HU9A 3K5TA 4HM1B 4KFDA 1WMNA 5IG5A 2BMOB 2HMMB 1EKMA 3DMCA 2I9WA 2LYXA 4HBRA 1Q864 2Z77A 1IQXA 1TIJA 1GY6A 3B8LA 5DRVA 1A2VA 3G8ZA 2XEPA 8CHOA 3I0YA 1W6YA 4IPBA 5IG0A 1FGTA 4MMXB 3AMOB 5IF6A 3LH4A 5IG3A 2OQEC 3PYJA 4RBNA 1DMQA 3F40A 3LOYA 5DREA 1VQO3 1IQYA 2RSXA 1M904 4N6OB 2KXGA 1TFKA 3EBTA 3ER7A 4JF8A 1UI7A 3LT9A 4FMBA 1IVWA 4GB5A 2P09A 4R80A 3OWSA 3FSDA 1UUVB 1WQLB 3NXJA 4FMDA 5IENA 4STDA 2B24B 1RJOA 4H61A 1PU4A 1K41A 1YGEA 3EQQB 4AKZA 1N9EA 1DVDA 3SOYA 1IV9A 1SPUA 4WHAA 1MOLA 2XSHB 4FCJA 3N8BA 2E2VA 1Q824 1NDOB 3F7SA 2XFTA 2R4IA 5TGNA 2CWUA 3NQYA 3SVAA 2OTL3 2CWVA 3N9HA 2P0XA 3BNEA 3UL5A 2Z76A 4XM4A 1E97A 3Q90A 4LMIA 4IIAA 3KFQC 1L5GB 1CYUA 1YJ93 3CNMA 4J8TA 3M8CA 3FLJA 3JVCA 3WA3A 2CFKA 4MJDA 1Q7Y4 2FGTA 4BTWA 3FF2A 2KRTA 2CFWA 5CK6A 3S5CA 3I563 2OOVA 1G96A 2RCDA 3K63A 3ECFA 3EHCA 1N9JA 4HZBB 2WGQA 1O7PB 3F9SA 3AMOA 1VQP3 1W5ZA 3F7XA 1TU5A 3RGRA 1KQS2 4FCZA 3F14A 3SLUA 1O7MB 5CF1A 4HM2B 2CFLA 3KN4A 2IUJA 3X3XA 1TUHA 2HMKB 1T5YA 4MEIA 3S28A 2OQEA 2INXA 1IT8A 1DYUA 1K734 3U1WA 1E3VA 4H3UA 1IQ8A 3FKAA 1OUNA 1IVUA 3BNDA 1N5HA 1KWIA 1WMOA 2W6JH 2Z7AA 3V99A 1OHOA 4AKYA 1K28A 3MYTA 4HM6B 2WOFA 3K9MC 3CCU3 3G16A 2W0QA 4R9KA 3LTBA 5FGOA 2OCTA 4IT7A 2QEX3 2WOHA 4L7KA 5AIFA 3VGNA 3UL6A 2LQVA 2XF3A 3HI7A 1NO3A 3CME3 3EJVA 4J9AA 1RKYA 1NB3I 1JV2B 3OWUA 1WNHA 2CC3A 4HM7B 3D3LA 5ELJA 3DGOA 3PGBA 5AIIA 3A76A 5IEOA 3X41A 5CXOA 1U5OA 3IMAB 2XR8B 1SIHA 2IMJA 3HZPA 2CWTA 1EA2A 3LTAA 1QALA 2BO9B 1W01A 3NHXA 2GEYA 1ULIB 3G0KA 3JUMA 5D82A 1K8A4 2W56B 3B4OA 3L0RA 3GZXB 3T0UA 4HJLB 2O3OA 3GZBA 3O8YA 5AIGA 5AYRB 1CQSA 4XB5A 3RGAA 3H51A 3MHEA 1W00A 1JNQA 3BNCA 2BNGA 1OHPA 5EQLA 2CH9A 4TX4A 1BUQA 4XBXA 1AV4A 1NU3A 4EXRA 2ML6A 4K1VA 3BB9A 1JRQA 3WOFB 3CU3A 3CC73 1VQM3 3I553 4N6NB 1JB4A 3EN1B 2QGUA 2ZDJA 4MMYB 1A90A 3KIIA 3OWYA 3CCJ3 1LXEA 3PXMA 4Q53A 1GD3A 3X3ZA 4FMCA 3Q1CA 4CCVA 3KZTA 3STDA 1YJW3 1YIT3 2BT3A 3MWZA 4N6TA 3F8HA 5LC7A 3V92A 1JB5A 3DM8A 1Q40B 3HX8A 3FH1A 4R1KA 2F99A 3NQZA 2XFSA 3NBJA 2YFJB 3CMA3 1TFOA 3CCR3 1JKGA 1STDA 7STDA 3DZLA 2QIYA 5KP4A 1RN7A 3WODG 3E99A 1HKXA 4WFOA 2GU3A 2MC8A 3EC9A 1OHSA 1JN5A 1WTHA 2RGQA 2CFGA 2W9QA 1FUWA 3ROBA 1YI23 3K7CA 2XSOB 2GBXB 2YFLB 1U8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ 3;  1K8A 4;  1YJ9 3;  1W2B 2;  1Q86 4;  3CCM 3;  1YIT 3;  1YJW 3;  3CME 3;  1QVG 2;  2OTJ 3;  1Q7Y 4;  3CC4 3;  1Q81 4;  1NJI 4;  1VQ7 3;  1VQK 3;  1Q82 4;  3CC2 3;  1K73 4;  3CMA 3;  1VQL 3;  1VQN 3;  1QVF 2;  3CCV 3;  1K9M 4;  3I56 3;  3CCR 3;  1VQ8 3;  3CCS 3;  1VQO 3;  1M90 4;  1M1K 4;  3CXC 2;  1VQ9 3;  3CPW 2;  1VQ6 3;  2OTL 3;  3G4S 3;  3CCE 3;  3CCQ 3;  3OW2 2;  2QA4 3;  1N8R 4;  1KC8 4;  1KD1 4;  1JJ2 2;  3CD6 3;  3CC7 3;  1VQM 3;  3I55 3;  1YJN 3;  1YHQ 3;  3CCU 3;  1VQP 3;  3G71 3;  1VQ4 3;  3CCL 3;  1VQ5 3;  1KQS 2;  1YI2 3;  3CCJ 3;  3G6E 3;  2QEX 3;  1S72 3; 
#chains in the Genus database with same CATH topology
 3GZR A;  1LRA A;  1W2B 2;  1NWW A;  3PZW A;  3CCM 3;  2GEX A;  3DUK A;  1MGR A;  5STD A;  2CG1 A;  3MKI A;  3KSP A;  2K3D A;  2CK3 H;  3IPT A;  4LZI A;  4XBY A;  5G2G A;  2CIU A;  3H3H A;  3OV4 A;  1CEW I;  1RLS A;  3WA2 X;  2W56 A;  1BRJ A;  3HIG A;  2XRX B;  1M1K 4;  1RDS A;  1DMM A;  2IA7 A;  3EF8 A;  5JPP A;  3JUN A;  1Q42 A;  1D6U A;  1OGZ A;  1RGH A;  6GSP A;  3ALA A;  3SOA A;  2KF6 A;  1AVL A;  1BRH A;  1CYV A;  1YGW A;  3NBB A;  3G71 3;  1B21 A;  4HM5 B;  1RRH A;  4BL3 A;  3X3Y A;  5I97 A;  2XH9 A;  3FZW A;  3HII A;  1FYS A;  4HYZ A;  4EC6 A;  3NUV A;  4BIR A;  1GOV A;  1I2F A;  1PFP A;  2FXT A;  1IK3 A;  1DET A;  2HMO B;  2IUK A;  3N54 B;  5IW9 A;  2CHC A;  1DMN A;  3OX9 A;  1UCI A;  1UGH I;  1IU7 A;  1GSP A;  1O7N B;  1JZO A;  1STF I;  2H0G A;  3Q2P A;  1R4Y A;  1VQN 3;  1KSI A;  3D5G A;  3JUP A;  1J2B A;  5CF2 A;  1GYB A;  3LTD A;  4L8O A;  3CCS 3;  1YVB I;  2BU4 A;  4R4K A;  3CPW 2;  1M1X B;  4O8S A;  2B1X B;  4WWU C;  3CCE 3;  4ORL A;  4CDL A;  1Q40 A;  3GRD A;  2D1W A;  2QA4 3;  8RNT A;  3T8U A;  1X1Y A;  1LNH A;  1IV7 A;  3LXU X;  1IT7 A;  2P38 A;  3PCS A;  4X2H A;  3EE1 A;  3WMD A;  1ASK A;  1UCL A;  4XDV A;  5D81 A;  1R4C A;  2IY2 A;  2W03 A;  4N6L A;  2ZL8 A;  1ZGX A;  3GSP A;  1LQM B;  4PEJ A;  4RZM A;  1JKG B;  5D83 A;  6STD A;  1A2K A;  4WYK B;  3NBR A;  5CLK A;  3S67 A;  3FGY A;  1D6Z A;  3WHO A;  1GOU A;  1JN5 B;  2Z6B A;  4CJN A;  1NB5 I;  1I3I A;  3DGN A;  1VQ6 3;  1VQ9 3;  2GU1 A;  1O7W B;  4LSO A;  1BRN L;  3CPO A;  1N8R 4;  1UGI A;  3SYU A;  1ZO2 A;  2C10 A;  1YJN 3;  4O2H A;  3OXA A;  1A67 A;  1T2I A;  4XDW A;  1UI8 A;  1BSB A;  1VQ4 3;  1S5A A;  2K0M A;  1W7C A;  4HAA A;  1RN1 A;  3G6E 3;  3VF1 A;  4GL6 A;  2O9U X;  3RDE A;  1IVV A;  1O7G B;  1BNF A;  3B4P A;  4O02 B;  1DVC A;  2CW9 A;  3EB8 A;  4JRF A;  2ZA4 A;  3D4A A;  4EBG A;  3NV0 B;  2OTJ 3;  1NJI 4;  1VQ7 3;  3B7C A;  3CC2 3;  3U97 A;  3UJM A;  1QAK A;  4R9L A;  1E3R A;  1B27 A;  2GXF A;  4DKI A;  2CG0 A;  3EX9 A;  3UNL A;  1VQ8 3;  1M9G A;  2E2T A;  5IER A;  4EW5 A;  1I8V A;  7GSP A;  5BXQ A;  2A15 A;  2GBW B;  1G0T A;  4J5K A;  4WP5 A;  4I4K A;  1B2Z A;  1UUW B;  4O3V A;  2AAE A;  1JBS A;  4KFE A;  1VQ5 3;  3DY5 A;  2BHM A;  4L8P A;  2W2C A;  5AIH A;  3NM7 A;  1GS3 A;  3K0Z A;  2ZHX B;  1OH0 A;  4ILF A;  5KP3 A;  1B2S A;  1YVS A;  3PCR A;  2BMR B;  4MMZ B;  3D9R A;  4EV5 A;  3HK4 A;  3MSO A;  4OVM A;  2YX9 A;  3SED A;  2JQ5 A;  1EUI C;  2PNC A;  2STD A;  4KFF A;  4OK0 A;  4N3V A;  1W6C A;  2KAA A;  3LT8 A;  2MF7 A;  1EG9 B;  1ROV A;  2P05 A;  2ML5 A;  2W04 A;  4HKV B;  5AYS C;  1JBR A;  1D6Y A;  3GAX A;  4NHF A;  4WYK A;  3KE7 A;  3VSY A;  1ROA A;  4XBT A;  2WO0 A;  4AEQ A;  5JPU A;  1BVI A;  2F98 A;  4X2O A;  3MG2 A;  3GZY B;  1FGR A;  3X40 A;  3DXO A;  1TP6 A;  5A0O B;  1S72 3;  5IEP A;  1FGQ A;  3A5E A;  1GD4 A;  1SQW A;  1V58 A;  1B2X A;  1SJW A;  2UUG C;  4KVH A;  3MPH A;  3BIR A;  1W02 A;  4RNT A;  3FG3 A;  2CKF B;  4BTY A;  5G1K A;  4HM8 B;  1TRP A;  3JUQ A;  2HOH A;  5AEU B;  1RGF A;  1MGW A;  1I3F A;  1B3S A;  1FUT A;  2WGO A;  2F86 B;  3LTC A;  2SAR A;  1OF5 B;  3FG1 A;  4K1U A;  3DGL A;  3MG3 A;  5JBS A;  4K90 B;  1RRL A;  3NV0 A;  1BIR A;  2Q07 A;  3RNT A;  3OW2 2;  2PZV A;  2V1L A;  5FW5 A;  1JJ2 2;  3CD6 3;  3SXX A;  4FMA A;  3FF0 A;  1JB2 A;  2YFI B;  1Z1S A;  4G1M B;  3PS8 A;  3X42 A;  1QVF 2;  1BRG A;  1V74 A;  1UW1 A;  3V98 A;  1GY5 A;  2BMQ B;  1GY7 A;  1BAO A;  4N6V 0;  3HOH A;  5HGR A;  2P0M A;  1OPY A;  3MG1 A;  3QK9 A;  1FGO A;  5IG4 A;  1OCV A;  2L4V A;  1Q81 4;  1DE3 A;  1QAF A;  1WMP A;  4FR9 A;  3LZA A;  1LVN A;  1IVX A;  2H0H A;  2JDI H;  4HVN A;  3CCV 3;  1VQL 3;  1OAC A;  3F8X A;  4RNY A;  2W9P A;  5M1A A;  1SAR A;  3CXC 2;  5BVB A;  3BLZ A;  5BU4 A;  3G4S 3;  5GSP A;  3T8N A;  3LYG A;  4N6U A;  1RGK A;  5EEO A;  2Y73 A;  1X1X A;  1X1U A;  1BGS A;  3S27 A;  4NRE A;  1SII A;  1B20 A;  1ULJ B;  2SBL A;  5EVH A;  3CCL 3;  4HM3 B;  4HZ9 B;  1US1 A;  2XGL A;  1EQK A;  1BSE A;  1FA3 A;  2HMJ B;  4RNZ A;  3UB1 A;  4KZ1 A;  2E2U A;  1JBT A;  5LC6 A;  1LOX A;  1RCK A;  3NM2 A;  1N8Q A;  3S29 A;  3WDG B;  1QVG 2;  3KKG A;  1RGL A;  2UX0 A;  1UCJ A;  4EV2 A;  1BNS A;  2HMN B;  1Y4K A;  2HML B;  3WOE B;  2K54 A;  3D5I A;  3NX0 A;  1VQK 3;  1YNV X;  2F4Y A;  4OUQ A;  1K9M 4;  2RFR A;  3D79 A;  3TDG A;  2C11 A;  4HM0 B;  1RMS A;  2XGN A;  2CFD A;  3SX1 A;  1VZZ A;  4QWT A;  1I0V A;  1W2Z A;  4U13 A;  4EYC A;  1MNL A;  1KC8 4;  1RNT A;  1KD1 4;  1O7H B;  4ZM8 A;  3FG4 A;  1C7H A;  1NNV A;  5AI1 A;  5AEW B;  1W6G A;  1YHQ 3;  3ZG5 A;  4FCM A;  3DGM A;  5KP1 A;  2FNQ A;  2H0I A;  3LML A;  3KSE D;  1IYY A;  1RGA A;  1OF5 A;  1ZS7 A;  3EN8 A;  3FCS B;  1F8N A;  1YIJ 3;  4LEH A;  1ISK A;  4N6M A;  7RNT A;  1QMA A;  1UUG B;  2D42 A;  1BUJ A;  1AVK A;  1FGM A;  1UDI I;  3CNX A;  3J7Y d;  1BNR A;  1N5P A;  2KCD A;  4LGQ A;  2M7O A;  2OWP A;  4HM4 B;  3CC4 3;  1FUS A;  1BNI A;  2Y74 A;  1AR0 A;  4K61 A;  1IDP A;  2J8X B;  3BNB A;  2UGI A;  4BTX A;  1QJG A;  1W4N A;  4NPB A;  3JUO A;  1ZX2 A;  1G02 A;  3GWR A;  2OOV C;  3IJE B;  3QRD A;  3CCQ 3;  3EBY A;  1OGX A;  5ELU A;  1HU9 A;  1PY3 A;  2F5W A;  3K5T A;  4HM1 B;  4KFD A;  1WMN A;  1RGG A;  5RNT A;  5IG5 A;  2BMO B;  2HMM B;  1EKM A;  3DMC A;  2I9W A;  2LYX A;  4HBR A;  4KT3 B;  1Q86 4;  2Z77 A;  1IQX A;  4BU4 A;  1TIJ A;  1GY6 A;  3B8L A;  5DRV A;  1A2V A;  3G8Z A;  2XEP A;  8CHO A;  3I0Y A;  1W6Y A;  4BL2 A;  4IPB A;  5IG0 A;  1AY7 A;  1FGT A;  5M18 A;  4MMX B;  1C54 A;  1GOY A;  3AMO B;  3LH4 A;  5IF6 A;  5IG3 A;  1TRQ A;  2IYJ A;  2OQE C;  3PYJ A;  4RBN A;  1DMQ A;  2C4B A;  2CX1 A;  3F40 A;  3LOY A;  5DRE A;  1MWU A;  1IQY A;  2RSX A;  1VQO 3;  1M90 4;  4N6O B;  1BAN A;  2KXG A;  1TFK A;  3EBT A;  2RBI A;  3ER7 A;  4JF8 A;  1UI7 A;  3LT9 A;  1MWR A;  1TTO A;  1IVW A;  4FMB A;  4GSP A;  6RNT A;  4GB5 A;  2P09 A;  3AGN A;  3OWS A;  3FSD A;  4R80 A;  1UUV B;  1WQL B;  2KF5 A;  1B2U A;  3NXJ A;  4FMD A;  5IEN A;  4STD A;  1RN4 A;  2B24 B;  1LOW A;  1RJO A;  4H61 A;  1K41 A;  1YGE A;  3EQQ B;  4AKZ A;  1PU4 A;  1N9E A;  1DVD A;  3SOY A;  1IV9 A;  1SPU A;  4WHA A;  1MOL A;  2XSH B;  4FCJ A;  1CH0 A;  1MWT A;  3N8B A;  1LNI A;  2E2V A;  2F56 A;  1Q82 4;  1NDO B;  3F7S A;  1I0X A;  1HYF A;  2XFT A;  2R4I A;  5TGN A;  2L1S A;  2CWU A;  3NQY A;  3SVA A;  2OTL 3;  2CWV A;  3N9H A;  1LOV A;  1BOX A;  2P0X A;  3BNE A;  3UL5 A;  1TJD A;  2Z76 A;  4XM4 A;  1E97 A;  3Q90 A;  1GMP A;  3URP A;  4LMI A;  4IIA A;  1RTU A;  3KFQ C;  1L5G B;  1CYU A;  1BNE A;  1YJ9 3;  3CNM A;  4J8T A;  3M8C A;  3FLJ A;  3JVC A;  3KCH A;  3WA3 A;  2CFK A;  4MJD A;  1Q7Y 4;  2FGT A;  1BSA A;  4BTW A;  3FF2 A;  2KRT A;  2CFW A;  5CK6 A;  1I2G A;  3S5C A;  3I56 3;  1X1W A;  1B2M A;  2OOV A;  1G96 A;  2RCD A;  3K63 A;  3ECF A;  3EHC A;  1RGC A;  1N9J A;  3ZFZ A;  1VQQ A;  4HZB B;  2WGQ A;  1O7P B;  3F9S A;  3AMO A;  1VQP 3;  1W5Z A;  3F7X A;  1TU5 A;  3RGR A;  1KQS 2;  4FCZ A;  3F14 A;  3SLU A;  1O7M B;  5CF1 A;  4HM2 B;  2CFL A;  1FZU A;  3KN4 A;  1HZ1 A;  2IUJ A;  3X3X A;  1AQZ A;  1TUH A;  2HMK B;  1T5Y A;  4MEI A;  3S28 A;  4J5G A;  2OQE A;  2INX A;  1IT8 A;  1DYU A;  1K73 4;  4I5Q A;  3U1W A;  1E3V A;  4H3U A;  1IQ8 A;  3FKA A;  1OUN A;  1IVU A;  2RNT A;  3BND A;  1RHL A;  1N5H A;  1KWI A;  1WMO A;  2W6J H;  2Z7A A;  3V99 A;  1OHO A;  4AKY A;  1K28 A;  3MYT A;  4HM6 B;  2WOF A;  1T2H A;  3K9M C;  3AGO A;  3CCU 3;  3G16 A;  1BSC A;  2W0Q A;  4LYL B;  1MWS A;  3LTB A;  2GSP A;  4R9K A;  5FGO A;  2OCT A;  3WR2 A;  9RNT A;  4IT7 A;  2QEX 3;  2WOH A;  4L7K A;  5AIF A;  3VGN A;  3UL6 A;  1UCK A;  2LQV A;  2XF3 A;  3HI7 A;  1NO3 A;  3CME 3;  3EJV A;  4J9A A;  3DGY A;  1RKY A;  1NB3 I;  1JV2 B;  2R41 A;  2CX0 A;  1BSD A;  3OWU A;  1WNH A;  2CC3 A;  2F5M A;  3D3L A;  4HM7 B;  5ELJ A;  3DGO A;  3PGB A;  5AII A;  3A76 A;  2KF3 A;  1A2P A;  5IEO A;  3X41 A;  5CXO A;  1U5O A;  3IMA B;  1BRS A;  2XR8 B;  1BRI A;  1SIH A;  2IMJ A;  3HZP A;  2CWT A;  1EA2 A;  3LTA A;  1QAL A;  1BNJ A;  1W01 A;  2BO9 B;  3NHX A;  1RGE A;  2GEY A;  1ULI B;  3BU4 A;  3G0K A;  3JUM A;  5HOH A;  5D82 A;  1K8A 4;  2W56 B;  3B4O A;  1I70 A;  3GZX B;  3L0R A;  1PYL A;  3T0U A;  4HJL B;  2O3O A;  3GZB A;  3O8Y A;  5AIG A;  5AYR B;  1CQS A;  4XB5 A;  3RGA A;  3Q3F A;  3DH2 A;  3H51 A;  3MHE A;  1W00 A;  5M19 A;  1Q7H A;  1JNQ A;  3AHS A;  2BNG A;  1OHP A;  3BNC A;  3ZG0 A;  5EQL A;  2CH9 A;  1RSN A;  4TX4 A;  1BUQ A;  4XBX A;  1AV4 A;  1NU3 A;  1Q9E A;  4EXR A;  2ML6 A;  4K1V A;  3BB9 A;  1GMR A;  1BNG A;  1JZD A;  1JRQ A;  3WOF B;  3CU3 A;  1EEJ A;  3CC7 3;  3I55 3;  1VQM 3;  4N6N B;  1JB4 A;  3EN1 B;  2QGU A;  2ZDJ A;  1I2E A;  4MMY B;  1A90 A;  3KII A;  3OWY A;  3CCJ 3;  1LXE A;  1GMQ A;  1RNB A;  3PXM A;  4Q53 A;  1GD3 A;  3X3Z A;  4FMC A;  3Q1C A;  4CCV A;  3KZT A;  3STD A;  4CPK A;  1BRK A;  1BU4 A;  2BT3 A;  1YIT 3;  3MWZ A;  4N6T A;  1T3B A;  1YJW 3;  3F8H A;  5LC7 A;  3V92 A;  1JB5 A;  5G1L A;  3DM8 A;  1Q40 B;  3HX8 A;  5BIR A;  1V57 A;  3FH1 A;  4R1K A;  2AAD A;  2F99 A;  2XFS A;  1LOY A;  2YFJ B;  3NBJ A;  3NQZ A;  3CMA 3;  1TFO A;  3CCR 3;  2KF4 A;  1JKG A;  1LQG C;  1STD A;  7STD A;  3DZL A;  2QIY A;  5KP4 A;  1RN7 A;  3WOD G;  1RCL A;  3E99 A;  1FW7 A;  1HKX A;  4GHO A;  4WFO A;  2GU3 A;  2MC8 A;  3EC9 A;  1OHS A;  1JN5 A;  1WTH A;  2RGQ A;  3AHW A;  2CFG A;  2W9Q A;  2BIR A;  1FUW A;  3ROB A;  1YI2 3;  3K7C A;  2XSO B;  2GBX B;  2YFL B;  1U8C B;  4HOH A; 
#chains in the Genus database with same CATH homology
 3GZR A;  1W2B 2;  1NWW A;  3PZW A;  3CCM 3;  2GEX A;  3DUK A;  5STD A;  2CG1 A;  3MKI A;  3KSP A;  2CK3 H;  3IPT A;  4LZI A;  4XBY A;  5G2G A;  2CIU A;  3H3H A;  3OV4 A;  1CEW I;  3WA2 X;  2W56 A;  3HIG A;  2XRX B;  1M1K 4;  1DMM A;  2IA7 A;  3EF8 A;  5JPP A;  3JUN A;  1Q42 A;  1D6U A;  1OGZ A;  3ALA A;  3SOA A;  1AVL A;  1CYV A;  3NBB A;  3G71 3;  4HM5 B;  1RRH A;  3X3Y A;  5I97 A;  2XH9 A;  3FZW A;  3HII A;  4HYZ A;  4EC6 A;  3NUV A;  1IK3 A;  1PFP A;  2FXT A;  2HMO B;  3N54 B;  2IUK A;  5IW9 A;  2CHC A;  1DMN A;  3OX9 A;  1IU7 A;  1O7N B;  1STF I;  3Q2P A;  1VQN 3;  1KSI A;  3JUP A;  1J2B A;  5CF2 A;  1GYB A;  3LTD A;  4L8O A;  3CCS 3;  1YVB I;  4R4K A;  3CPW 2;  1M1X B;  4O8S A;  2B1X B;  4WWU C;  3CCE 3;  4ORL A;  4CDL A;  1Q40 A;  3GRD A;  2D1W A;  2QA4 3;  3T8U A;  1LNH A;  1IV7 A;  3LXU X;  1IT7 A;  2P38 A;  3PCS A;  4X2H A;  3EE1 A;  3WMD A;  1ASK A;  4XDV A;  5D81 A;  1R4C A;  2W03 A;  4N6L A;  2ZL8 A;  4PEJ A;  4RZM A;  1JKG B;  5D83 A;  6STD A;  1A2K A;  4WYK B;  3NBR A;  5CLK A;  3S67 A;  3FGY A;  1D6Z A;  1JN5 B;  2Z6B A;  1NB5 I;  3DGN A;  1VQ6 3;  1VQ9 3;  2GU1 A;  1O7W B;  4LSO A;  3CPO A;  1N8R 4;  1ZO2 A;  2C10 A;  1YJN 3;  4O2H A;  3OXA A;  1A67 A;  4XDW A;  1UI8 A;  1VQ4 3;  1S5A A;  2K0M A;  1W7C A;  3G6E 3;  3VF1 A;  4GL6 A;  2O9U X;  3RDE A;  1IVV A;  1O7G B;  3B4P A;  4O02 B;  1DVC A;  2CW9 A;  3EB8 A;  4JRF A;  4EBG A;  3NV0 B;  2OTJ 3;  1NJI 4;  1VQ7 3;  3B7C A;  3CC2 3;  3U97 A;  3UJM A;  1QAK A;  4R9L A;  1E3R A;  2GXF A;  2CG0 A;  3EX9 A;  3UNL A;  1VQ8 3;  1M9G A;  2E2T A;  5IER A;  5BXQ A;  2A15 A;  2GBW B;  4WP5 A;  4I4K A;  1UUW B;  4O3V A;  4KFE A;  1VQ5 3;  3DY5 A;  2BHM A;  4L8P A;  2W2C A;  5AIH A;  3NM7 A;  1GS3 A;  3K0Z A;  1OH0 A;  5KP3 A;  3PCR A;  4MMZ B;  2BMR B;  3D9R A;  4EV5 A;  3HK4 A;  3MSO A;  4OVM A;  2YX9 A;  3SED A;  2JQ5 A;  2STD A;  2PNC A;  4KFF A;  4OK0 A;  4N3V A;  1W6C A;  3LT8 A;  2MF7 A;  1EG9 B;  1ROV A;  2W04 A;  2ML5 A;  2P05 A;  4HKV B;  5AYS C;  1D6Y A;  3GAX A;  4NHF A;  4WYK A;  3KE7 A;  3VSY A;  1ROA A;  4XBT A;  2WO0 A;  4AEQ A;  5JPU A;  2F98 A;  4X2O A;  3MG2 A;  3GZY B;  1FGR A;  3X40 A;  3DXO A;  1TP6 A;  5A0O B;  1S72 3;  5IEP A;  1FGQ A;  1GD4 A;  1SQW A;  1SJW A;  4KVH A;  3MPH A;  1W02 A;  4BTY A;  3FG3 A;  2CKF B;  4HM8 B;  3JUQ A;  5AEU B;  3LTC A;  2WGO A;  2F86 B;  3FG1 A;  1OF5 B;  4K1U A;  3DGL A;  3MG3 A;  5JBS A;  4K90 B;  1RRL A;  3NV0 A;  2Q07 A;  3OW2 2;  2PZV A;  2V1L A;  5FW5 A;  1JJ2 2;  3CD6 3;  3SXX A;  4FMA A;  3FF0 A;  1JB2 A;  2YFI B;  1Z1S A;  4G1M B;  3PS8 A;  3X42 A;  1QVF 2;  1V74 A;  1UW1 A;  3V98 A;  1GY5 A;  2BMQ B;  1GY7 A;  4N6V 0;  5HGR A;  2P0M A;  1OPY A;  3MG1 A;  3QK9 A;  1FGO A;  5IG4 A;  1OCV A;  2L4V A;  1Q81 4;  1QAF A;  1WMP A;  4FR9 A;  3LZA A;  1LVN A;  1IVX A;  2JDI H;  4HVN A;  3CCV 3;  1VQL 3;  1OAC A;  3F8X A;  4RNY A;  2W9P A;  3CXC 2;  5BVB A;  3BLZ A;  3G4S 3;  3T8N A;  3LYG A;  4N6U A;  5EEO A;  2Y73 A;  3S27 A;  4NRE A;  1SII A;  1ULJ B;  2SBL A;  5EVH A;  3CCL 3;  4HM3 B;  4HZ9 B;  1US1 A;  2XGL A;  1EQK A;  1FA3 A;  2HMJ B;  4RNZ A;  3UB1 A;  4KZ1 A;  2E2U A;  5LC6 A;  1LOX A;  3NM2 A;  1QVG 2;  1N8Q A;  3S29 A;  3WDG B;  3KKG A;  4EV2 A;  2UX0 A;  3CC4 3;  2HMN B;  1VQK 3;  1Y4K A;  2HML B;  3WOE B;  2K54 A;  3NX0 A;  4OUQ A;  1K9M 4;  2RFR A;  3TDG A;  2C11 A;  4HM0 B;  2XGN A;  2CFD A;  3SX1 A;  1VZZ A;  4QWT A;  1W2Z A;  4U13 A;  4EYC A;  1MNL A;  1KC8 4;  1KD1 4;  1O7H B;  4ZM8 A;  3FG4 A;  1C7H A;  5AI1 A;  5AEW B;  1YHQ 3;  1W6G A;  4FCM A;  3DGM A;  5KP1 A;  2FNQ A;  3LML A;  3KSE D;  1OF5 A;  1YIJ 3;  3EN8 A;  3FCS B;  1F8N A;  4LEH A;  1ISK A;  4N6M A;  1QMA A;  2D42 A;  1AVK A;  1FGM A;  3CNX A;  3J7Y d;  1N5P A;  2KCD A;  4LGQ A;  2M7O A;  2OWP A;  4HM4 B;  2Y74 A;  4K61 A;  1AR0 A;  1IDP A;  3BNB A;  4BTX A;  1QJG A;  1W4N A;  3JUO A;  1ZX2 A;  3IJE B;  3GWR A;  2OOV C;  3QRD A;  3CCQ 3;  3EBY A;  1OGX A;  5ELU A;  1HU9 A;  3K5T A;  4HM1 B;  4KFD A;  1WMN A;  5IG5 A;  2BMO B;  2HMM B;  1EKM A;  3DMC A;  2I9W A;  2LYX A;  4HBR A;  1Q86 4;  2Z77 A;  1IQX A;  1TIJ A;  1GY6 A;  3B8L A;  5DRV A;  1A2V A;  3G8Z A;  2XEP A;  8CHO A;  3I0Y A;  1W6Y A;  4IPB A;  5IG0 A;  1FGT A;  4MMX B;  3AMO B;  5IF6 A;  3LH4 A;  5IG3 A;  2OQE C;  3PYJ A;  4RBN A;  1DMQ A;  3F40 A;  3LOY A;  5DRE A;  1VQO 3;  1IQY A;  2RSX A;  1M90 4;  4N6O B;  2KXG A;  1TFK A;  3EBT A;  3ER7 A;  4JF8 A;  1UI7 A;  3LT9 A;  4FMB A;  1IVW A;  4GB5 A;  2P09 A;  4R80 A;  3OWS A;  3FSD A;  1UUV B;  1WQL B;  3NXJ A;  4FMD A;  5IEN A;  4STD A;  2B24 B;  1RJO A;  4H61 A;  1PU4 A;  1K41 A;  1YGE A;  3EQQ B;  4AKZ A;  1N9E A;  1DVD A;  3SOY A;  1IV9 A;  1SPU A;  4WHA A;  1MOL A;  2XSH B;  4FCJ A;  3N8B A;  2E2V A;  1Q82 4;  1NDO B;  3F7S A;  2XFT A;  2R4I A;  5TGN A;  2CWU A;  3NQY A;  3SVA A;  2OTL 3;  2CWV A;  3N9H A;  2P0X A;  3BNE A;  3UL5 A;  2Z76 A;  4XM4 A;  1E97 A;  3Q90 A;  4LMI A;  4IIA A;  3KFQ C;  1L5G B;  1CYU A;  1YJ9 3;  3CNM A;  4J8T A;  3M8C A;  3FLJ A;  3JVC A;  3WA3 A;  2CFK A;  4MJD A;  1Q7Y 4;  2FGT A;  4BTW A;  3FF2 A;  2KRT A;  2CFW A;  5CK6 A;  3S5C A;  3I56 3;  2OOV A;  1G96 A;  2RCD A;  3K63 A;  3ECF A;  3EHC A;  1N9J A;  4HZB B;  2WGQ A;  1O7P B;  3F9S A;  3AMO A;  1VQP 3;  1W5Z A;  3F7X A;  1TU5 A;  3RGR A;  1KQS 2;  4FCZ A;  3F14 A;  3SLU A;  1O7M B;  5CF1 A;  4HM2 B;  2CFL A;  3KN4 A;  2IUJ A;  3X3X A;  1TUH A;  2HMK B;  1T5Y A;  4MEI A;  3S28 A;  2OQE A;  2INX A;  1IT8 A;  1DYU A;  1K73 4;  3U1W A;  1E3V A;  4H3U A;  1IQ8 A;  3FKA A;  1OUN A;  1IVU A;  3BND A;  1N5H A;  1KWI A;  1WMO A;  2W6J H;  2Z7A A;  3V99 A;  1OHO A;  4AKY A;  1K28 A;  3MYT A;  4HM6 B;  2WOF A;  3K9M C;  3CCU 3;  3G16 A;  2W0Q A;  4R9K A;  3LTB A;  5FGO A;  2OCT A;  4IT7 A;  2QEX 3;  2WOH A;  4L7K A;  5AIF A;  3VGN A;  3UL6 A;  2LQV A;  2XF3 A;  3HI7 A;  1NO3 A;  3CME 3;  3EJV A;  4J9A A;  1RKY A;  1NB3 I;  1JV2 B;  3OWU A;  1WNH A;  2CC3 A;  4HM7 B;  3D3L A;  5ELJ A;  3DGO A;  3PGB A;  5AII A;  3A76 A;  5IEO A;  3X41 A;  5CXO A;  1U5O A;  3IMA B;  2XR8 B;  1SIH A;  2IMJ A;  3HZP A;  2CWT A;  1EA2 A;  3LTA A;  1QAL A;  2BO9 B;  1W01 A;  3NHX A;  2GEY A;  1ULI B;  3G0K A;  3JUM A;  5D82 A;  1K8A 4;  2W56 B;  3B4O A;  3L0R A;  3GZX B;  3T0U A;  4HJL B;  2O3O A;  3GZB A;  3O8Y A;  5AIG A;  5AYR B;  1CQS A;  4XB5 A;  3RGA A;  3H51 A;  3MHE A;  1W00 A;  1JNQ A;  3BNC A;  2BNG A;  1OHP A;  5EQL A;  2CH9 A;  4TX4 A;  1BUQ A;  4XBX A;  1AV4 A;  1NU3 A;  4EXR A;  2ML6 A;  4K1V A;  3BB9 A;  1JRQ A;  3WOF B;  3CU3 A;  3CC7 3;  1VQM 3;  3I55 3;  4N6N B;  1JB4 A;  3EN1 B;  2QGU A;  2ZDJ A;  4MMY B;  1A90 A;  3KII A;  3OWY A;  3CCJ 3;  1LXE A;  3PXM A;  4Q53 A;  1GD3 A;  3X3Z A;  4FMC A;  3Q1C A;  4CCV A;  3KZT A;  3STD A;  1YJW 3;  1YIT 3;  2BT3 A;  3MWZ A;  4N6T A;  3F8H A;  5LC7 A;  3V92 A;  1JB5 A;  3DM8 A;  1Q40 B;  3HX8 A;  3FH1 A;  4R1K A;  2F99 A;  3NQZ A;  2XFS A;  3NBJ A;  2YFJ B;  3CMA 3;  1TFO A;  3CCR 3;  1JKG A;  1STD A;  7STD A;  3DZL A;  2QIY A;  5KP4 A;  1RN7 A;  3WOD G;  3E99 A;  1HKX A;  4WFO A;  2GU3 A;  2MC8 A;  3EC9 A;  1OHS A;  1JN5 A;  1WTH A;  2RGQ A;  2CFG A;  2W9Q A;  1FUW A;  3ROB A;  1YI2 3;  3K7C A;  2XSO B;  2GBX B;  2YFL B;  1U8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...