3CCM3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccm300
1Q814 3CD63 1KD14 3CCQ3 1W2B2 1N8R4 1M1K4 1VQ43 1JJ22 1YJN3 1KQS2 3G4S3 3CC23 1Q824 1YIJ3 1VQP3 3CCM3 1K734 1K9M4 3CMA3 1QVG2 1VQM3 1VQN3 1VQ73 3CCU3 3I553 3CPW2 1VQL3 1VQ93 3CCE3 1YIT3 1VQ53 1M904 1VQK3 1VQ83 2OTL3 1S723 1YJ93 3CCR3 3CC43 2OTJ3 1NJI4 1KC84 3CCS3 3CXC2 1VQO3 3CCV3 2QEX3 3G6E3 1Q864 3CC73 3OW22 1YI23 3I563 3CCL3 2QA43 3G713 1YJW3 3CME3 1YHQ3 1Q7Y4 1VQ63 1K8A4 3CCJ3 1QVF2
chains in the Genus database with same CATH superfamily
4LMIA 2HMOB 4HM1B 4K1UA 3DM8A 1M1K4 4HM2B 8CHOA 1YJN3 3KKGA 1Q824 4AKZA 4GSPA 2CG0A 1GD3A 1QALA 1ZS7A 4QWTA 4EV2A 1V74A 3D9RA 1X1WA 4LGQA 3AMOA 1JV2B 3ER7A 1RRLA 3FG3A 4WYKA 5JBSA 3CCR3 3TDGA 2UUGC 1MOLA 4HZ9B 3SX1A 1MWRA 1UCKA 3RDEA 2XH9A 2XF3A 5AI1A 1WNHA 4ILFA 1BAOA 3FLJA 2Y74A 1I2EA 3Q2PA 1LQGC 4N6LA 1O7PB 2P05A 3CCJ3 5GSPA 1G0TA 1JBTA 3SYUA 2GSPA 3WHOA 3GZYB 1MWTA 1SIIA 1CEWI 1WMPA 2W56A 3MHEA 1MGWA 3MG2A 1K9M4 3A76A 3FCSB 1IV9A 5CF2A 1GMQA 3MYTA 1L5GB 2OOVA 5IEPA 1IDPA 1U8CB 3F7SA 6GSPA 5AIGA 4BIRA 1GOVA 3KN4A 3KZTA 2IUJA 1N9JA 1GSPA 1I0VA 2CFWA 2O3OA 1NWWA 2BO9B 3WA2X 2AADA 1BNRA 4FCJA 3OV4A 2ML6A 5AIHA 2CWTA 1UCIA 2B24B 2OCTA 2C10A 1CH0A 1NDOB 3V99A 1QJGA 2HMJB 2W04A 3Q3FA 4RNTA 2JDIH 4DKIA 2CIUA 4EBGA 3PGBA 3SVAA 3GAXA 3GWRA 1GMPA 3BU4A 1T5YA 1BRSA 3DGLA 5AEWB 4R1KA 4K1VA 3NQYA 3H3HA 1K28A 1LNIA 1B2UA 3GSPA 4KFEA 1LOVA 1OUNA 3A5EA 2YFIB 2GU3A 4EC6A 2R4IA 3F8XA 3X3XA 3IMAB 2GEYA 1VZZA 2KF5A 2KAAA 5AEUB 1YJW3 5IG0A 3WA3A 1GMRA 2F5MA 3JUNA 3KSPA 5M1AA 1IYYA 3DMCA 1SJWA 2V1LA 3X3YA 3UL5A 3OX9A 1QVF2 1LOYA 1UI8A 1V57A 3B4OA 3N9HA 1UUVB 3RGAA 1IVWA 1O7HB 2CFDA 3NV0A 5IEOA 3ZG0A 4KZ1A 1OHSA 5JPPA 3PCSA 3CCM3 1W01A 4XDWA 4HM7B 4WYKB 3AMOB 1D6ZA 1GY5A 3EJVA 4XDVA 1R4YA 2BIRA 2CH9A 2D42A 3CC43 2L1SA 3LTDA 2OTJ3 2W6JH 1ROVA 2XGLA 2MC8A 3CNMA 4CPKA 5AIFA 1VQO3 4I4KA 1WQLB 2KF3A 1TUHA 4EXRA 1J2BA 3G8ZA 2PNCA 5EQLA 3K63A 2WGQA 5D83A 4HZBB 1DVCA 5G2GA 2W56B 1LNHA 1GYBA 3LT8A 4NHFA 3WOFB 3S27A 1PYLA 3LTBA 3EX9A 1ULJB 2O9UX 1JN5A 2YFJB 1E3VA 1EG9B 2WGOA 3LT9A 1MGRA 1YGWA 3MG3A 1VQ73 2W9QA 3NBRA 3F40A 3F14A 1VQ93 3ZFZA 3KSED 3UL6A 3X40A 3KCHA 1BNSA 4JRFA 1KC84 1AR0A 1QMAA 1TFOA 2IUKA 1LQMB 4JF8A 4XB5A 1RGFA 5BU4A 3EBTA 2HOHA 1BRKA 1HYFA 4FMBA 1O7GB 1RN7A 2K0MA 2UGIA 3HX8A 1VQ63 1BUQA 2PZVA 1I2GA 1IK3A 3WR2A 2FGTA 5IG3A 1I3FA 3OXAA 3CCQ3 2IA7A 1RGKA 1B3SA 1BNGA 2R41A 4OK0A 3SOAA 3BLZA 3CC23 3WOEB 5RNTA 1S5AA 2E2TA 3EE1A 2CX1A 1RJOA 4AKYA 1FW7A 4HM0B 3U97A 1BSBA 1PFPA 4WFOA 1A90A 5EEOA 4FCMA 1ASKA 1DVDA 1TTOA 1BRGA 1RGEA 2OWPA 5IF6A 4R9LA 3NUVA 2QEX3 3FH1A 1SARA 5CF1A 4O02B 5FW5A 2W9PA 1DMQA 1ZGXA 4CJNA 4EYCA 5LC6A 1OCVA 3DGMA 3N8BA 3CME3 1YHQ3 1K8A4 1AY7A 3G0KA 4RNYA 3MWZA 1ZX2A 2CKFB 1YVBI 3NV0B 1KD14 1OF5A 2LQVA 2Y73A 1BRHA 2CG1A 5TGNA 1MWUA 1OGXA 3RGRA 4CDLA 1IVVA 4N6OB 4OUQA 1KQS2 2C11A 5JPUA 3K0ZA 1ZO2A 2F5WA 3O8YA 4NREA 1MWSA 4PEJA 4N6NB 4BTYA 1VQN3 1UGHI 1D6UA 2ZDJA 3CPOA 3OWUA 4LZIA 1EEJA 5D82A 1AVKA 2IYJA 1YIT3 1CYVA 3CNXA 1N5HA 2K3DA 3MKIA 3D79A 3DZLA 4KVHA 3JUQA 2MF7A 1NJI4 3MG1A 1STDA 5IERA 1BRNL 4HKVB 2L4VA 1JZDA 3B7CA 3CCL3 3LMLA 3LOYA 3JUOA 2OQEC 5HGRA 1PU4A 1K41A 1JB5A 2BMRB 2W2CA 1LOWA 3EC9A 3SLUA 1Q9EA 1JN5B 3B8LA 1GOUA 1N9EA 3S29A 1W00A 2WO0A 3FF2A 5IENA 2J8XB 3CMA3 2CW9A 3EQQB 4IPBA 4KFDA 4AEQA 1A2VA 4MMYB 1RNBA 1BSAA 1C7HA 3BNDA 1GD4A 2K54A 4HM6B 4BU4A 1W6GA 1M904 1DYUA 1IVUA 5G1KA 3GZBA 2P0MA 3LTCA 1ISKA 4LEHA 1JKGA 3FG4A 1O7MB 4LSOA 4WP5A 3J7Yd 1OACA 3PCRA 1NO3A 3G713 4J5KA 2BNGA 2XSHB 1BSEA 1EA2A 4K61A 5ELJA 1BANA 1FUWA 1I2FA 1RLSA 3DY5A 4I5QA 4GHOA 1N8R4 2W0QA 3BNCA 2I9WA 1TIJA 4BL3A 1SPUA 2YX9A 2RCDA 2CHCA 4L7KA 1IT7A 1YIJ3 4WHAA 1D6YA 5STDA 1W2ZA 4H61A 1R4CA 3I553 2GBXB 4HVNA 2OTL3 1NNVA 2XSOB 4HBRA 3WMDA 1BOXA 4FR9A 4ZM8A 1IT8A 1UI7A 4XM4A 1RDSA 2CFGA 2QGUA 3JVCA 4R80A 1JBRA 1SIHA 1WTHA 5IW9A 1Q864 1RGGA 1GY6A 1W02A 1O7WB 2ZA4A 5FGOA 4MJDA 3DGYA 1BSDA 3NBBA 2E2UA 1OF5B 1I3IA 1W6CA 3WODG 1A2KA 2CX0A 1SQWA 3D3LA 2XFTA 1I0XA 3NQZA 3K5TA 1BNIA 1GY7A 1JRQA 2KF6A 2P38A 4LYLB 1RGLA 4EW5A 2CWVA 1QAFA 2B1XB 5KP1A 1VQP3 1K734 1I8VA 4X2OA 1BSCA 1RSNA 1B2ZA 2ZL8A 1CYUA 2FNQA 3M8CA 5DREA 4J8TA 3H51A 3K9MC 3CXC2 1JB2A 2GBWB 1Q42A 1OHPA 1Q40A 3NX0A 1WMNA 3RNTA 1FA3A 1FGMA 2KF4A 1LOXA 1RN1A 4NPBA 4ORLA 5G1LA 1OGZA 2P09A 3KIIA 1A67A 3EN8A 1BGSA 2INXA 3PYJA 4MMZB 3S67A 4RZMA 2HMKB 1E3RA 3HI7A 3E99A 4O8SA 5AYRB 1GOYA 4EV5A 8RNTA 2GEXA 3STDA 1DMMA 1ULIB 2Z7AA 4FMAA 6STDA 1DE3A 1LXEA 4N6UA 3OWSA 2YFLB 1T2HA 4L8OA 1JBSA 4HM3B 3DH2A 1EKMA 2KCDA 2SBLA 2QIYA 5A0OB 1UGIA 5DRVA 2C4BA 1RGHA 2GXFA 3X42A 1OH0A 1RGAA 2BMQB 1BNFA 2CK3H 5AIIA 4XBXA 2IY2A 1JKGB 1T2IA 2Z6BA 3B4PA 3AGOA 1IVXA 3DXOA 3EHCA 3SXXA 2RGQA 1UUWB 3DUKA 4FMDA 4J5GA 4N6MA 2XFSA 3BNEA 4IIAA 4HOHA 3SOYA 1B2MA 4HAAA 5ELUA 3CCV3 4X2HA 7RNTA 1WMOA 3SEDA 5LC7A 1UCJA 1OHOA 5KP4A 4J9AA 2STDA 4KFFA 1Q7Y4 1TFKA 4HM4B 4TX4A 3EF8A 2CWUA 2CFKA 4L8PA 3GZRA 1NB5I 4BL2A 5D81A 3AGNA 1DMNA 1EUIC 1W2B2 2H0IA 1VQ43 2OOVC 3S5CA 1X1XA 1B2XA 1FUTA 3VF1A 7GSPA 2XRXB 2IMJA 3VGNA 4U13A 3VSYA 2D1WA 3V98A 1F8NA 2M7OA 1RMSA 1FYSA 2Z76A 3D5GA 3IJEB 1DETA 1RCLA 5AYSC 2RBIA 1U5OA 1UDII 3EB8A 5BXQA 1T3BA 3FKAA 3K7CA 1KWIA 3GRDA 3CC73 3OW22 3KE7A 2HMLB 2Z77A 4N3VA 3HK4A 1QAKA 4K90B 1RTUA 3F8HA 1BVIA 1B20A 1RRHA 3D4AA 3UB1A 3LXUX 3UJMA 1BNJA 3Q90A 4KT3B 4Q53A 2BHMA 3BB9A 1HKXA 2WOFA 2KRTA 3HOHA 3QRDA 4HJLB 3V92A 1ROAA 1US1A 1UW1A 1N8QA 1MNLA 1W7CA 1EQKA 3IPTA 3NM7A 1GS3A 3Q1CA 4HM8B 1Z1SA 1W4NA 1FUSA 1IU7A 1X1UA 3EN1B 5M19A 3CPW2 3L0RA 4R4KA 3HIIA 3N54B 3T8UA 1V58A 1YVSA 4O3VA 6RNTA 1BRIA 1Q40B 2FXTA 2UX0A 1W5ZA 1G96A 5M18A 3LZAA 1E97A 1UCLA 1Q814 1YI23 5BIRA 5EVHA 1RN4A 1LRAA 1X1YA 3ROBA 3FGYA 2F56A 3OWYA 1VQQA 2ZHXB 1JNQA 3NM2A 3S28A 3CD63 1LVNA 1BRJA 2OQEA 4IT7A 1RNTA 1JJ22 1BIRA 2RSXA 1YGEA 1B27A 1BUJA 1AVLA 4XBTA 2HMMB 1VQM3 3MPHA 4BTXA 3NBJA 1FZUA 1O7NB 4R9KA 3CCU3 5I97A 1HZ1A 3WDGB 1IQ8A 2Q07A 1S723 3AHSA 1G02A 3JUPA 3PZWA 9RNTA 1B21A 3UNLA 5CLKA 3FZWA 4CCVA 3FSDA 1FGOA 1I70A 4O2HA 1RKYA 3CCS3 1M1XB 3LH4A 2LYXA 1TRPA 3ECFA 3I563 3T8NA 2QA43 3X3ZA 3BIRA 4H3UA 1TRQA 1UUGB 2WOHA 3PXMA 1W6YA 2BT3A 2W03A 1TU5A 3G4S3 3F7XA 3LTAA 3DGNA 3F9SA 3MSOA 1Q7HA 1QVG2 5KP3A 3ALAA 4FCZA 4FMCA 3DGOA 1VQL3 1N5PA 1VQ53 1IQXA 2XR8B 4GB5A 3T0UA 1KSIA 1VQK3 1VQ83 2CFLA 2F86B 3BNBA 3QK9A 3AHWA 3GZXB 3LYGA 2H0GA 1AV4A 1TP6A 2XGNA 2BU4A 1AQZA 4MEIA 2RFRA 2ML5A 3HIGA 4RBNA 3X41A 2F4YA 4N6V0 1CQSA 2GU1A 1RGCA 2JQ5A 3NHXA 3NXJA 4BTWA 1PY3A 1IQYA 3URPA 1NU3A 3G6E3 1A2PA 3PS8A 5CK6A 3ZG5A 1OPYA 1FGQA 3JUMA 4RNZA 2P0XA 5IG4A 1HU9A 5IG5A 4HM5B 1FGRA 2A15A 1Y4KA 1NB3I 1TJDA 2F98A 3CU3A 2F99A 2SARA 4GL6A 3CCE3 2HMNB 3G16A 7STDA 2XEPA 4WWUC 3HZPA 1BU4A 1YJ93 2CC3A 1JZOA 3U1WA 1M9GA 3FF0A 5CXOA 4XBYA 1RHLA 2AAEA 5HOHA 2H0HA 1JB4A 3FG1A 1C54A 1RCKA 4MMXB 2RNTA 2E2VA 3I0YA 1B2SA 1YNVX 2BMOB 3D5IA 1FGTA 3EBYA 3KFQC 4N6TA 4OVMA 4STDA 1STFI 4G1MB 4HYZA 2KXGA 5BVBA 1IV7A 1BNEA
chains in the Genus database with same CATH topology
4LMIA 2HMOB 4HM1B 4K1UA 3DM8A 1M1K4 4HM2B 8CHOA 1YJN3 3KKGA 1Q824 4AKZA 2CG0A 1GD3A 1QALA 4QWTA 4EV2A 1V74A 3D9RA 4LGQA 4WYKA 3AMOA 1JV2B 3ER7A 1RRLA 3FG3A 5JBSA 3CCR3 3TDGA 4HZ9B 1MOLA 3SX1A 3RDEA 2XH9A 2XF3A 5AI1A 1WNHA 3FLJA 2Y74A 3Q2PA 4N6LA 1O7PB 2P05A 3CCJ3 3GZYB 1SIIA 1CEWI 1WMPA 2W56A 3MHEA 3MG2A 1K9M4 3A76A 3FCSB 1IV9A 5CF2A 3MYTA 1L5GB 2OOVA 5IEPA 1IDPA 1U8CB 3F7SA 5AIGA 3KZTA 3KN4A 2IUJA 1N9JA 2CFWA 2O3OA 1NWWA 2BO9B 3WA2X 4FCJA 3OV4A 2ML6A 5AIHA 2CWTA 2B24B 2OCTA 2C10A 1NDOB 3V99A 1QJGA 2HMJB 2W04A 2JDIH 2CIUA 4EBGA 3PGBA 3SVAA 3GAXA 3GWRA 1T5YA 3DGLA 5AEWB 4R1KA 4K1VA 3NQYA 3H3HA 1K28A 4KFEA 1OUNA 2YFIB 2GU3A 4EC6A 2R4IA 3F8XA 3X3XA 3IMAB 2GEYA 1VZZA 5AEUB 1YJW3 5IG0A 3WA3A 3JUNA 3KSPA 3DMCA 1SJWA 2V1LA 3X3YA 3UL5A 3OX9A 1QVF2 1UI8A 3B4OA 3N9HA 1UUVB 3RGAA 1IVWA 1O7HB 2CFDA 3NV0A 5IEOA 5JPPA 4KZ1A 1OHSA 3PCSA 3CCM3 1W01A 4XDWA 4HM7B 4WYKB 3AMOB 1D6ZA 1GY5A 3EJVA 4XDVA 2CH9A 2D42A 3CC43 3LTDA 2OTJ3 2W6JH 1ROVA 2XGLA 2MC8A 3CNMA 5AIFA 1VQO3 4I4KA 1WQLB 1TUHA 4EXRA 1J2BA 3G8ZA 2PNCA 5EQLA 3K63A 2WGQA 5D83A 4HZBB 1DVCA 5G2GA 2W56B 1LNHA 1GYBA 3LT8A 4NHFA 3WOFB 3S27A 3LTBA 3EX9A 1ULJB 2O9UX 1JN5A 2YFJB 1E3VA 1EG9B 2WGOA 3LT9A 3MG3A 1VQ73 2W9QA 3NBRA 3F40A 3F14A 1VQ93 3KSED 3UL6A 3X40A 4JRFA 1KC84 1AR0A 1QMAA 1TFOA 2IUKA 4JF8A 4XB5A 3EBTA 4FMBA 1O7GB 1RN7A 2K0MA 3HX8A 1BUQA 1VQ63 2PZVA 1IK3A 2FGTA 5IG3A 3OXAA 3CCQ3 2IA7A 4OK0A 3SOAA 3BLZA 3CC23 3WOEB 1S5AA 2E2TA 3EE1A 1RJOA 4AKYA 4HM0B 3U97A 1PFPA 4WFOA 1A90A 5EEOA 4FCMA 1ASKA 1DVDA 5IF6A 2OWPA 4R9LA 3NUVA 2QEX3 3FH1A 5CF1A 4O02B 5FW5A 2W9PA 1DMQA 4EYCA 1YHQ3 3CME3 5LC6A 1OCVA 3DGMA 3N8BA 1K8A4 3G0KA 4RNYA 3MWZA 1ZX2A 2CKFB 1YVBI 3NV0B 1KD14 1OF5A 2LQVA 2Y73A 2CG1A 5TGNA 3RGRA 1OGXA 4CDLA 1IVVA 4N6OB 4OUQA 1KQS2 2C11A 5JPUA 3K0ZA 1ZO2A 3O8YA 4NREA 1VQN3 4PEJA 4N6NB 4BTYA 1D6UA 2ZDJA 3CPOA 3OWUA 4LZIA 1YIT3 5D82A 1AVKA 1CYVA 3CNXA 1N5HA 3MKIA 3DZLA 4KVHA 3JUQA 2MF7A 1NJI4 3MG1A 1STDA 5IERA 4HKVB 2L4VA 3B7CA 3CCL3 3LMLA 3LOYA 3JUOA 2OQEC 5HGRA 1PU4A 1K41A 1JB5A 2BMRB 2W2CA 3EC9A 3SLUA 1JN5B 3B8LA 1N9EA 3S29A 1W00A 2WO0A 3FF2A 5IENA 3CMA3 2CW9A 3EQQB 4IPBA 4KFDA 4AEQA 1A2VA 4MMYB 1C7HA 3BNDA 1GD4A 2K54A 4HM6B 1W6GA 1M904 1DYUA 1IVUA 3GZBA 2P0MA 3LTCA 1ISKA 4LEHA 1JKGA 3FG4A 1O7MB 4LSOA 4WP5A 3J7Yd 1OACA 3PCRA 1NO3A 3G713 2BNGA 2XSHB 1EA2A 4K61A 5ELJA 1FUWA 3DY5A 1N8R4 2W0QA 3BNCA 2I9WA 1TIJA 1SPUA 2YX9A 2RCDA 2CHCA 4L7KA 1IT7A 1YIJ3 4WHAA 1D6YA 5STDA 1W2ZA 4H61A 1R4CA 3I553 2GBXB 4HVNA 2OTL3 2XSOB 4HBRA 3WMDA 4FR9A 4ZM8A 1IT8A 1UI7A 4XM4A 3JVCA 2CFGA 2QGUA 4R80A 1SIHA 1WTHA 5IW9A 1Q864 1GY6A 1W02A 1O7WB 5FGOA 4MJDA 3NBBA 2E2UA 1OF5B 1W6CA 3WODG 1A2KA 1SQWA 3D3LA 2XFTA 3NQZA 3K5TA 1GY7A 1JRQA 2P38A 2CWVA 1QAFA 2B1XB 5KP1A 1VQP3 1K734 4X2OA 2ZL8A 1CYUA 2FNQA 3M8CA 5DREA 4J8TA 3H51A 3K9MC 3CXC2 1JB2A 2GBWB 1Q42A 1OHPA 1Q40A 3NX0A 1WMNA 1FA3A 1FGMA 1LOXA 4ORLA 1OGZA 2P09A 3KIIA 1A67A 3EN8A 2INXA 3PYJA 4MMZB 3S67A 4RZMA 2HMKB 1E3RA 3HI7A 3E99A 4O8SA 5AYRB 4EV5A 2GEXA 3STDA 1DMMA 1ULIB 2Z7AA 4FMAA 6STDA 1LXEA 4N6UA 3OWSA 2YFLB 4L8OA 4HM3B 1EKMA 2KCDA 2SBLA 2QIYA 5A0OB 5DRVA 3X42A 2GXFA 1OH0A 2BMQB 2CK3H 5AIIA 4XBXA 1JKGB 2Z6BA 3B4PA 3EHCA 3DXOA 1IVXA 3SXXA 2RGQA 1UUWB 3DUKA 4FMDA 4N6MA 3SOYA 2XFSA 3BNEA 4IIAA 5ELUA 3CCV3 4X2HA 1WMOA 3SEDA 5LC7A 1OHOA 5KP4A 4J9AA 2STDA 4KFFA 1Q7Y4 1TFKA 4HM4B 4TX4A 3EF8A 2CWUA 2CFKA 4L8PA 3GZRA 1NB5I 5D81A 1DMNA 1W2B2 1VQ43 2OOVC 3S5CA 3VF1A 2XRXB 2IMJA 3VGNA 4U13A 3VSYA 2D1WA 3V98A 1F8NA 2M7OA 2Z76A 3IJEB 5AYSC 1U5OA 3EB8A 5BXQA 3FKAA 3K7CA 1KWIA 3GRDA 3CC73 3OW22 3KE7A 2HMLB 2Z77A 4N3VA 3HK4A 1QAKA 4K90B 3F8HA 1RRHA 3UB1A 3UJMA 3LXUX 3Q90A 4Q53A 2BHMA 3BB9A 1HKXA 2WOFA 2KRTA 4HJLB 3QRDA 3V92A 1EQKA 1ROAA 1US1A 1UW1A 1N8QA 1MNLA 1W7CA 3IPTA 3NM7A 1GS3A 3Q1CA 4HM8B 1Z1SA 1W4NA 1IU7A 3EN1B 3CPW2 3L0RA 4R4KA 3HIIA 3N54B 3T8UA 4O3VA 1Q40B 2FXTA 2UX0A 1W5ZA 1G96A 3LZAA 1E97A 1Q814 1YI23 5EVHA 3ROBA 3FGYA 3OWYA 3NM2A 1JNQA 3CD63 3S28A 1LVNA 2OQEA 4IT7A 1JJ22 2RSXA 1YGEA 1AVLA 4XBTA 2HMMB 1VQM3 3MPHA 4BTXA 3NBJA 1O7NB 4R9KA 3CCU3 5I97A 3WDGB 1IQ8A 2Q07A 1S723 3JUPA 3PZWA 3UNLA 5CLKA 3FZWA 4CCVA 3FSDA 1FGOA 3CCS3 4O2HA 1RKYA 1M1XB 3LH4A 2LYXA 3I563 3ECFA 2QA43 3T8NA 3X3ZA 4H3UA 2WOHA 3PXMA 1W6YA 2BT3A 2W03A 1TU5A 3G4S3 3F7XA 3LTAA 3DGNA 3F9SA 3MSOA 1QVG2 5KP3A 3ALAA 4FCZA 4FMCA 3DGOA 1VQL3 1N5PA 1VQ53 1IQXA 2XR8B 4GB5A 3T0UA 1KSIA 1VQK3 1VQ83 2CFLA 2F86B 3BNBA 3QK9A 3GZXB 3LYGA 1AV4A 1TP6A 2XGNA 4MEIA 4RBNA 3X41A 2RFRA 2ML5A 3HIGA 4N6V0 1CQSA 2GU1A 2JQ5A 3NHXA 3NXJA 4BTWA 1IQYA 1NU3A 3G6E3 5CK6A 3PS8A 1OPYA 1FGQA 3JUMA 4RNZA 2P0XA 5IG4A 1HU9A 5IG5A 4HM5B 1FGRA 2A15A 1Y4KA 1NB3I 2F98A 3CU3A 2F99A 4GL6A 3CCE3 2HMNB 3G16A 7STDA 2XEPA 4WWUC 3HZPA 1YJ93 2CC3A 3U1WA 1M9GA 3FF0A 5CXOA 4XBYA 1JB4A 3FG1A 4MMXB 2E2VA 3I0YA 2BMOB 4N6TA 3EBYA 4OVMA 1FGTA 3KFQC 4STDA 1STFI 4G1MB 4HYZA 2KXGA 5BVBA 1IV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 4;  3CD6 3;  1KD1 4;  3CCQ 3;  1W2B 2;  1N8R 4;  1M1K 4;  1VQ4 3;  1JJ2 2;  1YJN 3;  1KQS 2;  3G4S 3;  3CC2 3;  1Q82 4;  1YIJ 3;  1VQP 3;  3CCM 3;  1K73 4;  1K9M 4;  3CMA 3;  1QVG 2;  1VQM 3;  1VQN 3;  1VQ7 3;  3CCU 3;  3I55 3;  3CPW 2;  1VQL 3;  1VQ9 3;  3CCE 3;  1YIT 3;  1VQ5 3;  1M90 4;  1VQK 3;  1VQ8 3;  2OTL 3;  1S72 3;  1YJ9 3;  3CCR 3;  3CC4 3;  2OTJ 3;  1NJI 4;  1KC8 4;  3CCS 3;  3CXC 2;  1VQO 3;  3CCV 3;  2QEX 3;  3G6E 3;  1Q86 4;  3CC7 3;  3OW2 2;  1YI2 3;  3I56 3;  3CCL 3;  2QA4 3;  3G71 3;  1YJW 3;  3CME 3;  1YHQ 3;  1Q7Y 4;  1VQ6 3;  1K8A 4;  3CCJ 3;  1QVF 2; 
#chains in the Genus database with same CATH topology
 4LMI A;  2HMO B;  4HM1 B;  4K1U A;  3DM8 A;  1M1K 4;  4HM2 B;  8CHO A;  1YJN 3;  3KKG A;  1Q82 4;  4AKZ A;  4GSP A;  2CG0 A;  1GD3 A;  1QAL A;  1ZS7 A;  4QWT A;  4EV2 A;  1V74 A;  3D9R A;  1X1W A;  4LGQ A;  3AMO A;  1JV2 B;  3ER7 A;  1RRL A;  3FG3 A;  4WYK A;  5JBS A;  3CCR 3;  3TDG A;  2UUG C;  1MOL A;  4HZ9 B;  3SX1 A;  1MWR A;  1UCK A;  3RDE A;  2XH9 A;  2XF3 A;  5AI1 A;  1WNH A;  4ILF A;  1BAO A;  3FLJ A;  2Y74 A;  1I2E A;  3Q2P A;  1LQG C;  4N6L A;  1O7P B;  2P05 A;  3CCJ 3;  5GSP A;  1G0T A;  1JBT A;  3SYU A;  2GSP A;  3WHO A;  3GZY B;  1MWT A;  1SII A;  1CEW I;  1WMP A;  2W56 A;  3MHE A;  1MGW A;  3MG2 A;  1K9M 4;  3A76 A;  3FCS B;  1IV9 A;  5CF2 A;  1GMQ A;  3MYT A;  1L5G B;  2OOV A;  5IEP A;  1IDP A;  1U8C B;  3F7S A;  6GSP A;  5AIG A;  4BIR A;  1GOV A;  3KN4 A;  3KZT A;  2IUJ A;  1N9J A;  1GSP A;  1I0V A;  2CFW A;  2O3O A;  1NWW A;  2BO9 B;  3WA2 X;  2AAD A;  1BNR A;  4FCJ A;  3OV4 A;  2ML6 A;  5AIH A;  2CWT A;  1UCI A;  2B24 B;  2OCT A;  2C10 A;  1CH0 A;  1NDO B;  3V99 A;  1QJG A;  2HMJ B;  2W04 A;  3Q3F A;  4RNT A;  2JDI H;  4DKI A;  2CIU A;  4EBG A;  3PGB A;  3SVA A;  3GAX A;  3GWR A;  1GMP A;  3BU4 A;  1T5Y A;  1BRS A;  3DGL A;  5AEW B;  4R1K A;  4K1V A;  3NQY A;  3H3H A;  1K28 A;  1LNI A;  1B2U A;  3GSP A;  4KFE A;  1LOV A;  1OUN A;  3A5E A;  2YFI B;  2GU3 A;  4EC6 A;  2R4I A;  3F8X A;  3X3X A;  3IMA B;  2GEY A;  1VZZ A;  2KF5 A;  2KAA A;  5AEU B;  1YJW 3;  5IG0 A;  3WA3 A;  1GMR A;  2F5M A;  3JUN A;  3KSP A;  5M1A A;  1IYY A;  3DMC A;  1SJW A;  2V1L A;  3X3Y A;  3UL5 A;  3OX9 A;  1QVF 2;  1LOY A;  1UI8 A;  1V57 A;  3B4O A;  3N9H A;  1UUV B;  3RGA A;  1IVW A;  1O7H B;  2CFD A;  3NV0 A;  5IEO A;  3ZG0 A;  4KZ1 A;  1OHS A;  5JPP A;  3PCS A;  3CCM 3;  1W01 A;  4XDW A;  4HM7 B;  4WYK B;  3AMO B;  1D6Z A;  1GY5 A;  3EJV A;  4XDV A;  1R4Y A;  2BIR A;  2CH9 A;  2D42 A;  3CC4 3;  2L1S A;  3LTD A;  2OTJ 3;  2W6J H;  1ROV A;  2XGL A;  2MC8 A;  3CNM A;  4CPK A;  5AIF A;  1VQO 3;  4I4K A;  1WQL B;  2KF3 A;  1TUH A;  4EXR A;  1J2B A;  3G8Z A;  2PNC A;  5EQL A;  3K63 A;  2WGQ A;  5D83 A;  4HZB B;  1DVC A;  5G2G A;  2W56 B;  1LNH A;  1GYB A;  3LT8 A;  4NHF A;  3WOF B;  3S27 A;  1PYL A;  3LTB A;  3EX9 A;  1ULJ B;  2O9U X;  1JN5 A;  2YFJ B;  1E3V A;  1EG9 B;  2WGO A;  3LT9 A;  1MGR A;  1YGW A;  3MG3 A;  1VQ7 3;  2W9Q A;  3NBR A;  3F40 A;  3F14 A;  1VQ9 3;  3ZFZ A;  3KSE D;  3UL6 A;  3X40 A;  3KCH A;  1BNS A;  4JRF A;  1KC8 4;  1AR0 A;  1QMA A;  1TFO A;  2IUK A;  1LQM B;  4JF8 A;  4XB5 A;  1RGF A;  5BU4 A;  3EBT A;  2HOH A;  1BRK A;  1HYF A;  4FMB A;  1O7G B;  1RN7 A;  2K0M A;  2UGI A;  3HX8 A;  1VQ6 3;  1BUQ A;  2PZV A;  1I2G A;  1IK3 A;  3WR2 A;  2FGT A;  5IG3 A;  1I3F A;  3OXA A;  3CCQ 3;  2IA7 A;  1RGK A;  1B3S A;  1BNG A;  2R41 A;  4OK0 A;  3SOA A;  3BLZ A;  3CC2 3;  3WOE B;  5RNT A;  1S5A A;  2E2T A;  3EE1 A;  2CX1 A;  1RJO A;  4AKY A;  1FW7 A;  4HM0 B;  3U97 A;  1BSB A;  1PFP A;  4WFO A;  1A90 A;  5EEO A;  4FCM A;  1ASK A;  1DVD A;  1TTO A;  1BRG A;  1RGE A;  2OWP A;  5IF6 A;  4R9L A;  3NUV A;  2QEX 3;  3FH1 A;  1SAR A;  5CF1 A;  4O02 B;  5FW5 A;  2W9P A;  1DMQ A;  1ZGX A;  4CJN A;  4EYC A;  5LC6 A;  1OCV A;  3DGM A;  3N8B A;  3CME 3;  1YHQ 3;  1K8A 4;  1AY7 A;  3G0K A;  4RNY A;  3MWZ A;  1ZX2 A;  2CKF B;  1YVB I;  3NV0 B;  1KD1 4;  1OF5 A;  2LQV A;  2Y73 A;  1BRH A;  2CG1 A;  5TGN A;  1MWU A;  1OGX A;  3RGR A;  4CDL A;  1IVV A;  4N6O B;  4OUQ A;  1KQS 2;  2C11 A;  5JPU A;  3K0Z A;  1ZO2 A;  2F5W A;  3O8Y A;  4NRE A;  1MWS A;  4PEJ A;  4N6N B;  4BTY A;  1VQN 3;  1UGH I;  1D6U A;  2ZDJ A;  3CPO A;  3OWU A;  4LZI A;  1EEJ A;  5D82 A;  1AVK A;  2IYJ A;  1YIT 3;  1CYV A;  3CNX A;  1N5H A;  2K3D A;  3MKI A;  3D79 A;  3DZL A;  4KVH A;  3JUQ A;  2MF7 A;  1NJI 4;  3MG1 A;  1STD A;  5IER A;  1BRN L;  4HKV B;  2L4V A;  1JZD A;  3B7C A;  3CCL 3;  3LML A;  3LOY A;  3JUO A;  2OQE C;  5HGR A;  1PU4 A;  1K41 A;  1JB5 A;  2BMR B;  2W2C A;  1LOW A;  3EC9 A;  3SLU A;  1Q9E A;  1JN5 B;  3B8L A;  1GOU A;  1N9E A;  3S29 A;  1W00 A;  2WO0 A;  3FF2 A;  5IEN A;  2J8X B;  3CMA 3;  2CW9 A;  3EQQ B;  4IPB A;  4KFD A;  4AEQ A;  1A2V A;  4MMY B;  1RNB A;  1BSA A;  1C7H A;  3BND A;  1GD4 A;  2K54 A;  4HM6 B;  4BU4 A;  1W6G A;  1M90 4;  1DYU A;  1IVU A;  5G1K A;  3GZB A;  2P0M A;  3LTC A;  1ISK A;  4LEH A;  1JKG A;  3FG4 A;  1O7M B;  4LSO A;  4WP5 A;  3J7Y d;  1OAC A;  3PCR A;  1NO3 A;  3G71 3;  4J5K A;  2BNG A;  2XSH B;  1BSE A;  1EA2 A;  4K61 A;  5ELJ A;  1BAN A;  1FUW A;  1I2F A;  1RLS A;  3DY5 A;  4I5Q A;  4GHO A;  1N8R 4;  2W0Q A;  3BNC A;  2I9W A;  1TIJ A;  4BL3 A;  1SPU A;  2YX9 A;  2RCD A;  2CHC A;  4L7K A;  1IT7 A;  1YIJ 3;  4WHA A;  1D6Y A;  5STD A;  1W2Z A;  4H61 A;  1R4C A;  3I55 3;  2GBX B;  4HVN A;  2OTL 3;  1NNV A;  2XSO B;  4HBR A;  3WMD A;  1BOX A;  4FR9 A;  4ZM8 A;  1IT8 A;  1UI7 A;  4XM4 A;  1RDS A;  2CFG A;  2QGU A;  3JVC A;  4R80 A;  1JBR A;  1SIH A;  1WTH A;  5IW9 A;  1Q86 4;  1RGG A;  1GY6 A;  1W02 A;  1O7W B;  2ZA4 A;  5FGO A;  4MJD A;  3DGY A;  1BSD A;  3NBB A;  2E2U A;  1OF5 B;  1I3I A;  1W6C A;  3WOD G;  1A2K A;  2CX0 A;  1SQW A;  3D3L A;  2XFT A;  1I0X A;  3NQZ A;  3K5T A;  1BNI A;  1GY7 A;  1JRQ A;  2KF6 A;  2P38 A;  4LYL B;  1RGL A;  4EW5 A;  2CWV A;  1QAF A;  2B1X B;  5KP1 A;  1VQP 3;  1K73 4;  1I8V A;  4X2O A;  1BSC A;  1RSN A;  1B2Z A;  2ZL8 A;  1CYU A;  2FNQ A;  3M8C A;  5DRE A;  4J8T A;  3H51 A;  3K9M C;  3CXC 2;  1JB2 A;  2GBW B;  1Q42 A;  1OHP A;  1Q40 A;  3NX0 A;  1WMN A;  3RNT A;  1FA3 A;  1FGM A;  2KF4 A;  1LOX A;  1RN1 A;  4NPB A;  4ORL A;  5G1L A;  1OGZ A;  2P09 A;  3KII A;  1A67 A;  3EN8 A;  1BGS A;  2INX A;  3PYJ A;  4MMZ B;  3S67 A;  4RZM A;  2HMK B;  1E3R A;  3HI7 A;  3E99 A;  4O8S A;  5AYR B;  1GOY A;  4EV5 A;  8RNT A;  2GEX A;  3STD A;  1DMM A;  1ULI B;  2Z7A A;  4FMA A;  6STD A;  1DE3 A;  1LXE A;  4N6U A;  3OWS A;  2YFL B;  1T2H A;  4L8O A;  1JBS A;  4HM3 B;  3DH2 A;  1EKM A;  2KCD A;  2SBL A;  2QIY A;  5A0O B;  1UGI A;  5DRV A;  2C4B A;  1RGH A;  2GXF A;  3X42 A;  1OH0 A;  1RGA A;  2BMQ B;  1BNF A;  2CK3 H;  5AII A;  4XBX A;  2IY2 A;  1JKG B;  1T2I A;  2Z6B A;  3B4P A;  3AGO A;  1IVX A;  3DXO A;  3EHC A;  3SXX A;  2RGQ A;  1UUW B;  3DUK A;  4FMD A;  4J5G A;  4N6M A;  2XFS A;  3BNE A;  4IIA A;  4HOH A;  3SOY A;  1B2M A;  4HAA A;  5ELU A;  3CCV 3;  4X2H A;  7RNT A;  1WMO A;  3SED A;  5LC7 A;  1UCJ A;  1OHO A;  5KP4 A;  4J9A A;  2STD A;  4KFF A;  1Q7Y 4;  1TFK A;  4HM4 B;  4TX4 A;  3EF8 A;  2CWU A;  2CFK A;  4L8P A;  3GZR A;  1NB5 I;  4BL2 A;  5D81 A;  3AGN A;  1DMN A;  1EUI C;  1W2B 2;  2H0I A;  1VQ4 3;  2OOV C;  3S5C A;  1X1X A;  1B2X A;  1FUT A;  3VF1 A;  7GSP A;  2XRX B;  2IMJ A;  3VGN A;  4U13 A;  3VSY A;  2D1W A;  3V98 A;  1F8N A;  2M7O A;  1RMS A;  1FYS A;  2Z76 A;  3D5G A;  3IJE B;  1DET A;  1RCL A;  5AYS C;  2RBI A;  1U5O A;  1UDI I;  3EB8 A;  5BXQ A;  1T3B A;  3FKA A;  3K7C A;  1KWI A;  3GRD A;  3CC7 3;  3OW2 2;  3KE7 A;  2HML B;  2Z77 A;  4N3V A;  3HK4 A;  1QAK A;  4K90 B;  1RTU A;  3F8H A;  1BVI A;  1B20 A;  1RRH A;  3D4A A;  3UB1 A;  3LXU X;  3UJM A;  1BNJ A;  3Q90 A;  4KT3 B;  4Q53 A;  2BHM A;  3BB9 A;  1HKX A;  2WOF A;  2KRT A;  3HOH A;  3QRD A;  4HJL B;  3V92 A;  1ROA A;  1US1 A;  1UW1 A;  1N8Q A;  1MNL A;  1W7C A;  1EQK A;  3IPT A;  3NM7 A;  1GS3 A;  3Q1C A;  4HM8 B;  1Z1S A;  1W4N A;  1FUS A;  1IU7 A;  1X1U A;  3EN1 B;  5M19 A;  3CPW 2;  3L0R A;  4R4K A;  3HII A;  3N54 B;  3T8U A;  1V58 A;  1YVS A;  4O3V A;  6RNT A;  1BRI A;  1Q40 B;  2FXT A;  2UX0 A;  1W5Z A;  1G96 A;  5M18 A;  3LZA A;  1E97 A;  1UCL A;  1Q81 4;  1YI2 3;  5BIR A;  5EVH A;  1RN4 A;  1LRA A;  1X1Y A;  3ROB A;  3FGY A;  2F56 A;  3OWY A;  1VQQ A;  2ZHX B;  1JNQ A;  3NM2 A;  3S28 A;  3CD6 3;  1LVN A;  1BRJ A;  2OQE A;  4IT7 A;  1RNT A;  1JJ2 2;  1BIR A;  2RSX A;  1YGE A;  1B27 A;  1BUJ A;  1AVL A;  4XBT A;  2HMM B;  1VQM 3;  3MPH A;  4BTX A;  3NBJ A;  1FZU A;  1O7N B;  4R9K A;  3CCU 3;  5I97 A;  1HZ1 A;  3WDG B;  1IQ8 A;  2Q07 A;  1S72 3;  3AHS A;  1G02 A;  3JUP A;  3PZW A;  9RNT A;  1B21 A;  3UNL A;  5CLK A;  3FZW A;  4CCV A;  3FSD A;  1FGO A;  1I70 A;  4O2H A;  1RKY A;  3CCS 3;  1M1X B;  3LH4 A;  2LYX A;  1TRP A;  3ECF A;  3I56 3;  3T8N A;  2QA4 3;  3X3Z A;  3BIR A;  4H3U A;  1TRQ A;  1UUG B;  2WOH A;  3PXM A;  1W6Y A;  2BT3 A;  2W03 A;  1TU5 A;  3G4S 3;  3F7X A;  3LTA A;  3DGN A;  3F9S A;  3MSO A;  1Q7H A;  1QVG 2;  5KP3 A;  3ALA A;  4FCZ A;  4FMC A;  3DGO A;  1VQL 3;  1N5P A;  1VQ5 3;  1IQX A;  2XR8 B;  4GB5 A;  3T0U A;  1KSI A;  1VQK 3;  1VQ8 3;  2CFL A;  2F86 B;  3BNB A;  3QK9 A;  3AHW A;  3GZX B;  3LYG A;  2H0G A;  1AV4 A;  1TP6 A;  2XGN A;  2BU4 A;  1AQZ A;  4MEI A;  2RFR A;  2ML5 A;  3HIG A;  4RBN A;  3X41 A;  2F4Y A;  4N6V 0;  1CQS A;  2GU1 A;  1RGC A;  2JQ5 A;  3NHX A;  3NXJ A;  4BTW A;  1PY3 A;  1IQY A;  3URP A;  1NU3 A;  3G6E 3;  1A2P A;  3PS8 A;  5CK6 A;  3ZG5 A;  1OPY A;  1FGQ A;  3JUM A;  4RNZ A;  2P0X A;  5IG4 A;  1HU9 A;  5IG5 A;  4HM5 B;  1FGR A;  2A15 A;  1Y4K A;  1NB3 I;  1TJD A;  2F98 A;  3CU3 A;  2F99 A;  2SAR A;  4GL6 A;  3CCE 3;  2HMN B;  3G16 A;  7STD A;  2XEP A;  4WWU C;  3HZP A;  1BU4 A;  1YJ9 3;  2CC3 A;  1JZO A;  3U1W A;  1M9G A;  3FF0 A;  5CXO A;  4XBY A;  1RHL A;  2AAE A;  5HOH A;  2H0H A;  1JB4 A;  3FG1 A;  1C54 A;  1RCK A;  4MMX B;  2RNT A;  2E2V A;  3I0Y A;  1B2S A;  1YNV X;  2BMO B;  3D5I A;  1FGT A;  3EBY A;  3KFQ C;  4N6T A;  4OVM A;  4STD A;  1STF I;  4G1M B;  4HYZ A;  2KXG A;  5BVB A;  1IV7 A;  1BNE A; 
#chains in the Genus database with same CATH homology
 4LMI A;  2HMO B;  4HM1 B;  4K1U A;  3DM8 A;  1M1K 4;  4HM2 B;  8CHO A;  1YJN 3;  3KKG A;  1Q82 4;  4AKZ A;  2CG0 A;  1GD3 A;  1QAL A;  4QWT A;  4EV2 A;  1V74 A;  3D9R A;  4LGQ A;  4WYK A;  3AMO A;  1JV2 B;  3ER7 A;  1RRL A;  3FG3 A;  5JBS A;  3CCR 3;  3TDG A;  4HZ9 B;  1MOL A;  3SX1 A;  3RDE A;  2XH9 A;  2XF3 A;  5AI1 A;  1WNH A;  3FLJ A;  2Y74 A;  3Q2P A;  4N6L A;  1O7P B;  2P05 A;  3CCJ 3;  3GZY B;  1SII A;  1CEW I;  1WMP A;  2W56 A;  3MHE A;  3MG2 A;  1K9M 4;  3A76 A;  3FCS B;  1IV9 A;  5CF2 A;  3MYT A;  1L5G B;  2OOV A;  5IEP A;  1IDP A;  1U8C B;  3F7S A;  5AIG A;  3KZT A;  3KN4 A;  2IUJ A;  1N9J A;  2CFW A;  2O3O A;  1NWW A;  2BO9 B;  3WA2 X;  4FCJ A;  3OV4 A;  2ML6 A;  5AIH A;  2CWT A;  2B24 B;  2OCT A;  2C10 A;  1NDO B;  3V99 A;  1QJG A;  2HMJ B;  2W04 A;  2JDI H;  2CIU A;  4EBG A;  3PGB A;  3SVA A;  3GAX A;  3GWR A;  1T5Y A;  3DGL A;  5AEW B;  4R1K A;  4K1V A;  3NQY A;  3H3H A;  1K28 A;  4KFE A;  1OUN A;  2YFI B;  2GU3 A;  4EC6 A;  2R4I A;  3F8X A;  3X3X A;  3IMA B;  2GEY A;  1VZZ A;  5AEU B;  1YJW 3;  5IG0 A;  3WA3 A;  3JUN A;  3KSP A;  3DMC A;  1SJW A;  2V1L A;  3X3Y A;  3UL5 A;  3OX9 A;  1QVF 2;  1UI8 A;  3B4O A;  3N9H A;  1UUV B;  3RGA A;  1IVW A;  1O7H B;  2CFD A;  3NV0 A;  5IEO A;  5JPP A;  4KZ1 A;  1OHS A;  3PCS A;  3CCM 3;  1W01 A;  4XDW A;  4HM7 B;  4WYK B;  3AMO B;  1D6Z A;  1GY5 A;  3EJV A;  4XDV A;  2CH9 A;  2D42 A;  3CC4 3;  3LTD A;  2OTJ 3;  2W6J H;  1ROV A;  2XGL A;  2MC8 A;  3CNM A;  5AIF A;  1VQO 3;  4I4K A;  1WQL B;  1TUH A;  4EXR A;  1J2B A;  3G8Z A;  2PNC A;  5EQL A;  3K63 A;  2WGQ A;  5D83 A;  4HZB B;  1DVC A;  5G2G A;  2W56 B;  1LNH A;  1GYB A;  3LT8 A;  4NHF A;  3WOF B;  3S27 A;  3LTB A;  3EX9 A;  1ULJ B;  2O9U X;  1JN5 A;  2YFJ B;  1E3V A;  1EG9 B;  2WGO A;  3LT9 A;  3MG3 A;  1VQ7 3;  2W9Q A;  3NBR A;  3F40 A;  3F14 A;  1VQ9 3;  3KSE D;  3UL6 A;  3X40 A;  4JRF A;  1KC8 4;  1AR0 A;  1QMA A;  1TFO A;  2IUK A;  4JF8 A;  4XB5 A;  3EBT A;  4FMB A;  1O7G B;  1RN7 A;  2K0M A;  3HX8 A;  1BUQ A;  1VQ6 3;  2PZV A;  1IK3 A;  2FGT A;  5IG3 A;  3OXA A;  3CCQ 3;  2IA7 A;  4OK0 A;  3SOA A;  3BLZ A;  3CC2 3;  3WOE B;  1S5A A;  2E2T A;  3EE1 A;  1RJO A;  4AKY A;  4HM0 B;  3U97 A;  1PFP A;  4WFO A;  1A90 A;  5EEO A;  4FCM A;  1ASK A;  1DVD A;  5IF6 A;  2OWP A;  4R9L A;  3NUV A;  2QEX 3;  3FH1 A;  5CF1 A;  4O02 B;  5FW5 A;  2W9P A;  1DMQ A;  4EYC A;  1YHQ 3;  3CME 3;  5LC6 A;  1OCV A;  3DGM A;  3N8B A;  1K8A 4;  3G0K A;  4RNY A;  3MWZ A;  1ZX2 A;  2CKF B;  1YVB I;  3NV0 B;  1KD1 4;  1OF5 A;  2LQV A;  2Y73 A;  2CG1 A;  5TGN A;  3RGR A;  1OGX A;  4CDL A;  1IVV A;  4N6O B;  4OUQ A;  1KQS 2;  2C11 A;  5JPU A;  3K0Z A;  1ZO2 A;  3O8Y A;  4NRE A;  1VQN 3;  4PEJ A;  4N6N B;  4BTY A;  1D6U A;  2ZDJ A;  3CPO A;  3OWU A;  4LZI A;  1YIT 3;  5D82 A;  1AVK A;  1CYV A;  3CNX A;  1N5H A;  3MKI A;  3DZL A;  4KVH A;  3JUQ A;  2MF7 A;  1NJI 4;  3MG1 A;  1STD A;  5IER A;  4HKV B;  2L4V A;  3B7C A;  3CCL 3;  3LML A;  3LOY A;  3JUO A;  2OQE C;  5HGR A;  1PU4 A;  1K41 A;  1JB5 A;  2BMR B;  2W2C A;  3EC9 A;  3SLU A;  1JN5 B;  3B8L A;  1N9E A;  3S29 A;  1W00 A;  2WO0 A;  3FF2 A;  5IEN A;  3CMA 3;  2CW9 A;  3EQQ B;  4IPB A;  4KFD A;  4AEQ A;  1A2V A;  4MMY B;  1C7H A;  3BND A;  1GD4 A;  2K54 A;  4HM6 B;  1W6G A;  1M90 4;  1DYU A;  1IVU A;  3GZB A;  2P0M A;  3LTC A;  1ISK A;  4LEH A;  1JKG A;  3FG4 A;  1O7M B;  4LSO A;  4WP5 A;  3J7Y d;  1OAC A;  3PCR A;  1NO3 A;  3G71 3;  2BNG A;  2XSH B;  1EA2 A;  4K61 A;  5ELJ A;  1FUW A;  3DY5 A;  1N8R 4;  2W0Q A;  3BNC A;  2I9W A;  1TIJ A;  1SPU A;  2YX9 A;  2RCD A;  2CHC A;  4L7K A;  1IT7 A;  1YIJ 3;  4WHA A;  1D6Y A;  5STD A;  1W2Z A;  4H61 A;  1R4C A;  3I55 3;  2GBX B;  4HVN A;  2OTL 3;  2XSO B;  4HBR A;  3WMD A;  4FR9 A;  4ZM8 A;  1IT8 A;  1UI7 A;  4XM4 A;  3JVC A;  2CFG A;  2QGU A;  4R80 A;  1SIH A;  1WTH A;  5IW9 A;  1Q86 4;  1GY6 A;  1W02 A;  1O7W B;  5FGO A;  4MJD A;  3NBB A;  2E2U A;  1OF5 B;  1W6C A;  3WOD G;  1A2K A;  1SQW A;  3D3L A;  2XFT A;  3NQZ A;  3K5T A;  1GY7 A;  1JRQ A;  2P38 A;  2CWV A;  1QAF A;  2B1X B;  5KP1 A;  1VQP 3;  1K73 4;  4X2O A;  2ZL8 A;  1CYU A;  2FNQ A;  3M8C A;  5DRE A;  4J8T A;  3H51 A;  3K9M C;  3CXC 2;  1JB2 A;  2GBW B;  1Q42 A;  1OHP A;  1Q40 A;  3NX0 A;  1WMN A;  1FA3 A;  1FGM A;  1LOX A;  4ORL A;  1OGZ A;  2P09 A;  3KII A;  1A67 A;  3EN8 A;  2INX A;  3PYJ A;  4MMZ B;  3S67 A;  4RZM A;  2HMK B;  1E3R A;  3HI7 A;  3E99 A;  4O8S A;  5AYR B;  4EV5 A;  2GEX A;  3STD A;  1DMM A;  1ULI B;  2Z7A A;  4FMA A;  6STD A;  1LXE A;  4N6U A;  3OWS A;  2YFL B;  4L8O A;  4HM3 B;  1EKM A;  2KCD A;  2SBL A;  2QIY A;  5A0O B;  5DRV A;  3X42 A;  2GXF A;  1OH0 A;  2BMQ B;  2CK3 H;  5AII A;  4XBX A;  1JKG B;  2Z6B A;  3B4P A;  3EHC A;  3DXO A;  1IVX A;  3SXX A;  2RGQ A;  1UUW B;  3DUK A;  4FMD A;  4N6M A;  3SOY A;  2XFS A;  3BNE A;  4IIA A;  5ELU A;  3CCV 3;  4X2H A;  1WMO A;  3SED A;  5LC7 A;  1OHO A;  5KP4 A;  4J9A A;  2STD A;  4KFF A;  1Q7Y 4;  1TFK A;  4HM4 B;  4TX4 A;  3EF8 A;  2CWU A;  2CFK A;  4L8P A;  3GZR A;  1NB5 I;  5D81 A;  1DMN A;  1W2B 2;  1VQ4 3;  2OOV C;  3S5C A;  3VF1 A;  2XRX B;  2IMJ A;  3VGN A;  4U13 A;  3VSY A;  2D1W A;  3V98 A;  1F8N A;  2M7O A;  2Z76 A;  3IJE B;  5AYS C;  1U5O A;  3EB8 A;  5BXQ A;  3FKA A;  3K7C A;  1KWI A;  3GRD A;  3CC7 3;  3OW2 2;  3KE7 A;  2HML B;  2Z77 A;  4N3V A;  3HK4 A;  1QAK A;  4K90 B;  3F8H A;  1RRH A;  3UB1 A;  3UJM A;  3LXU X;  3Q90 A;  4Q53 A;  2BHM A;  3BB9 A;  1HKX A;  2WOF A;  2KRT A;  4HJL B;  3QRD A;  3V92 A;  1EQK A;  1ROA A;  1US1 A;  1UW1 A;  1N8Q A;  1MNL A;  1W7C A;  3IPT A;  3NM7 A;  1GS3 A;  3Q1C A;  4HM8 B;  1Z1S A;  1W4N A;  1IU7 A;  3EN1 B;  3CPW 2;  3L0R A;  4R4K A;  3HII A;  3N54 B;  3T8U A;  4O3V A;  1Q40 B;  2FXT A;  2UX0 A;  1W5Z A;  1G96 A;  3LZA A;  1E97 A;  1Q81 4;  1YI2 3;  5EVH A;  3ROB A;  3FGY A;  3OWY A;  3NM2 A;  1JNQ A;  3CD6 3;  3S28 A;  1LVN A;  2OQE A;  4IT7 A;  1JJ2 2;  2RSX A;  1YGE A;  1AVL A;  4XBT A;  2HMM B;  1VQM 3;  3MPH A;  4BTX A;  3NBJ A;  1O7N B;  4R9K A;  3CCU 3;  5I97 A;  3WDG B;  1IQ8 A;  2Q07 A;  1S72 3;  3JUP A;  3PZW A;  3UNL A;  5CLK A;  3FZW A;  4CCV A;  3FSD A;  1FGO A;  3CCS 3;  4O2H A;  1RKY A;  1M1X B;  3LH4 A;  2LYX A;  3I56 3;  3ECF A;  2QA4 3;  3T8N A;  3X3Z A;  4H3U A;  2WOH A;  3PXM A;  1W6Y A;  2BT3 A;  2W03 A;  1TU5 A;  3G4S 3;  3F7X A;  3LTA A;  3DGN A;  3F9S A;  3MSO A;  1QVG 2;  5KP3 A;  3ALA A;  4FCZ A;  4FMC A;  3DGO A;  1VQL 3;  1N5P A;  1VQ5 3;  1IQX A;  2XR8 B;  4GB5 A;  3T0U A;  1KSI A;  1VQK 3;  1VQ8 3;  2CFL A;  2F86 B;  3BNB A;  3QK9 A;  3GZX B;  3LYG A;  1AV4 A;  1TP6 A;  2XGN A;  4MEI A;  4RBN A;  3X41 A;  2RFR A;  2ML5 A;  3HIG A;  4N6V 0;  1CQS A;  2GU1 A;  2JQ5 A;  3NHX A;  3NXJ A;  4BTW A;  1IQY A;  1NU3 A;  3G6E 3;  5CK6 A;  3PS8 A;  1OPY A;  1FGQ A;  3JUM A;  4RNZ A;  2P0X A;  5IG4 A;  1HU9 A;  5IG5 A;  4HM5 B;  1FGR A;  2A15 A;  1Y4K A;  1NB3 I;  2F98 A;  3CU3 A;  2F99 A;  4GL6 A;  3CCE 3;  2HMN B;  3G16 A;  7STD A;  2XEP A;  4WWU C;  3HZP A;  1YJ9 3;  2CC3 A;  3U1W A;  1M9G A;  3FF0 A;  5CXO A;  4XBY A;  1JB4 A;  3FG1 A;  4MMX B;  2E2V A;  3I0Y A;  2BMO B;  4N6T A;  3EBY A;  4OVM A;  1FGT A;  3KFQ C;  4STD A;  1STF I;  4G1M B;  4HYZ A;  2KXG A;  5BVB A;  1IV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...