1JZOA

Dsbc c101s
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN DSBC
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal Structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 67
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzoA02
3HJPA 1AQVA 2VLVA 3C1RA 1J08A 1BQ7A 1MDJA 4WBJA 2IMEA 4XS4B 2MMOA 4E8HA 3D0ZA 3DWVA 1XOAA 4KDXA 2AHEA 1Y25A 3BCKA 5DBQA 4EL1A 3KJYA 5IM9A 4RI6A 5DJLA 3WYWA 1T3BA 2B1LA 5JCUA 3ZMLA 1WRYA 9GSSA 4RUVA 3M9JA 3I6AA 4D73A 1EP7A 1CQHA 2BJXA 1PRXA 3GKKA 3GTUB 2JZSA 5D93A 1AQXA 2H72A 2N5AA 4G2EA 2YJ7A 2R6KA 1X5DA 4MPFA 2IWTA 3ZFLA 3UJ1A 2JU5A 5ECOB 3HCZA 2HFDA 2YP6A 4EO3A 2GDRA 3IAS2 2FA4A 4ISDA 3GKNA 5ECPB 1QK8A 3IA1A 3MNGA 2VCXA 4ML1A 4IHUA 5LNKe 3HHVA 1HQOA 3UL3A 3IV4A 5G5EA 3RBTA 4AGSA 3KXOA 1OC3A 2RLIA 3A2XA 3O76A 4OMVA 3RPPA 4MJCA 5IMCA 4NWYA 2CX3A 3UEMA 3SWLA 1QMVA 2H71A 1GNWA 4AJ8A 5ECMB 4WETA 3GX8A 6GSXA 1ABAA 4YH2A 4Q5RA 4GTUA 4YAVA 2R5GA 2LRTA 2M80A 1EGRA 4BA7A 1C72A 2YWNA 4GCIA 5DDLA 2IMIA 3CBUA 5JCWA 12GSA 2HE3A 2VAFA 1T4YA 4N11A 4OO5A 2EIRA 1TOFA 5IMFA 3I9V2 4JEDA 3HY2A 1JZRA 5IMVA 2G0FA 1T7PB 4OFNA 2I4AA 4HS1A 4K1FA 1GP1A 1GSEA 1QFNA 3ERGA 4PX1A 3TKSA 2JL4A 1WMJA 6GSSA 4HZ4A 3VFIA 1QUWA 3M3MA 4I5QA 5IO2A 1V40A 4LMVA 1Z3EA 3FZAA 1O7UA 1JZDA 1HYUA 3FR3A 3M9KA 3LXZA 3ZFBA 4XTSA 2LTKA 1XIYA 5IOXA 2KLXA 3M1GA 4YQMA 3LJRA 1V98A 1YY7A 4ML6A 3DXBA 1QQ2A 2HRFA 3F4RA 2H0GA 3D5JA 1XZOA 5HFIA 2GSTA 1F2EA 1J9BA 5D9VA 4IP1A 3QAWA 1A2JA 3HJMA 5ECNB 1OC9A 3C71A 1UN2A 2OADA 3EYTA 1NW2A 2WCIA 2CV4A 1K0MA 3KMOA 1NM3A 2GSQA 5DQSA 4ZL9A 3TJBA 1XPVA 3NZNA 5GZZB 1BYEA 2H1BA 5CAXA 4TKYA 4QL7A 1TRUA 2GZZA 1WE0A 3F3QA 3DGQA 4Q5FA 1YF0A 1PL2A 2PERA 4ZB9A 1MTCA 2HZEB 3P90A 4O92A 4PQIA 1GSSA 1EGOA 2L6DA 3KZQA 3DRNA 4JR6A 3UARA 2B6MA 2LSTA 1SD9A 2VCWA 2R37A 4V2LA 1G6WA 5D9XA 1SK1A 3EWLA 2B5XA 1O73A 1SJIA 2IL3A 3BJ5A 5A4VA 1PD21 4KW6A 4TVEA 2LRNA 3APOA 3D6IA 4I8BA 3ERFA 5CRDA 4MZBA 2JADA 4FYBA 4V1Ap 1U88A 1TXXA 1F9MA 4JR4A 2K8SA 3UVHA 4G10A 1EV9A 4PGTA 22GSA 2R2JA 4F9ZA 4ILFA 1N8JA 1K0BA 1ZMAA 1GNEA 4PNGA 17GSA 3ZL5A 1XW6A 4I2UA 4JBBA 2IIYA 1XW9A 2H01A 4Z7XA 4ZL7A 4G19A 5GAND 4MH3A 1OE8A 3QAGA 3CYNA 3C8EA 1GTIA 2B5EA 2YN1A 3TOUA 3QD9A 3HYPA 4BVXA 5A4UA 5IPGA 3HVXA 4FYUA 4F0BA 1ZCPA 1GUMA 4K8MA 2KP1A 1AXDA 5F8BA 4KDYA 4XS6A 5AGYA 3U5RE 1K3OA 2H6XA 5J9CA 5HFGA 4N0VA 3L78A 4AJ6A 5B6MA 4I6XA 2DBCA 2LKUA 3BBYA 2OJLA 2DJ3A 4I97A 1JLWA 4MZWA 18GSA 3HA9A 3H8QA 2JZTA 2J9HA 4HI7A 1MDKA 3ZTLA 2HZFA 4EF0A 3KD0A 3QAVA 4MMMA 1S3DA 2B7JA 4D73B 3HVSA 3BOAA 5ECSA 3ZVJD 2K18A 2BMXA 1R26A 3VLNA 1B48A 1HNCA 1M7TA 1AIUA 2CVKA 2XBQA 1FG4A 4KCAA 4FIWA 1OVNA 1G6YA 1EOGA 4FO5A 1SK2A 2WJUA 3LYPA 4LLRA 3PR8A 3QCPA 4V2NA 14GSA 5HR1A 5JWQB 4IKHA 1SU9A 3AY8A 5DQYA 3APQA 3ZLPA 5CP1A 4KNDA 1TTZA 4MK3A 2C80A 1XOBA 5ECHB 3Q74A 1A2MA 3G7IA 3FZ5A 4QL9A 3VI5A 2I9HA 3TRPA 1I9DA 4IJ3A 3IR4A 2IY2A 3F6DA 1TKDB 2K6VA 2O8VB 1XWKA 1Z7RA 2QC7A 1OE7A 3LXTA 2H0IA 3CRUA 1XWBA 2LEGA 3A2WA 5DAKA 4KE3A 5DVBA 3UIWA 4TN8A 3TKPA 3CSIA 1B4QA 1WP0A 1EZKA 2F8AA 5AIXA 1FO5A 2H70A 4DSSA 2RIIA 2B5YA 2WGRA 3GV1A 2IFQA 2CT6A 2Z9SA 3GUSA 2E7PA 3QPMA 2C8UA 2KOKA 4POKA 3ZRDA 3HDCA 1SJ6A 2H75A 4L5LA 4TR1B 3VPQA 4OCEA 4WR5A 4MH2A 1TK5B 4H86A 4EC0A 5KN1A 4TR4A 1TI1A 3MWHA 2HRNA 1B9XC 2GQMA 1F6MC 3N9JA 1VRSD 4N0ZA 1R5PA 1FHEA 5F06A 1R7HA 3ZREA 1TRSA 3ZYWA 2BTOT 2HXKA 5IO0A 5D9WA 4KX4A 3HZ8A 2J23A 2K9FA 3EVIA 4X43A 3C73A 2MMZA 1YKAA 4EXJA 1V9WA 2C0EA 2L4CA 2YJHA 1ON4A 1DE2A 4HJMA 3DD3A 4EVMA 2C3NA 3WGXA 5J3RA 2B1KA 2HI7A 3FYGA 4LA1A 4HDEA 2LNTA 3UVTA 1G0TA 2EC4A 4IGJA 2VO4A 2REMA 4OFMA 2R4VA 5HFKA 3L9VA 2H76A 2XC2A 1BAYA 3DIEA 4TXOA 3QFBC 1WPIA 4O32A 2H73A 2OACA 2PGTA 2CVDA 3Q6OA 1W4VA 2C4JA 1K0AA 1GWCA 3BD2A 3IHQA 4OFTA 3F63A 3TGZA 1QGVA 2DSAA 4MF7A 3GKMA 1RQMA 1OAZA 1TU7A 1FB6A 5ID2B 4ZBBA 3GH6A 4IQ1A 2FLSA 1HD2A 4BPYA 3UBLA 4WF4A 4Q5QA 2D2ZA 4K6XA 1KEBA 2C3QA 1SK0A 2GZPA 3HD5A 5B7CA 1OKTA 4N30A 4ECJA 1GTAA 2R3XA 1BX9A 3A2VA 1O85A 5FT3A 4TOPA 2YPMA 1O6JA 5INYA 4OD7A 2FNOA 3FHKA 19GSA 2CAQA 2OA7A 3LFLA 2A4VA 2TRCP 1YDKA 1XW5A 2DJ2A 4ECCA 4LL4B 2L4QA 1H75A 4P3YB 3UBKA 4TR0A 3RPNA 4IS0A 1YEPA 4MABA 1PX6A 2OE3A 4IQAA 1HNBA 1JZOA 2VL3A 2B3SA 4NV5A 4GWRA 3RDWA 1BJXA 1TW9A 3TKQA 6GSWA 1TU8A 4F2IA 1FAAA 2P5RA 3F4SA 4KAEA 3IK9A 2GSRA 3QDNA 2C0DA 3V1WA 5IPHA 4BWSA 2VIMA 4XS4A 2LUSA 3LEFA 1IYHA 2H66A 2DJKA 3IDVA 4EDZA 4I2TA 1TK0B 2GGTA 1M0UA 3GRXA 4MJAA 5KEJA 2OBKA 2IYJA 4J2FA 5D9TA 2ZCTA 3FKFA 1GLPA 4MDCA 5DALB 4GQCA 3KM6A 3IC4A 5ABRA 2IMFA 1SENA 2N5FA 2M46A 5G31A 5LD0A 2VLTA 2YZHA 1MD4A 5G2ZA 2LQOA 4EE0A 1OC8A 4MF6A 3ZZXA 3WT2A 3ZITA 1VF2A 1THXA 4XCSA 4XHMA 5IIZA 4PURA 4LL1B 1K0CA 2XBIA 1DE1A 2CQ9A 4LMWA 4POBA 1O81A 3E9JB 4PXOA 1O8WA 4GF0A 3VK9A 3LSZA 2RM5A 3TKRA 2X8CA 4NHWA 4WBRD 4DVCA 3GL3A 2OE0A 2L6CA 4POMA 2AAWA 5ECIB 3A5WA 2XPEA 3M0FA 4F82A 1QXHA 1HNAA 2O7KA 2KUCA 1GSDA 4ZXGA 4ZBDA 4AJ7A 1ACVA 1AW9A 3TUEA 3W6GA 2X8GA 2P0GA 1ERWA 1SYRA 5JWRB 3EURA 2ZNMA 3P8WA 1KBNA 3Q18A 3FZ9A 1A8YA 3WT1A 3K8NA 2TIRA 1YZXA 4PQHA 10GSA 2JZRA 2GS3A 4HZ2A 2FHEA 4F0CA 4O7HA 3ZMKA 4XS1A 1PGTA 3US3A 1M9BA 4KDUA 2VD0A 3TCOA 1SKRB 5ECRB 1Z6MA 3G9BA 3R2QA 2AYTA 1PSQA 3LGCA 1SJZA 1O8XA 2H1DA 3Q19A 1VF1A 3IRAA 3IAM2 2MMNA 2V1MA 4EDYA 2F51A 3F8UA 2GZYA 3MSZA 4X1UA 5AN1A 3VWWA 2YWOA 3D21A 5IMZA 2JSZA 2HLSA 2O89A 2OE1A 2DC5A 3C1SA 4YAPA 2O85A 3G7YA 4POLA 4ZB6A 1ML6A 2IMDA 1FVKA 3GKXA 4IP6A 2A2RA 2LV3A 2H1GA 3ZVJA 3H79A 2E0QA 2YCDA 4GRFA 2GLRA 1JZWA 4NPBA 3DKSA 1ZYEA 4ZIJA 2QGVA 3NIVA 3UAPA 2OBIA 1SKSB 1M2BA 4ID0A 4OCFA 2IPAA 4CHSA 3S9FA 1WWJA 1MDIA 1A23A 1T8EB 2AV4A 2AB6A 5G1KA 2H30A 3DMLA 1S3AA 3E3EA 3GFKA 1UVZA 3F3RA 16GSA 1AC1A 3KEBA 5E59A 5HR2A 5JWOB 4GSTA 2DIYA 1X9WB 2HSYA 4KCEA 2H19A 3PINA 11GSA 5CREA 1EWXA 5ECKB 2FWFA 4GQFA 1PN9A 5CRWA 2HZEA 2IN3A 4RI7A 1GL8A 1TK8B 3TOTA 3H4KA 4HOJA 3TRXA 4NMUA 2GQKA 1U3IA 4NV2A 2LJRA 4WEYA 3SBCA 5J4UA 3EU4A 1THOA 3HZ4A 4OWYA 5EY6A 4MA9A 4KSOA 4ZILA 1GTUA 1Q4JA 1T00A 2P5QA 3ERWA 3WD6A 1EP8A 2DMMA 5ECLB 1KNGA 3KTBA 1SL2B 2PMTA 1Z9HA 1ERVA 1EOHA 1MD3A 2F9SA 1U3AA 4ZB8A 1AAZA 2CA8A 2FY6A 4CW9A 4XRAA 3W8SA 1H4OA 3HKRA 3GHAA 4MJEA 4MCUA 5LCZA 4IJIA 1BEDA 3FZ4A 4N10A 3LQ7A 1X9MB 1SYXA 2YANA 2H6YA 2L57A 1XBSA 3FY7A 1GULA 8GSSA 2M72A 3FK8A 1GSUA 3IOSA 4K7NA 2C1YA 1GRXA 1K0DA 3KH9A 2LRCA 2P31A 1EV4A 6GSVA 5DCGA 5ELGA 1XXUA 5ENUA 2V32A 1ZL9A 1XVQA 5B6NA 1ERTA 1PA3A 3ISOA 3P7XA 2AJQB 1K3YA 3TJJA 3IPZA 1DBYA 1LU4A 2V41A 1GUHA 4NAXA 2FCHA 1B8XA 4L8EA 1I5GA 1NHOA 3TKSE 3KIJA 5HQPA 2F3MA 2HNLA 2K8VA 5EPFA 1YEXA 1ST9A 2WFCA 3CRTA 3KTLA 4NXIA 4WF5A 2L5LA 1NSWA 5D73A 2LJKA 3TJGA 4L0UA 3WGDA 3GIXA 2PU9C 1F3AA 4YQVA 3L4NA 1JFUA 3G7JA 1GTBA 1R4WA 4WKWA 5IQYA 1J0FA 4JZQA 4YQUA 3WGEA 2PN8A 3EC3A 4JRRA 3VPTA 2AUVA 5CO3A 1SL0B 4IN0A 5B8BA 4V1Ag 2KP2A 1X5EA 4RQRA 2CX4A 4V2MA 3LORA 4DEJA 1DUGA 3QOUA 1F3BA 1WIKA 5H5SA 4ECBA 4OO4A 4FYCA 1OC9B 3GNJA 3EE2A 4O5RA 2V2GA 4IBPA 3IK7A 3A3TA 5H5RA 1OYJA 3F0IA 3E0UA 1PX7A 2WDUA 1S3CA 1VF3A 4JU5A 4PNFA 2C0GA 2C0FA 1GSQA 2RM6A 5J5NA 2N5BA 4KH7A 2FD3A 5FHIA 4MF5A 1LJRA 1PKZA 1RK4A 1CQGA 2C3TA 3ZIVA 3KGKA 3L9UA 2WS2A 2VUPA 2NPBA 1Z7PA 3GX0A 2VLUA 1G7OA 3DYRA 4EKZA 1GSYA 1FOVA 1FVJA 2VL2C 3GH9A 3UMAA 2PVQA 3CXGA 2X8HA 2I1UA 2GQLA 2WZ9A 3U6VA 2FWEA 2WB9A 3DVWA 3D4MA 2HT9A 3OR5A 3VWUA 4ACSA 2H0HA 4BVYA 4PQ1A 3TJFA 1V2AA 2YV9A 2JSYA 2LS5A 3HVVA 2B7KA 3H93A 4FH8A 4TR1A 5GSSA 1TJDA 2QSIA 3MDKA 3VURA 3LG6A 5AIVA 3VWXA 3W8JA 3PH9A 1TRWA 4MZCA 5CRHA 3EU3A 1EEMA 5GSTA 1G7EA 1K0OA 2VCZA 5FWGA 4KB3A 2G2QA 13GSA 3F4TA 2GVPA 2WRTA 4IELA 3ME7A 2PBJA 2KHPA 1B9YC 1X9SB 5H5QA 1ERUA 5CRGA 3IBHA 5A5KA 5CYYA 3MAKA 3F6FA 3CMIA 1UA5A 5L71A 2XHFA 1BG5A 1YQ1A 5C00A 3HXSA 3NOFA 5HR0A 1PQNA 1SD8A 4F03A 3ED3A 2TRXA 4HU7A 5EVOA 1VF4A 2DIZA 2GT6A 1N2AA 2WULA 1YF1A 3GTUA 5IOWA 3I43A 1JLVA 1YKCA 1F37A 2LNSA 3CTFA 2PVOC 1Z6NA 4MPGA 4WXTA 2A2SA 3HJOA 1TDIA 1JHBA 2CVBA 2ALBA 3N5OA 5EL8A 2VL9A 3APSA 5F07A 4HJ2A 3CSHA 5CNWA 6GSTA 5KN0A 3QMXA 1V58A 4ZBAA 4WR4A 1XWGA 4ECIA 1T1VA 5E4WA 1T4ZA 6GSYA 1R5AA 3EINA 2L59A 4RQXA 4GLTA 4GXZA 4PUFC 1ZOFA 3QFAC 2CZ2A 4XIHA 4QQ7A 3I69A 3F9UA 5ID2A 2E2MA 1Z5YE 2FUG2 3GMFA 4TR3A 1SL1B 6GSUA 2CZ3A 2F8FA 1WOUA 2YZUA 3GURA 2NBSA 4BWQA 2H8LA 7GSSA 2PWJA 4TW5A 1TP9A 4HQSA 3UOMA 1B4PA 4NHZA 4ULXA 4MLYA 3TJKA 3CTGA 2VD1A 4HUAA 4HU9A 4MP4A 3FR9A 2H6ZA 2NVLA 1XWCA 2V6KA 2O87A 3GSTA 1A0RP 4E8EA 1IYIA 2HSHA 4IW9A 4K9ZA 2IMKA 2DJJA 1DSBA 5G1LA 2L5OA 5JCGA 1NHYA 4Q5NA 1VGLA 3J7Yb 4XRDA 2H74A 1A2LA 3L0HA 1M2DA 1M9AA 1A8LA 1V57A 3GSSA 5COHA 2FWGA 3DVXA 1AQWA 1XVWA 5F05A 2MYGA 1SKWB 1ILOA 4ZL8A 5DAKB 3PGTA 2VM1A 4KUNA 3CSJA 2ON5A 20GSA 4DSRA 4DSSB 2IFQB 1ZZYA 2FGXA 5J41A 2VL2A 1Q98A 4AF2A 5C04A 2HYXA 5G30A 3M8NA 1FW1A 5J9BA 5KN3A 2VCTA 1URMA 2GTUA 3TDGA 2MBTA 1U6TA 2LQQA 5G5FA 2JACA 2RUEA 1GSFA 2E2GA 1KTEA 2VOCA 4JE1A 5DCHA 5DALA 4EUYA 3P2AA 3KH7A 2GT5A 1UC7A 3H1NA 4K7IA 2ZUPA 2NDOA 4K0GA 3LYKA 1A0FA 1PKWA 4MJBA 5GAPD 5AISA 3KMNA 3FR6A 3L9SA 1X0RA 2YWMA 1OKDA 1PMTA 4IVFA 3QR6A 2DMLA 2ES7A 2DJ1A 3LWAA 3D22A 3DEXA 1ZYQB 4KGIA 3IE3A 2V6OA 1K0NA 1E2YA 3TRQA 2EIOA 2VCVA 4GSNA 4TRXA 4X0XA 3EMPA 2MZCA 4HQZA 5DJMA 4PUAA 5KN2A 1AUCA 1W89A 3FRCA 1M2AA 3GYKA 4L5OA 4J57E 1GH2A 2X64A 3FEUA 2VM2A 4TXOB 2MBSA 1ZGNA 5HR3A 2I3YA 3O6TA 1M99A 1MEKA 5IMAA 2EIQA 3J7Yk 3D4TA 1TI3A 3EMXA 4K2DA 2YWIA 5D96A 5A4WA 3JCML 1XCCA 1XFLA 4GSSA 1GLQA 3ZIJA 2XPDA 1XWAA 1A24A 3TB2A 4G9HA 4DSQA 3RHBA 3RAZA 4KA0A 5D8IA 5IMDA 3TKSC 1RW1A 1LBKA 2I81A 3C7MA 2VCQA 3ME8A 3GN3A 3KP9A 4KSMA 5B8AA 1EEJA 1YJ6A 2DLXA 2NTOA 1TRVA 3GA4A 3IXRA 4BL7A 3VWVA 4HEA2 4TXVA 2FWHA 2OKAA 2ON7A 2YV7A 4K7OA 2QKEA 2CAIA 2IJYA 4K0NA 3KCMA 2PUKC 1USBA 1WJKA 1U87A 1GUKA 2LJAA 5ELAA 2X99A 5F0GA 3BCIA 1Y6EA 3O3TA 3GL5A 1FB0A 2YNXA 2MMAA 1X5CA 3FW2A 4L0WA 1PL1A 1K3LA 2PPTA 2YOIA 2H1AA 2GSSA 3RHCA 5ECQB 3KP8A 1E6BA 2DJ0A 4CDOA 3VI7A 2RUFA 4J56E 2FA8A
chains in the Genus database with same CATH superfamily
3MHEA 3HJPA 1LQGC 1AQVA 2VLVA 1RLSA 2XSHB 3C1RA 4LYLB 1J08A 1M9GA 1BQ7A 1MDJA 4WBJA 5IG4A 3EPTA 2IMEA 4XS4B 2MMOA 2BT3A 3DGLA 3D0ZA 3DWVA 3OWUA 1M3IA 4E8HA 1XOAA 4KDXA 3SLUA 1Y25A 2AHEA 3BCKA 5DBQA 4EL1A 3EN8A 3KJYA 4KF9A 2M7OA 4USSA 5IM9A 4RI6A 4FQUA 5D82A 1ASKA 1JJ22 5DJLA 3WYWA 2CG0A 1T3BA 2B1LA 5JCUA 3K7CA 1FYSA 1WRYA 3ZMLA 1FUTA 9GSSA 4RUVA 3M9JA 3I6AA 4D73A 1EP7A 1ROVA 1CQHA 2BJXA 1PRXA 3GKKA 3GTUB 2JZSA 5D93A 1AQXA 3PCRA 7GSPA 1VQ83 2H72A 5AIIA 2N5AA 4G2EA 2YJ7A 3X3YA 4BL2A 2R6KA 1ULIB 1X5DA 4MPFA 1IQXA 2IWTA 3ZFLA 3HVNA 3UJ1A 2JU5A 5ECOB 3HCZA 3EB8A 3CD63 5AIFA 2HFDA 2YP6A 3MSOA 4EO3A 1MWTA 2GDRA 5KOWA 3IAS2 4ORLA 2WO0A 3WHOA 5KP1A 2FA4A 4ISDA 3GKNA 3UB1A 1QK8A 1BSCA 3EBTA 5I97A 5ECPB 4G1MB 3IA1A 2ML6A 3MNGA 2VCXA 4ML1A 4IHUA 5LNKe 3HHVA 4N6V0 1HQOA 1RN7A 3UL3A 3IV4A 3JUPA 4O02B 5G5EA 3RBTA 4AGSA 3KXOA 1GY5A 1IYYA 1BIRA 1OC3A 2RLIA 3A2XA 1O7HB 3O76A 4OMVA 2OCTA 4KFEA 3RPPA 4MJCA 1VQQA 5IMCA 4X2OA 4NWYA 2CX3A 2ZDJA 2B1XB 3UEMA 3SWLA 1QMVA 2YFIB 2H71A 1GNWA 1LNHA 4AJ8A 5ECMB 4WETA 2XRXB 2F56A 3JUMA 3LTDA 3MG3A 3GX8A 6GSXA 1ABAA 2Z6BA 4YH2A 4Q5RA 4GTUA 4YAVA 2R5GA 2LRTA 3SOYA 2M80A 1EGRA 1OF5A 1WMOA 4BA7A 1C72A 2YWNA 4GCIA 5DDLA 2IMIA 1MOLA 3V98A 3CBUA 5JCWA 1W7CA 12GSA 2HE3A 2VAFA 1T4YA 4N11A 4CCVA 4OO5A 1IVVA 3WMDA 1SJWA 2F5WA 2EIRA 3G713 1TOFA 5IMFA 3I9V2 2W56A 1QAKA 4JEDA 3HY2A 2HRKA 1JZRA 5AYRB 1VQ93 2G0FA 2WOFA 5IMVA 1KWIA 1T7PB 4OFNA 2C4BA 2I4AA 4HS1A 4IIAA 1GP1A 4PEJA 1GSEA 1EKMA 1QFNA 3ERGA 4K1FA 4PX1A 3TKSA 4RZMA 1UI7A 2JL4A 2L1SA 1WMJA 6GSSA 3JUOA 4HZ4A 3VFIA 2A15A 1QUWA 3M3MA 4I5QA 5IO2A 3FMWA 1JV2B 1V40A 2CW9A 4LMVA 1VQ43 2FXTA 2O9UX 1Z3EA 5CLKA 3M8CA 3FZAA 4Z2UA 1O7UA 2C11A 1JZDA 1HYUA 3FR3A 1NB5I 3M9KA 1LOVA 3CCR3 4L8PA 3LXZA 3ZFBA 4XTSA 2LTKA 3IHGA 1XIYA 5IOXA 2KLXA 3M1GA 2CWVA 4YQMA 3LJRA 1V98A 3MWZA 1YY7A 4ML6A 1O7WB 4HBRA 3DXBA 1QQ2A 2HRFA 3F4RA 2H0GA 3D5JA 3SEDA 2P0MA 1MWRA 1XZOA 5HFIA 1JKGB 3DZLA 2GSTA 2JQ5A 1F2EA 1J9BA 5D9VA 4FR9A 4IP1A 3QAWA 1OH0A 1A2JA 4FCMA 2W03A 4GB5A 3HJMA 5ECNB 4LEHA 1OC9A 2UUGC 3WOEB 3C71A 1UN2A 2OADA 3EYTA 1NW2A 2WCIA 4O2HA 2CV4A 1K0MA 1D6YA 2GXFA 3DUKA 3KMOA 4G0KA 3EX9A 1NM3A 2GSQA 2F99A 5DQSA 3NBRA 5BVBA 1DETA 4XB5A 4ZL9A 3TJBA 1XPVA 3NZNA 5GZZB 1GOVA 1BYEA 2H1BA 1LVNA 1RGLA 3ZG5A 5CAXA 4TKYA 3RNTA 1BRNL 4QL7A 2HMLB 1TRUA 1RNTA 2GZZA 1WE0A 3F3QA 3DGYA 2BU4A 5CK6A 3DGQA 4Q5FA 1G02A 1YF0A 1PL2A 2PERA 4ZB9A 3MYDA 1MTCA 2HZEB 3P90A 4O92A 4PQIA 1B2UA 4CY8A 2K54A 3G4S3 2WOHA 2XF3A 1GSSA 1EGOA 3PCSA 2L6DA 3KZQA 2P0XA 3DRNA 4JR6A 3UARA 2B6MA 3H51A 2LSTA 1A2KA 3X40A 1SD9A 3X3ZA 1DMMA 1LOXA 3RGAA 2VCWA 2R37A 4V2LA 4EC6A 1YVSA 2ML5A 1G6WA 1GD3A 1MWSA 3OXAA 5D9XA 1SK1A 3EWLA 2B5XA 4KZ1A 1O73A 1SJIA 2IL3A 4K1VA 3BJ5A 5A4VA 5AEUB 1PD21 4KW6A 1EQKA 4TVEA 2LRNA 3CCM3 3APOA 3D6IA 4I8BA 1Q40B 5CF1A 3ERFA 3AMOA 5CRDA 1QVF2 2V1LA 1CH0A 4MZBA 2JADA 4FYBA 2RBIA 4V1Ap 1VQ53 2DKIA 1U88A 4K61A 3R3EA 4BTXA 1TXXA 2SBLA 1F9MA 4JR4A 1MGRA 2K8SA 3UVHA 1I0XA 4G10A 3LW9A 1EV9A 1B3SA 4H61A 4PGTA 22GSA 2R2JA 4F9ZA 5KP3A 5RNTA 4ILFA 1N8JA 1K0BA 1ZMAA 1GNEA 4PNGA 3UJMA 3I553 17GSA 3ZL5A 1XW6A 3HOHA 1JNQA 3GRDA 3GWRA 4I2UA 4JBBA 2IIYA 1XW9A 2H01A 4Z7XA 4ZL7A 4G19A 5GAND 4MH3A 1OE8A 3QAGA 3CYNA 4WYKA 3C8EA 1GTIA 2B5EA 4K90B 2YN1A 3TOUA 3QD9A 3HYPA 5G2GA 3D3LA 4BVXA 5A4UA 5IPGA 3HVXA 3NM2A 1MNLA 3Q1CA 4FYUA 4F0BA 1ZCPA 9RNTA 1GUMA 4K8MA 2BMQB 2KP1A 1AXDA 5F8BA 2CWUA 1Q42A 3AGNA 3OX9A 1N5HA 4KDYA 4XS6A 1SARA 5AGYA 1US1A 3U5RE 1K3OA 2H6XA 5J9CA 5HFGA 4N0VA 3LZAA 3L78A 4N6TA 4AJ6A 5B6MA 4I6XA 2DBCA 2GSPA 4J8TA 1Q7Y4 2LKUA 3BBYA 2OJLA 2DJ3A 1BANA 2P09A 4HM0B 1VQM3 4I97A 1JLWA 1VQ63 4MZWA 3PPUA 18GSA 3HA9A 2RGQA 4CDLA 3H8QA 2JZTA 2J9HA 4HI7A 1MDKA 3ZTLA 2HZFA 3BU4A 3H3HA 5IENA 3FH1A 4AKYA 4EF0A 3KD0A 2XSOB 3QAVA 4MMMA 1YGEA 1BNFA 5IERA 1S3DA 2B7JA 1DMQA 4D73B 3HVSA 3BOAA 3CC23 1N9EA 5ECSA 3ZVJD 2K18A 4XBTA 2BMXA 1R26A 3VLNA 3DM8A 1B48A 1HNCA 1M7TA 1S5AA 1AIUA 2CVKA 2XBQA 2RFRA 4G0IA 3BNBA 1F8NA 1FG4A 1JB4A 4KCAA 4U13A 4FIWA 1OVNA 1YJN3 3LT9A 3KSED 1RGEA 8CHOA 1G6YA 3EF8A 1EOGA 4FO5A 1SK2A 2WJUA 3LYPA 4LLRA 3QK9A 3PR8A 4O8SA 3QCPA 3SVAA 4V2NA 14GSA 3BLZA 5HR1A 5JWQB 5BRTA 4IKHA 1LOWA 1SU9A 3AY8A 1RGHA 5DQYA 3APQA 2ZA4A 1BAOA 1TUHA 3ZLPA 2C10A 4KT3B 5CP1A 4KNDA 1TTZA 4MK3A 1GS3A 2C80A 1NWWA 1WQLB 4NREA 2F98A 1XOBA 1YNVX 5ECHB 2QEX3 3Q74A 1KC84 1A2MA 3G7IA 3DGNA 3FZ5A 4QL9A 3VI5A 2I9HA 3TRPA 1I9DA 4IJ3A 3FLJA 2IY2A 1VQN3 1BRKA 1NU3A 3F6DA 3IR4A 1TKDB 1UGIA 3S67A 4BIRA 2K6VA 2O8VB 1XWKA 1Z7RA 1W01A 1QAFA 5M19A 1T5YA 2QC7A 1BVIA 1OE7A 3NV0A 3LXTA 2H0IA 2SARA 3CRUA 1GY6A 3EC9A 1O7MB 1XWBA 4NHFA 2LEGA 3A2WA 5DAKA 4KE3A 5DVBA 3UIWA 4TN8A 3TKPA 3CSIA 1B4QA 4FMDA 1WP0A 1GY7A 3HI7A 1EZKA 2F8AA 1W00A 5AIXA 2H70A 1FO5A 3VF1A 4DSSA 4HYZA 2B5YA 2RIIA 2WGRA 3GV1A 2IFQA 2CT6A 3OWSA 4BVYB 1B2ZA 2Z9SA 3GUSA 2E7PA 3FCSB 3QPMA 2C8UA 2KOKA 5EQLA 1I70A 4POKA 3ZRDA 2W9PA 1SJ6A 1A2PA 2H75A 3HDCA 3K63A 4L5LA 4TR1B 3VPQA 5KP4A 1BUJA 1AV4A 4OCEA 4WR5A 4MH2A 1TK5B 5EVHA 4R9KA 1YIJ3 4H86A 4EC0A 5KN1A 4EV5A 2GEYA 4TR4A 1TI1A 3MWHA 2HRNA 1B9XC 4OUQA 2GQMA 1F6MC 3N9JA 1VRSD 2OWPA 4N0ZA 1R5PA 1FHEA 5F06A 2LYXA 1RHLA 1R7HA 1OHOA 3BIRA 3ZREA 1NJI4 1ULJB 1TRSA 3ZYWA 3MG1A 1JBSA 2BTOT 2HXKA 1YJ93 5IO0A 1L5GB 3NQZA 2W0QA 5D9WA 4KX4A 1SPUA 3HZ8A 2J23A 2K9FA 3EVIA 4X43A 5D83A 3C73A 2MMZA 5IG3A 3VGNA 3HIGA 1YKAA 4EXJA 2HRAA 1T2IA 2F86B 1V9WA 2C0EA 2L4CA 3D5IA 2YJHA 5BU4A 5AEWB 1ON4A 1DE2A 4HJMA 1SQWA 3DD3A 1CYUA 4RNTA 1Q864 4EVMA 2C3NA 4ICYA 3RGRA 1RDSA 4O5QA 3WGXA 3ER7A 1I2FA 5J3RA 2B1KA 2HI7A 2BHMA 1ZS7A 3N9HA 4BU4A 3FYGA 4LGQA 4LA1A 1JBRA 4HDEA 2LNTA 3GZYB 3UVTA 1G0TA 4EBGA 2EC4A 4IGJA 3HX8A 3A5IA 2VO4A 4CY6A 3ZG0A 1FUSA 1C7HA 3A5EA 1M904 4BL3A 2CK3H 1DVDA 2REMA 1TP6A 4MMXB 4OFMA 2R4VA 5HFKA 3L9VA 2H76A 2XC2A 1IVXA 1BAYA 3DIEA 4TXOA 4FMCA 3UL5A 3DY5A 3QFBC 3Q90A 1BSDA 3KE7A 1WPIA 4O32A 3STDA 2H73A 1RTUA 4KFDA 1BRGA 2OACA 2PGTA 2CVDA 1DVCA 3Q6OA 1W4VA 2C4JA 1K0AA 2CFKA 1GWCA 3BD2A 3IHQA 2IUKA 4OFTA 3F63A 3G8ZA 3TGZA 1QGVA 2DSAA 4MF7A 1I2EA 3GKMA 1RQMA 1OAZA 1TU7A 1FB6A 5ID2B 1UCLA 4ZBBA 3GH6A 4IQ1A 2FLSA 1HD2A 4BPYA 5FGOA 3UBLA 2I9WA 4WF4A 4Q5QA 2QA43 2D2ZA 2GU3A 3A76A 4K6XA 1KEBA 2C3QA 1SK0A 2GZPA 3HD5A 3IPTA 1OUNA 1RGKA 1YJW3 2HMJB 4FMBA 3JUQA 5B7CA 2X4AA 1OKTA 3ECFA 1VQO3 4N30A 4ECJA 1GTAA 2R3XA 1BX9A 1RGCA 1O85A 3A2VA 5FT3A 4TOPA 2YPMA 1O6JA 5INYA 4OD7A 2FNOA 3FHKA 19GSA 2CAQA 2OA7A 3FG3A 3LMLA 3LXUX 3FF0A 3LFLA 2A4VA 3WR2A 2TRCP 1RRHA 1YDKA 2XGNA 3Q3FA 1XW5A 5M18A 1W6YA 3F9SA 4MEIA 2DJ2A 3T0UA 4ECCA 4LL4B 1O7NB 3N54B 1NO3A 1XG8A 3NXJA 2KF4A 2L4QA 1H75A 1I3FA 4P3YB 3UBKA 4HM6B 4TR0A 3RPNA 4IS0A 1PU4A 1YEPA 4MABA 1CQSA 2OOVC 1PX6A 2OE3A 1HU9A 1BOXA 3F40A 1AVLA 4IQAA 1HNBA 1JZOA 2VL3A 2B3SA 1E97A 4STDA 4NV5A 4GWRA 3RDWA 3FKAA 1BJXA 1TW9A 3TKQA 6GSWA 1B27A 1TU8A 4F2IA 1FAAA 2P5RA 3F4SA 4J5GA 4KAEA 1FGMA 2R41A 1FGTA 5IEOA 3JVCA 1W02A 3IK9A 1HYFA 2GSRA 4MNNA 3QDNA 2C0DA 1AQZA 3F8HA 3V1WA 3KCHA 1RRLA 5IPHA 4BWSA 3CCV3 2VIMA 1WNHA 4XS4A 3CNXA 2LUSA 1U5OA 1W6CA 3LEFA 1IYHA 1TU5A 1EG9B 2DJKA 2H66A 3IDVA 4EDZA 1RNBA 2J8XB 4OVMA 3F7XA 3NHXA 4AKZA 3CU3A 1ZO2A 4I2TA 2CKFB 1BSBA 5A0OB 1TK0B 2GGTA 1M0UA 3GRXA 4MJAA 2B24B 5KEJA 1STFI 2OBKA 2IYJA 4J2FA 2CHCA 5D9TA 2ZCTA 3FKFA 1GLPA 4MDCA 3CCU3 1HZ1A 5DALB 4GQCA 3KM6A 1EUIC 3NBJA 1BRJA 2GU1A 5DRVA 5KOXA 3ROBA 3V92A 3IC4A 1YIT3 1VZZA 5ABRA 2IMFA 1SENA 2N5FA 2M46A 5G31A 3WOFB 5LD0A 2VLTA 2YZHA 4PTSA 1MD4A 5G2ZA 2CFDA 4L7KA 2LQOA 4EE0A 1OC8A 4MF6A 3ZZXA 3WT2A 3CCL3 2OTL3 3I563 3U1WA 3X41A 3ZITA 1VF2A 1Q824 4J5KA 1THXA 4XCSA 4XHMA 5IIZA 4PURA 4LL1B 1K0CA 4GL6A 2XBIA 1DE1A 1RN4A 2CQ9A 1N5PA 4LMWA 4POBA 1O81A 1OCVA 3E9JB 4CPKA 4PXOA 1O8WA 4GF0A 3VK9A 2Y73A 3LSZA 2RM5A 3TKRA 2X8CA 4NHWA 4WBRD 4DVCA 2O3OA 3CME3 2MF7A 3GL3A 2OE0A 5M1AA 4R1KA 3UL6A 4EV2A 1PN0A 2L6CA 4POMA 4Z2TA 2LQVA 1UW1A 2AAWA 5ECIB 3A5WA 2XPEA 2XH9A 1IV7A 3NQYA 3M0FA 3FZWA 4F82A 1QXHA 1HNAA 2O7KA 3B4PA 2KUCA 1GSDA 1LRAA 4ZXGA 4WHAA 4ZBDA 4XBYA 4AJ7A 4R4KA 1X1YA 4HM5B 1ACVA 1AW9A 3EE1A 3TUEA 3W6GA 2X8GA 2P0GA 1ERWA 3F8XA 1SYRA 5JWRB 2INXA 3EURA 2Y74A 2ZNMA 3P8WA 5D81A 1KBNA 3CMA3 1KQS2 3Q18A 3FZ9A 4N6MA 1A8YA 3WT1A 3K8NA 2ZL8A 2TIRA 1YZXA 1JB2A 4PQHA 1PFPA 1SIHA 1VQL3 2JZRA 4FCZA 10GSA 3CPOA 2GS3A 1CEWI 4HZ2A 2FHEA 4F0CA 1OHSA 1M1K4 4O7HA 3ZMKA 3WA2X 1O7PB 4XS1A 3B7CA 3GSPA 1PGTA 1VQK3 3US3A 1M9BA 4KDUA 4BL7B 2VD0A 3TCOA 1SKRB 5ECRB 1Z6MA 2CH9A 3G9BA 5BMUA 3R2QA 2AYTA 1PSQA 3LGCA 5BXQA 1SJZA 1O8XA 2H1DA 1TTOA 3Q19A 3NV0B 1VF1A 3IRAA 1J2BA 3IJEB 3IAM2 4HAAA 1GMRA 2MMNA 2V1MA 4EDYA 2F51A 3F8UA 4YKGA 1IVUA 1RMSA 2GZYA 1TRPA 3MSZA 4RBNA 4X1UA 5AN1A 3VWWA 2YWOA 3D21A 1BNSA 1BNRA 5IMZA 2JSZA 1G96A 2HLSA 1DYUA 2PZVA 2O89A 2OE1A 2STDA 2DC5A 3C1SA 1IK3A 4YAPA 2O85A 3G7YA 2R0CA 4POLA 4ZB6A 1ML6A 2IMDA 1FVKA 3GKXA 4IP6A 4EXRA 2A2RA 1AR0A 2CX0A 4X2HA 3MG2A 2LV3A 3KKGA 1IT7A 3PZWA 3OWYA 2H1GA 3ZVJA 3WA3A 3MIXA 4EIQA 3H79A 2E0QA 3BB9A 2YCDA 7RNTA 2OQEC 4GRFA 3LTBA 2GLRA 1JZWA 1JKGA 4NPBA 2OOVA 3DKSA 1ZYEA 4ZIJA 2GEXA 2QGVA 3NIVA 4G0LA 3IMAB 3LTAA 3Q2PA 3EBYA 3K5TA 1I0VA 4HM1B 3UAPA 2OBIA 1SKSB 3QRDA 1M2BA 4ID0A 3FF2A 4OCFA 2IPAA 3S28A 1RCKA 4CHSA 1Y4KA 3S9FA 2RNTA 1WWJA 1MDIA 1A23A 1T8EB 2AV4A 2AB6A 5G1KA 1PY3A 2H30A 3DMLA 4HKVB 1FGRA 4XDWA 2KF3A 1S3AA 3E3EA 3CXC2 3GFKA 1RGFA 1UVZA 3F3RA 16GSA 1AC1A 3KEBA 1UUWB 5E59A 5HR2A 1R4YA 5JWOB 4X4JA 1A67A 3J7Yd 2ZHXB 4GSTA 2DIYA 1X9WB 1BNJA 2HSYA 2QA2A 4KCEA 2H19A 3PINA 1ISKA 11GSA 5CREA 3LTCA 1EWXA 2YX9A 4BIKA 2PNCA 1DE3A 5ECKB 2QIYA 5JBSA 2FWFA 4GQFA 1PN9A 5CRWA 2HZEA 1K9M4 2IN3A 4RI7A 1K41A 1GL8A 1TK8B 3TOTA 3CCE3 3H4KA 3EHCA 2CFWA 4HOJA 3TRXA 4NMUA 2GQKA 1U3IA 4K2XA 4NV2A 3GZBA 2LJRA 4WEYA 3SBCA 1NB3I 2QGUA 3PXMA 1UCJA 3FGYA 5J4UA 5EEOA 3EU4A 1THOA 1W6GA 3B4OA 1IQYA 1N9JA 3HZ4A 4OWYA 3MPHA 5EY6A 1GOUA 4MA9A 3G0KA 4KSOA 1CYVA 5ELJA 4ZILA 1GTUA 1Q4JA 1T00A 2D42A 8RNTA 2P5QA 3ERWA 3WD6A 3SX1A 1Q40A 1ZYNA 1W5ZA 1EP8A 2DMMA 5ECLB 2HOHA 1KNGA 3KTBA 1SL2B 1W4NA 6GSPA 4N6OB 2PMTA 2FNQA 1Z9HA 1ERVA 1EOHA 6STDA 1MD3A 2F9SA 1U3AA 4ZB8A 1AAZA 3BNDA 4AEQA 2CA8A 2FY6A 4CW9A 1IT8A 4XRAA 3W8SA 1H4OA 3HKRA 1RCLA 4I4KA 3GHAA 4HJLB 4MJEA 4MCUA 5LCZA 4IJIA 3WDGB 2IUJA 1BEDA 4XBXA 3KZTA 5AIGA 3FZ4A 3VSYA 4N10A 5LC6A 3LQ7A 1X9MB 1SYXA 2YANA 2W04A 2H6YA 2L57A 1XBSA 3FY7A 1YI23 1GULA 8GSSA 5JPPA 2M72A 3FK8A 3LH4A 5AI1A 1GSUA 1AVKA 3IOSA 5IF6A 5IG5A 4K7NA 1OF5B 2C1YA 1GRXA 1K0DA 3KH9A 2LRCA 2P31A 1EV4A 4LMIA 6GSVA 3UNLA 2HMNB 4MJDA 5DCGA 1XXUA 5ENUA 5ELGA 2V32A 1MWUA 1ZL9A 4GSPA 1XVQA 5B6NA 1OHPA 1ERTA 1PA3A 2AADA 3SXXA 3ISOA 2W56B 3FG1A 1B2XA 3P7XA 2FGTA 2WGOA 2AJQB 3K9MC 1K3YA 3TJJA 3IPZA 2A4HA 1DBYA 1LU4A 1JB5A 1GUHA 2V41A 4NAXA 3AHWA 1B8XA 2FCHA 4L8EA 1I5GA 1NHOA 1Q9EA 3TKSE 3KIJA 5HQPA 2F3MA 1ZYPA 2HNLA 4HM3B 2K8VA 1YEXA 5EPFA 1ST9A 1W2ZA 2WFCA 2DKHA 2RCDA 3CRTA 5AIHA 3FG4A 3KTLA 4NXIA 4WF5A 2L5LA 1NSWA 5D73A 2LJKA 3TJGA 4L0UA 3WGDA 2MC8A 3GIXA 2Z76A 1JN5A 1UDII 1F3AA 2PU9C 4YQVA 3L4NA 4MMZB 1JFUA 3G7JA 1GTBA 1R4WA 4WKWA 5IQYA 1J0FA 4JZQA 4YQUA 3WGEA 2PN8A 3EC3A 2BO9B 4JRRA 3VPTA 4Z2RA 2AUVA 4HZBB 5IEPA 4BTYA 5CO3A 2P38A 1SL0B 4H3UA 4IN0A 3AHSA 5STDA 5B8BA 4V1Ag 1W2B2 2KP2A 2BMRB 3KSPA 1X5EA 3FSDA 2KCDA 4RQRA 1A90A 2CX4A 3K0ZA 1UUGB 4V2MA 3LORA 1BSEA 1NDOB 4DEJA 1DUGA 3QOUA 1OGXA 1F3BA 4ZM8A 2OQEA 1WIKA 3OV4A 1RGAA 5H5SA 4KFFA 4ECBA 4OO4A 4FYCA 1OC9B 3GNJA 3EE2A 4O5RA 2V2GA 4IBPA 5AYSC 3IK7A 3A3TA 5H5RA 3L0RA 5IW9A 1OYJA 3T8NA 3F0IA 3E0UA 2E2VA 1D6ZA 3CPW2 1PX7A 2WDUA 1S3CA 4LSOA 1VF3A 4JU5A 4PNFA 1BRHA 2C0GA 5FW5A 1YHQ3 2C0FA 4HM4B 1UCIA 1GSQA 2GBWB 1MGWA 2RM6A 5J5NA 2N5BA 4KH7A 2FD3A 5FHIA 4MF5A 3CCJ3 1LJRA 1PKZA 1RK4A 1BNIA 1CQGA 2C3TA 3ZIVA 3KGKA 3L9UA 2WS2A 2VUPA 2NPBA 1Z7PA 3HK4A 3GX0A 2VLUA 1G7OA 1X1XA 1IVWA 2CFGA 3DYRA 4KVHA 1FGOA 1S723 4EKZA 1GSYA 1FOVA 1FVJA 1ZGXA 2VL2C 3GH9A 3UMAA 1E3RA 2A2PA 2PVQA 1FGQA 3CXGA 2X8HA 2GBXB 2I1UA 2GQLA 2WZ9A 4BTWA 4HSCX 3U6VA 2FWEA 2WB9A 1BNEA 3DVWA 3D4MA 2HT9A 5JPUA 3OR5A 2HSMA 3VWUA 4ACSA 1RN1A 2E2TA 2L4VA 2H0HA 4BVYA 2BMOB 4PQ1A 4Q53A 1K734 3TJFA 1V2AA 1BGSA 1HKXA 4HM2B 2YV9A 2JSYA 1K28A 2LS5A 3HVVA 2R4IA 2B7KA 3H93A 4FH8A 1WMNA 4TR1A 5GSSA 2W9QA 1TJDA 2Z7AA 1I3IA 2QSIA 3AMOB 3URPA 3MDKA 3VURA 4N6NB 3LG6A 5AIVA 3VWXA 4WWUC 3W8JA 1GMPA 3PH9A 1TRWA 1M3JA 4MZCA 5CRHA 1FW7A 3EU3A 1EEMA 1B2SA 5GSTA 1G7EA 2AAEA 1TFKA 3S27A 1K0OA 1S3RA 2VCZA 3GZRA 5FWGA 3NM7A 4KB3A 2G2QA 13GSA 4HVNA 3F4TA 3S5CA 2GVPA 3NBBA 2WRTA 4IELA 2KAAA 3ME7A 2PBJA 1TFOA 2KHPA 1B9YC 2XFSA 1X9SB 1IQ8A 3BNEA 3EN1B 5H5QA 1ERUA 2CC3A 5CRGA 3IBHA 3OW22 5A5KA 5CYYA 3EJVA 3HIIA 1K8A4 3MAKA 3F6FA 3CMIA 1UA5A 5L71A 2XHFA 1BG5A 1YQ1A 5C00A 1LNIA 3HXSA 3NOFA 5HR0A 4CJNA 2R0GA 1PQNA 3G6E3 1SD8A 4A5PA 3ED3A 4F03A 4WYKB 2TRXA 4HU7A 5EVOA 1VF4A 2DIZA 2GT6A 1N2AA 2WULA 1YF1A 3GTUA 4BVXB 5IOWA 3I43A 1JLVA 1U8CB 4OK0A 1YKCA 5GSPA 1F37A 2LNSA 1UGHI 3CTFA 1FOHA 2PVOC 1STDA 1Z6NA 4GHOA 1Q814 4MPGA 4WXTA 1GOYA 2P05A 2A2SA 3HJOA 1KSIA 1TDIA 1JHBA 4O5UA 2CVBA 2ALBA 4XM4A 3N5OA 5EL8A 2VL9A 3APSA 5F07A 4HJ2A 3CSHA 3IC8A 5CNWA 4N6LA 6GSTA 2E2UA 5KN0A 1C54A 1V58A 3QMXA 4ZBAA 1GMQA 4WR4A 1XWGA 4ECIA 1T1VA 5E4WA 2HMKB 1T4ZA 6GSYA 1R5AA 4K5SA 3B8LA 3EINA 2L59A 1A2VA 4RQXA 4GLTA 4GXZA 3S29A 4PUFC 2W2CA 1X1UA 1X1WA 1ZOFA 2CZ2A 3QFAC 2UZ8A 4XIHA 2QA1A 2XEPA 4FMAA 4IT7A 4QQ7A 3I69A 3F9UA 5ID2A 2E2MA 1Z5YE 2FUG2 3GMFA 1V74A 4TR3A 4YKFA 4QWTA 1SL1B 6GSUA 2CZ3A 2YFJB 2F8FA 1WOUA 2YZUA 3GURA 2W6JH 2NBSA 1Q7HA 1IU7A 4BWQA 2H8LA 1RKYA 7GSSA 5HOHA 3MYTA 3LYGA 2PWJA 2RSXA 1QALA 3U97A 4TW5A 1TP9A 4HQSA 3UOMA 1B4PA 4NHZA 2F4YA 4ULXA 1T2HA 1SIIA 4MLYA 2KRTA 1B2MA 3TJKA 3CTGA 2CWTA 4XDVA 2VD1A 4HUAA 3D79A 4HU9A 4MP4A 3X3XA 3FR9A 2H6ZA 2NVLA 4DKIA 3G16A 1XWCA 2V6KA 2O87A 3GSTA 1QJGA 3BNCA 2Q07A 1A0RP 1TRQA 4E8EA 1IYIA 2HSHA 2F5MA 4IW9A 1QVG2 4K9ZA 1I8VA 2IMKA 2DJJA 1DSBA 5G1LA 2L5OA 3ZFZA 1O7GB 2KF6A 2XFTA 5HGRA 5JCGA 1NHYA 4Q5NA 3CNMA 5TGNA 3DGOA 1VGLA 1Z1SA 4K5RA 3J7Yb 4XRDA 3SYUA 2H74A 1A2LA 3L0HA 3PGBA 1M2DA 1FA3A 1M9AA 1A8LA 1V57A 1BSAA 3GSSA 3E99A 2HMOB 5COHA 2FWGA 1GD4A 3DVXA 1AQWA 5BIRA 1XVWA 5F05A 2K3DA 2MYGA 1SKWB 1ILOA 4ZL8A 3LOYA 5DAKB 1IDPA 1BRSA 3PYJA 4TX4A 3T8UA 2Z77A 3PGTA 1PFOA 2VM1A 1D6UA 4KUNA 1PYLA 4IPBA 7STDA 1VQP3 3CSJA 2ON5A 20GSA 4DSRA 4DSSB 2X49A 1YGWA 2IFQB 3SOAA 3D4AA 1ZZYA 2FGXA 1LXEA 1YVBI 3KN4A 5J41A 2VL2A 3NUVA 2JDIH 1OGZA 1Q98A 5C04A 4AF2A 2CG1A 2HYXA 5G30A 3M8NA 3N8BA 1FW1A 5J9BA 5KN3A 1NNVA 2UGIA 1IV9A 1UI8A 2VCTA 4RNZA 3ALAA 1URMA 2GTUA 3TDGA 2MBTA 1U6TA 2LQQA 1FUWA 5G5FA 2JACA 2RUEA 1GSFA 4WP5A 1R4CA 2E2GA 3O8YA 1KTEA 4MMYB 2VOCA 4JE1A 5DCHA 2BNGA 5CF2A 2KXGA 5DALA 2OTJ3 3GAXA 3RDEA 4EUYA 3P2AA 3KFQC 3KH7A 1RJOA 2GT5A 1JRQA 4FCJA 3EQQB 1GYBA 1UC7A 3H1NA 4K7IA 2ZUPA 2NDOA 1JBTA 4K0GA 3LYKA 2YFLB 1A0FA 1PKWA 4MJBA 5GAPD 5AISA 3KMNA 3FR6A 3L9SA 1X0RA 4HM8B 3AGOA 2YWMA 1VQ73 2CIUA 1OKDA 1PMTA 4N3VA 4IVFA 3QR6A 1JN5B 2DMLA 2ES7A 1E3VA 1N8R4 2DJ1A 3D22A 3LWAA 3DEXA 1ZYQB 4KGIA 3D9RA 2HMMB 1BUQA 3DMCA 3IE3A 2V6OA 1K0NA 1E2YA 4EYCA 3TRQA 4LZIA 2EIOA 4R9LA 1LQMB 2VCVA 4GSNA 4O3VA 4TRXA 4X0XA 3EMPA 1N8QA 3PS8A 4WFOA 2CX1A 2MZCA 1EA2A 4HQZA 5DJMA 4K1UA 2KF5A 2D1WA 4PUAA 5KN2A 1BU4A 3NX0A 1AUCA 4HZ9B 1W89A 3FRCA 1M2AA 5IG0A 1I2GA 3CQFA 3GYKA 4RNYA 4L5OA 4J57E 4JRFA 1GH2A 3WODG 2X64A 3FEUA 2VM2A 4TXOB 2MBSA 3X42A 1ZGNA 2K0MA 1AY7A 5HR3A 2I3YA 3O6TA 4HOHA 1KD14 3MKIA 1M99A 3I0YA 3KIIA 2IA7A 1MEKA 5DREA 5IMAA 3CCQ3 2R0PA 2EIQA 3J7Yk 3D4TA 2WGQA 3V99A 3DXOA 1TI3A 6RNTA 5LC7A 3LT8A 2YWIA 3EMXA 4K2DA 5D96A 1B21A 4EIPA 1WMPA 5A4WA 3JCML 1XCCA 1XFLA 4GSSA 1GLQA 3ZIJA 2XPDA 2BIRA 1XWAA 4HM7B 4N6UA 1A24A 3TB2A 4L8OA 4G9HA 4DSQA 4J9AA 1DMNA 3RHBA 3RAZA 4KA0A 1ZX2A 5D8IA 5IMDA 1QMAA 1RSNA 3TKSC 1WTHA 1RW1A 3D5GA 1LBKA 2I81A 3C7MA 2VCQA 3ME8A 3GN3A 3KP9A 4KSMA 5B8AA 1EEJA 2UX0A 1YJ6A 2DLXA 2NTOA 1TRVA 3GA4A 3IXRA 4BL7A 1UUVB 3VWVA 4R80A 3CC73 4HEA2 3F14A 4TXVA 2FWHA 2IMJA 2OKAA 2ON7A 1OACA 2YV7A 4K7OA 2QKEA 3GZXB 1OPYA 2CAIA 2IJYA 4K0NA 3DGMA 3KCMA 1ROAA 2PUKC 1USBA 1WJKA 4JF8A 3F7SA 1U87A 3CC43 2XGLA 1GUKA 2LJAA 5ELAA 2X99A 5ELUA 5F0GA 3BCIA 1Y6EA 3O3TA 1LOYA 3GL5A 1RGGA 1FB0A 3CCS3 2YNXA 2MMAA 1X5CA 3FW2A 4L0WA 1PL1A 5CXOA 1K3LA 2PPTA 2YOIA 2H1AA 1BNGA 3DH2A 4EW5A 3HZPA 2GSSA 1M1XB 3RHCA 2XR8B 5ECQB 3KP8A 1E6BA 1BRIA 2DJ0A 3JUNA 1FZUA 1TIJA 1GSPA 1B20A 4CDOA 3VI7A 2RUFA 4J56E 2CFLA 2FA8A 1UCKA
chains in the Genus database with same CATH topology
3HJPA 1AQVA 2VLVA 3C1RA 1J08A 1BQ7A 1MDJA 4WBJA 3EPTA 2IMEA 4XS4B 2MMOA 4E8HA 3D0ZA 3DWVA 1XOAA 4KDXA 2AHEA 1Y25A 3BCKA 5DBQA 4EL1A 3KJYA 4KF9A 4USSA 5IM9A 4RI6A 4FQUA 5DJLA 3WYWA 1T3BA 2B1LA 5JCUA 3ZMLA 1WRYA 9GSSA 4RUVA 3M9JA 3I6AA 4D73A 1EP7A 1CQHA 2BJXA 1PRXA 3GKKA 3GTUB 2JZSA 5D93A 1AQXA 2H72A 2N5AA 4G2EA 2YJ7A 2R6KA 1X5DA 4MPFA 2IWTA 3ZFLA 3UJ1A 2JU5A 5ECOB 3HCZA 2HFDA 2YP6A 4EO3A 2GDRA 5KOWA 3IAS2 2FA4A 4ISDA 3GKNA 5ECPB 1QK8A 3IA1A 3MNGA 2VCXA 4ML1A 4IHUA 5LNKe 3HHVA 1HQOA 3UL3A 3IV4A 5G5EA 3RBTA 4AGSA 3KXOA 1OC3A 2RLIA 3A2XA 3O76A 4OMVA 3RPPA 4MJCA 5IMCA 4NWYA 2CX3A 3UEMA 3SWLA 1QMVA 2H71A 1GNWA 4AJ8A 5ECMB 4WETA 3GX8A 6GSXA 1ABAA 4YH2A 4Q5RA 4GTUA 4YAVA 2R5GA 2LRTA 2M80A 1EGRA 4BA7A 1C72A 2YWNA 4GCIA 5DDLA 2IMIA 3CBUA 5JCWA 12GSA 2HE3A 2VAFA 1T4YA 4N11A 4OO5A 2EIRA 1TOFA 5IMFA 3I9V2 4JEDA 3HY2A 2HRKA 1JZRA 5IMVA 2G0FA 1T7PB 4OFNA 2I4AA 4HS1A 4K1FA 1GP1A 1GSEA 1QFNA 3ERGA 4PX1A 3TKSA 2JL4A 1WMJA 6GSSA 4HZ4A 3VFIA 1QUWA 3M3MA 4I5QA 5IO2A 3FMWA 1V40A 4LMVA 1Z3EA 3FZAA 4Z2UA 1O7UA 1JZDA 1HYUA 3FR3A 3M9KA 3LXZA 3ZFBA 4XTSA 2LTKA 3IHGA 1XIYA 5IOXA 2KLXA 3M1GA 4YQMA 3LJRA 1V98A 1YY7A 4ML6A 3DXBA 1QQ2A 2HRFA 3F4RA 2H0GA 3D5JA 1XZOA 5HFIA 2GSTA 1F2EA 1J9BA 5D9VA 4IP1A 3QAWA 1A2JA 3HJMA 5ECNB 1OC9A 3C71A 1UN2A 2OADA 3EYTA 1NW2A 2WCIA 2CV4A 1K0MA 3KMOA 4G0KA 1NM3A 2GSQA 5DQSA 4ZL9A 3TJBA 1XPVA 3NZNA 5GZZB 1BYEA 2H1BA 5CAXA 4TKYA 4QL7A 1TRUA 2GZZA 1WE0A 3F3QA 3DGQA 4Q5FA 1YF0A 1PL2A 2PERA 4ZB9A 3MYDA 1MTCA 2HZEB 3P90A 4O92A 4PQIA 4CY8A 1GSSA 1EGOA 2L6DA 3KZQA 3DRNA 4JR6A 3UARA 2B6MA 2LSTA 1SD9A 2VCWA 2R37A 4V2LA 1G6WA 5D9XA 1SK1A 3EWLA 2B5XA 1O73A 1SJIA 2IL3A 3BJ5A 5A4VA 1PD21 4KW6A 4TVEA 2LRNA 3APOA 3D6IA 4I8BA 3ERFA 5CRDA 4MZBA 2JADA 4FYBA 4V1Ap 2DKIA 1U88A 3R3EA 1TXXA 1F9MA 4JR4A 2K8SA 3UVHA 4G10A 3LW9A 1EV9A 4PGTA 22GSA 2R2JA 4F9ZA 4ILFA 1N8JA 1K0BA 1ZMAA 1GNEA 4PNGA 17GSA 3ZL5A 1XW6A 4I2UA 4JBBA 2IIYA 1XW9A 2H01A 4Z7XA 4ZL7A 4G19A 5GAND 4MH3A 1OE8A 3QAGA 3CYNA 3C8EA 1GTIA 2B5EA 2YN1A 3TOUA 3QD9A 3HYPA 4BVXA 5A4UA 5IPGA 3HVXA 4FYUA 4F0BA 1ZCPA 1GUMA 4K8MA 2KP1A 1AXDA 5F8BA 4KDYA 4XS6A 5AGYA 3U5RE 1K3OA 2H6XA 5J9CA 5HFGA 4N0VA 3L78A 4AJ6A 5B6MA 4I6XA 2DBCA 2LKUA 3BBYA 2OJLA 2DJ3A 4I97A 1JLWA 4MZWA 3PPUA 18GSA 3HA9A 3H8QA 2JZTA 2J9HA 4HI7A 1MDKA 3ZTLA 2HZFA 4EF0A 3KD0A 3QAVA 4MMMA 1S3DA 2B7JA 4D73B 3HVSA 3BOAA 5ECSA 3ZVJD 2K18A 2BMXA 1R26A 3VLNA 1B48A 1HNCA 1M7TA 1AIUA 2CVKA 2XBQA 4G0IA 1FG4A 4KCAA 4FIWA 1OVNA 1G6YA 1EOGA 4FO5A 1SK2A 2WJUA 3LYPA 4LLRA 3PR8A 3QCPA 4V2NA 14GSA 5HR1A 5JWQB 5BRTA 4IKHA 1SU9A 3AY8A 5DQYA 3APQA 3ZLPA 5CP1A 4KNDA 1TTZA 4MK3A 2C80A 1XOBA 5ECHB 3Q74A 1A2MA 3G7IA 3FZ5A 4QL9A 3VI5A 2I9HA 3TRPA 1I9DA 4IJ3A 3IR4A 2IY2A 3F6DA 1TKDB 2K6VA 2O8VB 1XWKA 1Z7RA 2QC7A 1OE7A 3LXTA 2H0IA 3CRUA 1XWBA 2LEGA 3A2WA 5DAKA 4KE3A 5DVBA 3UIWA 4TN8A 3TKPA 3CSIA 1B4QA 1WP0A 1EZKA 2F8AA 5AIXA 1FO5A 2H70A 4DSSA 2RIIA 2B5YA 2WGRA 3GV1A 2IFQA 2CT6A 4BVYB 2Z9SA 3GUSA 2E7PA 3QPMA 2C8UA 2KOKA 4POKA 3ZRDA 3HDCA 1SJ6A 2H75A 4L5LA 4TR1B 3VPQA 4OCEA 4WR5A 4MH2A 1TK5B 4H86A 4EC0A 5KN1A 4TR4A 1TI1A 3MWHA 2HRNA 1B9XC 2GQMA 1F6MC 3N9JA 1VRSD 4N0ZA 1R5PA 1FHEA 5F06A 1R7HA 3ZREA 1TRSA 3ZYWA 2BTOT 2HXKA 5IO0A 5D9WA 4KX4A 3HZ8A 2J23A 2K9FA 3EVIA 4X43A 3C73A 2MMZA 1YKAA 4EXJA 2HRAA 1V9WA 2C0EA 2L4CA 2YJHA 1ON4A 1DE2A 4HJMA 3DD3A 4EVMA 2C3NA 4ICYA 4O5QA 3WGXA 5J3RA 2B1KA 2HI7A 3FYGA 4LA1A 4HDEA 2LNTA 3UVTA 1G0TA 2EC4A 4IGJA 3A5IA 2VO4A 4CY6A 2REMA 4OFMA 2R4VA 5HFKA 3L9VA 2H76A 2XC2A 1BAYA 3DIEA 4TXOA 3QFBC 1WPIA 4O32A 2H73A 2OACA 2PGTA 2CVDA 3Q6OA 1W4VA 2C4JA 1K0AA 1GWCA 3BD2A 3IHQA 4OFTA 3F63A 3TGZA 1QGVA 2DSAA 4MF7A 3GKMA 1RQMA 1OAZA 1TU7A 1FB6A 5ID2B 4ZBBA 3GH6A 4IQ1A 2FLSA 1HD2A 4BPYA 3UBLA 4WF4A 4Q5QA 2D2ZA 4K6XA 1KEBA 2C3QA 1SK0A 2GZPA 3HD5A 5B7CA 2X4AA 1OKTA 4N30A 4ECJA 1GTAA 2R3XA 1BX9A 3A2VA 1O85A 5FT3A 4TOPA 2YPMA 1O6JA 5INYA 4OD7A 2FNOA 3FHKA 19GSA 2CAQA 2OA7A 3LFLA 2A4VA 2TRCP 1YDKA 1XW5A 2DJ2A 4ECCA 4LL4B 2L4QA 1H75A 4P3YB 3UBKA 4TR0A 3RPNA 4IS0A 1YEPA 4MABA 1PX6A 2OE3A 4IQAA 1HNBA 1JZOA 2VL3A 2B3SA 4NV5A 4GWRA 3RDWA 1BJXA 1TW9A 3TKQA 6GSWA 1TU8A 4F2IA 1FAAA 2P5RA 3F4SA 4KAEA 3IK9A 2GSRA 4MNNA 3QDNA 2C0DA 3V1WA 5IPHA 4BWSA 2VIMA 4XS4A 2LUSA 3LEFA 1IYHA 2H66A 2DJKA 3IDVA 4EDZA 4I2TA 1TK0B 2GGTA 1M0UA 3GRXA 4MJAA 5KEJA 2OBKA 2IYJA 4J2FA 5D9TA 2ZCTA 3FKFA 1GLPA 4MDCA 5DALB 4GQCA 3KM6A 5KOXA 3IC4A 5ABRA 2IMFA 1SENA 2N5FA 2M46A 5G31A 5LD0A 2VLTA 2YZHA 4PTSA 1MD4A 5G2ZA 2LQOA 4EE0A 1OC8A 4MF6A 3ZZXA 3WT2A 3ZITA 1VF2A 1THXA 4XCSA 4XHMA 5IIZA 4PURA 4LL1B 1K0CA 2XBIA 1DE1A 2CQ9A 4LMWA 4POBA 1O81A 3E9JB 4PXOA 1O8WA 4GF0A 3VK9A 3LSZA 2RM5A 3TKRA 2X8CA 4NHWA 4WBRD 4DVCA 3GL3A 2OE0A 1PN0A 2L6CA 4POMA 4Z2TA 2AAWA 5ECIB 3A5WA 2XPEA 3M0FA 4F82A 1QXHA 1HNAA 2O7KA 2KUCA 1GSDA 4ZXGA 4ZBDA 4AJ7A 1ACVA 1AW9A 3TUEA 3W6GA 2X8GA 2P0GA 1ERWA 1SYRA 5JWRB 3EURA 2ZNMA 3P8WA 1KBNA 3Q18A 3FZ9A 1A8YA 3WT1A 3K8NA 2TIRA 1YZXA 4PQHA 10GSA 2JZRA 2GS3A 4HZ2A 2FHEA 4F0CA 4O7HA 3ZMKA 4XS1A 1PGTA 3US3A 1M9BA 4KDUA 4BL7B 2VD0A 3TCOA 1SKRB 5ECRB 1Z6MA 3G9BA 5BMUA 3R2QA 2AYTA 1PSQA 3LGCA 1SJZA 1O8XA 2H1DA 3Q19A 1VF1A 3IRAA 3IAM2 2MMNA 2V1MA 4EDYA 2F51A 3F8UA 4YKGA 2GZYA 3MSZA 4X1UA 5AN1A 3VWWA 2YWOA 3D21A 5IMZA 2JSZA 2HLSA 2O89A 2OE1A 2DC5A 3C1SA 4YAPA 2O85A 3G7YA 2R0CA 4POLA 4ZB6A 1ML6A 2IMDA 1FVKA 3GKXA 4IP6A 2A2RA 2LV3A 2H1GA 3ZVJA 3MIXA 4EIQA 3H79A 2E0QA 2YCDA 4GRFA 2GLRA 1JZWA 4NPBA 3DKSA 1ZYEA 4ZIJA 2QGVA 3NIVA 4G0LA 3UAPA 2OBIA 1SKSB 1M2BA 4ID0A 4OCFA 2IPAA 4CHSA 3S9FA 1WWJA 1MDIA 1A23A 1T8EB 2AV4A 2AB6A 5G1KA 2H30A 3DMLA 1S3AA 3E3EA 3GFKA 1UVZA 3F3RA 16GSA 1AC1A 3KEBA 5E59A 5HR2A 5JWOB 4X4JA 4GSTA 2DIYA 1X9WB 2HSYA 2QA2A 4KCEA 2H19A 3PINA 11GSA 5CREA 1EWXA 5ECKB 2FWFA 4GQFA 1PN9A 5CRWA 2HZEA 2IN3A 4RI7A 1GL8A 1TK8B 3TOTA 3H4KA 4HOJA 3TRXA 4NMUA 2GQKA 1U3IA 4K2XA 4NV2A 2LJRA 4WEYA 3SBCA 5J4UA 3EU4A 1THOA 3HZ4A 4OWYA 5EY6A 4MA9A 4KSOA 4ZILA 1GTUA 1Q4JA 1T00A 2P5QA 3ERWA 3WD6A 1ZYNA 1EP8A 2DMMA 5ECLB 1KNGA 3KTBA 1SL2B 2PMTA 1Z9HA 1ERVA 1EOHA 1MD3A 2F9SA 1U3AA 4ZB8A 1AAZA 2CA8A 2FY6A 4CW9A 4XRAA 3W8SA 1H4OA 3HKRA 3GHAA 4MJEA 4MCUA 5LCZA 4IJIA 1BEDA 3FZ4A 4N10A 3LQ7A 1X9MB 1SYXA 2YANA 2H6YA 2L57A 1XBSA 3FY7A 1GULA 8GSSA 2M72A 3FK8A 1GSUA 3IOSA 4K7NA 2C1YA 1GRXA 1K0DA 3KH9A 2LRCA 2P31A 1EV4A 6GSVA 5DCGA 1XXUA 5ENUA 5ELGA 2V32A 1ZL9A 1XVQA 5B6NA 1ERTA 1PA3A 3ISOA 3P7XA 2AJQB 1K3YA 3TJJA 3IPZA 2A4HA 1DBYA 1LU4A 2V41A 1GUHA 4NAXA 2FCHA 1B8XA 4L8EA 1I5GA 1NHOA 3TKSE 3KIJA 5HQPA 2F3MA 1ZYPA 2HNLA 2K8VA 5EPFA 1YEXA 1ST9A 2WFCA 2DKHA 3CRTA 3KTLA 4NXIA 4WF5A 2L5LA 1NSWA 5D73A 2LJKA 3TJGA 4L0UA 3WGDA 3GIXA 2PU9C 1F3AA 4YQVA 3L4NA 1JFUA 3G7JA 1GTBA 1R4WA 4WKWA 5IQYA 1J0FA 4JZQA 4YQUA 3WGEA 2PN8A 3EC3A 4JRRA 3VPTA 4Z2RA 2AUVA 5CO3A 1SL0B 4IN0A 5B8BA 4V1Ag 2KP2A 1X5EA 4RQRA 2CX4A 4V2MA 3LORA 4DEJA 1DUGA 3QOUA 1F3BA 1WIKA 5H5SA 4ECBA 4OO4A 4FYCA 1OC9B 3GNJA 3EE2A 4O5RA 2V2GA 4IBPA 3IK7A 3A3TA 5H5RA 1OYJA 3F0IA 3E0UA 1PX7A 2WDUA 1S3CA 1VF3A 4JU5A 4PNFA 2C0GA 2C0FA 1GSQA 2RM6A 5J5NA 2N5BA 4KH7A 2FD3A 5FHIA 4MF5A 1LJRA 1PKZA 1RK4A 1CQGA 2C3TA 3ZIVA 3KGKA 3L9UA 2WS2A 2VUPA 2NPBA 1Z7PA 3GX0A 2VLUA 1G7OA 3DYRA 4EKZA 1GSYA 1FOVA 1FVJA 2VL2C 3GH9A 3UMAA 2A2PA 2PVQA 3CXGA 2X8HA 2I1UA 2GQLA 2WZ9A 3U6VA 2FWEA 2WB9A 3DVWA 3D4MA 2HT9A 3OR5A 2HSMA 3VWUA 4ACSA 2H0HA 4BVYA 4PQ1A 3TJFA 1V2AA 2YV9A 2JSYA 2LS5A 3HVVA 2B7KA 3H93A 4FH8A 4TR1A 5GSSA 1TJDA 2QSIA 3MDKA 3VURA 3LG6A 5AIVA 3VWXA 3W8JA 3PH9A 1TRWA 4MZCA 5CRHA 3EU3A 1EEMA 5GSTA 1G7EA 1K0OA 2VCZA 5FWGA 4KB3A 2G2QA 13GSA 3F4TA 2GVPA 2WRTA 4IELA 3ME7A 2PBJA 2KHPA 1B9YC 1X9SB 5H5QA 1ERUA 5CRGA 3IBHA 5A5KA 5CYYA 3MAKA 3F6FA 3CMIA 1UA5A 5L71A 2XHFA 1BG5A 1YQ1A 5C00A 3HXSA 3NOFA 5HR0A 2R0GA 1PQNA 1SD8A 4A5PA 3ED3A 4F03A 2TRXA 4HU7A 5EVOA 1VF4A 2DIZA 2GT6A 1N2AA 2WULA 1YF1A 3GTUA 4BVXB 5IOWA 3I43A 1JLVA 1YKCA 1F37A 2LNSA 3CTFA 1FOHA 2PVOC 1Z6NA 4MPGA 4WXTA 2A2SA 3HJOA 1TDIA 1JHBA 4O5UA 2CVBA 2ALBA 3N5OA 5EL8A 2VL9A 3APSA 5F07A 4HJ2A 3CSHA 3IC8A 5CNWA 6GSTA 5KN0A 3QMXA 1V58A 4ZBAA 4WR4A 1XWGA 4ECIA 1T1VA 5E4WA 1T4ZA 6GSYA 1R5AA 4K5SA 3EINA 2L59A 4RQXA 4GLTA 4GXZA 4PUFC 1ZOFA 3QFAC 2CZ2A 2UZ8A 4XIHA 2QA1A 4QQ7A 3I69A 3F9UA 5ID2A 2E2MA 1Z5YE 2FUG2 3GMFA 4TR3A 4YKFA 1SL1B 6GSUA 2CZ3A 2F8FA 1WOUA 2YZUA 3GURA 2NBSA 4BWQA 2H8LA 7GSSA 2PWJA 4TW5A 1TP9A 4HQSA 3UOMA 1B4PA 4NHZA 4ULXA 4MLYA 3TJKA 3CTGA 2VD1A 4HUAA 4HU9A 4MP4A 3FR9A 2H6ZA 2NVLA 1XWCA 2V6KA 2O87A 3GSTA 1A0RP 4E8EA 1IYIA 2HSHA 4IW9A 4K9ZA 2IMKA 2DJJA 1DSBA 5G1LA 2L5OA 5JCGA 1NHYA 4Q5NA 1VGLA 4K5RA 3J7Yb 4XRDA 2H74A 1A2LA 3L0HA 1M2DA 1M9AA 1A8LA 1V57A 3GSSA 5COHA 2FWGA 3DVXA 1AQWA 1XVWA 5F05A 2MYGA 1SKWB 1ILOA 4ZL8A 5DAKB 3PGTA 2VM1A 4KUNA 3CSJA 2ON5A 20GSA 4DSRA 4DSSB 2X49A 2IFQB 1ZZYA 2FGXA 5J41A 2VL2A 1Q98A 4AF2A 5C04A 2HYXA 5G30A 3M8NA 1FW1A 5J9BA 5KN3A 2VCTA 1URMA 2GTUA 3TDGA 2MBTA 1U6TA 2LQQA 5G5FA 2JACA 2RUEA 1GSFA 2E2GA 1KTEA 2VOCA 4JE1A 5DCHA 5DALA 4EUYA 3P2AA 3KH7A 2GT5A 1UC7A 3H1NA 4K7IA 2ZUPA 2NDOA 4K0GA 3LYKA 1A0FA 1PKWA 4MJBA 5GAPD 5AISA 3KMNA 3FR6A 3L9SA 1X0RA 2YWMA 1OKDA 1PMTA 4IVFA 3QR6A 2DMLA 2ES7A 2DJ1A 3LWAA 3D22A 3DEXA 1ZYQB 4KGIA 3IE3A 2V6OA 1K0NA 1E2YA 3TRQA 2EIOA 2VCVA 4GSNA 4TRXA 4X0XA 3EMPA 2MZCA 4HQZA 5DJMA 4PUAA 5KN2A 1AUCA 1W89A 3FRCA 1M2AA 3GYKA 4L5OA 4J57E 1GH2A 2X64A 3FEUA 2VM2A 4TXOB 2MBSA 1ZGNA 5HR3A 2I3YA 3O6TA 1M99A 1MEKA 5IMAA 2R0PA 2EIQA 3J7Yk 3D4TA 1TI3A 3EMXA 4K2DA 2YWIA 5D96A 4EIPA 5A4WA 3JCML 1XCCA 1XFLA 4GSSA 1GLQA 3ZIJA 2XPDA 1XWAA 1A24A 3TB2A 4G9HA 4DSQA 3RHBA 3RAZA 4KA0A 5D8IA 5IMDA 3TKSC 1RW1A 1LBKA 2I81A 3C7MA 2VCQA 3ME8A 3GN3A 3KP9A 4KSMA 5B8AA 1EEJA 1YJ6A 2DLXA 2NTOA 1TRVA 3GA4A 3IXRA 4BL7A 3VWVA 4HEA2 4TXVA 2FWHA 2OKAA 2ON7A 2YV7A 4K7OA 2QKEA 2CAIA 2IJYA 4K0NA 3KCMA 2PUKC 1USBA 1WJKA 1U87A 1GUKA 2LJAA 5ELAA 2X99A 5F0GA 3BCIA 1Y6EA 3O3TA 3GL5A 1FB0A 2YNXA 2MMAA 1X5CA 3FW2A 4L0WA 1PL1A 1K3LA 2PPTA 2YOIA 2H1AA 2GSSA 3RHCA 5ECQB 3KP8A 1E6BA 2DJ0A 4CDOA 3VI7A 2RUFA 4J56E 2FA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJP A;  1AQV A;  2VLV A;  3C1R A;  1J08 A;  1BQ7 A;  1MDJ A;  4WBJ A;  2IME A;  4XS4 B;  2MMO A;  4E8H A;  3D0Z A;  3DWV A;  1XOA A;  4KDX A;  2AHE A;  1Y25 A;  3BCK A;  5DBQ A;  4EL1 A;  3KJY A;  5IM9 A;  4RI6 A;  5DJL A;  3WYW A;  1T3B A;  2B1L A;  5JCU A;  3ZML A;  1WRY A;  9GSS A;  4RUV A;  3M9J A;  3I6A A;  4D73 A;  1EP7 A;  1CQH A;  2BJX A;  1PRX A;  3GKK A;  3GTU B;  2JZS A;  5D93 A;  1AQX A;  2H72 A;  2N5A A;  4G2E A;  2YJ7 A;  2R6K A;  1X5D A;  4MPF A;  2IWT A;  3ZFL A;  3UJ1 A;  2JU5 A;  5ECO B;  3HCZ A;  2HFD A;  2YP6 A;  4EO3 A;  2GDR A;  3IAS 2;  2FA4 A;  4ISD A;  3GKN A;  5ECP B;  1QK8 A;  3IA1 A;  3MNG A;  2VCX A;  4ML1 A;  4IHU A;  5LNK e;  3HHV A;  1HQO A;  3UL3 A;  3IV4 A;  5G5E A;  3RBT A;  4AGS A;  3KXO A;  1OC3 A;  2RLI A;  3A2X A;  3O76 A;  4OMV A;  3RPP A;  4MJC A;  5IMC A;  4NWY A;  2CX3 A;  3UEM A;  3SWL A;  1QMV A;  2H71 A;  1GNW A;  4AJ8 A;  5ECM B;  4WET A;  3GX8 A;  6GSX A;  1ABA A;  4YH2 A;  4Q5R A;  4GTU A;  4YAV A;  2R5G A;  2LRT A;  2M80 A;  1EGR A;  4BA7 A;  1C72 A;  2YWN A;  4GCI A;  5DDL A;  2IMI A;  3CBU A;  5JCW A;  12GS A;  2HE3 A;  2VAF A;  1T4Y A;  4N11 A;  4OO5 A;  2EIR A;  1TOF A;  5IMF A;  3I9V 2;  4JED A;  3HY2 A;  1JZR A;  5IMV A;  2G0F A;  1T7P B;  4OFN A;  2I4A A;  4HS1 A;  4K1F A;  1GP1 A;  1GSE A;  1QFN A;  3ERG A;  4PX1 A;  3TKS A;  2JL4 A;  1WMJ A;  6GSS A;  4HZ4 A;  3VFI A;  1QUW A;  3M3M A;  4I5Q A;  5IO2 A;  1V40 A;  4LMV A;  1Z3E A;  3FZA A;  1O7U A;  1JZD A;  1HYU A;  3FR3 A;  3M9K A;  3LXZ A;  3ZFB A;  4XTS A;  2LTK A;  1XIY A;  5IOX A;  2KLX A;  3M1G A;  4YQM A;  3LJR A;  1V98 A;  1YY7 A;  4ML6 A;  3DXB A;  1QQ2 A;  2HRF A;  3F4R A;  2H0G A;  3D5J A;  1XZO A;  5HFI A;  2GST A;  1F2E A;  1J9B A;  5D9V A;  4IP1 A;  3QAW A;  1A2J A;  3HJM A;  5ECN B;  1OC9 A;  3C71 A;  1UN2 A;  2OAD A;  3EYT A;  1NW2 A;  2WCI A;  2CV4 A;  1K0M A;  3KMO A;  1NM3 A;  2GSQ A;  5DQS A;  4ZL9 A;  3TJB A;  1XPV A;  3NZN A;  5GZZ B;  1BYE A;  2H1B A;  5CAX A;  4TKY A;  4QL7 A;  1TRU A;  2GZZ A;  1WE0 A;  3F3Q A;  3DGQ A;  4Q5F A;  1YF0 A;  1PL2 A;  2PER A;  4ZB9 A;  1MTC A;  2HZE B;  3P90 A;  4O92 A;  4PQI A;  1GSS A;  1EGO A;  2L6D A;  3KZQ A;  3DRN A;  4JR6 A;  3UAR A;  2B6M A;  2LST A;  1SD9 A;  2VCW A;  2R37 A;  4V2L A;  1G6W A;  5D9X A;  1SK1 A;  3EWL A;  2B5X A;  1O73 A;  1SJI A;  2IL3 A;  3BJ5 A;  5A4V A;  1PD2 1;  4KW6 A;  4TVE A;  2LRN A;  3APO A;  3D6I A;  4I8B A;  3ERF A;  5CRD A;  4MZB A;  2JAD A;  4FYB A;  4V1A p;  1U88 A;  1TXX A;  1F9M A;  4JR4 A;  2K8S A;  3UVH A;  4G10 A;  1EV9 A;  4PGT A;  22GS A;  2R2J A;  4F9Z A;  4ILF A;  1N8J A;  1K0B A;  1ZMA A;  1GNE A;  4PNG A;  17GS A;  3ZL5 A;  1XW6 A;  4I2U A;  4JBB A;  2IIY A;  1XW9 A;  2H01 A;  4Z7X A;  4ZL7 A;  4G19 A;  5GAN D;  4MH3 A;  1OE8 A;  3QAG A;  3CYN A;  3C8E A;  1GTI A;  2B5E A;  2YN1 A;  3TOU A;  3QD9 A;  3HYP A;  4BVX A;  5A4U A;  5IPG A;  3HVX A;  4FYU A;  4F0B A;  1ZCP A;  1GUM A;  4K8M A;  2KP1 A;  1AXD A;  5F8B A;  4KDY A;  4XS6 A;  5AGY A;  3U5R E;  1K3O A;  2H6X A;  5J9C A;  5HFG A;  4N0V A;  3L78 A;  4AJ6 A;  5B6M A;  4I6X A;  2DBC A;  2LKU A;  3BBY A;  2OJL A;  2DJ3 A;  4I97 A;  1JLW A;  4MZW A;  18GS A;  3HA9 A;  3H8Q A;  2JZT A;  2J9H A;  4HI7 A;  1MDK A;  3ZTL A;  2HZF A;  4EF0 A;  3KD0 A;  3QAV A;  4MMM A;  1S3D A;  2B7J A;  4D73 B;  3HVS A;  3BOA A;  5ECS A;  3ZVJ D;  2K18 A;  2BMX A;  1R26 A;  3VLN A;  1B48 A;  1HNC A;  1M7T A;  1AIU A;  2CVK A;  2XBQ A;  1FG4 A;  4KCA A;  4FIW A;  1OVN A;  1G6Y A;  1EOG A;  4FO5 A;  1SK2 A;  2WJU A;  3LYP A;  4LLR A;  3PR8 A;  3QCP A;  4V2N A;  14GS A;  5HR1 A;  5JWQ B;  4IKH A;  1SU9 A;  3AY8 A;  5DQY A;  3APQ A;  3ZLP A;  5CP1 A;  4KND A;  1TTZ A;  4MK3 A;  2C80 A;  1XOB A;  5ECH B;  3Q74 A;  1A2M A;  3G7I A;  3FZ5 A;  4QL9 A;  3VI5 A;  2I9H A;  3TRP A;  1I9D A;  4IJ3 A;  3IR4 A;  2IY2 A;  3F6D A;  1TKD B;  2K6V A;  2O8V B;  1XWK A;  1Z7R A;  2QC7 A;  1OE7 A;  3LXT A;  2H0I A;  3CRU A;  1XWB A;  2LEG A;  3A2W A;  5DAK A;  4KE3 A;  5DVB A;  3UIW A;  4TN8 A;  3TKP A;  3CSI A;  1B4Q A;  1WP0 A;  1EZK A;  2F8A A;  5AIX A;  1FO5 A;  2H70 A;  4DSS A;  2RII A;  2B5Y A;  2WGR A;  3GV1 A;  2IFQ A;  2CT6 A;  2Z9S A;  3GUS A;  2E7P A;  3QPM A;  2C8U A;  2KOK A;  4POK A;  3ZRD A;  3HDC A;  1SJ6 A;  2H75 A;  4L5L A;  4TR1 B;  3VPQ A;  4OCE A;  4WR5 A;  4MH2 A;  1TK5 B;  4H86 A;  4EC0 A;  5KN1 A;  4TR4 A;  1TI1 A;  3MWH A;  2HRN A;  1B9X C;  2GQM A;  1F6M C;  3N9J A;  1VRS D;  4N0Z A;  1R5P A;  1FHE A;  5F06 A;  1R7H A;  3ZRE A;  1TRS A;  3ZYW A;  2BTO T;  2HXK A;  5IO0 A;  5D9W A;  4KX4 A;  3HZ8 A;  2J23 A;  2K9F A;  3EVI A;  4X43 A;  3C73 A;  2MMZ A;  1YKA A;  4EXJ A;  1V9W A;  2C0E A;  2L4C A;  2YJH A;  1ON4 A;  1DE2 A;  4HJM A;  3DD3 A;  4EVM A;  2C3N A;  3WGX A;  5J3R A;  2B1K A;  2HI7 A;  3FYG A;  4LA1 A;  4HDE A;  2LNT A;  3UVT A;  1G0T A;  2EC4 A;  4IGJ A;  2VO4 A;  2REM A;  4OFM A;  2R4V A;  5HFK A;  3L9V A;  2H76 A;  2XC2 A;  1BAY A;  3DIE A;  4TXO A;  3QFB C;  1WPI A;  4O32 A;  2H73 A;  2OAC A;  2PGT A;  2CVD A;  3Q6O A;  1W4V A;  2C4J A;  1K0A A;  1GWC A;  3BD2 A;  3IHQ A;  4OFT A;  3F63 A;  3TGZ A;  1QGV A;  2DSA A;  4MF7 A;  3GKM A;  1RQM A;  1OAZ A;  1TU7 A;  1FB6 A;  5ID2 B;  4ZBB A;  3GH6 A;  4IQ1 A;  2FLS A;  1HD2 A;  4BPY A;  3UBL A;  4WF4 A;  4Q5Q A;  2D2Z A;  4K6X A;  1KEB A;  2C3Q A;  1SK0 A;  2GZP A;  3HD5 A;  5B7C A;  1OKT A;  4N30 A;  4ECJ A;  1GTA A;  2R3X A;  1BX9 A;  3A2V A;  1O85 A;  5FT3 A;  4TOP A;  2YPM A;  1O6J A;  5INY A;  4OD7 A;  2FNO A;  3FHK A;  19GS A;  2CAQ A;  2OA7 A;  3LFL A;  2A4V A;  2TRC P;  1YDK A;  1XW5 A;  2DJ2 A;  4ECC A;  4LL4 B;  2L4Q A;  1H75 A;  4P3Y B;  3UBK A;  4TR0 A;  3RPN A;  4IS0 A;  1YEP A;  4MAB A;  1PX6 A;  2OE3 A;  4IQA A;  1HNB A;  1JZO A;  2VL3 A;  2B3S A;  4NV5 A;  4GWR A;  3RDW A;  1BJX A;  1TW9 A;  3TKQ A;  6GSW A;  1TU8 A;  4F2I A;  1FAA A;  2P5R A;  3F4S A;  4KAE A;  3IK9 A;  2GSR A;  3QDN A;  2C0D A;  3V1W A;  5IPH A;  4BWS A;  2VIM A;  4XS4 A;  2LUS A;  3LEF A;  1IYH A;  2H66 A;  2DJK A;  3IDV A;  4EDZ A;  4I2T A;  1TK0 B;  2GGT A;  1M0U A;  3GRX A;  4MJA A;  5KEJ A;  2OBK A;  2IYJ A;  4J2F A;  5D9T A;  2ZCT A;  3FKF A;  1GLP A;  4MDC A;  5DAL B;  4GQC A;  3KM6 A;  3IC4 A;  5ABR A;  2IMF A;  1SEN A;  2N5F A;  2M46 A;  5G31 A;  5LD0 A;  2VLT A;  2YZH A;  1MD4 A;  5G2Z A;  2LQO A;  4EE0 A;  1OC8 A;  4MF6 A;  3ZZX A;  3WT2 A;  3ZIT A;  1VF2 A;  1THX A;  4XCS A;  4XHM A;  5IIZ A;  4PUR A;  4LL1 B;  1K0C A;  2XBI A;  1DE1 A;  2CQ9 A;  4LMW A;  4POB A;  1O81 A;  3E9J B;  4PXO A;  1O8W A;  4GF0 A;  3VK9 A;  3LSZ A;  2RM5 A;  3TKR A;  2X8C A;  4NHW A;  4WBR D;  4DVC A;  3GL3 A;  2OE0 A;  2L6C A;  4POM A;  2AAW A;  5ECI B;  3A5W A;  2XPE A;  3M0F A;  4F82 A;  1QXH A;  1HNA A;  2O7K A;  2KUC A;  1GSD A;  4ZXG A;  4ZBD A;  4AJ7 A;  1ACV A;  1AW9 A;  3TUE A;  3W6G A;  2X8G A;  2P0G A;  1ERW A;  1SYR A;  5JWR B;  3EUR A;  2ZNM A;  3P8W A;  1KBN A;  3Q18 A;  3FZ9 A;  1A8Y A;  3WT1 A;  3K8N A;  2TIR A;  1YZX A;  4PQH A;  10GS A;  2JZR A;  2GS3 A;  4HZ2 A;  2FHE A;  4F0C A;  4O7H A;  3ZMK A;  4XS1 A;  1PGT A;  3US3 A;  1M9B A;  4KDU A;  2VD0 A;  3TCO A;  1SKR B;  5ECR B;  1Z6M A;  3G9B A;  3R2Q A;  2AYT A;  1PSQ A;  3LGC A;  1SJZ A;  1O8X A;  2H1D A;  3Q19 A;  1VF1 A;  3IRA A;  3IAM 2;  2MMN A;  2V1M A;  4EDY A;  2F51 A;  3F8U A;  2GZY A;  3MSZ A;  4X1U A;  5AN1 A;  3VWW A;  2YWO A;  3D21 A;  5IMZ A;  2JSZ A;  2HLS A;  2O89 A;  2OE1 A;  2DC5 A;  3C1S A;  4YAP A;  2O85 A;  3G7Y A;  4POL A;  4ZB6 A;  1ML6 A;  2IMD A;  1FVK A;  3GKX A;  4IP6 A;  2A2R A;  2LV3 A;  2H1G A;  3ZVJ A;  3H79 A;  2E0Q A;  2YCD A;  4GRF A;  2GLR A;  1JZW A;  4NPB A;  3DKS A;  1ZYE A;  4ZIJ A;  2QGV A;  3NIV A;  3UAP A;  2OBI A;  1SKS B;  1M2B A;  4ID0 A;  4OCF A;  2IPA A;  4CHS A;  3S9F A;  1WWJ A;  1MDI A;  1A23 A;  1T8E B;  2AV4 A;  2AB6 A;  5G1K A;  2H30 A;  3DML A;  1S3A A;  3E3E A;  3GFK A;  1UVZ A;  3F3R A;  16GS A;  1AC1 A;  3KEB A;  5E59 A;  5HR2 A;  5JWO B;  4GST A;  2DIY A;  1X9W B;  2HSY A;  4KCE A;  2H19 A;  3PIN A;  11GS A;  5CRE A;  1EWX A;  5ECK B;  2FWF A;  4GQF A;  1PN9 A;  5CRW A;  2HZE A;  2IN3 A;  4RI7 A;  1GL8 A;  1TK8 B;  3TOT A;  3H4K A;  4HOJ A;  3TRX A;  4NMU A;  2GQK A;  1U3I A;  4NV2 A;  2LJR A;  4WEY A;  3SBC A;  5J4U A;  3EU4 A;  1THO A;  3HZ4 A;  4OWY A;  5EY6 A;  4MA9 A;  4KSO A;  4ZIL A;  1GTU A;  1Q4J A;  1T00 A;  2P5Q A;  3ERW A;  3WD6 A;  1EP8 A;  2DMM A;  5ECL B;  1KNG A;  3KTB A;  1SL2 B;  2PMT A;  1Z9H A;  1ERV A;  1EOH A;  1MD3 A;  2F9S A;  1U3A A;  4ZB8 A;  1AAZ A;  2CA8 A;  2FY6 A;  4CW9 A;  4XRA A;  3W8S A;  1H4O A;  3HKR A;  3GHA A;  4MJE A;  4MCU A;  5LCZ A;  4IJI A;  1BED A;  3FZ4 A;  4N10 A;  3LQ7 A;  1X9M B;  1SYX A;  2YAN A;  2H6Y A;  2L57 A;  1XBS A;  3FY7 A;  1GUL A;  8GSS A;  2M72 A;  3FK8 A;  1GSU A;  3IOS A;  4K7N A;  2C1Y A;  1GRX A;  1K0D A;  3KH9 A;  2LRC A;  2P31 A;  1EV4 A;  6GSV A;  5DCG A;  5ELG A;  1XXU A;  5ENU A;  2V32 A;  1ZL9 A;  1XVQ A;  5B6N A;  1ERT A;  1PA3 A;  3ISO A;  3P7X A;  2AJQ B;  1K3Y A;  3TJJ A;  3IPZ A;  1DBY A;  1LU4 A;  2V41 A;  1GUH A;  4NAX A;  2FCH A;  1B8X A;  4L8E A;  1I5G A;  1NHO A;  3TKS E;  3KIJ A;  5HQP A;  2F3M A;  2HNL A;  2K8V A;  5EPF A;  1YEX A;  1ST9 A;  2WFC A;  3CRT A;  3KTL A;  4NXI A;  4WF5 A;  2L5L A;  1NSW A;  5D73 A;  2LJK A;  3TJG A;  4L0U A;  3WGD A;  3GIX A;  2PU9 C;  1F3A A;  4YQV A;  3L4N A;  1JFU A;  3G7J A;  1GTB A;  1R4W A;  4WKW A;  5IQY A;  1J0F A;  4JZQ A;  4YQU A;  3WGE A;  2PN8 A;  3EC3 A;  4JRR A;  3VPT A;  2AUV A;  5CO3 A;  1SL0 B;  4IN0 A;  5B8B A;  4V1A g;  2KP2 A;  1X5E A;  4RQR A;  2CX4 A;  4V2M A;  3LOR A;  4DEJ A;  1DUG A;  3QOU A;  1F3B A;  1WIK A;  5H5S A;  4ECB A;  4OO4 A;  4FYC A;  1OC9 B;  3GNJ A;  3EE2 A;  4O5R A;  2V2G A;  4IBP A;  3IK7 A;  3A3T A;  5H5R A;  1OYJ A;  3F0I A;  3E0U A;  1PX7 A;  2WDU A;  1S3C A;  1VF3 A;  4JU5 A;  4PNF A;  2C0G A;  2C0F A;  1GSQ A;  2RM6 A;  5J5N A;  2N5B A;  4KH7 A;  2FD3 A;  5FHI A;  4MF5 A;  1LJR A;  1PKZ A;  1RK4 A;  1CQG A;  2C3T A;  3ZIV A;  3KGK A;  3L9U A;  2WS2 A;  2VUP A;  2NPB A;  1Z7P A;  3GX0 A;  2VLU A;  1G7O A;  3DYR A;  4EKZ A;  1GSY A;  1FOV A;  1FVJ A;  2VL2 C;  3GH9 A;  3UMA A;  2PVQ A;  3CXG A;  2X8H A;  2I1U A;  2GQL A;  2WZ9 A;  3U6V A;  2FWE A;  2WB9 A;  3DVW A;  3D4M A;  2HT9 A;  3OR5 A;  3VWU A;  4ACS A;  2H0H A;  4BVY A;  4PQ1 A;  3TJF A;  1V2A A;  2YV9 A;  2JSY A;  2LS5 A;  3HVV A;  2B7K A;  3H93 A;  4FH8 A;  4TR1 A;  5GSS A;  1TJD A;  2QSI A;  3MDK A;  3VUR A;  3LG6 A;  5AIV A;  3VWX A;  3W8J A;  3PH9 A;  1TRW A;  4MZC A;  5CRH A;  3EU3 A;  1EEM A;  5GST A;  1G7E A;  1K0O A;  2VCZ A;  5FWG A;  4KB3 A;  2G2Q A;  13GS A;  3F4T A;  2GVP A;  2WRT A;  4IEL A;  3ME7 A;  2PBJ A;  2KHP A;  1B9Y C;  1X9S B;  5H5Q A;  1ERU A;  5CRG A;  3IBH A;  5A5K A;  5CYY A;  3MAK A;  3F6F A;  3CMI A;  1UA5 A;  5L71 A;  2XHF A;  1BG5 A;  1YQ1 A;  5C00 A;  3HXS A;  3NOF A;  5HR0 A;  1PQN A;  1SD8 A;  4F03 A;  3ED3 A;  2TRX A;  4HU7 A;  5EVO A;  1VF4 A;  2DIZ A;  2GT6 A;  1N2A A;  2WUL A;  1YF1 A;  3GTU A;  5IOW A;  3I43 A;  1JLV A;  1YKC A;  1F37 A;  2LNS A;  3CTF A;  2PVO C;  1Z6N A;  4MPG A;  4WXT A;  2A2S A;  3HJO A;  1TDI A;  1JHB A;  2CVB A;  2ALB A;  3N5O A;  5EL8 A;  2VL9 A;  3APS A;  5F07 A;  4HJ2 A;  3CSH A;  5CNW A;  6GST A;  5KN0 A;  3QMX A;  1V58 A;  4ZBA A;  4WR4 A;  1XWG A;  4ECI A;  1T1V A;  5E4W A;  1T4Z A;  6GSY A;  1R5A A;  3EIN A;  2L59 A;  4RQX A;  4GLT A;  4GXZ A;  4PUF C;  1ZOF A;  3QFA C;  2CZ2 A;  4XIH A;  4QQ7 A;  3I69 A;  3F9U A;  5ID2 A;  2E2M A;  1Z5Y E;  2FUG 2;  3GMF A;  4TR3 A;  1SL1 B;  6GSU A;  2CZ3 A;  2F8F A;  1WOU A;  2YZU A;  3GUR A;  2NBS A;  4BWQ A;  2H8L A;  7GSS A;  2PWJ A;  4TW5 A;  1TP9 A;  4HQS A;  3UOM A;  1B4P A;  4NHZ A;  4ULX A;  4MLY A;  3TJK A;  3CTG A;  2VD1 A;  4HUA A;  4HU9 A;  4MP4 A;  3FR9 A;  2H6Z A;  2NVL A;  1XWC A;  2V6K A;  2O87 A;  3GST A;  1A0R P;  4E8E A;  1IYI A;  2HSH A;  4IW9 A;  4K9Z A;  2IMK A;  2DJJ A;  1DSB A;  5G1L A;  2L5O A;  5JCG A;  1NHY A;  4Q5N A;  1VGL A;  3J7Y b;  4XRD A;  2H74 A;  1A2L A;  3L0H A;  1M2D A;  1M9A A;  1A8L A;  1V57 A;  3GSS A;  5COH A;  2FWG A;  3DVX A;  1AQW A;  1XVW A;  5F05 A;  2MYG A;  1SKW B;  1ILO A;  4ZL8 A;  5DAK B;  3PGT A;  2VM1 A;  4KUN A;  3CSJ A;  2ON5 A;  20GS A;  4DSR A;  4DSS B;  2IFQ B;  1ZZY A;  2FGX A;  5J41 A;  2VL2 A;  1Q98 A;  4AF2 A;  5C04 A;  2HYX A;  5G30 A;  3M8N A;  1FW1 A;  5J9B A;  5KN3 A;  2VCT A;  1URM A;  2GTU A;  3TDG A;  2MBT A;  1U6T A;  2LQQ A;  5G5F A;  2JAC A;  2RUE A;  1GSF A;  2E2G A;  1KTE A;  2VOC A;  4JE1 A;  5DCH A;  5DAL A;  4EUY A;  3P2A A;  3KH7 A;  2GT5 A;  1UC7 A;  3H1N A;  4K7I A;  2ZUP A;  2NDO A;  4K0G A;  3LYK A;  1A0F A;  1PKW A;  4MJB A;  5GAP D;  5AIS A;  3KMN A;  3FR6 A;  3L9S A;  1X0R A;  2YWM A;  1OKD A;  1PMT A;  4IVF A;  3QR6 A;  2DML A;  2ES7 A;  2DJ1 A;  3LWA A;  3D22 A;  3DEX A;  1ZYQ B;  4KGI A;  3IE3 A;  2V6O A;  1K0N A;  1E2Y A;  3TRQ A;  2EIO A;  2VCV A;  4GSN A;  4TRX A;  4X0X A;  3EMP A;  2MZC A;  4HQZ A;  5DJM A;  4PUA A;  5KN2 A;  1AUC A;  1W89 A;  3FRC A;  1M2A A;  3GYK A;  4L5O A;  4J57 E;  1GH2 A;  2X64 A;  3FEU A;  2VM2 A;  4TXO B;  2MBS A;  1ZGN A;  5HR3 A;  2I3Y A;  3O6T A;  1M99 A;  1MEK A;  5IMA A;  2EIQ A;  3J7Y k;  3D4T A;  1TI3 A;  3EMX A;  4K2D A;  2YWI A;  5D96 A;  5A4W A;  3JCM L;  1XCC A;  1XFL A;  4GSS A;  1GLQ A;  3ZIJ A;  2XPD A;  1XWA A;  1A24 A;  3TB2 A;  4G9H A;  4DSQ A;  3RHB A;  3RAZ A;  4KA0 A;  5D8I A;  5IMD A;  3TKS C;  1RW1 A;  1LBK A;  2I81 A;  3C7M A;  2VCQ A;  3ME8 A;  3GN3 A;  3KP9 A;  4KSM A;  5B8A A;  1EEJ A;  1YJ6 A;  2DLX A;  2NTO A;  1TRV A;  3GA4 A;  3IXR A;  4BL7 A;  3VWV A;  4HEA 2;  4TXV A;  2FWH A;  2OKA A;  2ON7 A;  2YV7 A;  4K7O A;  2QKE A;  2CAI A;  2IJY A;  4K0N A;  3KCM A;  2PUK C;  1USB A;  1WJK A;  1U87 A;  1GUK A;  2LJA A;  5ELA A;  2X99 A;  5F0G A;  3BCI A;  1Y6E A;  3O3T A;  3GL5 A;  1FB0 A;  2YNX A;  2MMA A;  1X5C A;  3FW2 A;  4L0W A;  1PL1 A;  1K3L A;  2PPT A;  2YOI A;  2H1A A;  2GSS A;  3RHC A;  5ECQ B;  3KP8 A;  1E6B A;  2DJ0 A;  4CDO A;  3VI7 A;  2RUF A;  4J56 E;  2FA8 A; 
#chains in the Genus database with same CATH topology
 3MHE A;  3HJP A;  1LQG C;  1AQV A;  2VLV A;  1RLS A;  2XSH B;  3C1R A;  4LYL B;  1J08 A;  1M9G A;  1BQ7 A;  1MDJ A;  4WBJ A;  5IG4 A;  3EPT A;  2IME A;  4XS4 B;  2MMO A;  2BT3 A;  3DGL A;  3D0Z A;  3DWV A;  3OWU A;  1M3I A;  4E8H A;  1XOA A;  4KDX A;  3SLU A;  1Y25 A;  2AHE A;  3BCK A;  5DBQ A;  4EL1 A;  3EN8 A;  3KJY A;  4KF9 A;  2M7O A;  4USS A;  5IM9 A;  4RI6 A;  4FQU A;  5D82 A;  1ASK A;  1JJ2 2;  5DJL A;  3WYW A;  2CG0 A;  1T3B A;  2B1L A;  5JCU A;  3K7C A;  1FYS A;  1WRY A;  3ZML A;  1FUT A;  9GSS A;  4RUV A;  3M9J A;  3I6A A;  4D73 A;  1EP7 A;  1ROV A;  1CQH A;  2BJX A;  1PRX A;  3GKK A;  3GTU B;  2JZS A;  5D93 A;  1AQX A;  3PCR A;  7GSP A;  1VQ8 3;  2H72 A;  5AII A;  2N5A A;  4G2E A;  2YJ7 A;  3X3Y A;  4BL2 A;  2R6K A;  1ULI B;  1X5D A;  4MPF A;  1IQX A;  2IWT A;  3ZFL A;  3HVN A;  3UJ1 A;  2JU5 A;  5ECO B;  3HCZ A;  3EB8 A;  3CD6 3;  5AIF A;  2HFD A;  2YP6 A;  3MSO A;  4EO3 A;  1MWT A;  2GDR A;  5KOW A;  3IAS 2;  4ORL A;  2WO0 A;  3WHO A;  5KP1 A;  2FA4 A;  4ISD A;  3GKN A;  3UB1 A;  1QK8 A;  1BSC A;  3EBT A;  5I97 A;  5ECP B;  4G1M B;  3IA1 A;  2ML6 A;  3MNG A;  2VCX A;  4ML1 A;  4IHU A;  5LNK e;  3HHV A;  4N6V 0;  1HQO A;  1RN7 A;  3UL3 A;  3IV4 A;  3JUP A;  4O02 B;  5G5E A;  3RBT A;  4AGS A;  3KXO A;  1GY5 A;  1IYY A;  1BIR A;  1OC3 A;  2RLI A;  3A2X A;  1O7H B;  3O76 A;  4OMV A;  2OCT A;  4KFE A;  3RPP A;  4MJC A;  1VQQ A;  5IMC A;  4X2O A;  4NWY A;  2CX3 A;  2ZDJ A;  2B1X B;  3UEM A;  3SWL A;  1QMV A;  2YFI B;  2H71 A;  1GNW A;  1LNH A;  4AJ8 A;  5ECM B;  4WET A;  2XRX B;  2F56 A;  3JUM A;  3LTD A;  3MG3 A;  3GX8 A;  6GSX A;  1ABA A;  2Z6B A;  4YH2 A;  4Q5R A;  4GTU A;  4YAV A;  2R5G A;  2LRT A;  3SOY A;  2M80 A;  1EGR A;  1OF5 A;  1WMO A;  4BA7 A;  1C72 A;  2YWN A;  4GCI A;  5DDL A;  2IMI A;  1MOL A;  3V98 A;  3CBU A;  5JCW A;  1W7C A;  12GS A;  2HE3 A;  2VAF A;  1T4Y A;  4N11 A;  4CCV A;  4OO5 A;  1IVV A;  3WMD A;  1SJW A;  2F5W A;  2EIR A;  3G71 3;  1TOF A;  5IMF A;  3I9V 2;  2W56 A;  1QAK A;  4JED A;  3HY2 A;  2HRK A;  1JZR A;  5AYR B;  1VQ9 3;  2G0F A;  2WOF A;  5IMV A;  1KWI A;  1T7P B;  4OFN A;  2C4B A;  2I4A A;  4HS1 A;  4IIA A;  1GP1 A;  4PEJ A;  1GSE A;  1EKM A;  1QFN A;  3ERG A;  4K1F A;  4PX1 A;  3TKS A;  4RZM A;  1UI7 A;  2JL4 A;  2L1S A;  1WMJ A;  6GSS A;  3JUO A;  4HZ4 A;  3VFI A;  2A15 A;  1QUW A;  3M3M A;  4I5Q A;  5IO2 A;  3FMW A;  1JV2 B;  1V40 A;  2CW9 A;  4LMV A;  1VQ4 3;  2FXT A;  2O9U X;  1Z3E A;  5CLK A;  3M8C A;  3FZA A;  4Z2U A;  1O7U A;  2C11 A;  1JZD A;  1HYU A;  3FR3 A;  1NB5 I;  3M9K A;  1LOV A;  3CCR 3;  4L8P A;  3LXZ A;  3ZFB A;  4XTS A;  2LTK A;  3IHG A;  1XIY A;  5IOX A;  2KLX A;  3M1G A;  2CWV A;  4YQM A;  3LJR A;  1V98 A;  3MWZ A;  1YY7 A;  4ML6 A;  1O7W B;  4HBR A;  3DXB A;  1QQ2 A;  2HRF A;  3F4R A;  2H0G A;  3D5J A;  3SED A;  2P0M A;  1MWR A;  1XZO A;  5HFI A;  1JKG B;  3DZL A;  2GST A;  2JQ5 A;  1F2E A;  1J9B A;  5D9V A;  4FR9 A;  4IP1 A;  3QAW A;  1OH0 A;  1A2J A;  4FCM A;  2W03 A;  4GB5 A;  3HJM A;  5ECN B;  4LEH A;  1OC9 A;  2UUG C;  3WOE B;  3C71 A;  1UN2 A;  2OAD A;  3EYT A;  1NW2 A;  2WCI A;  4O2H A;  2CV4 A;  1K0M A;  1D6Y A;  2GXF A;  3DUK A;  3KMO A;  4G0K A;  3EX9 A;  1NM3 A;  2GSQ A;  2F99 A;  5DQS A;  3NBR A;  5BVB A;  1DET A;  4XB5 A;  4ZL9 A;  3TJB A;  1XPV A;  3NZN A;  5GZZ B;  1GOV A;  1BYE A;  2H1B A;  1LVN A;  1RGL A;  3ZG5 A;  5CAX A;  4TKY A;  3RNT A;  1BRN L;  4QL7 A;  2HML B;  1TRU A;  1RNT A;  2GZZ A;  1WE0 A;  3F3Q A;  3DGY A;  2BU4 A;  5CK6 A;  3DGQ A;  4Q5F A;  1G02 A;  1YF0 A;  1PL2 A;  2PER A;  4ZB9 A;  3MYD A;  1MTC A;  2HZE B;  3P90 A;  4O92 A;  4PQI A;  1B2U A;  4CY8 A;  2K54 A;  3G4S 3;  2WOH A;  2XF3 A;  1GSS A;  1EGO A;  3PCS A;  2L6D A;  3KZQ A;  2P0X A;  3DRN A;  4JR6 A;  3UAR A;  2B6M A;  3H51 A;  2LST A;  1A2K A;  3X40 A;  1SD9 A;  3X3Z A;  1DMM A;  1LOX A;  3RGA A;  2VCW A;  2R37 A;  4V2L A;  4EC6 A;  1YVS A;  2ML5 A;  1G6W A;  1GD3 A;  1MWS A;  3OXA A;  5D9X A;  1SK1 A;  3EWL A;  2B5X A;  4KZ1 A;  1O73 A;  1SJI A;  2IL3 A;  4K1V A;  3BJ5 A;  5A4V A;  5AEU B;  1PD2 1;  4KW6 A;  1EQK A;  4TVE A;  2LRN A;  3CCM 3;  3APO A;  3D6I A;  4I8B A;  1Q40 B;  5CF1 A;  3ERF A;  3AMO A;  5CRD A;  1QVF 2;  2V1L A;  1CH0 A;  4MZB A;  2JAD A;  4FYB A;  2RBI A;  4V1A p;  1VQ5 3;  2DKI A;  1U88 A;  4K61 A;  3R3E A;  4BTX A;  1TXX A;  2SBL A;  1F9M A;  4JR4 A;  1MGR A;  2K8S A;  3UVH A;  1I0X A;  4G10 A;  3LW9 A;  1EV9 A;  1B3S A;  4H61 A;  4PGT A;  22GS A;  2R2J A;  4F9Z A;  5KP3 A;  5RNT A;  4ILF A;  1N8J A;  1K0B A;  1ZMA A;  1GNE A;  4PNG A;  3UJM A;  3I55 3;  17GS A;  3ZL5 A;  1XW6 A;  3HOH A;  1JNQ A;  3GRD A;  3GWR A;  4I2U A;  4JBB A;  2IIY A;  1XW9 A;  2H01 A;  4Z7X A;  4ZL7 A;  4G19 A;  5GAN D;  4MH3 A;  1OE8 A;  3QAG A;  3CYN A;  4WYK A;  3C8E A;  1GTI A;  2B5E A;  4K90 B;  2YN1 A;  3TOU A;  3QD9 A;  3HYP A;  5G2G A;  3D3L A;  4BVX A;  5A4U A;  5IPG A;  3HVX A;  3NM2 A;  1MNL A;  3Q1C A;  4FYU A;  4F0B A;  1ZCP A;  9RNT A;  1GUM A;  4K8M A;  2BMQ B;  2KP1 A;  1AXD A;  5F8B A;  2CWU A;  1Q42 A;  3AGN A;  3OX9 A;  1N5H A;  4KDY A;  4XS6 A;  1SAR A;  5AGY A;  1US1 A;  3U5R E;  1K3O A;  2H6X A;  5J9C A;  5HFG A;  4N0V A;  3LZA A;  3L78 A;  4N6T A;  4AJ6 A;  5B6M A;  4I6X A;  2DBC A;  2GSP A;  4J8T A;  1Q7Y 4;  2LKU A;  3BBY A;  2OJL A;  2DJ3 A;  1BAN A;  2P09 A;  4HM0 B;  1VQM 3;  4I97 A;  1JLW A;  1VQ6 3;  4MZW A;  3PPU A;  18GS A;  3HA9 A;  2RGQ A;  4CDL A;  3H8Q A;  2JZT A;  2J9H A;  4HI7 A;  1MDK A;  3ZTL A;  2HZF A;  3BU4 A;  3H3H A;  5IEN A;  3FH1 A;  4AKY A;  4EF0 A;  3KD0 A;  2XSO B;  3QAV A;  4MMM A;  1YGE A;  1BNF A;  5IER A;  1S3D A;  2B7J A;  1DMQ A;  4D73 B;  3HVS A;  3BOA A;  3CC2 3;  1N9E A;  5ECS A;  3ZVJ D;  2K18 A;  4XBT A;  2BMX A;  1R26 A;  3VLN A;  3DM8 A;  1B48 A;  1HNC A;  1M7T A;  1S5A A;  1AIU A;  2CVK A;  2XBQ A;  2RFR A;  4G0I A;  3BNB A;  1F8N A;  1FG4 A;  1JB4 A;  4KCA A;  4U13 A;  4FIW A;  1OVN A;  1YJN 3;  3LT9 A;  3KSE D;  1RGE A;  8CHO A;  1G6Y A;  3EF8 A;  1EOG A;  4FO5 A;  1SK2 A;  2WJU A;  3LYP A;  4LLR A;  3QK9 A;  3PR8 A;  4O8S A;  3QCP A;  3SVA A;  4V2N A;  14GS A;  3BLZ A;  5HR1 A;  5JWQ B;  5BRT A;  4IKH A;  1LOW A;  1SU9 A;  3AY8 A;  1RGH A;  5DQY A;  3APQ A;  2ZA4 A;  1BAO A;  1TUH A;  3ZLP A;  2C10 A;  4KT3 B;  5CP1 A;  4KND A;  1TTZ A;  4MK3 A;  1GS3 A;  2C80 A;  1NWW A;  1WQL B;  4NRE A;  2F98 A;  1XOB A;  1YNV X;  5ECH B;  2QEX 3;  3Q74 A;  1KC8 4;  1A2M A;  3G7I A;  3DGN A;  3FZ5 A;  4QL9 A;  3VI5 A;  2I9H A;  3TRP A;  1I9D A;  4IJ3 A;  3FLJ A;  2IY2 A;  1VQN 3;  1BRK A;  1NU3 A;  3F6D A;  3IR4 A;  1TKD B;  1UGI A;  3S67 A;  4BIR A;  2K6V A;  2O8V B;  1XWK A;  1Z7R A;  1W01 A;  1QAF A;  5M19 A;  1T5Y A;  2QC7 A;  1BVI A;  1OE7 A;  3NV0 A;  3LXT A;  2H0I A;  2SAR A;  3CRU A;  1GY6 A;  3EC9 A;  1O7M B;  1XWB A;  4NHF A;  2LEG A;  3A2W A;  5DAK A;  4KE3 A;  5DVB A;  3UIW A;  4TN8 A;  3TKP A;  3CSI A;  1B4Q A;  4FMD A;  1WP0 A;  1GY7 A;  3HI7 A;  1EZK A;  2F8A A;  1W00 A;  5AIX A;  2H70 A;  1FO5 A;  3VF1 A;  4DSS A;  4HYZ A;  2B5Y A;  2RII A;  2WGR A;  3GV1 A;  2IFQ A;  2CT6 A;  3OWS A;  4BVY B;  1B2Z A;  2Z9S A;  3GUS A;  2E7P A;  3FCS B;  3QPM A;  2C8U A;  2KOK A;  5EQL A;  1I70 A;  4POK A;  3ZRD A;  2W9P A;  1SJ6 A;  1A2P A;  2H75 A;  3HDC A;  3K63 A;  4L5L A;  4TR1 B;  3VPQ A;  5KP4 A;  1BUJ A;  1AV4 A;  4OCE A;  4WR5 A;  4MH2 A;  1TK5 B;  5EVH A;  4R9K A;  1YIJ 3;  4H86 A;  4EC0 A;  5KN1 A;  4EV5 A;  2GEY A;  4TR4 A;  1TI1 A;  3MWH A;  2HRN A;  1B9X C;  4OUQ A;  2GQM A;  1F6M C;  3N9J A;  1VRS D;  2OWP A;  4N0Z A;  1R5P A;  1FHE A;  5F06 A;  2LYX A;  1RHL A;  1R7H A;  1OHO A;  3BIR A;  3ZRE A;  1NJI 4;  1ULJ B;  1TRS A;  3ZYW A;  3MG1 A;  1JBS A;  2BTO T;  2HXK A;  1YJ9 3;  5IO0 A;  1L5G B;  3NQZ A;  2W0Q A;  5D9W A;  4KX4 A;  1SPU A;  3HZ8 A;  2J23 A;  2K9F A;  3EVI A;  4X43 A;  5D83 A;  3C73 A;  2MMZ A;  5IG3 A;  3VGN A;  3HIG A;  1YKA A;  4EXJ A;  2HRA A;  1T2I A;  2F86 B;  1V9W A;  2C0E A;  2L4C A;  3D5I A;  2YJH A;  5BU4 A;  5AEW B;  1ON4 A;  1DE2 A;  4HJM A;  1SQW A;  3DD3 A;  1CYU A;  4RNT A;  1Q86 4;  4EVM A;  2C3N A;  4ICY A;  3RGR A;  1RDS A;  4O5Q A;  3WGX A;  3ER7 A;  1I2F A;  5J3R A;  2B1K A;  2HI7 A;  2BHM A;  1ZS7 A;  3N9H A;  4BU4 A;  3FYG A;  4LGQ A;  4LA1 A;  1JBR A;  4HDE A;  2LNT A;  3GZY B;  3UVT A;  1G0T A;  4EBG A;  2EC4 A;  4IGJ A;  3HX8 A;  3A5I A;  2VO4 A;  4CY6 A;  3ZG0 A;  1FUS A;  1C7H A;  3A5E A;  1M90 4;  4BL3 A;  2CK3 H;  1DVD A;  2REM A;  1TP6 A;  4MMX B;  4OFM A;  2R4V A;  5HFK A;  3L9V A;  2H76 A;  2XC2 A;  1IVX A;  1BAY A;  3DIE A;  4TXO A;  4FMC A;  3UL5 A;  3DY5 A;  3QFB C;  3Q90 A;  1BSD A;  3KE7 A;  1WPI A;  4O32 A;  3STD A;  2H73 A;  1RTU A;  4KFD A;  1BRG A;  2OAC A;  2PGT A;  2CVD A;  1DVC A;  3Q6O A;  1W4V A;  2C4J A;  1K0A A;  2CFK A;  1GWC A;  3BD2 A;  3IHQ A;  2IUK A;  4OFT A;  3F63 A;  3G8Z A;  3TGZ A;  1QGV A;  2DSA A;  4MF7 A;  1I2E A;  3GKM A;  1RQM A;  1OAZ A;  1TU7 A;  1FB6 A;  5ID2 B;  1UCL A;  4ZBB A;  3GH6 A;  4IQ1 A;  2FLS A;  1HD2 A;  4BPY A;  5FGO A;  3UBL A;  2I9W A;  4WF4 A;  4Q5Q A;  2QA4 3;  2D2Z A;  2GU3 A;  3A76 A;  4K6X A;  1KEB A;  2C3Q A;  1SK0 A;  2GZP A;  3HD5 A;  3IPT A;  1OUN A;  1RGK A;  1YJW 3;  2HMJ B;  4FMB A;  3JUQ A;  5B7C A;  2X4A A;  1OKT A;  3ECF A;  1VQO 3;  4N30 A;  4ECJ A;  1GTA A;  2R3X A;  1BX9 A;  1RGC A;  1O85 A;  3A2V A;  5FT3 A;  4TOP A;  2YPM A;  1O6J A;  5INY A;  4OD7 A;  2FNO A;  3FHK A;  19GS A;  2CAQ A;  2OA7 A;  3FG3 A;  3LML A;  3LXU X;  3FF0 A;  3LFL A;  2A4V A;  3WR2 A;  2TRC P;  1RRH A;  1YDK A;  2XGN A;  3Q3F A;  1XW5 A;  5M18 A;  1W6Y A;  3F9S A;  4MEI A;  2DJ2 A;  3T0U A;  4ECC A;  4LL4 B;  1O7N B;  3N54 B;  1NO3 A;  1XG8 A;  3NXJ A;  2KF4 A;  2L4Q A;  1H75 A;  1I3F A;  4P3Y B;  3UBK A;  4HM6 B;  4TR0 A;  3RPN A;  4IS0 A;  1PU4 A;  1YEP A;  4MAB A;  1CQS A;  2OOV C;  1PX6 A;  2OE3 A;  1HU9 A;  1BOX A;  3F40 A;  1AVL A;  4IQA A;  1HNB A;  1JZO A;  2VL3 A;  2B3S A;  1E97 A;  4STD A;  4NV5 A;  4GWR A;  3RDW A;  3FKA A;  1BJX A;  1TW9 A;  3TKQ A;  6GSW A;  1B27 A;  1TU8 A;  4F2I A;  1FAA A;  2P5R A;  3F4S A;  4J5G A;  4KAE A;  1FGM A;  2R41 A;  1FGT A;  5IEO A;  3JVC A;  1W02 A;  3IK9 A;  1HYF A;  2GSR A;  4MNN A;  3QDN A;  2C0D A;  1AQZ A;  3F8H A;  3V1W A;  3KCH A;  1RRL A;  5IPH A;  4BWS A;  3CCV 3;  2VIM A;  1WNH A;  4XS4 A;  3CNX A;  2LUS A;  1U5O A;  1W6C A;  3LEF A;  1IYH A;  1TU5 A;  1EG9 B;  2DJK A;  2H66 A;  3IDV A;  4EDZ A;  1RNB A;  2J8X B;  4OVM A;  3F7X A;  3NHX A;  4AKZ A;  3CU3 A;  1ZO2 A;  4I2T A;  2CKF B;  1BSB A;  5A0O B;  1TK0 B;  2GGT A;  1M0U A;  3GRX A;  4MJA A;  2B24 B;  5KEJ A;  1STF I;  2OBK A;  2IYJ A;  4J2F A;  2CHC A;  5D9T A;  2ZCT A;  3FKF A;  1GLP A;  4MDC A;  3CCU 3;  1HZ1 A;  5DAL B;  4GQC A;  3KM6 A;  1EUI C;  3NBJ A;  1BRJ A;  2GU1 A;  5DRV A;  5KOX A;  3ROB A;  3V92 A;  3IC4 A;  1YIT 3;  1VZZ A;  5ABR A;  2IMF A;  1SEN A;  2N5F A;  2M46 A;  5G31 A;  3WOF B;  5LD0 A;  2VLT A;  2YZH A;  4PTS A;  1MD4 A;  5G2Z A;  2CFD A;  4L7K A;  2LQO A;  4EE0 A;  1OC8 A;  4MF6 A;  3ZZX A;  3WT2 A;  3CCL 3;  2OTL 3;  3I56 3;  3U1W A;  3X41 A;  3ZIT A;  1VF2 A;  1Q82 4;  4J5K A;  1THX A;  4XCS A;  4XHM A;  5IIZ A;  4PUR A;  4LL1 B;  1K0C A;  4GL6 A;  2XBI A;  1DE1 A;  1RN4 A;  2CQ9 A;  1N5P A;  4LMW A;  4POB A;  1O81 A;  1OCV A;  3E9J B;  4CPK A;  4PXO A;  1O8W A;  4GF0 A;  3VK9 A;  2Y73 A;  3LSZ A;  2RM5 A;  3TKR A;  2X8C A;  4NHW A;  4WBR D;  4DVC A;  2O3O A;  3CME 3;  2MF7 A;  3GL3 A;  2OE0 A;  5M1A A;  4R1K A;  3UL6 A;  4EV2 A;  1PN0 A;  2L6C A;  4POM A;  4Z2T A;  2LQV A;  1UW1 A;  2AAW A;  5ECI B;  3A5W A;  2XPE A;  2XH9 A;  1IV7 A;  3NQY A;  3M0F A;  3FZW A;  4F82 A;  1QXH A;  1HNA A;  2O7K A;  3B4P A;  2KUC A;  1GSD A;  1LRA A;  4ZXG A;  4WHA A;  4ZBD A;  4XBY A;  4AJ7 A;  4R4K A;  1X1Y A;  4HM5 B;  1ACV A;  1AW9 A;  3EE1 A;  3TUE A;  3W6G A;  2X8G A;  2P0G A;  1ERW A;  3F8X A;  1SYR A;  5JWR B;  2INX A;  3EUR A;  2Y74 A;  2ZNM A;  3P8W A;  5D81 A;  1KBN A;  3CMA 3;  1KQS 2;  3Q18 A;  3FZ9 A;  4N6M A;  1A8Y A;  3WT1 A;  3K8N A;  2ZL8 A;  2TIR A;  1YZX A;  1JB2 A;  4PQH A;  1PFP A;  1SIH A;  1VQL 3;  2JZR A;  4FCZ A;  10GS A;  3CPO A;  2GS3 A;  1CEW I;  4HZ2 A;  2FHE A;  4F0C A;  1OHS A;  1M1K 4;  4O7H A;  3ZMK A;  3WA2 X;  1O7P B;  4XS1 A;  3B7C A;  3GSP A;  1PGT A;  1VQK 3;  3US3 A;  1M9B A;  4KDU A;  4BL7 B;  2VD0 A;  3TCO A;  1SKR B;  5ECR B;  1Z6M A;  2CH9 A;  3G9B A;  5BMU A;  3R2Q A;  2AYT A;  1PSQ A;  3LGC A;  5BXQ A;  1SJZ A;  1O8X A;  2H1D A;  1TTO A;  3Q19 A;  3NV0 B;  1VF1 A;  3IRA A;  1J2B A;  3IJE B;  3IAM 2;  4HAA A;  1GMR A;  2MMN A;  2V1M A;  4EDY A;  2F51 A;  3F8U A;  4YKG A;  1IVU A;  1RMS A;  2GZY A;  1TRP A;  3MSZ A;  4RBN A;  4X1U A;  5AN1 A;  3VWW A;  2YWO A;  3D21 A;  1BNS A;  1BNR A;  5IMZ A;  2JSZ A;  1G96 A;  2HLS A;  1DYU A;  2PZV A;  2O89 A;  2OE1 A;  2STD A;  2DC5 A;  3C1S A;  1IK3 A;  4YAP A;  2O85 A;  3G7Y A;  2R0C A;  4POL A;  4ZB6 A;  1ML6 A;  2IMD A;  1FVK A;  3GKX A;  4IP6 A;  4EXR A;  2A2R A;  1AR0 A;  2CX0 A;  4X2H A;  3MG2 A;  2LV3 A;  3KKG A;  1IT7 A;  3PZW A;  3OWY A;  2H1G A;  3ZVJ A;  3WA3 A;  3MIX A;  4EIQ A;  3H79 A;  2E0Q A;  3BB9 A;  2YCD A;  7RNT A;  2OQE C;  4GRF A;  3LTB A;  2GLR A;  1JZW A;  1JKG A;  4NPB A;  2OOV A;  3DKS A;  1ZYE A;  4ZIJ A;  2GEX A;  2QGV A;  3NIV A;  4G0L A;  3IMA B;  3LTA A;  3Q2P A;  3EBY A;  3K5T A;  1I0V A;  4HM1 B;  3UAP A;  2OBI A;  1SKS B;  3QRD A;  1M2B A;  4ID0 A;  3FF2 A;  4OCF A;  2IPA A;  3S28 A;  1RCK A;  4CHS A;  1Y4K A;  3S9F A;  2RNT A;  1WWJ A;  1MDI A;  1A23 A;  1T8E B;  2AV4 A;  2AB6 A;  5G1K A;  1PY3 A;  2H30 A;  3DML A;  4HKV B;  1FGR A;  4XDW A;  2KF3 A;  1S3A A;  3E3E A;  3CXC 2;  3GFK A;  1RGF A;  1UVZ A;  3F3R A;  16GS A;  1AC1 A;  3KEB A;  1UUW B;  5E59 A;  5HR2 A;  1R4Y A;  5JWO B;  4X4J A;  1A67 A;  3J7Y d;  2ZHX B;  4GST A;  2DIY A;  1X9W B;  1BNJ A;  2HSY A;  2QA2 A;  4KCE A;  2H19 A;  3PIN A;  1ISK A;  11GS A;  5CRE A;  3LTC A;  1EWX A;  2YX9 A;  4BIK A;  2PNC A;  1DE3 A;  5ECK B;  2QIY A;  5JBS A;  2FWF A;  4GQF A;  1PN9 A;  5CRW A;  2HZE A;  1K9M 4;  2IN3 A;  4RI7 A;  1K41 A;  1GL8 A;  1TK8 B;  3TOT A;  3CCE 3;  3H4K A;  3EHC A;  2CFW A;  4HOJ A;  3TRX A;  4NMU A;  2GQK A;  1U3I A;  4K2X A;  4NV2 A;  3GZB A;  2LJR A;  4WEY A;  3SBC A;  1NB3 I;  2QGU A;  3PXM A;  1UCJ A;  3FGY A;  5J4U A;  5EEO A;  3EU4 A;  1THO A;  1W6G A;  3B4O A;  1IQY A;  1N9J A;  3HZ4 A;  4OWY A;  3MPH A;  5EY6 A;  1GOU A;  4MA9 A;  3G0K A;  4KSO A;  1CYV A;  5ELJ A;  4ZIL A;  1GTU A;  1Q4J A;  1T00 A;  2D42 A;  8RNT A;  2P5Q A;  3ERW A;  3WD6 A;  3SX1 A;  1Q40 A;  1ZYN A;  1W5Z A;  1EP8 A;  2DMM A;  5ECL B;  2HOH A;  1KNG A;  3KTB A;  1SL2 B;  1W4N A;  6GSP A;  4N6O B;  2PMT A;  2FNQ A;  1Z9H A;  1ERV A;  1EOH A;  6STD A;  1MD3 A;  2F9S A;  1U3A A;  4ZB8 A;  1AAZ A;  3BND A;  4AEQ A;  2CA8 A;  2FY6 A;  4CW9 A;  1IT8 A;  4XRA A;  3W8S A;  1H4O A;  3HKR A;  1RCL A;  4I4K A;  3GHA A;  4HJL B;  4MJE A;  4MCU A;  5LCZ A;  4IJI A;  3WDG B;  2IUJ A;  1BED A;  4XBX A;  3KZT A;  5AIG A;  3FZ4 A;  3VSY A;  4N10 A;  5LC6 A;  3LQ7 A;  1X9M B;  1SYX A;  2YAN A;  2W04 A;  2H6Y A;  2L57 A;  1XBS A;  3FY7 A;  1YI2 3;  1GUL A;  8GSS A;  5JPP A;  2M72 A;  3FK8 A;  3LH4 A;  5AI1 A;  1GSU A;  1AVK A;  3IOS A;  5IF6 A;  5IG5 A;  4K7N A;  1OF5 B;  2C1Y A;  1GRX A;  1K0D A;  3KH9 A;  2LRC A;  2P31 A;  1EV4 A;  4LMI A;  6GSV A;  3UNL A;  2HMN B;  4MJD A;  5DCG A;  1XXU A;  5ENU A;  5ELG A;  2V32 A;  1MWU A;  1ZL9 A;  4GSP A;  1XVQ A;  5B6N A;  1OHP A;  1ERT A;  1PA3 A;  2AAD A;  3SXX A;  3ISO A;  2W56 B;  3FG1 A;  1B2X A;  3P7X A;  2FGT A;  2WGO A;  2AJQ B;  3K9M C;  1K3Y A;  3TJJ A;  3IPZ A;  2A4H A;  1DBY A;  1LU4 A;  1JB5 A;  1GUH A;  2V41 A;  4NAX A;  3AHW A;  1B8X A;  2FCH A;  4L8E A;  1I5G A;  1NHO A;  1Q9E A;  3TKS E;  3KIJ A;  5HQP A;  2F3M A;  1ZYP A;  2HNL A;  4HM3 B;  2K8V A;  1YEX A;  5EPF A;  1ST9 A;  1W2Z A;  2WFC A;  2DKH A;  2RCD A;  3CRT A;  5AIH A;  3FG4 A;  3KTL A;  4NXI A;  4WF5 A;  2L5L A;  1NSW A;  5D73 A;  2LJK A;  3TJG A;  4L0U A;  3WGD A;  2MC8 A;  3GIX A;  2Z76 A;  1JN5 A;  1UDI I;  1F3A A;  2PU9 C;  4YQV A;  3L4N A;  4MMZ B;  1JFU A;  3G7J A;  1GTB A;  1R4W A;  4WKW A;  5IQY A;  1J0F A;  4JZQ A;  4YQU A;  3WGE A;  2PN8 A;  3EC3 A;  2BO9 B;  4JRR A;  3VPT A;  4Z2R A;  2AUV A;  4HZB B;  5IEP A;  4BTY A;  5CO3 A;  2P38 A;  1SL0 B;  4H3U A;  4IN0 A;  3AHS A;  5STD A;  5B8B A;  4V1A g;  1W2B 2;  2KP2 A;  2BMR B;  3KSP A;  1X5E A;  3FSD A;  2KCD A;  4RQR A;  1A90 A;  2CX4 A;  3K0Z A;  1UUG B;  4V2M A;  3LOR A;  1BSE A;  1NDO B;  4DEJ A;  1DUG A;  3QOU A;  1OGX A;  1F3B A;  4ZM8 A;  2OQE A;  1WIK A;  3OV4 A;  1RGA A;  5H5S A;  4KFF A;  4ECB A;  4OO4 A;  4FYC A;  1OC9 B;  3GNJ A;  3EE2 A;  4O5R A;  2V2G A;  4IBP A;  5AYS C;  3IK7 A;  3A3T A;  5H5R A;  3L0R A;  5IW9 A;  1OYJ A;  3T8N A;  3F0I A;  3E0U A;  2E2V A;  1D6Z A;  3CPW 2;  1PX7 A;  2WDU A;  1S3C A;  4LSO A;  1VF3 A;  4JU5 A;  4PNF A;  1BRH A;  2C0G A;  5FW5 A;  1YHQ 3;  2C0F A;  4HM4 B;  1UCI A;  1GSQ A;  2GBW B;  1MGW A;  2RM6 A;  5J5N A;  2N5B A;  4KH7 A;  2FD3 A;  5FHI A;  4MF5 A;  3CCJ 3;  1LJR A;  1PKZ A;  1RK4 A;  1BNI A;  1CQG A;  2C3T A;  3ZIV A;  3KGK A;  3L9U A;  2WS2 A;  2VUP A;  2NPB A;  1Z7P A;  3HK4 A;  3GX0 A;  2VLU A;  1G7O A;  1X1X A;  1IVW A;  2CFG A;  3DYR A;  4KVH A;  1FGO A;  1S72 3;  4EKZ A;  1GSY A;  1FOV A;  1FVJ A;  1ZGX A;  2VL2 C;  3GH9 A;  3UMA A;  1E3R A;  2A2P A;  2PVQ A;  1FGQ A;  3CXG A;  2X8H A;  2GBX B;  2I1U A;  2GQL A;  2WZ9 A;  4BTW A;  4HSC X;  3U6V A;  2FWE A;  2WB9 A;  1BNE A;  3DVW A;  3D4M A;  2HT9 A;  5JPU A;  3OR5 A;  2HSM A;  3VWU A;  4ACS A;  1RN1 A;  2E2T A;  2L4V A;  2H0H A;  4BVY A;  2BMO B;  4PQ1 A;  4Q53 A;  1K73 4;  3TJF A;  1V2A A;  1BGS A;  1HKX A;  4HM2 B;  2YV9 A;  2JSY A;  1K28 A;  2LS5 A;  3HVV A;  2R4I A;  2B7K A;  3H93 A;  4FH8 A;  1WMN A;  4TR1 A;  5GSS A;  2W9Q A;  1TJD A;  2Z7A A;  1I3I A;  2QSI A;  3AMO B;  3URP A;  3MDK A;  3VUR A;  4N6N B;  3LG6 A;  5AIV A;  3VWX A;  4WWU C;  3W8J A;  1GMP A;  3PH9 A;  1TRW A;  1M3J A;  4MZC A;  5CRH A;  1FW7 A;  3EU3 A;  1EEM A;  1B2S A;  5GST A;  1G7E A;  2AAE A;  1TFK A;  3S27 A;  1K0O A;  1S3R A;  2VCZ A;  3GZR A;  5FWG A;  3NM7 A;  4KB3 A;  2G2Q A;  13GS A;  4HVN A;  3F4T A;  3S5C A;  2GVP A;  3NBB A;  2WRT A;  4IEL A;  2KAA A;  3ME7 A;  2PBJ A;  1TFO A;  2KHP A;  1B9Y C;  2XFS A;  1X9S B;  1IQ8 A;  3BNE A;  3EN1 B;  5H5Q A;  1ERU A;  2CC3 A;  5CRG A;  3IBH A;  3OW2 2;  5A5K A;  5CYY A;  3EJV A;  3HII A;  1K8A 4;  3MAK A;  3F6F A;  3CMI A;  1UA5 A;  5L71 A;  2XHF A;  1BG5 A;  1YQ1 A;  5C00 A;  1LNI A;  3HXS A;  3NOF A;  5HR0 A;  4CJN A;  2R0G A;  1PQN A;  3G6E 3;  1SD8 A;  4A5P A;  3ED3 A;  4F03 A;  4WYK B;  2TRX A;  4HU7 A;  5EVO A;  1VF4 A;  2DIZ A;  2GT6 A;  1N2A A;  2WUL A;  1YF1 A;  3GTU A;  4BVX B;  5IOW A;  3I43 A;  1JLV A;  1U8C B;  4OK0 A;  1YKC A;  5GSP A;  1F37 A;  2LNS A;  1UGH I;  3CTF A;  1FOH A;  2PVO C;  1STD A;  1Z6N A;  4GHO A;  1Q81 4;  4MPG A;  4WXT A;  1GOY A;  2P05 A;  2A2S A;  3HJO A;  1KSI A;  1TDI A;  1JHB A;  4O5U A;  2CVB A;  2ALB A;  4XM4 A;  3N5O A;  5EL8 A;  2VL9 A;  3APS A;  5F07 A;  4HJ2 A;  3CSH A;  3IC8 A;  5CNW A;  4N6L A;  6GST A;  2E2U A;  5KN0 A;  1C54 A;  1V58 A;  3QMX A;  4ZBA A;  1GMQ A;  4WR4 A;  1XWG A;  4ECI A;  1T1V A;  5E4W A;  2HMK B;  1T4Z A;  6GSY A;  1R5A A;  4K5S A;  3B8L A;  3EIN A;  2L59 A;  1A2V A;  4RQX A;  4GLT A;  4GXZ A;  3S29 A;  4PUF C;  2W2C A;  1X1U A;  1X1W A;  1ZOF A;  2CZ2 A;  3QFA C;  2UZ8 A;  4XIH A;  2QA1 A;  2XEP A;  4FMA A;  4IT7 A;  4QQ7 A;  3I69 A;  3F9U A;  5ID2 A;  2E2M A;  1Z5Y E;  2FUG 2;  3GMF A;  1V74 A;  4TR3 A;  4YKF A;  4QWT A;  1SL1 B;  6GSU A;  2CZ3 A;  2YFJ B;  2F8F A;  1WOU A;  2YZU A;  3GUR A;  2W6J H;  2NBS A;  1Q7H A;  1IU7 A;  4BWQ A;  2H8L A;  1RKY A;  7GSS A;  5HOH A;  3MYT A;  3LYG A;  2PWJ A;  2RSX A;  1QAL A;  3U97 A;  4TW5 A;  1TP9 A;  4HQS A;  3UOM A;  1B4P A;  4NHZ A;  2F4Y A;  4ULX A;  1T2H A;  1SII A;  4MLY A;  2KRT A;  1B2M A;  3TJK A;  3CTG A;  2CWT A;  4XDV A;  2VD1 A;  4HUA A;  3D79 A;  4HU9 A;  4MP4 A;  3X3X A;  3FR9 A;  2H6Z A;  2NVL A;  4DKI A;  3G16 A;  1XWC A;  2V6K A;  2O87 A;  3GST A;  1QJG A;  3BNC A;  2Q07 A;  1A0R P;  1TRQ A;  4E8E A;  1IYI A;  2HSH A;  2F5M A;  4IW9 A;  1QVG 2;  4K9Z A;  1I8V A;  2IMK A;  2DJJ A;  1DSB A;  5G1L A;  2L5O A;  3ZFZ A;  1O7G B;  2KF6 A;  2XFT A;  5HGR A;  5JCG A;  1NHY A;  4Q5N A;  3CNM A;  5TGN A;  3DGO A;  1VGL A;  1Z1S A;  4K5R A;  3J7Y b;  4XRD A;  3SYU A;  2H74 A;  1A2L A;  3L0H A;  3PGB A;  1M2D A;  1FA3 A;  1M9A A;  1A8L A;  1V57 A;  1BSA A;  3GSS A;  3E99 A;  2HMO B;  5COH A;  2FWG A;  1GD4 A;  3DVX A;  1AQW A;  5BIR A;  1XVW A;  5F05 A;  2K3D A;  2MYG A;  1SKW B;  1ILO A;  4ZL8 A;  3LOY A;  5DAK B;  1IDP A;  1BRS A;  3PYJ A;  4TX4 A;  3T8U A;  2Z77 A;  3PGT A;  1PFO A;  2VM1 A;  1D6U A;  4KUN A;  1PYL A;  4IPB A;  7STD A;  1VQP 3;  3CSJ A;  2ON5 A;  20GS A;  4DSR A;  4DSS B;  2X49 A;  1YGW A;  2IFQ B;  3SOA A;  3D4A A;  1ZZY A;  2FGX A;  1LXE A;  1YVB I;  3KN4 A;  5J41 A;  2VL2 A;  3NUV A;  2JDI H;  1OGZ A;  1Q98 A;  5C04 A;  4AF2 A;  2CG1 A;  2HYX A;  5G30 A;  3M8N A;  3N8B A;  1FW1 A;  5J9B A;  5KN3 A;  1NNV A;  2UGI A;  1IV9 A;  1UI8 A;  2VCT A;  4RNZ A;  3ALA A;  1URM A;  2GTU A;  3TDG A;  2MBT A;  1U6T A;  2LQQ A;  1FUW A;  5G5F A;  2JAC A;  2RUE A;  1GSF A;  4WP5 A;  1R4C A;  2E2G A;  3O8Y A;  1KTE A;  4MMY B;  2VOC A;  4JE1 A;  5DCH A;  2BNG A;  5CF2 A;  2KXG A;  5DAL A;  2OTJ 3;  3GAX A;  3RDE A;  4EUY A;  3P2A A;  3KFQ C;  3KH7 A;  1RJO A;  2GT5 A;  1JRQ A;  4FCJ A;  3EQQ B;  1GYB A;  1UC7 A;  3H1N A;  4K7I A;  2ZUP A;  2NDO A;  1JBT A;  4K0G A;  3LYK A;  2YFL B;  1A0F A;  1PKW A;  4MJB A;  5GAP D;  5AIS A;  3KMN A;  3FR6 A;  3L9S A;  1X0R A;  4HM8 B;  3AGO A;  2YWM A;  1VQ7 3;  2CIU A;  1OKD A;  1PMT A;  4N3V A;  4IVF A;  3QR6 A;  1JN5 B;  2DML A;  2ES7 A;  1E3V A;  1N8R 4;  2DJ1 A;  3D22 A;  3LWA A;  3DEX A;  1ZYQ B;  4KGI A;  3D9R A;  2HMM B;  1BUQ A;  3DMC A;  3IE3 A;  2V6O A;  1K0N A;  1E2Y A;  4EYC A;  3TRQ A;  4LZI A;  2EIO A;  4R9L A;  1LQM B;  2VCV A;  4GSN A;  4O3V A;  4TRX A;  4X0X A;  3EMP A;  1N8Q A;  3PS8 A;  4WFO A;  2CX1 A;  2MZC A;  1EA2 A;  4HQZ A;  5DJM A;  4K1U A;  2KF5 A;  2D1W A;  4PUA A;  5KN2 A;  1BU4 A;  3NX0 A;  1AUC A;  4HZ9 B;  1W89 A;  3FRC A;  1M2A A;  5IG0 A;  1I2G A;  3CQF A;  3GYK A;  4RNY A;  4L5O A;  4J57 E;  4JRF A;  1GH2 A;  3WOD G;  2X64 A;  3FEU A;  2VM2 A;  4TXO B;  2MBS A;  3X42 A;  1ZGN A;  2K0M A;  1AY7 A;  5HR3 A;  2I3Y A;  3O6T A;  4HOH A;  1KD1 4;  3MKI A;  1M99 A;  3I0Y A;  3KII A;  2IA7 A;  1MEK A;  5DRE A;  5IMA A;  3CCQ 3;  2R0P A;  2EIQ A;  3J7Y k;  3D4T A;  2WGQ A;  3V99 A;  3DXO A;  1TI3 A;  6RNT A;  5LC7 A;  3LT8 A;  2YWI A;  3EMX A;  4K2D A;  5D96 A;  1B21 A;  4EIP A;  1WMP A;  5A4W A;  3JCM L;  1XCC A;  1XFL A;  4GSS A;  1GLQ A;  3ZIJ A;  2XPD A;  2BIR A;  1XWA A;  4HM7 B;  4N6U A;  1A24 A;  3TB2 A;  4L8O A;  4G9H A;  4DSQ A;  4J9A A;  1DMN A;  3RHB A;  3RAZ A;  4KA0 A;  1ZX2 A;  5D8I A;  5IMD A;  1QMA A;  1RSN A;  3TKS C;  1WTH A;  1RW1 A;  3D5G A;  1LBK A;  2I81 A;  3C7M A;  2VCQ A;  3ME8 A;  3GN3 A;  3KP9 A;  4KSM A;  5B8A A;  1EEJ A;  2UX0 A;  1YJ6 A;  2DLX A;  2NTO A;  1TRV A;  3GA4 A;  3IXR A;  4BL7 A;  1UUV B;  3VWV A;  4R80 A;  3CC7 3;  4HEA 2;  3F14 A;  4TXV A;  2FWH A;  2IMJ A;  2OKA A;  2ON7 A;  1OAC A;  2YV7 A;  4K7O A;  2QKE A;  3GZX B;  1OPY A;  2CAI A;  2IJY A;  4K0N A;  3DGM A;  3KCM A;  1ROA A;  2PUK C;  1USB A;  1WJK A;  4JF8 A;  3F7S A;  1U87 A;  3CC4 3;  2XGL A;  1GUK A;  2LJA A;  5ELA A;  2X99 A;  5ELU A;  5F0G A;  3BCI A;  1Y6E A;  3O3T A;  1LOY A;  3GL5 A;  1RGG A;  1FB0 A;  3CCS 3;  2YNX A;  2MMA A;  1X5C A;  3FW2 A;  4L0W A;  1PL1 A;  5CXO A;  1K3L A;  2PPT A;  2YOI A;  2H1A A;  1BNG A;  3DH2 A;  4EW5 A;  3HZP A;  2GSS A;  1M1X B;  3RHC A;  2XR8 B;  5ECQ B;  3KP8 A;  1E6B A;  1BRI A;  2DJ0 A;  3JUN A;  1FZU A;  1TIJ A;  1GSP A;  1B20 A;  4CDO A;  3VI7 A;  2RUF A;  4J56 E;  2CFL A;  2FA8 A;  1UCK A; 
#chains in the Genus database with same CATH homology
 3HJP A;  1AQV A;  2VLV A;  3C1R A;  1J08 A;  1BQ7 A;  1MDJ A;  4WBJ A;  3EPT A;  2IME A;  4XS4 B;  2MMO A;  4E8H A;  3D0Z A;  3DWV A;  1XOA A;  4KDX A;  2AHE A;  1Y25 A;  3BCK A;  5DBQ A;  4EL1 A;  3KJY A;  4KF9 A;  4USS A;  5IM9 A;  4RI6 A;  4FQU A;  5DJL A;  3WYW A;  1T3B A;  2B1L A;  5JCU A;  3ZML A;  1WRY A;  9GSS A;  4RUV A;  3M9J A;  3I6A A;  4D73 A;  1EP7 A;  1CQH A;  2BJX A;  1PRX A;  3GKK A;  3GTU B;  2JZS A;  5D93 A;  1AQX A;  2H72 A;  2N5A A;  4G2E A;  2YJ7 A;  2R6K A;  1X5D A;  4MPF A;  2IWT A;  3ZFL A;  3UJ1 A;  2JU5 A;  5ECO B;  3HCZ A;  2HFD A;  2YP6 A;  4EO3 A;  2GDR A;  5KOW A;  3IAS 2;  2FA4 A;  4ISD A;  3GKN A;  5ECP B;  1QK8 A;  3IA1 A;  3MNG A;  2VCX A;  4ML1 A;  4IHU A;  5LNK e;  3HHV A;  1HQO A;  3UL3 A;  3IV4 A;  5G5E A;  3RBT A;  4AGS A;  3KXO A;  1OC3 A;  2RLI A;  3A2X A;  3O76 A;  4OMV A;  3RPP A;  4MJC A;  5IMC A;  4NWY A;  2CX3 A;  3UEM A;  3SWL A;  1QMV A;  2H71 A;  1GNW A;  4AJ8 A;  5ECM B;  4WET A;  3GX8 A;  6GSX A;  1ABA A;  4YH2 A;  4Q5R A;  4GTU A;  4YAV A;  2R5G A;  2LRT A;  2M80 A;  1EGR A;  4BA7 A;  1C72 A;  2YWN A;  4GCI A;  5DDL A;  2IMI A;  3CBU A;  5JCW A;  12GS A;  2HE3 A;  2VAF A;  1T4Y A;  4N11 A;  4OO5 A;  2EIR A;  1TOF A;  5IMF A;  3I9V 2;  4JED A;  3HY2 A;  2HRK A;  1JZR A;  5IMV A;  2G0F A;  1T7P B;  4OFN A;  2I4A A;  4HS1 A;  4K1F A;  1GP1 A;  1GSE A;  1QFN A;  3ERG A;  4PX1 A;  3TKS A;  2JL4 A;  1WMJ A;  6GSS A;  4HZ4 A;  3VFI A;  1QUW A;  3M3M A;  4I5Q A;  5IO2 A;  3FMW A;  1V40 A;  4LMV A;  1Z3E A;  3FZA A;  4Z2U A;  1O7U A;  1JZD A;  1HYU A;  3FR3 A;  3M9K A;  3LXZ A;  3ZFB A;  4XTS A;  2LTK A;  3IHG A;  1XIY A;  5IOX A;  2KLX A;  3M1G A;  4YQM A;  3LJR A;  1V98 A;  1YY7 A;  4ML6 A;  3DXB A;  1QQ2 A;  2HRF A;  3F4R A;  2H0G A;  3D5J A;  1XZO A;  5HFI A;  2GST A;  1F2E A;  1J9B A;  5D9V A;  4IP1 A;  3QAW A;  1A2J A;  3HJM A;  5ECN B;  1OC9 A;  3C71 A;  1UN2 A;  2OAD A;  3EYT A;  1NW2 A;  2WCI A;  2CV4 A;  1K0M A;  3KMO A;  4G0K A;  1NM3 A;  2GSQ A;  5DQS A;  4ZL9 A;  3TJB A;  1XPV A;  3NZN A;  5GZZ B;  1BYE A;  2H1B A;  5CAX A;  4TKY A;  4QL7 A;  1TRU A;  2GZZ A;  1WE0 A;  3F3Q A;  3DGQ A;  4Q5F A;  1YF0 A;  1PL2 A;  2PER A;  4ZB9 A;  3MYD A;  1MTC A;  2HZE B;  3P90 A;  4O92 A;  4PQI A;  4CY8 A;  1GSS A;  1EGO A;  2L6D A;  3KZQ A;  3DRN A;  4JR6 A;  3UAR A;  2B6M A;  2LST A;  1SD9 A;  2VCW A;  2R37 A;  4V2L A;  1G6W A;  5D9X A;  1SK1 A;  3EWL A;  2B5X A;  1O73 A;  1SJI A;  2IL3 A;  3BJ5 A;  5A4V A;  1PD2 1;  4KW6 A;  4TVE A;  2LRN A;  3APO A;  3D6I A;  4I8B A;  3ERF A;  5CRD A;  4MZB A;  2JAD A;  4FYB A;  4V1A p;  2DKI A;  1U88 A;  3R3E A;  1TXX A;  1F9M A;  4JR4 A;  2K8S A;  3UVH A;  4G10 A;  3LW9 A;  1EV9 A;  4PGT A;  22GS A;  2R2J A;  4F9Z A;  4ILF A;  1N8J A;  1K0B A;  1ZMA A;  1GNE A;  4PNG A;  17GS A;  3ZL5 A;  1XW6 A;  4I2U A;  4JBB A;  2IIY A;  1XW9 A;  2H01 A;  4Z7X A;  4ZL7 A;  4G19 A;  5GAN D;  4MH3 A;  1OE8 A;  3QAG A;  3CYN A;  3C8E A;  1GTI A;  2B5E A;  2YN1 A;  3TOU A;  3QD9 A;  3HYP A;  4BVX A;  5A4U A;  5IPG A;  3HVX A;  4FYU A;  4F0B A;  1ZCP A;  1GUM A;  4K8M A;  2KP1 A;  1AXD A;  5F8B A;  4KDY A;  4XS6 A;  5AGY A;  3U5R E;  1K3O A;  2H6X A;  5J9C A;  5HFG A;  4N0V A;  3L78 A;  4AJ6 A;  5B6M A;  4I6X A;  2DBC A;  2LKU A;  3BBY A;  2OJL A;  2DJ3 A;  4I97 A;  1JLW A;  4MZW A;  3PPU A;  18GS A;  3HA9 A;  3H8Q A;  2JZT A;  2J9H A;  4HI7 A;  1MDK A;  3ZTL A;  2HZF A;  4EF0 A;  3KD0 A;  3QAV A;  4MMM A;  1S3D A;  2B7J A;  4D73 B;  3HVS A;  3BOA A;  5ECS A;  3ZVJ D;  2K18 A;  2BMX A;  1R26 A;  3VLN A;  1B48 A;  1HNC A;  1M7T A;  1AIU A;  2CVK A;  2XBQ A;  4G0I A;  1FG4 A;  4KCA A;  4FIW A;  1OVN A;  1G6Y A;  1EOG A;  4FO5 A;  1SK2 A;  2WJU A;  3LYP A;  4LLR A;  3PR8 A;  3QCP A;  4V2N A;  14GS A;  5HR1 A;  5JWQ B;  5BRT A;  4IKH A;  1SU9 A;  3AY8 A;  5DQY A;  3APQ A;  3ZLP A;  5CP1 A;  4KND A;  1TTZ A;  4MK3 A;  2C80 A;  1XOB A;  5ECH B;  3Q74 A;  1A2M A;  3G7I A;  3FZ5 A;  4QL9 A;  3VI5 A;  2I9H A;  3TRP A;  1I9D A;  4IJ3 A;  3IR4 A;  2IY2 A;  3F6D A;  1TKD B;  2K6V A;  2O8V B;  1XWK A;  1Z7R A;  2QC7 A;  1OE7 A;  3LXT A;  2H0I A;  3CRU A;  1XWB A;  2LEG A;  3A2W A;  5DAK A;  4KE3 A;  5DVB A;  3UIW A;  4TN8 A;  3TKP A;  3CSI A;  1B4Q A;  1WP0 A;  1EZK A;  2F8A A;  5AIX A;  1FO5 A;  2H70 A;  4DSS A;  2RII A;  2B5Y A;  2WGR A;  3GV1 A;  2IFQ A;  2CT6 A;  4BVY B;  2Z9S A;  3GUS A;  2E7P A;  3QPM A;  2C8U A;  2KOK A;  4POK A;  3ZRD A;  3HDC A;  1SJ6 A;  2H75 A;  4L5L A;  4TR1 B;  3VPQ A;  4OCE A;  4WR5 A;  4MH2 A;  1TK5 B;  4H86 A;  4EC0 A;  5KN1 A;  4TR4 A;  1TI1 A;  3MWH A;  2HRN A;  1B9X C;  2GQM A;  1F6M C;  3N9J A;  1VRS D;  4N0Z A;  1R5P A;  1FHE A;  5F06 A;  1R7H A;  3ZRE A;  1TRS A;  3ZYW A;  2BTO T;  2HXK A;  5IO0 A;  5D9W A;  4KX4 A;  3HZ8 A;  2J23 A;  2K9F A;  3EVI A;  4X43 A;  3C73 A;  2MMZ A;  1YKA A;  4EXJ A;  2HRA A;  1V9W A;  2C0E A;  2L4C A;  2YJH A;  1ON4 A;  1DE2 A;  4HJM A;  3DD3 A;  4EVM A;  2C3N A;  4ICY A;  4O5Q A;  3WGX A;  5J3R A;  2B1K A;  2HI7 A;  3FYG A;  4LA1 A;  4HDE A;  2LNT A;  3UVT A;  1G0T A;  2EC4 A;  4IGJ A;  3A5I A;  2VO4 A;  4CY6 A;  2REM A;  4OFM A;  2R4V A;  5HFK A;  3L9V A;  2H76 A;  2XC2 A;  1BAY A;  3DIE A;  4TXO A;  3QFB C;  1WPI A;  4O32 A;  2H73 A;  2OAC A;  2PGT A;  2CVD A;  3Q6O A;  1W4V A;  2C4J A;  1K0A A;  1GWC A;  3BD2 A;  3IHQ A;  4OFT A;  3F63 A;  3TGZ A;  1QGV A;  2DSA A;  4MF7 A;  3GKM A;  1RQM A;  1OAZ A;  1TU7 A;  1FB6 A;  5ID2 B;  4ZBB A;  3GH6 A;  4IQ1 A;  2FLS A;  1HD2 A;  4BPY A;  3UBL A;  4WF4 A;  4Q5Q A;  2D2Z A;  4K6X A;  1KEB A;  2C3Q A;  1SK0 A;  2GZP A;  3HD5 A;  5B7C A;  2X4A A;  1OKT A;  4N30 A;  4ECJ A;  1GTA A;  2R3X A;  1BX9 A;  3A2V A;  1O85 A;  5FT3 A;  4TOP A;  2YPM A;  1O6J A;  5INY A;  4OD7 A;  2FNO A;  3FHK A;  19GS A;  2CAQ A;  2OA7 A;  3LFL A;  2A4V A;  2TRC P;  1YDK A;  1XW5 A;  2DJ2 A;  4ECC A;  4LL4 B;  2L4Q A;  1H75 A;  4P3Y B;  3UBK A;  4TR0 A;  3RPN A;  4IS0 A;  1YEP A;  4MAB A;  1PX6 A;  2OE3 A;  4IQA A;  1HNB A;  1JZO A;  2VL3 A;  2B3S A;  4NV5 A;  4GWR A;  3RDW A;  1BJX A;  1TW9 A;  3TKQ A;  6GSW A;  1TU8 A;  4F2I A;  1FAA A;  2P5R A;  3F4S A;  4KAE A;  3IK9 A;  2GSR A;  4MNN A;  3QDN A;  2C0D A;  3V1W A;  5IPH A;  4BWS A;  2VIM A;  4XS4 A;  2LUS A;  3LEF A;  1IYH A;  2H66 A;  2DJK A;  3IDV A;  4EDZ A;  4I2T A;  1TK0 B;  2GGT A;  1M0U A;  3GRX A;  4MJA A;  5KEJ A;  2OBK A;  2IYJ A;  4J2F A;  5D9T A;  2ZCT A;  3FKF A;  1GLP A;  4MDC A;  5DAL B;  4GQC A;  3KM6 A;  5KOX A;  3IC4 A;  5ABR A;  2IMF A;  1SEN A;  2N5F A;  2M46 A;  5G31 A;  5LD0 A;  2VLT A;  2YZH A;  4PTS A;  1MD4 A;  5G2Z A;  2LQO A;  4EE0 A;  1OC8 A;  4MF6 A;  3ZZX A;  3WT2 A;  3ZIT A;  1VF2 A;  1THX A;  4XCS A;  4XHM A;  5IIZ A;  4PUR A;  4LL1 B;  1K0C A;  2XBI A;  1DE1 A;  2CQ9 A;  4LMW A;  4POB A;  1O81 A;  3E9J B;  4PXO A;  1O8W A;  4GF0 A;  3VK9 A;  3LSZ A;  2RM5 A;  3TKR A;  2X8C A;  4NHW A;  4WBR D;  4DVC A;  3GL3 A;  2OE0 A;  1PN0 A;  2L6C A;  4POM A;  4Z2T A;  2AAW A;  5ECI B;  3A5W A;  2XPE A;  3M0F A;  4F82 A;  1QXH A;  1HNA A;  2O7K A;  2KUC A;  1GSD A;  4ZXG A;  4ZBD A;  4AJ7 A;  1ACV A;  1AW9 A;  3TUE A;  3W6G A;  2X8G A;  2P0G A;  1ERW A;  1SYR A;  5JWR B;  3EUR A;  2ZNM A;  3P8W A;  1KBN A;  3Q18 A;  3FZ9 A;  1A8Y A;  3WT1 A;  3K8N A;  2TIR A;  1YZX A;  4PQH A;  10GS A;  2JZR A;  2GS3 A;  4HZ2 A;  2FHE A;  4F0C A;  4O7H A;  3ZMK A;  4XS1 A;  1PGT A;  3US3 A;  1M9B A;  4KDU A;  4BL7 B;  2VD0 A;  3TCO A;  1SKR B;  5ECR B;  1Z6M A;  3G9B A;  5BMU A;  3R2Q A;  2AYT A;  1PSQ A;  3LGC A;  1SJZ A;  1O8X A;  2H1D A;  3Q19 A;  1VF1 A;  3IRA A;  3IAM 2;  2MMN A;  2V1M A;  4EDY A;  2F51 A;  3F8U A;  4YKG A;  2GZY A;  3MSZ A;  4X1U A;  5AN1 A;  3VWW A;  2YWO A;  3D21 A;  5IMZ A;  2JSZ A;  2HLS A;  2O89 A;  2OE1 A;  2DC5 A;  3C1S A;  4YAP A;  2O85 A;  3G7Y A;  2R0C A;  4POL A;  4ZB6 A;  1ML6 A;  2IMD A;  1FVK A;  3GKX A;  4IP6 A;  2A2R A;  2LV3 A;  2H1G A;  3ZVJ A;  3MIX A;  4EIQ A;  3H79 A;  2E0Q A;  2YCD A;  4GRF A;  2GLR A;  1JZW A;  4NPB A;  3DKS A;  1ZYE A;  4ZIJ A;  2QGV A;  3NIV A;  4G0L A;  3UAP A;  2OBI A;  1SKS B;  1M2B A;  4ID0 A;  4OCF A;  2IPA A;  4CHS A;  3S9F A;  1WWJ A;  1MDI A;  1A23 A;  1T8E B;  2AV4 A;  2AB6 A;  5G1K A;  2H30 A;  3DML A;  1S3A A;  3E3E A;  3GFK A;  1UVZ A;  3F3R A;  16GS A;  1AC1 A;  3KEB A;  5E59 A;  5HR2 A;  5JWO B;  4X4J A;  4GST A;  2DIY A;  1X9W B;  2HSY A;  2QA2 A;  4KCE A;  2H19 A;  3PIN A;  11GS A;  5CRE A;  1EWX A;  5ECK B;  2FWF A;  4GQF A;  1PN9 A;  5CRW A;  2HZE A;  2IN3 A;  4RI7 A;  1GL8 A;  1TK8 B;  3TOT A;  3H4K A;  4HOJ A;  3TRX A;  4NMU A;  2GQK A;  1U3I A;  4K2X A;  4NV2 A;  2LJR A;  4WEY A;  3SBC A;  5J4U A;  3EU4 A;  1THO A;  3HZ4 A;  4OWY A;  5EY6 A;  4MA9 A;  4KSO A;  4ZIL A;  1GTU A;  1Q4J A;  1T00 A;  2P5Q A;  3ERW A;  3WD6 A;  1ZYN A;  1EP8 A;  2DMM A;  5ECL B;  1KNG A;  3KTB A;  1SL2 B;  2PMT A;  1Z9H A;  1ERV A;  1EOH A;  1MD3 A;  2F9S A;  1U3A A;  4ZB8 A;  1AAZ A;  2CA8 A;  2FY6 A;  4CW9 A;  4XRA A;  3W8S A;  1H4O A;  3HKR A;  3GHA A;  4MJE A;  4MCU A;  5LCZ A;  4IJI A;  1BED A;  3FZ4 A;  4N10 A;  3LQ7 A;  1X9M B;  1SYX A;  2YAN A;  2H6Y A;  2L57 A;  1XBS A;  3FY7 A;  1GUL A;  8GSS A;  2M72 A;  3FK8 A;  1GSU A;  3IOS A;  4K7N A;  2C1Y A;  1GRX A;  1K0D A;  3KH9 A;  2LRC A;  2P31 A;  1EV4 A;  6GSV A;  5DCG A;  1XXU A;  5ENU A;  5ELG A;  2V32 A;  1ZL9 A;  1XVQ A;  5B6N A;  1ERT A;  1PA3 A;  3ISO A;  3P7X A;  2AJQ B;  1K3Y A;  3TJJ A;  3IPZ A;  2A4H A;  1DBY A;  1LU4 A;  2V41 A;  1GUH A;  4NAX A;  2FCH A;  1B8X A;  4L8E A;  1I5G A;  1NHO A;  3TKS E;  3KIJ A;  5HQP A;  2F3M A;  1ZYP A;  2HNL A;  2K8V A;  5EPF A;  1YEX A;  1ST9 A;  2WFC A;  2DKH A;  3CRT A;  3KTL A;  4NXI A;  4WF5 A;  2L5L A;  1NSW A;  5D73 A;  2LJK A;  3TJG A;  4L0U A;  3WGD A;  3GIX A;  2PU9 C;  1F3A A;  4YQV A;  3L4N A;  1JFU A;  3G7J A;  1GTB A;  1R4W A;  4WKW A;  5IQY A;  1J0F A;  4JZQ A;  4YQU A;  3WGE A;  2PN8 A;  3EC3 A;  4JRR A;  3VPT A;  4Z2R A;  2AUV A;  5CO3 A;  1SL0 B;  4IN0 A;  5B8B A;  4V1A g;  2KP2 A;  1X5E A;  4RQR A;  2CX4 A;  4V2M A;  3LOR A;  4DEJ A;  1DUG A;  3QOU A;  1F3B A;  1WIK A;  5H5S A;  4ECB A;  4OO4 A;  4FYC A;  1OC9 B;  3GNJ A;  3EE2 A;  4O5R A;  2V2G A;  4IBP A;  3IK7 A;  3A3T A;  5H5R A;  1OYJ A;  3F0I A;  3E0U A;  1PX7 A;  2WDU A;  1S3C A;  1VF3 A;  4JU5 A;  4PNF A;  2C0G A;  2C0F A;  1GSQ A;  2RM6 A;  5J5N A;  2N5B A;  4KH7 A;  2FD3 A;  5FHI A;  4MF5 A;  1LJR A;  1PKZ A;  1RK4 A;  1CQG A;  2C3T A;  3ZIV A;  3KGK A;  3L9U A;  2WS2 A;  2VUP A;  2NPB A;  1Z7P A;  3GX0 A;  2VLU A;  1G7O A;  3DYR A;  4EKZ A;  1GSY A;  1FOV A;  1FVJ A;  2VL2 C;  3GH9 A;  3UMA A;  2A2P A;  2PVQ A;  3CXG A;  2X8H A;  2I1U A;  2GQL A;  2WZ9 A;  3U6V A;  2FWE A;  2WB9 A;  3DVW A;  3D4M A;  2HT9 A;  3OR5 A;  2HSM A;  3VWU A;  4ACS A;  2H0H A;  4BVY A;  4PQ1 A;  3TJF A;  1V2A A;  2YV9 A;  2JSY A;  2LS5 A;  3HVV A;  2B7K A;  3H93 A;  4FH8 A;  4TR1 A;  5GSS A;  1TJD A;  2QSI A;  3MDK A;  3VUR A;  3LG6 A;  5AIV A;  3VWX A;  3W8J A;  3PH9 A;  1TRW A;  4MZC A;  5CRH A;  3EU3 A;  1EEM A;  5GST A;  1G7E A;  1K0O A;  2VCZ A;  5FWG A;  4KB3 A;  2G2Q A;  13GS A;  3F4T A;  2GVP A;  2WRT A;  4IEL A;  3ME7 A;  2PBJ A;  2KHP A;  1B9Y C;  1X9S B;  5H5Q A;  1ERU A;  5CRG A;  3IBH A;  5A5K A;  5CYY A;  3MAK A;  3F6F A;  3CMI A;  1UA5 A;  5L71 A;  2XHF A;  1BG5 A;  1YQ1 A;  5C00 A;  3HXS A;  3NOF A;  5HR0 A;  2R0G A;  1PQN A;  1SD8 A;  4A5P A;  3ED3 A;  4F03 A;  2TRX A;  4HU7 A;  5EVO A;  1VF4 A;  2DIZ A;  2GT6 A;  1N2A A;  2WUL A;  1YF1 A;  3GTU A;  4BVX B;  5IOW A;  3I43 A;  1JLV A;  1YKC A;  1F37 A;  2LNS A;  3CTF A;  1FOH A;  2PVO C;  1Z6N A;  4MPG A;  4WXT A;  2A2S A;  3HJO A;  1TDI A;  1JHB A;  4O5U A;  2CVB A;  2ALB A;  3N5O A;  5EL8 A;  2VL9 A;  3APS A;  5F07 A;  4HJ2 A;  3CSH A;  3IC8 A;  5CNW A;  6GST A;  5KN0 A;  3QMX A;  1V58 A;  4ZBA A;  4WR4 A;  1XWG A;  4ECI A;  1T1V A;  5E4W A;  1T4Z A;  6GSY A;  1R5A A;  4K5S A;  3EIN A;  2L59 A;  4RQX A;  4GLT A;  4GXZ A;  4PUF C;  1ZOF A;  3QFA C;  2CZ2 A;  2UZ8 A;  4XIH A;  2QA1 A;  4QQ7 A;  3I69 A;  3F9U A;  5ID2 A;  2E2M A;  1Z5Y E;  2FUG 2;  3GMF A;  4TR3 A;  4YKF A;  1SL1 B;  6GSU A;  2CZ3 A;  2F8F A;  1WOU A;  2YZU A;  3GUR A;  2NBS A;  4BWQ A;  2H8L A;  7GSS A;  2PWJ A;  4TW5 A;  1TP9 A;  4HQS A;  3UOM A;  1B4P A;  4NHZ A;  4ULX A;  4MLY A;  3TJK A;  3CTG A;  2VD1 A;  4HUA A;  4HU9 A;  4MP4 A;  3FR9 A;  2H6Z A;  2NVL A;  1XWC A;  2V6K A;  2O87 A;  3GST A;  1A0R P;  4E8E A;  1IYI A;  2HSH A;  4IW9 A;  4K9Z A;  2IMK A;  2DJJ A;  1DSB A;  5G1L A;  2L5O A;  5JCG A;  1NHY A;  4Q5N A;  1VGL A;  4K5R A;  3J7Y b;  4XRD A;  2H74 A;  1A2L A;  3L0H A;  1M2D A;  1M9A A;  1A8L A;  1V57 A;  3GSS A;  5COH A;  2FWG A;  3DVX A;  1AQW A;  1XVW A;  5F05 A;  2MYG A;  1SKW B;  1ILO A;  4ZL8 A;  5DAK B;  3PGT A;  2VM1 A;  4KUN A;  3CSJ A;  2ON5 A;  20GS A;  4DSR A;  4DSS B;  2X49 A;  2IFQ B;  1ZZY A;  2FGX A;  5J41 A;  2VL2 A;  1Q98 A;  4AF2 A;  5C04 A;  2HYX A;  5G30 A;  3M8N A;  1FW1 A;  5J9B A;  5KN3 A;  2VCT A;  1URM A;  2GTU A;  3TDG A;  2MBT A;  1U6T A;  2LQQ A;  5G5F A;  2JAC A;  2RUE A;  1GSF A;  2E2G A;  1KTE A;  2VOC A;  4JE1 A;  5DCH A;  5DAL A;  4EUY A;  3P2A A;  3KH7 A;  2GT5 A;  1UC7 A;  3H1N A;  4K7I A;  2ZUP A;  2NDO A;  4K0G A;  3LYK A;  1A0F A;  1PKW A;  4MJB A;  5GAP D;  5AIS A;  3KMN A;  3FR6 A;  3L9S A;  1X0R A;  2YWM A;  1OKD A;  1PMT A;  4IVF A;  3QR6 A;  2DML A;  2ES7 A;  2DJ1 A;  3LWA A;  3D22 A;  3DEX A;  1ZYQ B;  4KGI A;  3IE3 A;  2V6O A;  1K0N A;  1E2Y A;  3TRQ A;  2EIO A;  2VCV A;  4GSN A;  4TRX A;  4X0X A;  3EMP A;  2MZC A;  4HQZ A;  5DJM A;  4PUA A;  5KN2 A;  1AUC A;  1W89 A;  3FRC A;  1M2A A;  3GYK A;  4L5O A;  4J57 E;  1GH2 A;  2X64 A;  3FEU A;  2VM2 A;  4TXO B;  2MBS A;  1ZGN A;  5HR3 A;  2I3Y A;  3O6T A;  1M99 A;  1MEK A;  5IMA A;  2R0P A;  2EIQ A;  3J7Y k;  3D4T A;  1TI3 A;  3EMX A;  4K2D A;  2YWI A;  5D96 A;  4EIP A;  5A4W A;  3JCM L;  1XCC A;  1XFL A;  4GSS A;  1GLQ A;  3ZIJ A;  2XPD A;  1XWA A;  1A24 A;  3TB2 A;  4G9H A;  4DSQ A;  3RHB A;  3RAZ A;  4KA0 A;  5D8I A;  5IMD A;  3TKS C;  1RW1 A;  1LBK A;  2I81 A;  3C7M A;  2VCQ A;  3ME8 A;  3GN3 A;  3KP9 A;  4KSM A;  5B8A A;  1EEJ A;  1YJ6 A;  2DLX A;  2NTO A;  1TRV A;  3GA4 A;  3IXR A;  4BL7 A;  3VWV A;  4HEA 2;  4TXV A;  2FWH A;  2OKA A;  2ON7 A;  2YV7 A;  4K7O A;  2QKE A;  2CAI A;  2IJY A;  4K0N A;  3KCM A;  2PUK C;  1USB A;  1WJK A;  1U87 A;  1GUK A;  2LJA A;  5ELA A;  2X99 A;  5F0G A;  3BCI A;  1Y6E A;  3O3T A;  3GL5 A;  1FB0 A;  2YNX A;  2MMA A;  1X5C A;  3FW2 A;  4L0W A;  1PL1 A;  1K3L A;  2PPT A;  2YOI A;  2H1A A;  2GSS A;  3RHC A;  5ECQ B;  3KP8 A;  1E6B A;  2DJ0 A;  4CDO A;  3VI7 A;  2RUF A;  4J56 E;  2FA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...