3CCM3

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ccm300
2OTJ3 1YIJ3 1Q864 1YJW3 3CCE3 3I553 1YI23 1K9M4 1JJ22 3CD63 3CCR3 1NJI4 1YJN3 3I563 1Q814 1VQM3 1Q7Y4 1VQP3 1QVF2 1VQL3 1Q824 2OTL3 3CXC2 1S723 1KD14 3CC43 3G713 3CMA3 1W2B2 3CPW2 1VQN3 1YJ93 1VQ83 1KC84 3G4S3 1VQ73 3CCU3 1VQ93 1VQO3 1VQ53 1QVG2 3CCL3 2QA43 1K734 1VQ43 1YIT3 3CCM3 1VQ63 3OW22 1VQK3 3CC23 3CCQ3 1KQS2 3CCJ3 3CC73 1N8R4 3G6E3 1K8A4 3CCV3 3CME3 1M1K4 2QEX3 1YHQ3 3CCS3 1M904
chains in the Genus database with same CATH superfamily
3JUNA 5KP4A 1OGZA 3K5TA 1Q864 1NNVA 3BNCA 3EBYA 3STDA 4J5GA 2L1SA 2O3OA 4R9KA 1ROAA 2IUJA 3SLUA 3AMOA 4H3UA 1VQM3 1O7HB 3PCSA 3HIGA 1CYVA 1Q40B 1GSPA 1DMQA 4RNZA 4O2HA 1V57A 3FF0A 1G0TA 3SX1A 2MF7A 4R4KA 3X41A 1JBRA 1I3IA 5AIFA 3NHXA 3AMOB 3LTDA 2Z6BA 4AEQA 1RJOA 2KXGA 2IMJA 3URPA 1LOYA 4WP5A 3CC73 1N8R4 2OWPA 4NHFA 1RGGA 3MG2A 1RN1A 1X1XA 4K1UA 1AVKA 1DMMA 3EC9A 1RGAA 5GSPA 3X3ZA 4CCVA 1JJ22 1OHPA 3ZG5A 1Q814 3FZWA 1WNHA 1N5HA 3N54B 1TUHA 1IVXA 3ER7A 1ROVA 4EV5A 2GSPA 3SXXA 2FGTA 3D9RA 1E3VA 3OWSA 2WGQA 4LMIA 3CMA3 3K7CA 5EVHA 1SPUA 4J8TA 3X42A 2CFDA 4ORLA 1YNVX 1VQ43 4O8SA 3B8LA 2P0MA 3LT8A 3OW22 1BRSA 1C7HA 4ILFA 3X3XA 1BSEA 2W04A 2CK3H 2RNTA 4XDVA 3CME3 2QGUA 3LT9A 3T8NA 3BNBA 1JBSA 1D6YA 1GYBA 1JV2B 1W6CA 3NQYA 4HM2B 1OH0A 4NREA 5IEOA 5FW5A 2SBLA 5CF1A 3LYGA 3NM2A 3QRDA 3N8BA 4R80A 3GZYB 4G1MB 1O7GB 3WOEB 4HM6B 1ASKA 3KFQC 5IG0A 8CHOA 2LQVA 2KCDA 2RCDA 2E2VA 2CH9A 1VQ83 1C54A 3CPOA 3DH2A 4FCMA 3CCM3 5AEUB 1LNHA 2Z76A 3B4PA 1BRKA 1L5GB 3LXUX 1BRNL 2WO0A 1NDOB 2OQEC 1W4NA 2GU1A 4HM5B 4RNYA 4HJLB 3BB9A 1I8VA 2P09A 3T8UA 2I9WA 1VQP3 1DETA 1Q7HA 1TJDA 2GEYA 2H0HA 2CFLA 1S5AA 3F9SA 1BSCA 1B2MA 4I5QA 5G1LA 5IG5A 1PY3A 1QJGA 2W56B 3LOYA 5IERA 3S28A 3DXOA 4BTWA 1QVG2 2QA43 2V1LA 1HU9A 4LGQA 1LQGC 3MWZA 1BOXA 3EB8A 3JUMA 2R41A 3LMLA 3Q3FA 5G2GA 4HOHA 1GOVA 1UDII 4HM4B 1AQZA 2H0IA 1AR0A 1IVVA 1R4CA 4X2OA 4CJNA 6GSPA 3WODG 1N8QA 3EBTA 3CCE3 1X1YA 1RGHA 3TDGA 4KT3B 3HI7A 1A2VA 3QK9A 5IG3A 1T2HA 4BTYA 1BANA 2YFLB 3Q90A 3FLJA 3MHEA 1ZX2A 1NU3A 3OX9A 4EV2A 4ZM8A 4H61A 1RRLA 5IENA 1FGOA 4I4KA 1N5PA 2PNCA 3NBBA 3G4S3 1IV7A 1IT8A 2CFKA 1UGHI 3OV4A 3CCU3 1VQQA 1VQO3 1A90A 3GZRA 1IQ8A 2B24B 4L8PA 8RNTA 1IYYA 3D5IA 2JQ5A 1W02A 4XDWA 2IUKA 4OVMA 1MWUA 3WA3A 2WOHA 5AYSC 1RGKA 1A2PA 2CHCA 3F14A 4RZMA 1I70A 4HBRA 5ELJA 2OTJ3 3D5GA 3GZXB 1W6YA 1RTUA 2OCTA 4N6TA 2M7OA 3HOHA 1K41A 3MSOA 1Q9EA 4HVNA 4O02B 1TTOA 2BMRB 4WHAA 1S723 1RNTA 5DRVA 1FUWA 1RKYA 1W2B2 3PS8A 2A15A 5BU4A 1B2ZA 4Q53A 3LH4A 5FGOA 2RGQA 3SOAA 2KAAA 3G16A 3DUKA 1SJWA 5AYRB 2P0XA 3KZTA 3RGAA 3ROBA 4AKYA 1LXEA 3CCS3 1V58A 3EE1A 3EF8A 3PGBA 3DGOA 3ZG0A 1BIRA 3SOYA 1FZUA 2CG1A 1YJN3 4QWTA 3AHWA 3FKAA 4MJDA 1TP6A 4J5KA 2J8XB 1VQL3 5JPPA 3LTCA 3D3LA 3FF2A 1O7MB 3D79A 1EUIC 1AV4A 1US1A 1OHOA 1T3BA 3A76A 3JUPA 2BO9B 2OQEA 3BLZA 1B20A 1UCIA 1WMNA 1FYSA 2XRXB 2XSHB 3B4OA 2BNGA 3FG3A 3K63A 3H3HA 1YGEA 4CPKA 2GBXB 2Z77A 1B27A 1RCKA 3BIRA 1E97A 3UB1A 2GEXA 1D6ZA 2KF5A 2ZDJA 4X2HA 1WTHA 2F86B 1IU7A 3HZPA 1WMOA 1IK3A 1VQ63 1B2SA 2ML6A 1O7WB 3BNEA 4WWUC 3CCR3 3I563 2JDIH 1LQMB 3VSYA 1RLSA 3JUOA 1GMPA 1LRAA 1GMRA 1O7PB 1STDA 3PCRA 5M1AA 3S29A 5IW9A 1RDSA 3S27A 1BAOA 1Q824 3V98A 3G8ZA 3K9MC 4HAAA 5IEPA 3GRDA 4FMAA 5AIHA 5HOHA 1LOVA 3FG4A 1GY5A 2GU3A 4GSPA 3UL6A 1M1XB 2W9PA 2HMLB 2HOHA 3B7CA 4O3VA 4RNTA 5CF2A 1TU5A 5LC6A 4FCZA 5A0OB 1VQK3 2K0MA 1FUSA 1W5ZA 4J9AA 5M19A 1BNFA 1BNSA 1KWIA 1BNJA 1JKGB 2QIYA 2XF3A 1BRGA 1B2XA 1EA2A 1JZOA 3SVAA 4HZ9B 1EG9B 2OOVA 4EXRA 1GY7A 3V92A 2L4VA 1Q42A 3KN4A 3L0RA 1Q7Y4 2F98A 1DE3A 1RGFA 2IA7A 3F7SA 4N6OB 1IQXA 2WGOA 1FUTA 1MGWA 1JB5A 2Y74A 3EN1B 2KF4A 3MG1A 4KZ1A 3IMAB 1I0XA 3Q1CA 4PEJA 5BXQA 2E2TA 2HMOB 3NV0B 1LOWA 4N6V0 5AIIA 3GWRA 1I2FA 5KP1A 4HZBB 1OUNA 1J2BA 1FGQA 2BMOB 2B1XB 1JBTA 2CX0A 2XR8B 1WQLB 2F56A 1K734 2CIUA 3UJMA 2STDA 1LNIA 2AADA 1OCVA 1OF5B 2XFSA 1GD3A 1SIHA 1GY6A 2PZVA 1LOXA 3DGLA 1RHLA 1R4YA 1RNBA 1JB2A 4KVHA 4R1KA 1NO3A 1MWRA 1QALA 4HM7B 4LZIA 4MMZB 4FMDA 5EEOA 1YIJ3 1BU4A 3JUQA 1YI23 3CD63 4L7KA 1RN4A 3IPTA 2UUGC 1FGRA 1OHSA 2F5MA 2RFRA 2H0GA 1W2ZA 4XBXA 1WMPA 2W6JH 2C4BA 2INXA 2F99A 3G0KA 1UUGB 2YFJB 2P05A 3EJVA 1OF5A 1OGXA 1UGIA 3V99A 3K0ZA 1G96A 1G02A 4FCJA 3EQQB 4JF8A 5AEWB 2D42A 4KFDA 3LTAA 1Y4KA 1JZDA 1RMSA 1DVDA 2KF6A 3AGNA 2Y73A 3FH1A 4MMXB 1AVLA 5ELUA 3SEDA 1BNGA 1ULJB 1ZS7A 1KSIA 5HGRA 2BMQB 1IDPA 3CNMA 1UUVB 2W03A 2CG0A 1K28A 1TIJA 2BT3A 2CC3A 5M18A 4K1VA 3NBRA 1SARA 1SIIA 3CCJ3 1ULIB 2IY2A 2R4IA 1OPYA 5D83A 1TFKA 5KP3A 5BVBA 2RSXA 3O8YA 4KFFA 1M1K4 1VQ93 1M904 4R9LA 4EW5A 1B21A 4NPBA 1EQKA 1QMAA 2HMKB 3DGNA 1YJW3 3I553 2ZHXB 1UI8A 1B2UA 1YVBI 3WOFB 1MWSA 1DYUA 2W2CA 2WOFA 2BIRA 1BNIA 3ALAA 1E3RA 2F4YA 3CU3A 3UNLA 3FGYA 2FXTA 2CWUA 1GMQA 3DY5A 4BTXA 3EN8A 7GSPA 3OWYA 1X1WA 1UI7A 3NBJA 3KSPA 4KFEA 4HKVB 3IJEB 5CLKA 1FW7A 4K61A 3DM8A 3M8CA 1UCJA 1PYLA 3F40A 3VGNA 1RRHA 1RGEA 4HYZA 4MMYB 2LYXA 2Q07A 2XSOB 2FNQA 3G6E3 3S5CA 2QEX3 3D4AA 1EKMA 1AY7A 4WYKA 4GHOA 3GSPA 4K90B 3SYUA 3F7XA 1EEJA 3BNDA 3WMDA 1PU4A 1BSAA 2K3DA 4N6UA 2XGNA 5EQLA 2OTL3 5BIRA 5IG4A 1SQWA 4STDA 3CC43 5STDA 1BSDA 3E99A 4IPBA 1UUWB 3U97A 2CWVA 3RNTA 1KC84 1IT7A 3VF1A 1VQ53 1D6UA 3HX8A 3KIIA 3CCL3 1BRJA 1W01A 2XGLA 3MPHA 4XM4A 1TRPA 2KRTA 3I0YA 3CC23 3H51A 1JRQA 2BU4A 3WHOA 3FG1A 3KKGA 1NWWA 1IVUA 2AAEA 3X40A 3EX9A 2CWTA 5D82A 4RBNA 2D1WA 2O9UX 1N9EA 4GL6A 1Q40A 2CKFB 1UCKA 3HK4A 4HM0B 5IF6A 4JRFA 2W9QA 3EHCA 5G1KA 2HMMB 2XFTA 3NM7A 1JN5A 1CEWI 2C11A 1N9JA 2ZL8A 1RSNA 5TGNA 1KD14 1LVNA 1HKXA 1W00A 1RGCA 3GAXA 4EBGA 1YJ93 1O7NB 4BL2A 3MKIA 4N3VA 4EYCA 3LTBA 1PFPA 3BU4A 1HZ1A 4N6NB 1MOLA 1I3FA 2GXFA 4L8OA 1BNEA 1BUQA 2F5WA 1CYUA 4LSOA 3X3YA 1MNLA 2W56A 5CXOA 3LZAA 1BSBA 3NXJA 3PXMA 1IQYA 3KSED 3NV0A 3DMCA 3DGMA 2HMNB 1K8A4 6STDA 1A2KA 3A5EA 1STFI 2YX9A 3AGOA 1MWTA 2HMJB 1W6GA 3ECFA 1BNRA 1TRQA 3FSDA 1T2IA 4HM1B 3U1WA 4LEHA 3RGRA 1DVCA 1JKGA 1V74A 2GBWB 4XBTA 3WR2A 4OK0A 1TFOA 1GOUA 5DREA 1ZO2A 5JBSA 1VQN3 4FMBA 4GB5A 3T0UA 3NUVA 2Z7AA 1VQ73 1QAFA 3DZLA 2UX0A 1W7CA 4HM3B 4DKIA 1UCLA 1GOYA 2IYJA 1FGTA 1IV9A 3F8HA 3FCSB 1VZZA 4LYLB 2OOVC 9RNTA 3RDEA 2ML5A 3PYJA 2SARA 5JPUA 4FR9A 3F8XA 3NQZA 3S67A 2KF3A 1CQSA 1I2GA 2CX1A 1F8NA 3GZBA 1U5OA 1IVWA 4MEIA 3JVCA 1RGLA 3MYTA 3Q2PA 3CPW2 2W0QA 4WFOA 2YFIB 1B3SA 1I2EA 3NX0A 4WYKB 4N6MA 4HM8B 1DMNA 3OWUA 1BGSA 1FGMA 1GS3A 1OACA 3PZWA 5LC7A 2CFWA 6RNTA 1YIT3 1YVSA 3OXAA 1BUJA 4XB5A 1BRHA 3HIIA 1BRIA 1I0VA 1ISKA 4EC6A 1FA3A 3UL5A 1YHQ3 1X1UA 2E2UA 5D81A 1BVIA 1HYFA 3N9HA 4U13A 1K9M4 1U8CB 4BU4A 2K54A 2UGIA 4OUQA 5AI1A 4N6LA 1UW1A 4XBYA 7RNTA 7STDA 1NJI4 5CK6A 5RNTA 1CH0A 4TX4A 1NB5I 1QVF2 3DGYA 3KE7A 1JB4A 3CXC2 1QAKA 2XEPA 4FMCA 3G713 4BL3A 1GD4A 2BHMA 1Z1SA 3WDGB 4AKZA 3ZFZA 2CW9A 2RBIA 2XH9A 3KCHA 4CDLA 1T5YA 2C10A 3MG3A 2ZA4A 5I97A 1NB3I 1RN7A 4BIRA 1JN5B 5AIGA 4IT7A 1ZGXA 3AHSA 2MC8A 1M9GA 3CCQ3 1KQS2 3WA2X 1MGRA 2CFGA 2P38A 4IIAA 3CNXA 1A67A 3J7Yd 3CCV3 1RCLA 1YGWA 1JNQA
chains in the Genus database with same CATH topology
3JUNA 5KP4A 1OGZA 3K5TA 1Q864 3BNCA 3EBYA 3STDA 2O3OA 4R9KA 3SLUA 1ROAA 2IUJA 3AMOA 4H3UA 1VQM3 1O7HB 3PCSA 3HIGA 1CYVA 1Q40B 1DMQA 4RNZA 4O2HA 3FF0A 3SX1A 2MF7A 4R4KA 3X41A 5AIFA 3NHXA 3AMOB 3LTDA 2Z6BA 4AEQA 1RJOA 2KXGA 2IMJA 4WP5A 3CC73 1N8R4 2OWPA 4NHFA 3MG2A 1JJ22 4K1UA 1AVKA 1DMMA 3EC9A 3X3ZA 4CCVA 1OHPA 1Q814 3FZWA 1WNHA 1N5HA 3N54B 1TUHA 1IVXA 3ER7A 1ROVA 4EV5A 3SXXA 2FGTA 3D9RA 1E3VA 3OWSA 2WGQA 4LMIA 3CMA3 3K7CA 5EVHA 1SPUA 4J8TA 3X42A 2CFDA 4ORLA 1VQ43 4O8SA 3B8LA 2P0MA 3LT8A 3OW22 1C7HA 3X3XA 2W04A 2CK3H 4XDVA 3CME3 2QGUA 3LT9A 3T8NA 3BNBA 1D6YA 1GYBA 1JV2B 1W6CA 3NQYA 4HM2B 1OH0A 4NREA 5IEOA 5FW5A 2SBLA 5CF1A 3LYGA 3NM2A 3QRDA 3N8BA 4R80A 3GZYB 4G1MB 1O7GB 3WOEB 4HM6B 1ASKA 3KFQC 5IG0A 8CHOA 2LQVA 2KCDA 2RCDA 2E2VA 2CH9A 1VQ83 3CPOA 4FCMA 3CCM3 5AEUB 1LNHA 2Z76A 3B4PA 1L5GB 3LXUX 2WO0A 1NDOB 2OQEC 1W4NA 2GU1A 4HM5B 4RNYA 4HJLB 3BB9A 2P09A 3T8UA 2I9WA 1VQP3 2GEYA 2CFLA 1S5AA 3F9SA 5IG5A 1QJGA 2W56B 3LOYA 5IERA 3S28A 3DXOA 4BTWA 1QVG2 2QA43 2V1LA 1HU9A 4LGQA 3MWZA 5G2GA 3EB8A 3JUMA 3LMLA 4HM4B 1IVVA 1AR0A 1R4CA 4X2OA 3WODG 1N8QA 3EBTA 3CCE3 3TDGA 3HI7A 1A2VA 3QK9A 5IG3A 4BTYA 2YFLB 3Q90A 3FLJA 3MHEA 1ZX2A 1NU3A 3OX9A 4EV2A 4ZM8A 4H61A 1RRLA 5IENA 1FGOA 4I4KA 1N5PA 2PNCA 3NBBA 3G4S3 1IV7A 1IT8A 2CFKA 3OV4A 3CCU3 1VQO3 1A90A 3GZRA 1IQ8A 2B24B 4L8PA 2JQ5A 1W02A 4XDWA 2IUKA 4OVMA 3WA3A 2WOHA 5AYSC 3F14A 2CHCA 5ELJA 4RZMA 2OTJ3 4HBRA 3GZXB 1W6YA 2OCTA 4N6TA 2M7OA 4HVNA 1K41A 3MSOA 4O02B 2BMRB 4WHAA 1S723 1FUWA 5DRVA 1RKYA 1W2B2 3PS8A 2A15A 4Q53A 3LH4A 5FGOA 2RGQA 3SOAA 3G16A 3DUKA 1SJWA 5AYRB 2P0XA 3KZTA 3RGAA 3ROBA 4AKYA 1LXEA 3CCS3 3EE1A 3EF8A 3PGBA 3DGOA 3SOYA 2CG1A 1YJN3 4QWTA 3FKAA 4MJDA 1TP6A 1VQL3 5JPPA 3LTCA 3D3LA 3FF2A 1O7MB 1AV4A 1US1A 1OHOA 3A76A 3JUPA 2BO9B 2OQEA 3BLZA 1WMNA 3K63A 2XRXB 3FG3A 2XSHB 3B4OA 2BNGA 3H3HA 1YGEA 2GBXB 2Z77A 1E97A 3UB1A 2GEXA 1D6ZA 2ZDJA 4X2HA 1WTHA 2F86B 1IU7A 3HZPA 1WMOA 1IK3A 1VQ63 2ML6A 1O7WB 3BNEA 4WWUC 3CCR3 3I563 2JDIH 3VSYA 3JUOA 5IW9A 3PCRA 1O7PB 1STDA 3S29A 1Q824 3S27A 3V98A 3G8ZA 3K9MC 5IEPA 3GRDA 4FMAA 5AIHA 3FG4A 1GY5A 2GU3A 3UL6A 1M1XB 2W9PA 2HMLB 4O3VA 3B7CA 5CF2A 1TU5A 5LC6A 4FCZA 5A0OB 1VQK3 2K0MA 1W5ZA 4J9AA 2XF3A 1KWIA 1JKGB 2QIYA 1EA2A 3SVAA 4HZ9B 1EG9B 2OOVA 4EXRA 1GY7A 3V92A 2L4VA 1Q42A 3KN4A 3L0RA 1Q7Y4 2F98A 2IA7A 3F7SA 4N6OB 1IQXA 2WGOA 1JB5A 2Y74A 3EN1B 3MG1A 4KZ1A 3IMAB 3Q1CA 4PEJA 5BXQA 2E2TA 2HMOB 3NV0B 4N6V0 5AIIA 3GWRA 5KP1A 4HZBB 1OUNA 1J2BA 1FGQA 2BMOB 2B1XB 2XR8B 1WQLB 1K734 2CIUA 3UJMA 2STDA 1OCVA 1OF5B 2XFSA 1GD3A 1SIHA 1GY6A 2PZVA 1LOXA 3DGLA 1JB2A 4KVHA 4R1KA 1NO3A 1QALA 4HM7B 4LZIA 4MMZB 4FMDA 5EEOA 1YIJ3 3JUQA 1YI23 3CD63 4L7KA 3IPTA 1FGRA 1OHSA 2RFRA 1W2ZA 4XBXA 1WMPA 2W6JH 2INXA 2F99A 3G0KA 2YFJB 3EJVA 2P05A 3V99A 1OF5A 1OGXA 3K0ZA 1G96A 4FCJA 4JF8A 3EQQB 5AEWB 2D42A 4KFDA 3LTAA 1Y4KA 1DVDA 2Y73A 3FH1A 4MMXB 1AVLA 5ELUA 3SEDA 1ULJB 5HGRA 1KSIA 2BMQB 1IDPA 3CNMA 1UUVB 2W03A 2CG0A 1K28A 1TIJA 2BT3A 2CC3A 3CCJ3 4K1VA 3NBRA 1SIIA 1ULIB 2R4IA 5D83A 1OPYA 5BVBA 1TFKA 5KP3A 2RSXA 3O8YA 4KFFA 1M1K4 1VQ93 1M904 4R9LA 1EQKA 1QMAA 2HMKB 3DGNA 1YJW3 3I553 1UI8A 1YVBI 3WOFB 1DYUA 2W2CA 2WOFA 3ALAA 1E3RA 3CU3A 3UNLA 3FGYA 2FXTA 2CWUA 3DY5A 4BTXA 3EN8A 3OWYA 1UI7A 3NBJA 3KSPA 4KFEA 4HKVB 3IJEB 5CLKA 4K61A 3DM8A 3M8CA 3VGNA 3F40A 1RRHA 4HYZA 4MMYB 2LYXA 2Q07A 2XSOB 2FNQA 3G6E3 3S5CA 2QEX3 1EKMA 4WYKA 4K90B 3F7XA 3WMDA 3BNDA 1PU4A 4N6UA 2XGNA 5EQLA 2OTL3 5IG4A 1SQWA 4STDA 3CC43 5STDA 3E99A 4IPBA 1UUWB 3U97A 2CWVA 1KC84 1IT7A 3VF1A 1VQ53 1D6UA 3HX8A 3KIIA 3CCL3 1W01A 2XGLA 3MPHA 4XM4A 2KRTA 3I0YA 3CC23 3H51A 1JRQA 3FG1A 3KKGA 1NWWA 1IVUA 3X40A 3EX9A 2CWTA 5D82A 4RBNA 2D1WA 2O9UX 1N9EA 4GL6A 1Q40A 2CKFB 3HK4A 4HM0B 5IF6A 4JRFA 2W9QA 3EHCA 2HMMB 2XFTA 3NM7A 1JN5A 1CEWI 2C11A 1N9JA 2ZL8A 5TGNA 1KD14 1LVNA 1HKXA 1W00A 3GAXA 4EBGA 1YJ93 1O7NB 4EYCA 3MKIA 4N3VA 3LTBA 1PFPA 4N6NB 1MOLA 2GXFA 4L8OA 1BUQA 1CYUA 4LSOA 3X3YA 1MNLA 2W56A 5CXOA 3LZAA 3NXJA 3PXMA 1IQYA 3KSED 3NV0A 3DMCA 3DGMA 2HMNB 1K8A4 6STDA 1A2KA 1STFI 2YX9A 2HMJB 1W6GA 3ECFA 3FSDA 4HM1B 3U1WA 4LEHA 3RGRA 1DVCA 1JKGA 1V74A 2GBWB 4XBTA 4OK0A 1TFOA 5DREA 1ZO2A 5JBSA 1VQN3 4FMBA 4GB5A 3T0UA 3NUVA 2Z7AA 1VQ73 1QAFA 3DZLA 2UX0A 1W7CA 4HM3B 1FGTA 1IV9A 3F8HA 3FCSB 1VZZA 2OOVC 3RDEA 2ML5A 3PYJA 5JPUA 4FR9A 3F8XA 3NQZA 3S67A 1CQSA 1F8NA 3GZBA 1U5OA 1IVWA 4MEIA 3JVCA 3MYTA 3Q2PA 3CPW2 2W0QA 4WFOA 2YFIB 3NX0A 4WYKB 4N6MA 4HM8B 1DMNA 3OWUA 1FGMA 3PZWA 1GS3A 1OACA 1YIT3 5LC7A 2CFWA 3OXAA 4XB5A 3HIIA 1ISKA 4EC6A 1FA3A 3UL5A 1YHQ3 2E2UA 5D81A 4U13A 3N9HA 1K9M4 1U8CB 2K54A 4OUQA 5AI1A 7STDA 4N6LA 1UW1A 4XBYA 1NJI4 5CK6A 4TX4A 1NB5I 1QVF2 3KE7A 1JB4A 3CXC2 1QAKA 2XEPA 4FMCA 3G713 1GD4A 2BHMA 1Z1SA 3WDGB 4AKZA 2CW9A 2XH9A 4CDLA 1T5YA 2C10A 3MG3A 5I97A 1NB3I 1RN7A 1JN5B 5AIGA 4IT7A 2MC8A 1M9GA 3CCQ3 1KQS2 3WA2X 2CFGA 2P38A 4IIAA 3CNXA 1A67A 3J7Yd 3CCV3 1JNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ 3;  1YIJ 3;  1Q86 4;  1YJW 3;  3CCE 3;  3I55 3;  1YI2 3;  1K9M 4;  1JJ2 2;  3CD6 3;  3CCR 3;  1NJI 4;  1YJN 3;  3I56 3;  1Q81 4;  1VQM 3;  1Q7Y 4;  1VQP 3;  1QVF 2;  1VQL 3;  1Q82 4;  2OTL 3;  3CXC 2;  1S72 3;  1KD1 4;  3CC4 3;  3G71 3;  3CMA 3;  1W2B 2;  3CPW 2;  1VQN 3;  1YJ9 3;  1VQ8 3;  1KC8 4;  3G4S 3;  1VQ7 3;  3CCU 3;  1VQ9 3;  1VQO 3;  1VQ5 3;  1QVG 2;  3CCL 3;  2QA4 3;  1K73 4;  1VQ4 3;  1YIT 3;  3CCM 3;  1VQ6 3;  3OW2 2;  1VQK 3;  3CC2 3;  3CCQ 3;  1KQS 2;  3CCJ 3;  3CC7 3;  1N8R 4;  3G6E 3;  1K8A 4;  3CCV 3;  3CME 3;  1M1K 4;  2QEX 3;  1YHQ 3;  3CCS 3;  1M90 4; 
#chains in the Genus database with same CATH topology
 3JUN A;  5KP4 A;  1OGZ A;  3K5T A;  1Q86 4;  1NNV A;  3BNC A;  3EBY A;  3STD A;  4J5G A;  2L1S A;  2O3O A;  4R9K A;  1ROA A;  2IUJ A;  3SLU A;  3AMO A;  4H3U A;  1VQM 3;  1O7H B;  3PCS A;  3HIG A;  1CYV A;  1Q40 B;  1GSP A;  1DMQ A;  4RNZ A;  4O2H A;  1V57 A;  3FF0 A;  1G0T A;  3SX1 A;  2MF7 A;  4R4K A;  3X41 A;  1JBR A;  1I3I A;  5AIF A;  3NHX A;  3AMO B;  3LTD A;  2Z6B A;  4AEQ A;  1RJO A;  2KXG A;  2IMJ A;  3URP A;  1LOY A;  4WP5 A;  3CC7 3;  1N8R 4;  2OWP A;  4NHF A;  1RGG A;  3MG2 A;  1RN1 A;  1X1X A;  4K1U A;  1AVK A;  1DMM A;  3EC9 A;  1RGA A;  5GSP A;  3X3Z A;  4CCV A;  1JJ2 2;  1OHP A;  3ZG5 A;  1Q81 4;  3FZW A;  1WNH A;  1N5H A;  3N54 B;  1TUH A;  1IVX A;  3ER7 A;  1ROV A;  4EV5 A;  2GSP A;  3SXX A;  2FGT A;  3D9R A;  1E3V A;  3OWS A;  2WGQ A;  4LMI A;  3CMA 3;  3K7C A;  5EVH A;  1SPU A;  4J8T A;  3X42 A;  2CFD A;  4ORL A;  1YNV X;  1VQ4 3;  4O8S A;  3B8L A;  2P0M A;  3LT8 A;  3OW2 2;  1BRS A;  1C7H A;  4ILF A;  3X3X A;  1BSE A;  2W04 A;  2CK3 H;  2RNT A;  4XDV A;  3CME 3;  2QGU A;  3LT9 A;  3T8N A;  3BNB A;  1JBS A;  1D6Y A;  1GYB A;  1JV2 B;  1W6C A;  3NQY A;  4HM2 B;  1OH0 A;  4NRE A;  5IEO A;  5FW5 A;  2SBL A;  5CF1 A;  3LYG A;  3NM2 A;  3QRD A;  3N8B A;  4R80 A;  3GZY B;  4G1M B;  1O7G B;  3WOE B;  4HM6 B;  1ASK A;  3KFQ C;  5IG0 A;  8CHO A;  2LQV A;  2KCD A;  2RCD A;  2E2V A;  2CH9 A;  1VQ8 3;  1C54 A;  3CPO A;  3DH2 A;  4FCM A;  3CCM 3;  5AEU B;  1LNH A;  2Z76 A;  3B4P A;  1BRK A;  1L5G B;  3LXU X;  1BRN L;  2WO0 A;  1NDO B;  2OQE C;  1W4N A;  2GU1 A;  4HM5 B;  4RNY A;  4HJL B;  3BB9 A;  1I8V A;  2P09 A;  3T8U A;  2I9W A;  1VQP 3;  1DET A;  1Q7H A;  1TJD A;  2GEY A;  2H0H A;  2CFL A;  1S5A A;  3F9S A;  1BSC A;  1B2M A;  4I5Q A;  5G1L A;  5IG5 A;  1PY3 A;  1QJG A;  2W56 B;  3LOY A;  5IER A;  3S28 A;  3DXO A;  4BTW A;  1QVG 2;  2QA4 3;  2V1L A;  1HU9 A;  4LGQ A;  1LQG C;  3MWZ A;  1BOX A;  3EB8 A;  3JUM A;  2R41 A;  3LML A;  3Q3F A;  5G2G A;  4HOH A;  1GOV A;  1UDI I;  4HM4 B;  1AQZ A;  2H0I A;  1AR0 A;  1IVV A;  1R4C A;  4X2O A;  4CJN A;  6GSP A;  3WOD G;  1N8Q A;  3EBT A;  3CCE 3;  1X1Y A;  1RGH A;  3TDG A;  4KT3 B;  3HI7 A;  1A2V A;  3QK9 A;  5IG3 A;  1T2H A;  4BTY A;  1BAN A;  2YFL B;  3Q90 A;  3FLJ A;  3MHE A;  1ZX2 A;  1NU3 A;  3OX9 A;  4EV2 A;  4ZM8 A;  4H61 A;  1RRL A;  5IEN A;  1FGO A;  4I4K A;  1N5P A;  2PNC A;  3NBB A;  3G4S 3;  1IV7 A;  1IT8 A;  2CFK A;  1UGH I;  3OV4 A;  3CCU 3;  1VQQ A;  1VQO 3;  1A90 A;  3GZR A;  1IQ8 A;  2B24 B;  4L8P A;  8RNT A;  1IYY A;  3D5I A;  2JQ5 A;  1W02 A;  4XDW A;  2IUK A;  4OVM A;  1MWU A;  3WA3 A;  2WOH A;  5AYS C;  1RGK A;  1A2P A;  2CHC A;  3F14 A;  4RZM A;  1I70 A;  4HBR A;  5ELJ A;  2OTJ 3;  3D5G A;  3GZX B;  1W6Y A;  1RTU A;  2OCT A;  4N6T A;  2M7O A;  3HOH A;  1K41 A;  3MSO A;  1Q9E A;  4HVN A;  4O02 B;  1TTO A;  2BMR B;  4WHA A;  1S72 3;  1RNT A;  5DRV A;  1FUW A;  1RKY A;  1W2B 2;  3PS8 A;  2A15 A;  5BU4 A;  1B2Z A;  4Q53 A;  3LH4 A;  5FGO A;  2RGQ A;  3SOA A;  2KAA A;  3G16 A;  3DUK A;  1SJW A;  5AYR B;  2P0X A;  3KZT A;  3RGA A;  3ROB A;  4AKY A;  1LXE A;  3CCS 3;  1V58 A;  3EE1 A;  3EF8 A;  3PGB A;  3DGO A;  3ZG0 A;  1BIR A;  3SOY A;  1FZU A;  2CG1 A;  1YJN 3;  4QWT A;  3AHW A;  3FKA A;  4MJD A;  1TP6 A;  4J5K A;  2J8X B;  1VQL 3;  5JPP A;  3LTC A;  3D3L A;  3FF2 A;  1O7M B;  3D79 A;  1EUI C;  1AV4 A;  1US1 A;  1OHO A;  1T3B A;  3A76 A;  3JUP A;  2BO9 B;  2OQE A;  3BLZ A;  1B20 A;  1UCI A;  1WMN A;  1FYS A;  2XRX B;  2XSH B;  3B4O A;  2BNG A;  3FG3 A;  3K63 A;  3H3H A;  1YGE A;  4CPK A;  2GBX B;  2Z77 A;  1B27 A;  1RCK A;  3BIR A;  1E97 A;  3UB1 A;  2GEX A;  1D6Z A;  2KF5 A;  2ZDJ A;  4X2H A;  1WTH A;  2F86 B;  1IU7 A;  3HZP A;  1WMO A;  1IK3 A;  1VQ6 3;  1B2S A;  2ML6 A;  1O7W B;  3BNE A;  4WWU C;  3CCR 3;  3I56 3;  2JDI H;  1LQM B;  3VSY A;  1RLS A;  3JUO A;  1GMP A;  1LRA A;  1GMR A;  1O7P B;  1STD A;  3PCR A;  5M1A A;  3S29 A;  5IW9 A;  1RDS A;  3S27 A;  1BAO A;  1Q82 4;  3V98 A;  3G8Z A;  3K9M C;  4HAA A;  5IEP A;  3GRD A;  4FMA A;  5AIH A;  5HOH A;  1LOV A;  3FG4 A;  1GY5 A;  2GU3 A;  4GSP A;  3UL6 A;  1M1X B;  2W9P A;  2HML B;  2HOH A;  3B7C A;  4O3V A;  4RNT A;  5CF2 A;  1TU5 A;  5LC6 A;  4FCZ A;  5A0O B;  1VQK 3;  2K0M A;  1FUS A;  1W5Z A;  4J9A A;  5M19 A;  1BNF A;  1BNS A;  1KWI A;  1BNJ A;  1JKG B;  2QIY A;  2XF3 A;  1BRG A;  1B2X A;  1EA2 A;  1JZO A;  3SVA A;  4HZ9 B;  1EG9 B;  2OOV A;  4EXR A;  1GY7 A;  3V92 A;  2L4V A;  1Q42 A;  3KN4 A;  3L0R A;  1Q7Y 4;  2F98 A;  1DE3 A;  1RGF A;  2IA7 A;  3F7S A;  4N6O B;  1IQX A;  2WGO A;  1FUT A;  1MGW A;  1JB5 A;  2Y74 A;  3EN1 B;  2KF4 A;  3MG1 A;  4KZ1 A;  3IMA B;  1I0X A;  3Q1C A;  4PEJ A;  5BXQ A;  2E2T A;  2HMO B;  3NV0 B;  1LOW A;  4N6V 0;  5AII A;  3GWR A;  1I2F A;  5KP1 A;  4HZB B;  1OUN A;  1J2B A;  1FGQ A;  2BMO B;  2B1X B;  1JBT A;  2CX0 A;  2XR8 B;  1WQL B;  2F56 A;  1K73 4;  2CIU A;  3UJM A;  2STD A;  1LNI A;  2AAD A;  1OCV A;  1OF5 B;  2XFS A;  1GD3 A;  1SIH A;  1GY6 A;  2PZV A;  1LOX A;  3DGL A;  1RHL A;  1R4Y A;  1RNB A;  1JB2 A;  4KVH A;  4R1K A;  1NO3 A;  1MWR A;  1QAL A;  4HM7 B;  4LZI A;  4MMZ B;  4FMD A;  5EEO A;  1YIJ 3;  1BU4 A;  3JUQ A;  1YI2 3;  3CD6 3;  4L7K A;  1RN4 A;  3IPT A;  2UUG C;  1FGR A;  1OHS A;  2F5M A;  2RFR A;  2H0G A;  1W2Z A;  4XBX A;  1WMP A;  2W6J H;  2C4B A;  2INX A;  2F99 A;  3G0K A;  1UUG B;  2YFJ B;  2P05 A;  3EJV A;  1OF5 A;  1OGX A;  1UGI A;  3V99 A;  3K0Z A;  1G96 A;  1G02 A;  4FCJ A;  3EQQ B;  4JF8 A;  5AEW B;  2D42 A;  4KFD A;  3LTA A;  1Y4K A;  1JZD A;  1RMS A;  1DVD A;  2KF6 A;  3AGN A;  2Y73 A;  3FH1 A;  4MMX B;  1AVL A;  5ELU A;  3SED A;  1BNG A;  1ULJ B;  1ZS7 A;  1KSI A;  5HGR A;  2BMQ B;  1IDP A;  3CNM A;  1UUV B;  2W03 A;  2CG0 A;  1K28 A;  1TIJ A;  2BT3 A;  2CC3 A;  5M18 A;  4K1V A;  3NBR A;  1SAR A;  1SII A;  3CCJ 3;  1ULI B;  2IY2 A;  2R4I A;  1OPY A;  5D83 A;  1TFK A;  5KP3 A;  5BVB A;  2RSX A;  3O8Y A;  4KFF A;  1M1K 4;  1VQ9 3;  1M90 4;  4R9L A;  4EW5 A;  1B21 A;  4NPB A;  1EQK A;  1QMA A;  2HMK B;  3DGN A;  1YJW 3;  3I55 3;  2ZHX B;  1UI8 A;  1B2U A;  1YVB I;  3WOF B;  1MWS A;  1DYU A;  2W2C A;  2WOF A;  2BIR A;  1BNI A;  3ALA A;  1E3R A;  2F4Y A;  3CU3 A;  3UNL A;  3FGY A;  2FXT A;  2CWU A;  1GMQ A;  3DY5 A;  4BTX A;  3EN8 A;  7GSP A;  3OWY A;  1X1W A;  1UI7 A;  3NBJ A;  3KSP A;  4KFE A;  4HKV B;  3IJE B;  5CLK A;  1FW7 A;  4K61 A;  3DM8 A;  3M8C A;  1UCJ A;  1PYL A;  3F40 A;  3VGN A;  1RRH A;  1RGE A;  4HYZ A;  4MMY B;  2LYX A;  2Q07 A;  2XSO B;  2FNQ A;  3G6E 3;  3S5C A;  2QEX 3;  3D4A A;  1EKM A;  1AY7 A;  4WYK A;  4GHO A;  3GSP A;  4K90 B;  3SYU A;  3F7X A;  1EEJ A;  3BND A;  3WMD A;  1PU4 A;  1BSA A;  2K3D A;  4N6U A;  2XGN A;  5EQL A;  2OTL 3;  5BIR A;  5IG4 A;  1SQW A;  4STD A;  3CC4 3;  5STD A;  1BSD A;  3E99 A;  4IPB A;  1UUW B;  3U97 A;  2CWV A;  3RNT A;  1KC8 4;  1IT7 A;  3VF1 A;  1VQ5 3;  1D6U A;  3HX8 A;  3KII A;  3CCL 3;  1BRJ A;  1W01 A;  2XGL A;  3MPH A;  4XM4 A;  1TRP A;  2KRT A;  3I0Y A;  3CC2 3;  3H51 A;  1JRQ A;  2BU4 A;  3WHO A;  3FG1 A;  3KKG A;  1NWW A;  1IVU A;  2AAE A;  3X40 A;  3EX9 A;  2CWT A;  5D82 A;  4RBN A;  2D1W A;  2O9U X;  1N9E A;  4GL6 A;  1Q40 A;  2CKF B;  1UCK A;  3HK4 A;  4HM0 B;  5IF6 A;  4JRF A;  2W9Q A;  3EHC A;  5G1K A;  2HMM B;  2XFT A;  3NM7 A;  1JN5 A;  1CEW I;  2C11 A;  1N9J A;  2ZL8 A;  1RSN A;  5TGN A;  1KD1 4;  1LVN A;  1HKX A;  1W00 A;  1RGC A;  3GAX A;  4EBG A;  1YJ9 3;  1O7N B;  4BL2 A;  3MKI A;  4N3V A;  4EYC A;  3LTB A;  1PFP A;  3BU4 A;  1HZ1 A;  4N6N B;  1MOL A;  1I3F A;  2GXF A;  4L8O A;  1BNE A;  1BUQ A;  2F5W A;  1CYU A;  4LSO A;  3X3Y A;  1MNL A;  2W56 A;  5CXO A;  3LZA A;  1BSB A;  3NXJ A;  3PXM A;  1IQY A;  3KSE D;  3NV0 A;  3DMC A;  3DGM A;  2HMN B;  1K8A 4;  6STD A;  1A2K A;  3A5E A;  1STF I;  2YX9 A;  3AGO A;  1MWT A;  2HMJ B;  1W6G A;  3ECF A;  1BNR A;  1TRQ A;  3FSD A;  1T2I A;  4HM1 B;  3U1W A;  4LEH A;  3RGR A;  1DVC A;  1JKG A;  1V74 A;  2GBW B;  4XBT A;  3WR2 A;  4OK0 A;  1TFO A;  1GOU A;  5DRE A;  1ZO2 A;  5JBS A;  1VQN 3;  4FMB A;  4GB5 A;  3T0U A;  3NUV A;  2Z7A A;  1VQ7 3;  1QAF A;  3DZL A;  2UX0 A;  1W7C A;  4HM3 B;  4DKI A;  1UCL A;  1GOY A;  2IYJ A;  1FGT A;  1IV9 A;  3F8H A;  3FCS B;  1VZZ A;  4LYL B;  2OOV C;  9RNT A;  3RDE A;  2ML5 A;  3PYJ A;  2SAR A;  5JPU A;  4FR9 A;  3F8X A;  3NQZ A;  3S67 A;  2KF3 A;  1CQS A;  1I2G A;  2CX1 A;  1F8N A;  3GZB A;  1U5O A;  1IVW A;  4MEI A;  3JVC A;  1RGL A;  3MYT A;  3Q2P A;  3CPW 2;  2W0Q A;  4WFO A;  2YFI B;  1B3S A;  1I2E A;  3NX0 A;  4WYK B;  4N6M A;  4HM8 B;  1DMN A;  3OWU A;  1BGS A;  1FGM A;  1GS3 A;  1OAC A;  3PZW A;  5LC7 A;  2CFW A;  6RNT A;  1YIT 3;  1YVS A;  3OXA A;  1BUJ A;  4XB5 A;  1BRH A;  3HII A;  1BRI A;  1I0V A;  1ISK A;  4EC6 A;  1FA3 A;  3UL5 A;  1YHQ 3;  1X1U A;  2E2U A;  5D81 A;  1BVI A;  1HYF A;  3N9H A;  4U13 A;  1K9M 4;  1U8C B;  4BU4 A;  2K54 A;  2UGI A;  4OUQ A;  5AI1 A;  4N6L A;  1UW1 A;  4XBY A;  7RNT A;  7STD A;  1NJI 4;  5CK6 A;  5RNT A;  1CH0 A;  4TX4 A;  1NB5 I;  1QVF 2;  3DGY A;  3KE7 A;  1JB4 A;  3CXC 2;  1QAK A;  2XEP A;  4FMC A;  3G71 3;  4BL3 A;  1GD4 A;  2BHM A;  1Z1S A;  3WDG B;  4AKZ A;  3ZFZ A;  2CW9 A;  2RBI A;  2XH9 A;  3KCH A;  4CDL A;  1T5Y A;  2C10 A;  3MG3 A;  2ZA4 A;  5I97 A;  1NB3 I;  1RN7 A;  4BIR A;  1JN5 B;  5AIG A;  4IT7 A;  1ZGX A;  3AHS A;  2MC8 A;  1M9G A;  3CCQ 3;  1KQS 2;  3WA2 X;  1MGR A;  2CFG A;  2P38 A;  4IIA A;  3CNX A;  1A67 A;  3J7Y d;  3CCV 3;  1RCL A;  1YGW A;  1JNQ A; 
#chains in the Genus database with same CATH homology
 3JUN A;  5KP4 A;  1OGZ A;  3K5T A;  1Q86 4;  3BNC A;  3EBY A;  3STD A;  2O3O A;  4R9K A;  3SLU A;  1ROA A;  2IUJ A;  3AMO A;  4H3U A;  1VQM 3;  1O7H B;  3PCS A;  3HIG A;  1CYV A;  1Q40 B;  1DMQ A;  4RNZ A;  4O2H A;  3FF0 A;  3SX1 A;  2MF7 A;  4R4K A;  3X41 A;  5AIF A;  3NHX A;  3AMO B;  3LTD A;  2Z6B A;  4AEQ A;  1RJO A;  2KXG A;  2IMJ A;  4WP5 A;  3CC7 3;  1N8R 4;  2OWP A;  4NHF A;  3MG2 A;  1JJ2 2;  4K1U A;  1AVK A;  1DMM A;  3EC9 A;  3X3Z A;  4CCV A;  1OHP A;  1Q81 4;  3FZW A;  1WNH A;  1N5H A;  3N54 B;  1TUH A;  1IVX A;  3ER7 A;  1ROV A;  4EV5 A;  3SXX A;  2FGT A;  3D9R A;  1E3V A;  3OWS A;  2WGQ A;  4LMI A;  3CMA 3;  3K7C A;  5EVH A;  1SPU A;  4J8T A;  3X42 A;  2CFD A;  4ORL A;  1VQ4 3;  4O8S A;  3B8L A;  2P0M A;  3LT8 A;  3OW2 2;  1C7H A;  3X3X A;  2W04 A;  2CK3 H;  4XDV A;  3CME 3;  2QGU A;  3LT9 A;  3T8N A;  3BNB A;  1D6Y A;  1GYB A;  1JV2 B;  1W6C A;  3NQY A;  4HM2 B;  1OH0 A;  4NRE A;  5IEO A;  5FW5 A;  2SBL A;  5CF1 A;  3LYG A;  3NM2 A;  3QRD A;  3N8B A;  4R80 A;  3GZY B;  4G1M B;  1O7G B;  3WOE B;  4HM6 B;  1ASK A;  3KFQ C;  5IG0 A;  8CHO A;  2LQV A;  2KCD A;  2RCD A;  2E2V A;  2CH9 A;  1VQ8 3;  3CPO A;  4FCM A;  3CCM 3;  5AEU B;  1LNH A;  2Z76 A;  3B4P A;  1L5G B;  3LXU X;  2WO0 A;  1NDO B;  2OQE C;  1W4N A;  2GU1 A;  4HM5 B;  4RNY A;  4HJL B;  3BB9 A;  2P09 A;  3T8U A;  2I9W A;  1VQP 3;  2GEY A;  2CFL A;  1S5A A;  3F9S A;  5IG5 A;  1QJG A;  2W56 B;  3LOY A;  5IER A;  3S28 A;  3DXO A;  4BTW A;  1QVG 2;  2QA4 3;  2V1L A;  1HU9 A;  4LGQ A;  3MWZ A;  5G2G A;  3EB8 A;  3JUM A;  3LML A;  4HM4 B;  1IVV A;  1AR0 A;  1R4C A;  4X2O A;  3WOD G;  1N8Q A;  3EBT A;  3CCE 3;  3TDG A;  3HI7 A;  1A2V A;  3QK9 A;  5IG3 A;  4BTY A;  2YFL B;  3Q90 A;  3FLJ A;  3MHE A;  1ZX2 A;  1NU3 A;  3OX9 A;  4EV2 A;  4ZM8 A;  4H61 A;  1RRL A;  5IEN A;  1FGO A;  4I4K A;  1N5P A;  2PNC A;  3NBB A;  3G4S 3;  1IV7 A;  1IT8 A;  2CFK A;  3OV4 A;  3CCU 3;  1VQO 3;  1A90 A;  3GZR A;  1IQ8 A;  2B24 B;  4L8P A;  2JQ5 A;  1W02 A;  4XDW A;  2IUK A;  4OVM A;  3WA3 A;  2WOH A;  5AYS C;  3F14 A;  2CHC A;  5ELJ A;  4RZM A;  2OTJ 3;  4HBR A;  3GZX B;  1W6Y A;  2OCT A;  4N6T A;  2M7O A;  4HVN A;  1K41 A;  3MSO A;  4O02 B;  2BMR B;  4WHA A;  1S72 3;  1FUW A;  5DRV A;  1RKY A;  1W2B 2;  3PS8 A;  2A15 A;  4Q53 A;  3LH4 A;  5FGO A;  2RGQ A;  3SOA A;  3G16 A;  3DUK A;  1SJW A;  5AYR B;  2P0X A;  3KZT A;  3RGA A;  3ROB A;  4AKY A;  1LXE A;  3CCS 3;  3EE1 A;  3EF8 A;  3PGB A;  3DGO A;  3SOY A;  2CG1 A;  1YJN 3;  4QWT A;  3FKA A;  4MJD A;  1TP6 A;  1VQL 3;  5JPP A;  3LTC A;  3D3L A;  3FF2 A;  1O7M B;  1AV4 A;  1US1 A;  1OHO A;  3A76 A;  3JUP A;  2BO9 B;  2OQE A;  3BLZ A;  1WMN A;  3K63 A;  2XRX B;  3FG3 A;  2XSH B;  3B4O A;  2BNG A;  3H3H A;  1YGE A;  2GBX B;  2Z77 A;  1E97 A;  3UB1 A;  2GEX A;  1D6Z A;  2ZDJ A;  4X2H A;  1WTH A;  2F86 B;  1IU7 A;  3HZP A;  1WMO A;  1IK3 A;  1VQ6 3;  2ML6 A;  1O7W B;  3BNE A;  4WWU C;  3CCR 3;  3I56 3;  2JDI H;  3VSY A;  3JUO A;  5IW9 A;  3PCR A;  1O7P B;  1STD A;  3S29 A;  1Q82 4;  3S27 A;  3V98 A;  3G8Z A;  3K9M C;  5IEP A;  3GRD A;  4FMA A;  5AIH A;  3FG4 A;  1GY5 A;  2GU3 A;  3UL6 A;  1M1X B;  2W9P A;  2HML B;  4O3V A;  3B7C A;  5CF2 A;  1TU5 A;  5LC6 A;  4FCZ A;  5A0O B;  1VQK 3;  2K0M A;  1W5Z A;  4J9A A;  2XF3 A;  1KWI A;  1JKG B;  2QIY A;  1EA2 A;  3SVA A;  4HZ9 B;  1EG9 B;  2OOV A;  4EXR A;  1GY7 A;  3V92 A;  2L4V A;  1Q42 A;  3KN4 A;  3L0R A;  1Q7Y 4;  2F98 A;  2IA7 A;  3F7S A;  4N6O B;  1IQX A;  2WGO A;  1JB5 A;  2Y74 A;  3EN1 B;  3MG1 A;  4KZ1 A;  3IMA B;  3Q1C A;  4PEJ A;  5BXQ A;  2E2T A;  2HMO B;  3NV0 B;  4N6V 0;  5AII A;  3GWR A;  5KP1 A;  4HZB B;  1OUN A;  1J2B A;  1FGQ A;  2BMO B;  2B1X B;  2XR8 B;  1WQL B;  1K73 4;  2CIU A;  3UJM A;  2STD A;  1OCV A;  1OF5 B;  2XFS A;  1GD3 A;  1SIH A;  1GY6 A;  2PZV A;  1LOX A;  3DGL A;  1JB2 A;  4KVH A;  4R1K A;  1NO3 A;  1QAL A;  4HM7 B;  4LZI A;  4MMZ B;  4FMD A;  5EEO A;  1YIJ 3;  3JUQ A;  1YI2 3;  3CD6 3;  4L7K A;  3IPT A;  1FGR A;  1OHS A;  2RFR A;  1W2Z A;  4XBX A;  1WMP A;  2W6J H;  2INX A;  2F99 A;  3G0K A;  2YFJ B;  3EJV A;  2P05 A;  3V99 A;  1OF5 A;  1OGX A;  3K0Z A;  1G96 A;  4FCJ A;  4JF8 A;  3EQQ B;  5AEW B;  2D42 A;  4KFD A;  3LTA A;  1Y4K A;  1DVD A;  2Y73 A;  3FH1 A;  4MMX B;  1AVL A;  5ELU A;  3SED A;  1ULJ B;  5HGR A;  1KSI A;  2BMQ B;  1IDP A;  3CNM A;  1UUV B;  2W03 A;  2CG0 A;  1K28 A;  1TIJ A;  2BT3 A;  2CC3 A;  3CCJ 3;  4K1V A;  3NBR A;  1SII A;  1ULI B;  2R4I A;  5D83 A;  1OPY A;  5BVB A;  1TFK A;  5KP3 A;  2RSX A;  3O8Y A;  4KFF A;  1M1K 4;  1VQ9 3;  1M90 4;  4R9L A;  1EQK A;  1QMA A;  2HMK B;  3DGN A;  1YJW 3;  3I55 3;  1UI8 A;  1YVB I;  3WOF B;  1DYU A;  2W2C A;  2WOF A;  3ALA A;  1E3R A;  3CU3 A;  3UNL A;  3FGY A;  2FXT A;  2CWU A;  3DY5 A;  4BTX A;  3EN8 A;  3OWY A;  1UI7 A;  3NBJ A;  3KSP A;  4KFE A;  4HKV B;  3IJE B;  5CLK A;  4K61 A;  3DM8 A;  3M8C A;  3VGN A;  3F40 A;  1RRH A;  4HYZ A;  4MMY B;  2LYX A;  2Q07 A;  2XSO B;  2FNQ A;  3G6E 3;  3S5C A;  2QEX 3;  1EKM A;  4WYK A;  4K90 B;  3F7X A;  3WMD A;  3BND A;  1PU4 A;  4N6U A;  2XGN A;  5EQL A;  2OTL 3;  5IG4 A;  1SQW A;  4STD A;  3CC4 3;  5STD A;  3E99 A;  4IPB A;  1UUW B;  3U97 A;  2CWV A;  1KC8 4;  1IT7 A;  3VF1 A;  1VQ5 3;  1D6U A;  3HX8 A;  3KII A;  3CCL 3;  1W01 A;  2XGL A;  3MPH A;  4XM4 A;  2KRT A;  3I0Y A;  3CC2 3;  3H51 A;  1JRQ A;  3FG1 A;  3KKG A;  1NWW A;  1IVU A;  3X40 A;  3EX9 A;  2CWT A;  5D82 A;  4RBN A;  2D1W A;  2O9U X;  1N9E A;  4GL6 A;  1Q40 A;  2CKF B;  3HK4 A;  4HM0 B;  5IF6 A;  4JRF A;  2W9Q A;  3EHC A;  2HMM B;  2XFT A;  3NM7 A;  1JN5 A;  1CEW I;  2C11 A;  1N9J A;  2ZL8 A;  5TGN A;  1KD1 4;  1LVN A;  1HKX A;  1W00 A;  3GAX A;  4EBG A;  1YJ9 3;  1O7N B;  4EYC A;  3MKI A;  4N3V A;  3LTB A;  1PFP A;  4N6N B;  1MOL A;  2GXF A;  4L8O A;  1BUQ A;  1CYU A;  4LSO A;  3X3Y A;  1MNL A;  2W56 A;  5CXO A;  3LZA A;  3NXJ A;  3PXM A;  1IQY A;  3KSE D;  3NV0 A;  3DMC A;  3DGM A;  2HMN B;  1K8A 4;  6STD A;  1A2K A;  1STF I;  2YX9 A;  2HMJ B;  1W6G A;  3ECF A;  3FSD A;  4HM1 B;  3U1W A;  4LEH A;  3RGR A;  1DVC A;  1JKG A;  1V74 A;  2GBW B;  4XBT A;  4OK0 A;  1TFO A;  5DRE A;  1ZO2 A;  5JBS A;  1VQN 3;  4FMB A;  4GB5 A;  3T0U A;  3NUV A;  2Z7A A;  1VQ7 3;  1QAF A;  3DZL A;  2UX0 A;  1W7C A;  4HM3 B;  1FGT A;  1IV9 A;  3F8H A;  3FCS B;  1VZZ A;  2OOV C;  3RDE A;  2ML5 A;  3PYJ A;  5JPU A;  4FR9 A;  3F8X A;  3NQZ A;  3S67 A;  1CQS A;  1F8N A;  3GZB A;  1U5O A;  1IVW A;  4MEI A;  3JVC A;  3MYT A;  3Q2P A;  3CPW 2;  2W0Q A;  4WFO A;  2YFI B;  3NX0 A;  4WYK B;  4N6M A;  4HM8 B;  1DMN A;  3OWU A;  1FGM A;  3PZW A;  1GS3 A;  1OAC A;  1YIT 3;  5LC7 A;  2CFW A;  3OXA A;  4XB5 A;  3HII A;  1ISK A;  4EC6 A;  1FA3 A;  3UL5 A;  1YHQ 3;  2E2U A;  5D81 A;  4U13 A;  3N9H A;  1K9M 4;  1U8C B;  2K54 A;  4OUQ A;  5AI1 A;  7STD A;  4N6L A;  1UW1 A;  4XBY A;  1NJI 4;  5CK6 A;  4TX4 A;  1NB5 I;  1QVF 2;  3KE7 A;  1JB4 A;  3CXC 2;  1QAK A;  2XEP A;  4FMC A;  3G71 3;  1GD4 A;  2BHM A;  1Z1S A;  3WDG B;  4AKZ A;  2CW9 A;  2XH9 A;  4CDL A;  1T5Y A;  2C10 A;  3MG3 A;  5I97 A;  1NB3 I;  1RN7 A;  1JN5 B;  5AIG A;  4IT7 A;  2MC8 A;  1M9G A;  3CCQ 3;  1KQS 2;  3WA2 X;  2CFG A;  2P38 A;  4IIA A;  3CNX A;  1A67 A;  3J7Y d;  3CCV 3;  1JNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...