1JZOA

Dsbc c101s
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal Structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN DSBC
total genus 67
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzoA02
2MBTA 1JLWA 4V2NA 1K0CA 3EMPA 2RIIA 3Q74A 3P2AA 3W6GA 4J57E 3M9KA 4ECJA 2EC4A 4L5OA 5D9WA 1IYIA 3QD9A 1Z9HA 1HNBA 1Z7PA 2X8HA 1K3YA 2PN8A 3BCKA 1PQNA 4XIHA 1EOGA 2H0IA 4OFMA 3HJPA 4MF7A 1XW6A 3PINA 4KA0A 3US3A 5F0GA 4LL1B 1WMJA 4I8BA 2B7KA 2H76A 4IJ3A 4OO5A 3F8UA 3BOAA 3EVIA 1HD2A 3UVHA 3M1GA 4WR4A 5KEJA 3GX8A 2HZEB 1JZOA 4PUFC 2FHEA 3BJ5A 2IL3A 3VWXA 5A4VA 2TRCP 4KCEA 4XCSA 1KBNA 4V1Ag 3ZREA 2OA7A 5ECQB 3RHCA 1K3OA 4YAVA 3CBUA 2E7PA 1G6WA 2GQMA 5F07A 4WF5A 3UEMA 4PGTA 3L9UA 4J2FA 2XC2A 3KD0A 3TRXA 1XCCA 4HU7A 2DIZA 4DVCA 3EYTA 2DC5A 1K3LA 1XWCA 4ULXA 5KN3A 3FZ4A 4DSSB 3G9BA 5DQYA 1WIKA 2ON7A 1QUWA 2YWOA 4TN8A 1XVWA 4OFNA 5IIZA 2VCQA 4GTUA 4L5LA 5F8BA 2EIOA 5DBQA 2P5QA 2TRXA 4F82A 2OBIA 4POMA 5J5NA 3UBLA 3ZZXA 2VIMA 5DAKA 1OC8A 2KLXA 1GNWA 2B7JA 5LD0A 3KH7A 1K0BA 3ERWA 1ML6A 4ILFA 1BYEA 1WE0A 2NBSA 4PNFA 1M2DA 4N10A 5J4UA 3ZVJD 1K0MA 1N2AA 1F2EA 1XW5A 3IAM2 3L9VA 1PL2A 5D9XA 1AQVA 2JADA 1AIUA 1YQ1A 4RI7A 5B6NA 3LEFA 3H93A 4K0GA 1TXXA 3IE3A 5COHA 4TR0A 1V98A 4ZL7A 3TJBA 1G6YA 5IMAA 4FYCA 1K0DA 1OKTA 2OE0A 2VLVA 2M80A 5HFGA 3GUSA 1HQOA 1GRXA 2YWIA 2VL3A 2R6KA 1IYHA 1LJRA 5IQYA 4K6XA 2H6ZA 3DGQA 3F0IA 3ZLPA 1SK1A 4IP1A 2LV3A 5IMVA 2L6DA 2CVBA 5CRWA 2LEGA 2CZ2A 2GS3A 3G7YA 5ELAA 1MDJA 4OO4A 3U6VA 4NHWA 3EC3A 2A2SA 1SKRB 1TU8A 1LBKA 4BVXA 1G7OA 2C0DA 2H1GA 5CP1A 3WD6A 2K8VA 1R7HA 2BMXA 4TR1B 3GH9A 3ZMKA 3FY7A 2FY6A 6GSWA 3GA4A 3N9JA 3Q18A 1S3DA 2WDUA 2CVDA 4NMUA 2J23A 2I4AA 1GULA 3HVXA 2FWFA 2H1DA 2NDOA 2LQQA 1PKWA 1YY7A 1O8WA 2D2ZA 4K9ZA 1ZYEA 1GUHA 1PD21 2R37A 2HNLA 3CYNA 2L5LA 3J7Yk 1A24A 1T3BA 4YQMA 4F2IA 3FZ5A 4IP6A 1SJ6A 2J9HA 5ECNB 1T8EB 4JEDA 3BBYA 3DYRA 1MD4A 1TRVA 5H5SA 3K8NA 1ABAA 2H1AA 2H30A 2VD1A 1GUMA 1AQXA 1A2MA 3I9V2 4FIWA 4WKWA 5IMCA 4MZBA 3WGEA 4N0ZA 2C1YA 3LWAA 4KUNA 2MMNA 3TOUA 3UL3A 6GSVA 1PA3A 5INYA 1TK8B 3D6IA 1HYUA 1TKDB 3A2VA 2HI7A 5ABRA 3GKXA 4IELA 2RM6A 5CO3A 1FHEA 11GSA 5HFIA 3RHBA 2YCDA 22GSA 3TKPA 4ISDA 1RK4A 3IBHA 1GWCA 4KGIA 4PX1A 2I9HA 3IA1A 3DVWA 4V2LA 6GSSA 1SKWB 3APQA 4GXZA 2CA8A 4RI6A 1B8XA 3WT2A 5LNKe 2B5XA 3G7IA 5AGYA 1FG4A 2YPMA 3GL3A 2DJKA 2QSIA 1H4OA 3QCPA 3A2WA 2FGXA 1VGLA 2DJ3A 3LORA 4IHUA 1W4VA 3IAS2 2VCZA 1YEXA 3VWVA 2O8VB 3H8QA 2VL2C 4EKZA 3Q19A 5HQPA 2H0HA 1JZRA 2VAFA 3GRXA 3KMNA 3KTLA 4PUAA 8GSSA 4LMWA 3VFIA 1XWKA 3OR5A 4Q5RA 1TP9A 3DIEA 3GV1A 2FWGA 1SL1B 1YJ6A 3GN3A 4YQVA 2H0GA 20GSA 4GRFA 4OCFA 4IGJA 17GSA 4XTSA 1TTZA 2DJJA 3P7XA 4XS4A 2B3SA 2REMA 2CT6A 2HE3A 1S3AA 4Q5FA 2FNOA 2A2RA 1NHOA 1GTAA 2EIQA 1SD8A 3LXZA 1FAAA 2OKAA 1UVZA 2PPTA 3IXRA 1PMTA 3KGKA 4EL1A 2X99A 4G10A 3ERGA 12GSA 4ZL9A 3KXOA 3UBKA 5IO2A 1T4YA 3C71A 2RM5A 4Q5QA 2H74A 1OE7A 4DSRA 4BPYA 5E59A 4PNGA 2YANA 3DEXA 1M9BA 2YV9A 4MPFA 2V41A 4N11A 1XZOA 1ACVA 3DD3A 1XIYA 1Z6MA 3HHVA 5B7CA 2DLXA 9GSSA 3VPQA 1UA5A 4JZQA 2C3NA 3HJMA 2BJXA 2DMMA 4IQAA 3JCML 3HY2A 2OE1A 2GT6A 4K0NA 3WYWA 3P90A 3DVXA 4HI7A 3G7JA 2GQLA 3IDVA 4MF6A 3RBTA 2MMAA 1XXUA 4F0CA 16GSA 5AIXA 1URMA 1OC9A 3IV4A 2GTUA 1OYJA 2IMDA 1MEKA 3GMFA 5GZZB 4MK3A 1ZYQB 2TIRA 5B8BA 1X0RA 5FT3A 2L57A 3LYKA 3NZNA 1PSQA 1A23A 1TK5B 1THXA 4YQUA 4IBPA 5DQSA 2R3XA 3ISOA 1OC3A 2O87A 4GWRA 3C8EA 4MH2A 4TXOB 1DUGA 1TRSA 4MP4A 2GSSA 3QAGA 2B1KA 1M99A 2G2QA 4MABA 4LLRA 3HXSA 1GTIA 2IFQA 4XS4B 3DMLA 1BEDA 2DJ1A 4QQ7A 2O89A 3GURA 4ZXGA 1F6MC 1SD9A 3F63A 1AW9A 5ECMB 4F03A 4BWSA 5DCHA 3LSZA 3TJJA 1GSYA 5JWRB 1XBSA 1YKCA 3ZTLA 2G0FA 5G1KA 5F05A 3O76A 5CNWA 5FWGA 1Z7RA 1U3IA 3F3QA 1ZMAA 3C1RA 2V32A 5ECKB 1Y25A 1V57A 2CV4A 2QKEA 5H5QA 3TRQA 3FW2A 2H6YA 4IN0A 2VM2A 4ZL8A 3AY8A 1FB6A 4IS0A 3GSSA 2XPEA 5ECSA 1N8JA 3DKSA 2H66A 5A5KA 3NOFA 5HFKA 2WZ9A 3GKKA 5A4WA 2LRTA 2HSYA 2MBSA 2JACA 5DDLA 3VPTA 3VI5A 3HVVA 3KM6A 2I3YA 2IMFA 1O81A 5CREA 4O92A 5EVOA 1A0FA 1V2AA 2LSTA 1EP7A 1GL8A 7GSSA 1I5GA 2C3QA 2H01A 2DBCA 1EP8A 2RLIA 4LL4B 2HSHA 2IYJA 4MDCA 2K8SA 1Y6EA 1MDIA 3TUEA 3GNJA 2JZTA 3F6DA 5IMFA 4L8EA 1GTUA 1M9AA 2JZRA 2K9FA 2LJAA 1ERWA 1THOA 4KAEA 5GSTA 3UAPA 1S3CA 2PU9C 4I97A 1X5DA 2HFDA 1YF1A 3GX0A 2P5RA 3LFLA 2IFQB 2F51A 3UOMA 3GTUB 1KTEA 1B9YC 10GSA 1B9XC 2IWTA 4ZBAA 4L0UA 2XBIA 1TJDA 3GHAA 3D21A 1KEBA 3GFKA 2MZCA 1T00A 3ME7A 1WRYA 1SL2B 5EPFA 4JRRA 2LJKA 1R5AA 4KB3A 3PGTA 2ES7A 2Z9SA 1EEJA 3HYPA 5ELGA 1QGVA 3TKSE 3A2XA 2GZPA 2HRFA 2M72A 3KP8A 3ED3A 3DWVA 5JCUA 2GSTA 2PBJA 4MMMA 4POBA 4DSQA 18GSA 1F3AA 2DJ0A 2WJUA 4TKYA 4EDZA 3CSIA 4BL7A 4KDYA 5ECHB 2EIRA 4KH7A 3TRPA 5IMDA 2VL9A 2E2GA 2B1LA 3MSZA 4HUAA 3D4TA 1QXHA 1SENA 2LRNA 3HZ4A 3TDGA 4NXIA 5HR3A 4JE1A 2YZHA 3HZ8A 1E2YA 1GSSA 5CRGA 3KMOA 3KP9A 4TR3A 3UJ1A 4XS6A 2H1BA 4RUVA 4NWYA 1SJIA 5CYYA 1TI1A 3FR6A 2YJ7A 4POKA 3F4TA 4N0VA 2GZYA 2R2JA 1G7EA 1X9MB 1KNGA 3ZMLA 4O7HA 3E3EA 3TKSC 4ID0A 3SBCA 4XRDA 4KSMA 4TXOA 3I43A 1O85A 2VO4A 2KHPA 2YN1A 4NAXA 4G9HA 3KCMA 2KP2A 2ALBA 4HEA2 4DEJA 5H5RA 2C80A 3MDKA 3ZFLA 1FVJA 5D9VA 4AF2A 5DCGA 1M0UA 2A4VA 5J3RA 5GAPD 1QK8A 1JZDA 2WCIA 1BAYA 4AJ8A 2I1UA 3IOSA 2JSYA 3VK9A 4LMVA 1FOVA 1ZOFA 3I6AA 4HDEA 3MWHA 3HCZA 3TJGA 5JCGA 2C8UA 5IO0A 3Q6OA 2YWMA 1EZKA 3A3TA 3IC4A 5DALA 3M8NA 2PWJA 5IM9A 5JWQB 2VOCA 4HS1A 1PX6A 1YDKA 1FVKA 1C72A 3WGXA 1UC7A 5IOXA 1DE2A 1T4ZA 4H86A 3F3RA 2DJ2A 1ERTA 5DALB 1Q4JA 2FA8A 4EE0A 2FWEA 1XW9A 3DRNA 4E8EA 2AYTA 3TCOA 5KN1A 6GSTA 2NTOA 1DE1A 2FD3A 2GQKA 3TJFA 3WGDA 3RPNA 4ECIA 2LUSA 3TB2A 3KH9A 2PGTA 3CMIA 4QL9A 4IJIA 1R4WA 3F6FA 3GKNA 3FR3A 4I2UA 1QMVA 1DBYA 3ME8A 4YH2A 2KP1A 4TXVA 2V1MA 2VLTA 4FO5A 3TGZA 5B8AA 6GSUA 1WP0A 2E0QA 3TJKA 4BVYA 4MH3A 4J56E 3N5OA 2WS2A 4EUYA 2H72A 4MZCA 6GSYA 4ZB8A 2MMOA 3W8SA 3W8JA 1PGTA 4ACSA 3FRCA 1YKAA 2FUG2 2PVQA 4GCIA 2H19A 3ZL5A 1FO5A 3D4MA 1A2LA 3MNGA 3CXGA 1NSWA 2MYGA 3LJRA 5F06A 1Z6NA 2VCVA 4GLTA 3GKMA 3ZIJA 2GLRA 2X64A 5CRHA 4NV5A 1VRSD 3GTUA 1CQGA 4TVEA 1I9DA 2AB6A 4PQIA 3D0ZA 2GT5A 3VWUA 3H79A 2DSAA 4I2TA 2WRTA 1F9MA 3PR8A 3RDWA 4GSNA 2YV7A 1T1VA 1GLPA 1EOHA 4F9ZA 1J08A 1B4PA 1JZWA 1YF0A 2PERA 2CVKA 4ML6A 3FYGA 2CX4A 4NPBA 2R4VA 3WT1A 1GLQA 1SYXA 1USBA 4O32A 1WJKA 2CAIA 5AIVA 2RUEA 5IOWA 2H71A 2V6KA 4I6XA 4MPGA 1TRUA 3E0UA 1TW9A 5CAXA 1ZZYA 4EC0A 4V2MA 4CHSA 4F0BA 5IPGA 3KEBA 4NV2A 4YAPA 1B48A 2OJLA 1U6TA 5IMZA 1OKDA 4LA1A 3S9FA 1XWBA 3IPZA 3RPPA 4ECBA 5J41A 5G31A 1A8LA 5C04A 3L4NA 2NVLA 2YNXA 5ENUA 1CQHA 4MZWA 3P8WA 2CX3A 3M0FA 4EVMA 2QGVA 2VL2A 3SWLA 2LNSA 4K7IA 1R5PA 1G0TA 3APSA 2H70A 2OADA 4G2EA 3ERFA 1XOAA 2VCTA 1EV4A 3A5WA 1A8YA 4L0WA 3QDNA 2JL4A 5J9BA 4NHZA 3IK7A 3IK9A 4TOPA 1EGOA 2L6CA 4FYBA 2X8GA 3O6TA 1GSEA 5JWOB 3J7Yb 4Q5NA 5HR0A 1HNAA 2LQOA 1U3AA 4IKHA 2RUFA 2FA4A 3ZITA 2LNTA 13GSA 3CTGA 3F9UA 2H75A 2IMIA 1VF3A 4MA9A 5ID2B 1UN2A 1Z3EA 1TU7A 4BWQA 1WWJA 3R2QA 19GSA 3GIXA 4AGSA 4BA7A 1GSFA 2XBQA 5CRDA 1ZL9A 3KZQA 1XVQA 4X1UA 4KE3A 1QQ2A 1X9SB 2NPBA 4AJ7A 1DSBA 1SK2A 2FLSA 4ZBBA 2PUKC 4PQ1A 5D8IA 2CAQA 4HJ2A 4ZILA 3O3TA 5EY6A 1RQMA 3E9JB 5ECPB 3VWWA 6GSXA 1W89A 3VLNA 4DSSA 4EXJA 1VF1A 4JR6A 1M2AA 5FHIA 2ON5A 2GZZA 5EL8A 1A2JA 5LCZA 5DAKB 2C4JA 3C73A 4KDXA 2KUCA 1PX7A 2IN3A 3KTBA 2LS5A 2K18A 4TW5A 2HZFA 3LQ7A 4FH8A 4WBRD 4MF5A 4PURA 2P0GA 5A4UA 4HOJA 4IW9A 1GSUA 4OMVA 3VURA 2F8AA 2CQ9A 3TKRA 1E6BA 2VLUA 3KIJA 3GYKA 1B4QA 1T7PB 5GSSA 1A0RP 4ZB6A 2V2GA 4WETA 4G19A 3HVSA 2WB9A 4MJEA 2YWNA 5J9CA 4K2DA 3PH9A 4P3YB 2BTOT 2N5AA 5HR1A 2AV4A 3APOA 2B5YA 2IMEA 1GTBA 2HLSA 5DJLA 2VD0A 4K8MA 2N5FA 4EDYA 1XOBA 2VUPA 4V1Ap 2LJRA 4ZBDA 1AXDA 4EO3A 1TI3A 5G5FA 2AAWA 2JU5A 1ZCPA 4KSOA 1VF2A 2L4CA 3CRTA 3EINA 1OVNA 4HQSA 2YP6A 1XPVA 3I69A 4GQFA 3EMXA 1PKZA 4X43A 4XS1A 1ILOA 1YEPA 5GAND 3RAZA 3U5RE 3QPMA 3FKFA 3TOTA 3QOUA 5D93A 4TR1A 3LYPA 1PL1A 3ZVJA 2C0FA 3DXBA 2ZCTA 5DVBA 2FCHA 2X8CA 4POLA 2WFCA 5G2ZA 4PXOA 1NHYA 2R5GA 1EGRA 5C00A 1SKSB 2B6MA 3FZ9A 3EU3A 2IMKA 4GQCA 2PMTA 4HZ4A 4XRAA 1BJXA 3LGCA 4XHMA 2HRNA 5AISA 3EE2A 3FEUA 2O85A 5DJMA 4CDOA 3QMXA 2F8FA 3QFAC 2WGRA 2F3MA 1SL0B 3QR6A 4HU9A 5ECRB 3CRUA 2L4QA 3L0HA 3VI7A 3GSTA 5ECIB 2L5OA 4X0XA 3H4KA 1U88A 1XWGA 1ERVA 14GSA 2AJQB 2LKUA 3NIVA 3HKRA 3D22A 1M7TA 3EURA 2F9SA 3M3MA 1XFLA 3F4SA 3L9SA 4KCAA 1TK0B 2IJYA 4Z7XA 2DMLA 3FR9A 2PVOC 2YOIA 1JLVA 1F37A 5G1LA 3TKQA 3FHKA 4TR4A 1FW1A 2I81A 3GH6A 1PN9A 1EWXA 4ECCA 1O7UA 1NW2A 2DIYA 4HJMA 2YZUA 1GUKA 5ECLB 5ID2A 2O7KA 4HQZA 5AN1A 3ZYWA 1V9WA 2OBKA 3F4RA 1PRXA 4HZ2A 3FK8A 3IRAA 4ZIJA 1OE8A 4WXTA 1OAZA 5G5EA 5IPHA 1BQ7A 2H73A 4CW9A 2VM1A 1Z5YE 2XHFA 5D96A 2M46A 1JHBA 2AUVA 2P31A 1X5EA 3QFBC 4KW6A 3FZAA 2ZNMA 2HYXA 3C1SA 3UVTA 2LRCA 1F3BA 4JR4A 2HZEA 4K7NA 4WR5A 1WOUA 1MD3A 4JBBA 3CSJA 1K0NA 3D5JA 4OD7A 2JZSA 1GSQA 4WEYA 2L59A 3C7MA 4OCEA 2QC7A 4FYUA 4GSTA 2ZUPA 2C0GA 1SK0A 4WBJA 3TKSA 5D73A 1YZXA 2C3TA 5E4WA 3H1NA 4K1FA 1NM3A 3L78A 1V40A 5HR2A 1K0AA 4WF4A 4MLYA 5B6MA 3IR4A 4PQHA 1ERUA 4N30A 3UARA 2IY2A 4K7OA 4JU5A 2CZ3A 1TRWA 3CSHA 3MAKA 1BG5A 3GL5A 4RQXA 3HD5A 1RW1A 1SJZA 4KX4A 3ZFBA 4IVFA 1LU4A 1FB0A 1Q98A 1AC1A 1GP1A 3QAWA 3LG6A 1OC9B 4EF0A 3BD2A 3EU4A 1JFUA 5ECOB 3ZRDA 4OFTA 1GSDA 1GNEA 4I5QA 2MMZA 4O5RA 2OE3A 1VF4A 2K6VA 5KN0A 2HT9A 2JSZA 4AJ6A 1ST9A 1HNCA 1O73A 2AHEA 1QFNA 4MJBA 5L71A 2LTKA 1X5CA 1EV9A 2E2MA 3LXTA 4MJCA 1M2BA 1V58A 1MTCA 2GSRA 4KDUA 4ZB9A 3HA9A 3QAVA 1AQWA 3CTFA 5JCWA 2IPAA 4OWYA 4GSSA 4MJAA 1J0FA 4TRXA 4E8HA 1J9BA 2HXKA 1O8XA 2YJHA 3KJYA 1H75A 3ZIVA 1ZGNA 1AAZA 1U87A 2XPDA 1R26A 2H6XA 2GVPA 1AUCA 2N5BA 2V6OA 1GH2A 5G30A 2GGTA 5KN2A 2C0EA 2WULA 4IQ1A 1ON4A 1TDIA 1SU9A 2FWHA 1TOFA 3EWLA 4D73A 2B5EA 1WPIA 4ML1A 3HDCA 2VCXA 2GSQA 3UMAA 3M9JA 4KNDA 4QL7A 1O6JA 3UIWA 2IIYA 2H8LA 4RQRA 2GDRA 1MDKA 1K0OA 4D73B 1BX9A 4GF0A 5D9TA 1XWAA 3HJOA 4MCUA 1SYRA 1EEMA 3V1WA 1X9WB 2KOKA 3IHQA 2VCWA 3BCIA 2OACA
chains in the Genus database with same CATH superfamily
4N6TA 2MBTA 1Q40B 2BMQB 1JLWA 4V2NA 1K0CA 3EMPA 1VQ83 2O3OA 2RIIA 3Q74A 1B2MA 3P2AA 3W6GA 4J57E 4HM1B 1BNJA 3M9KA 1CQSA 3CXC2 4ECJA 4EV5A 2EC4A 4L5OA 5D9WA 1IYIA 3QD9A 1RGCA 3FF0A 3SEDA 1Z9HA 1HNBA 1Z7PA 2X8HA 4BL2A 1K3YA 2PN8A 1Q40A 2W04A 3BCKA 3LTCA 1PQNA 4XIHA 1ASKA 1RRLA 1EOGA 2H0IA 4OFMA 1BANA 3HJPA 4MF7A 1BNSA 1W5ZA 1XW6A 1WMNA 2KAAA 3PINA 3S29A 4KA0A 3US3A 5F0GA 1B27A 4LL1B 1WMJA 1E97A 2A4HA 2B7KA 2H76A 4I8BA 4IJ3A 1VQN3 3MYDA 3F8UA 4OO5A 3BOAA 3EVIA 1HD2A 4G0IA 3UVHA 3ZG5A 3M1GA 1W01A 4WR4A 5KEJA 3GX8A 2HZEB 1JZOA 4PUFC 2FHEA 3BJ5A 2IL3A 5AIFA 3VWXA 5A4VA 2TRCP 4KCEA 4XCSA 3M8CA 1KBNA 1I0VA 4V1Ag 2OWPA 5M1AA 3ZREA 2OA7A 5ECQB 3RHCA 1W2ZA 3KN4A 1K3OA 4YAVA 3CBUA 5D83A 2E7PA 1G6WA 3GSPA 3ZG0A 2GQMA 1Q824 1OF5A 5F07A 2IMJA 2LQVA 3NBBA 4WF5A 3UEMA 4PGTA 3L9UA 2GSPA 2XC2A 4J2FA 3KD0A 1HZ1A 3TRXA 1XCCA 1PYLA 2W2CA 5AIGA 3DGNA 1K28A 4HU7A 2I9WA 1VQ93 1Z1SA 2DIZA 4BL7B 4EIPA 1RJOA 4DVCA 4WHAA 1FA3A 3D5GA 2DC5A 3EYTA 1K3LA 3LW9A 1XWCA 4ULXA 5KN3A 3FZ4A 4DSSB 3G9BA 1JV2B 5DQYA 2Y74A 1WIKA 2ON7A 1QUWA 2YWOA 4TN8A 1YJN3 1XVWA 4OFNA 5IIZA 1LOYA 2VCQA 4GTUA 2OQEA 4L5LA 5F8BA 2EIOA 5DBQA 2P5QA 2TRXA 3EJVA 4F82A 2OBIA 4POMA 5J5NA 3UBLA 3ZZXA 1FGQA 3CCQ3 2VIMA 4HM4B 5DAKA 1OC8A 1FUTA 2KLXA 4BVYB 5FW5A 1HU9A 1GNWA 2B7JA 5LD0A 3KH7A 1UI7A 1K0BA 3ERWA 1ML6A 4ILFA 1BYEA 1WE0A 3QRDA 2NBSA 4PNFA 1M2DA 4N10A 5J4UA 1JNQA 3ZVJD 1K0MA 1N2AA 2F5WA 1F2EA 1XW5A 1KWIA 2B1XB 2CFDA 3IAM2 4GL6A 4AKYA 1FGTA 3L9VA 1PL2A 5D9XA 1AQVA 2JADA 1AIUA 1YQ1A 4RI7A 5B6NA 3LEFA 3H93A 4K0GA 2CFKA 1TXXA 3IE3A 5COHA 4TR0A 1V98A 2E2VA 4ZL7A 3TJBA 1G6YA 5IMAA 3N8BA 4FYCA 3MIXA 1K0DA 1OKTA 2OE0A 2VLVA 2J8XB 2M80A 5HFGA 3GUSA 2P0MA 1HQOA 3ER7A 1LOXA 1GRXA 2YWIA 2VL3A 5AYSC 2R6KA 3K7CA 1IYHA 1LJRA 5IQYA 4K6XA 2H6ZA 4HVNA 2YFJB 4O2HA 1U5OA 1BOXA 4BL3A 3DGQA 3F0IA 3ZLPA 1M9GA 1SK1A 1LOVA 4IP1A 2LV3A 5IMVA 2L6DA 1BRJA 1DYUA 2JQ5A 2CVBA 2LEGA 5CRWA 2CZ2A 2GS3A 3G7YA 5ELAA 1VQP3 1MDJA 3LMLA 4OO4A 1TUHA 4NHWA 3U6VA 3EC3A 1JN5B 2OCTA 2A2SA 1N5HA 1W02A 1SKRB 5IW9A 1TU8A 4HM6B 3UJMA 1LBKA 3FMWA 2HMJB 1RSNA 4BVXA 2BU4A 1G7OA 3CCS3 2C0DA 2H1GA 2INXA 2CIUA 5CP1A 3WD6A 3X3ZA 3VSYA 2K8VA 2V1LA 3SOYA 1R7HA 2BMXA 4TR1B 2CW9A 1C54A 4X2OA 1UCLA 2W9QA 3F9SA 4QWTA 3GH9A 3ZMKA 3FY7A 2FY6A 6GSWA 3GA4A 3N9JA 3Q18A 4U13A 1S3DA 2WDUA 2CVDA 1QAKA 4NMUA 2J23A 2I4AA 4PEJA 4L8OA 1AY7A 1GULA 3HVXA 1UW1A 1W6YA 2FWFA 1IQXA 2H1DA 2NDOA 1OHSA 2LQQA 1PKWA 1YY7A 3WMDA 1O8WA 1M1K4 3EF8A 2D2ZA 4K9ZA 1ZYEA 1GUHA 1PD21 4KT3B 2R37A 1RTUA 2HNLA 3CYNA 1YVSA 1GD3A 2L5LA 5RNTA 3J7Yk 1A24A 1T3BA 4YQMA 1O7HB 4F2IA 3FZ5A 4IP6A 2WOHA 1RGEA 1Q814 1SJ6A 2XF3A 2J9HA 5ECNB 1T8EB 4JEDA 3E99A 3BBYA 3DYRA 1MD4A 1TRVA 5H5SA 3FLJA 2GBWB 3K8NA 1ABAA 2H1AA 3NQZA 2H30A 2VD1A 2F4YA 1GUMA 2BMOB 1AQXA 2QEX3 1A2MA 2R4IA 1Q7Y4 1AV4A 3I9V2 4FIWA 4WKWA 1KD14 3MG2A 5IMCA 4MZBA 3WGEA 4N0ZA 2C1YA 3LWAA 4X2HA 2IUKA 2WO0A 1QVG2 1IYYA 4KUNA 2MMNA 3TOUA 3UL3A 6GSVA 3K9MC 1PA3A 1B3SA 5INYA 1TK8B 1X1WA 3D6IA 2CKFB 1HYUA 1FUSA 3A2VA 1TKDB 2HI7A 5ABRA 1W6GA 3GKXA 4IELA 1GY7A 2RM6A 5CO3A 1BNIA 1FHEA 1STDA 5CXOA 11GSA 1BRHA 3D3LA 5HFIA 3RHBA 3EN8A 3AGOA 2YCDA 1IU7A 3LTAA 22GSA 3TKPA 3UNLA 4ISDA 1BRKA 1RK4A 3EBYA 3IBHA 1GWCA 3FSDA 3GZYB 3U97A 2UZ8A 4KGIA 4PX1A 2I9HA 4FMDA 3JUPA 3IA1A 3DVWA 1O7WB 4V2LA 6GSSA 2AADA 4FMBA 3APQA 1SKWB 4GXZA 2CA8A 2YFIB 4RI6A 3WOEB 1B8XA 3WT2A 5LNKe 2B5XA 3G7IA 5AGYA 4FMCA 1FG4A 2YPMA 3GL3A 1RGAA 2L4VA 2DJKA 2QSIA 5AEWB 1H4OA 1ZX2A 3QCPA 3A2WA 2FGXA 1VGLA 2DJ3A 3LORA 4USSA 4IHUA 1W4VA 3IAS2 5CF2A 2VCZA 3BB9A 1QAFA 1YEXA 3VWVA 1ZO2A 2O8VB 3H8QA 3KCHA 3PS8A 2VL2C 4N6NB 4EKZA 3Q19A 5HQPA 2H0HA 1EUIC 1JZRA 2VAFA 3GRXA 3KMNA 3KTLA 4PUAA 8GSSA 1RNTA 4LMWA 4KFDA 3VFIA 1XWKA 1GMRA 3OR5A 4Q5RA 2BT3A 1TP9A 3DIEA 3GV1A 1G96A 2FWGA 1SL1B 1YJ6A 3GN3A 4YQVA 2H0GA 4O02B 20GSA 4HZ9B 4HM0B 4G0LA 4GRFA 4K5SA 4OCFA 2Q07A 1IT8A 3OW22 4LEHA 4IGJA 17GSA 4XTSA 1TTZA 2DJJA 3P7XA 4XS4A 2WGOA 2CWUA 2B3SA 2REMA 2CT6A 2PZVA 2HE3A 1S3AA 4Q5FA 2FNOA 3UB1A 5D82A 1LQGC 2A2RA 1UUWB 1I8VA 1GTAA 1NHOA 2EIQA 1UGHI 1SD8A 3LXZA 1FAAA 2OKAA 1UVZA 1MGRA 2PPTA 3IXRA 2Z77A 1PMTA 3NUVA 3KGKA 1TP6A 4EL1A 3EPTA 2X99A 4G10A 4CDLA 3GZRA 2F86B 1CH0A 3ERGA 12GSA 4ZL9A 3KXOA 3UBKA 5IO2A 1T4YA 3C71A 3CNXA 2RM5A 3LTDA 4Q5QA 4XDVA 4CPKA 2H74A 5STDA 1OE7A 4EIQA 4DSRA 4BPYA 3X3XA 3DGYA 5E59A 4PNGA 2YANA 3DEXA 3MYTA 1M9BA 2YV9A 3AMOB 4MPFA 2V41A 4WWUC 4N11A 1XZOA 1ACVA 3DD3A 2FNQA 1XIYA 1Z6MA 3HHVA 4J5KA 3N9HA 5B7CA 2P09A 2DLXA 3G8ZA 9GSSA 1IV9A 2XH9A 3VPQA 1RN4A 3B4OA 3PGBA 1UA5A 4JZQA 4R1KA 3EB8A 2C3NA 3HJMA 2BJXA 2DMMA 1WQLB 1A2VA 4IQAA 3JCML 1YVBI 3HY2A 5KP3A 2OE1A 2GT6A 2BNGA 2E2TA 4K0NA 1PY3A 3WYWA 1LNHA 3P90A 3DVXA 4HI7A 3G7JA 2GQLA 3IDVA 4MF6A 3RBTA 3N54B 2MMAA 2OTL3 1XXUA 4F0CA 16GSA 5AIXA 4R9KA 1URMA 1W4NA 3WR2A 1OC9A 1CEWI 5HOHA 3IV4A 2GTUA 1FGOA 1OYJA 3PPUA 2IMDA 1MEKA 1HYFA 1KQS2 3F7XA 3GMFA 5GZZB 4TX4A 4MK3A 1ZYQB 2HRAA 2TIRA 5B8BA 1X0RA 5FT3A 2L57A 3LYKA 3NZNA 1ROAA 2B24B 1PSQA 1A23A 3FF2A 1TK5B 1THXA 4YQUA 1UCKA 4IBPA 5DQSA 2R3XA 3ISOA 1OC3A 2O87A 4AEQA 4GWRA 3C8EA 4MH2A 4TXOB 1DUGA 2ZDJA 1LVNA 1TRSA 4MP4A 3LT9A 2XRXB 2GSSA 3QAGA 2B1KA 1M99A 3D5IA 2G2QA 1S5AA 2QA43 4MABA 4LLRA 3HXSA 5HGRA 9RNTA 5I97A 5CLKA 3RGRA 7RNTA 1GTIA 3V99A 3D4AA 2IFQA 3NBRA 4XS4B 3DMLA 1BEDA 2DJ1A 1VZZA 4QQ7A 4LMIA 1EKMA 1K9M4 1XG8A 2O89A 5ELUA 1N8R4 2CFLA 3GURA 4ZXGA 4NHFA 1F6MC 1LXEA 4G1MB 1SD9A 2L1SA 3F63A 1AW9A 5ECMB 4F03A 4BWSA 5DCHA 3LSZA 3TJJA 3MHEA 1WMPA 2F5MA 1GSYA 3A5EA 5JWRB 1XBSA 1DE3A 1UUGB 3FG1A 1YKCA 3ZTLA 2G0FA 4N3VA 1UGIA 3OX9A 3HK4A 5G1KA 1C7HA 3KIIA 5F05A 3O76A 3GZBA 5CNWA 1MWUA 5FWGA 4BTXA 1Z7RA 1U3IA 3X3YA 1TFKA 3F3QA 1ZMAA 3C1RA 4XBTA 4HM8B 2V32A 3B8LA 3NM2A 4KFFA 5ECKB 5LC7A 1DETA 1Y25A 1V57A 2CV4A 2KF3A 2QKEA 5H5QA 3TRQA 1SARA 4WP5A 3FW2A 2H6YA 1FGRA 4BVXB 4IN0A 2VM2A 1QVF2 1DVCA 4ZL8A 2MF7A 4FQUA 3AY8A 1FB6A 4IS0A 3GSSA 2SBLA 4R9LA 2XPEA 5ECSA 1N8JA 3DKSA 1I2FA 2H66A 1Q42A 5A5KA 3NOFA 1GMQA 5HFKA 4ORLA 1BGSA 5KP1A 2WZ9A 3GKKA 3CC23 5A4WA 2LRTA 3BLZA 1UI8A 1ISKA 2HSYA 2MBSA 2JACA 5DDLA 3VPTA 5BMUA 1JJ22 3VI5A 1A90A 1RLSA 3HVVA 3KM6A 1BNEA 3DMCA 2I3YA 2IMFA 1D6ZA 1O81A 3FKAA 1DVDA 4Z2UA 5CREA 4O92A 2RCDA 4K90B 5EVOA 1A0FA 1V2AA 1WNHA 3VGNA 3H3HA 2LSTA 3DGLA 1EP7A 1GL8A 7GSSA 1I5GA 3F40A 2C3QA 1PFOA 2H01A 1PN0A 2DBCA 3STDA 1EP8A 2RLIA 3BNDA 4LL4B 1T2HA 2HSHA 2IYJA 3UL5A 4MDCA 1GYBA 2CFWA 3DZLA 2K8SA 1Y6EA 1MDIA 1STFI 3RDEA 3DGOA 1AVKA 3GZXB 2XFTA 3TUEA 3GNJA 1FYSA 2JZTA 4FCMA 2YX9A 2RGQA 1BUJA 3F6DA 5IMFA 4L8EA 3KSED 1FOHA 1M9AA 1GTUA 1M3IA 2JZRA 2K9FA 2LJAA 1ERWA 1THOA 4K2XA 4KAEA 5GSTA 3UAPA 1S3CA 2PU9C 4I97A 1X5DA 2HFDA 3MPHA 1YF1A 1ROVA 3GX0A 2P5RA 3LFLA 4HM5B 2IFQB 3G16A 1WTHA 2F51A 3UOMA 3GTUB 3X41A 1KTEA 2CX0A 4IPBA 1B9YC 3NQYA 4NREA 1B9XC 10GSA 2IWTA 3JUNA 2M7OA 4ZBAA 1DMNA 4L0UA 3S27A 3I0YA 2XBIA 1GOUA 1W6CA 1MOLA 1TJDA 3GHAA 3D21A 2KF5A 1KEBA 3GFKA 1IQYA 2MZCA 1T00A 2KF4A 3ME7A 1WRYA 3MSOA 1SL2B 5EPFA 4JRRA 4N6LA 3KZTA 4J8TA 2LJKA 1R5AA 1W00A 2QA1A 4KB3A 1PU4A 5IG5A 3PGTA 1GOVA 2ES7A 4N6V0 1EEJA 2Z9SA 3HYPA 1QGVA 5ELGA 3OWSA 3A2XA 3TKSE 2KCDA 1YHQ3 5TGNA 2GZPA 3NBJA 2HRFA 2M72A 3KP8A 5IEPA 1JRQA 3ED3A 1IDPA 3DH2A 3DWVA 4BU4A 2STDA 5JCUA 4H3UA 2GSTA 2PBJA 4MMMA 5IEOA 2BO9B 4POBA 4DSQA 18GSA 2W56A 1BIRA 3EE1A 1F3AA 1YGEA 2DJ0A 3SX1A 2WJUA 1X1XA 4TKYA 4EDZA 3CSIA 4BL7A 1BVIA 4KDYA 5ECHB 2EIRA 3D9RA 4FCZA 3CPW2 4KH7A 3TRPA 1I3FA 5IMDA 2VL9A 2E2GA 2B1LA 3MSZA 4HUAA 1OUNA 1B20A 3S28A 1QXHA 1SENA 2LRNA 3TDGA 1BRNL 1GSPA 3D79A 3D4TA 3HZ4A 1E3RA 4NXIA 4RNYA 4EW5A 1K8A4 1DMQA 5HR3A 4JE1A 1QMAA 2YZHA 3HZ8A 2CG0A 1E2YA 1GS3A 4K1VA 1S723 3F8HA 3HIIA 1GSSA 5CRGA 3KMOA 3KP9A 4TR3A 3UJ1A 4XS6A 2H1BA 5AEUB 4HAAA 4RUVA 1TU5A 4NWYA 3JUOA 1SJIA 2Z7AA 2CK3H 5CYYA 1TI1A 5IG4A 1CYVA 3FR6A 2YJ7A 2R0CA 1RRHA 4POKA 2GU1A 3F4TA 1BU4A 4N0VA 2GZYA 1CYUA 4XDWA 2R2JA 1G7EA 1X9MB 1EG9B 1RGHA 1KNGA 3ZMLA 1IK3A 4O7HA 1I3IA 2KF6A 4GSPA 3E3EA 3TKSC 2A15A 4ID0A 1SIIA 1Q864 3SBCA 1IVXA 4XRDA 2HSMA 1NB3I 4KSMA 4TXOA 3I43A 2XEPA 3DUKA 3K63A 4Z2TA 1O85A 2VO4A 2KHPA 2YN1A 4NAXA 2D42A 4G9HA 3KCMA 2KP2A 2ALBA 4HEA2 4DEJA 3CC43 5H5RA 2C80A 2X49A 3MDKA 3ZFLA 1FW7A 3PYJA 1FVJA 2CWVA 5D9VA 4AF2A 5DCGA 1M0UA 3V92A 2A4VA 5J3RA 4Z2RA 5GAPD 1YI23 1QK8A 1JZDA 3JVCA 2WCIA 4MMXB 2Z6BA 1BAYA 4AJ8A 3HIGA 2I1UA 5BXQA 3IOSA 2JSYA 3VK9A 4BIKA 4LMVA 1FOVA 1ZOFA 4XBXA 3I6AA 4HDEA 2W03A 3MWHA 2BHMA 3HCZA 3TJGA 2K0MA 5JCGA 1YIJ3 1N9JA 3NV0A 1NWWA 2C8UA 5IO0A 3Q6OA 2YWMA 1EZKA 3A3TA 3IC4A 5DALA 1AVLA 1JB5A 1E3VA 3M8NA 2P0XA 3HOHA 2PWJA 4MMYB 5IM9A 3T8UA 5JWQB 2VOCA 4HS1A 3IMAB 5AIIA 7GSPA 1PX6A 1YDKA 2XSOB 2PNCA 1FVKA 1JKGA 2W56B 1IVVA 1C72A 3WGXA 3CME3 2P38A 1OGXA 1UC7A 3FH1A 4BTYA 5IOXA 1DE2A 1T4ZA 4H86A 1V74A 3F3RA 1RNBA 2HMMB 3B4PA 2DJ2A 1ERTA 5DALB 1Q4JA 2FA8A 4EE0A 4DKIA 1SIHA 2FWEA 1XW9A 1LOWA 1N5PA 3DRNA 1J2BA 4E8EA 2UUGC 2AYTA 3TCOA 5KN1A 2KXGA 2NTOA 6GSTA 1DE1A 1WMOA 2FD3A 1YIT3 2GQKA 1VQ43 3TJFA 3WGDA 3DXOA 3RPNA 4ECIA 2LUSA 4STDA 2F99A 3TB2A 3KH9A 2RSXA 2PGTA 3CMIA 4QL9A 1I0XA 2CC3A 1Y4KA 4IJIA 3MG1A 1R4WA 2D1WA 3F6FA 3GKNA 3FR3A 3CNMA 4I2UA 1QMVA 1JB4A 1KSIA 1DBYA 3ME8A 4YH2A 2KP1A 4TXVA 1O7NB 4LGQA 2V1MA 2VLTA 2W9PA 4FO5A 2ZL8A 3R3EA 3TGZA 3EQQB 5B8AA 6GSUA 3KSPA 4Q53A 1WP0A 3LXUX 3MKIA 2E0QA 3TJKA 2O9UX 4BVYA 3CU3A 4MH3A 3BNEA 4J56E 1LNIA 3N5OA 2WS2A 4EUYA 4ICYA 2H72A 4LSOA 4MZCA 1BRGA 6GSYA 1X1YA 4ZB8A 3J7Yd 2MMOA 3W8SA 3W8JA 1PGTA 1ULJB 3FRCA 4ACSA 1YKAA 2FUG2 2PVQA 4GCIA 5KP4A 1JB2A 2H19A 1YNVX 1IT7A 3ZL5A 1FO5A 3NXJA 3D4MA 1A2LA 4WFOA 3AGNA 3MNGA 3CXGA 1NSWA 2MYGA 3LJRA 4MNNA 5F06A 1Z6NA 2VCVA 2CHCA 3GKMA 4GLTA 2GLRA 3ZIJA 2X64A 5CRHA 4NV5A 3RNTA 1VRSD 3GTUA 1CQGA 4TVEA 1I9DA 1B2SA 2AB6A 5AI1A 4PQIA 3D0ZA 2GT5A 3VWUA 3H79A 2DSAA 1BAOA 3F8XA 4I2TA 3ECFA 3U1WA 2WRTA 1ULIB 1F9MA 3PR8A 3RDWA 4GSNA 2R0GA 2YV7A 1T1VA 2HMLB 4GHOA 1GLPA 3I563 1FUWA 1EOHA 4LYLB 4F9ZA 2XFSA 1L5GB 1J08A 1B4PA 1JZWA 4O5UA 1G02A 1YF0A 2PERA 2HRKA 2CVKA 4ML6A 4XM4A 3PCRA 3FYGA 3GWRA 2CX4A 2HMNB 3BU4A 2ML5A 3HX8A 3NX0A 4NPBA 1RCKA 2R4VA 3WT1A 1GLQA 1SYXA 1USBA 4O32A 1TRPA 1MWTA 1WJKA 2CAIA 5AIVA 2GXFA 1NO3A 2RUEA 5IOWA 2H71A 2V6KA 3F7SA 4FR9A 4I6XA 4MPGA 2DKHA 4K5RA 1TRUA 3E0UA 1TW9A 5CAXA 1ZZYA 4EC0A 4V2MA 4CHSA 4F0BA 5IPGA 3KEBA 4NV2A 5CK6A 1B48A 4YAPA 5JPPA 2OJLA 1U6TA 5IMZA 1OKDA 4LA1A 1ZYPA 3S9FA 1XWBA 2GU3A 1IVUA 5IF6A 4MJDA 3IPZA 3RPPA 3FZWA 4ECBA 2P05A 5J41A 5G31A 1OACA 1A8LA 3SYUA 5C04A 3L4NA 2NVLA 2YNXA 2C11A 4MEIA 3T0UA 5ENUA 1CQHA 1R4YA 4MZWA 1R4CA 3OV4A 3P8WA 5BRTA 3DY5A 2CX3A 3M0FA 4WYKA 4EVMA 2QGVA 2VL2A 4L8PA 1BSAA 3SWLA 2LNSA 3CCM3 3GAXA 4K7IA 1R5PA 1G0TA 1FZUA 1GMPA 3APSA 2H70A 1SQWA 3G713 5BU4A 2OADA 4G2EA 3A5IA 1O7GB 1OHOA 3ERFA 4KF9A 1XOAA 2VCTA 2W0QA 3A76A 4RZMA 1EV4A 3A5WA 1A8YA 4L0WA 1OHPA 3QDNA 2C4BA 4WYKB 2JL4A 5J9BA 1MWSA 4NHZA 3IK7A 1JBSA 3IK9A 4TOPA 3CCL3 1YJW3 1EGOA 2L6CA 4FYBA 3G4S3 2X8GA 3O6TA 3K0ZA 1GSEA 1M3JA 5JWOB 3J7Yb 4Q5NA 5AYRB 4MMZB 5HR0A 3IJEB 1JBRA 3HVNA 1HNAA 2LQOA 2C10A 1U3AA 4IKHA 4X4JA 2RUFA 1TIJA 3S5CA 2FA4A 2X4AA 3ZITA 2LNTA 1BRSA 4CY6A 2Y73A 13GSA 3CTGA 4YKFA 3F9UA 2H75A 2IMIA 1VF3A 2HMOB 4MA9A 5ID2B 1UN2A 1Z3EA 1TU7A 4BWQA 1WWJA 3R2QA 19GSA 3GIXA 4AGSA 5BVBA 3X40A 4BA7A 1GSFA 5A0OB 2OQEC 2GBXB 2XBQA 3G6E3 5CRDA 1ZL9A 3KZQA 4EXRA 1DMMA 1XVQA 4X1UA 4KE3A 4J9AA 3CC73 4ZM8A 1TRQA 2KRTA 4RBNA 1QQ2A 1X9SB 1D6UA 2NPBA 4AJ7A 1DSBA 1SK2A 2QA2A 2FLSA 4ZBBA 2PUKC 4PQ1A 8RNTA 5D8IA 3WDGB 2RBIA 5D81A 5FGOA 3CCR3 2CAQA 4LZIA 4HJ2A 5JPUA 4ZILA 3O3TA 5EY6A 1RQMA 3E9JB 5ECPB 4FCJA 3VWWA 1KC84 3MG3A 6GSXA 1W89A 1UCJA 4KVHA 3VLNA 4DSSA 4EXJA 1GY5A 5EQLA 1VF1A 4JR6A 3SLUA 1M2AA 3FCSB 4JRFA 2ON5A 5FHIA 5BIRA 4KFEA 2GZZA 1Q9EA 1I2EA 1B2UA 5EL8A 1A2JA 5LCZA 3UL6A 5DAKB 1IV7A 1NDOB 2HOHA 2C4JA 3C73A 1BSEA 1IVWA 4KDXA 4HYZA 4N6UA 1UUVB 2KUCA 1PX7A 2IN3A 1VQL3 3KTBA 3EHCA 4HM7B 2LS5A 1VQ63 2K18A 4TW5A 2HZFA 3LQ7A 4FH8A 4WBRD 3ROBA 1B2ZA 4MF5A 1EQKA 4PURA 1NJI4 2P0GA 5A4UA 4HOJA 1YJ93 4IW9A 4CJNA 1I2GA 1GSUA 4OMVA 3VURA 2F8AA 2CQ9A 3TKRA 1E6BA 2VLUA 3CCU3 3GYKA 3KIJA 1B4QA 3CCJ3 1T7PB 1AQZA 4XBYA 1A0RP 5GSSA 3CPOA 3HZPA 4ZB6A 2V2GA 3I553 3FGYA 4WETA 5GSPA 4G19A 3HVSA 2WB9A 4MJEA 2YWNA 2F56A 3IC8A 5J9CA 1Q7HA 4K2DA 3PH9A 4P3YB 2BTOT 1M904 2Z76A 2N5AA 2AV4A 5HR1A 3APOA 2YFLB 2UX0A 6STDA 2B5YA 2IMEA 4K61A 1GTBA 2HLSA 5DJLA 2VD0A 1BRIA 1BNRA 1TTOA 3CD63 4K8MA 2N5FA 4EDYA 2HMKB 4RNTA 1XOBA 2VUPA 4V1Ap 2LJRA 4ZBDA 3Q1CA 1AXDA 4EO3A 1TI3A 3L0RA 5G5FA 4EV2A 2AAWA 2JU5A 1ZCPA 4KSOA 2WOFA 1VF2A 2RNTA 2L4CA 3LTBA 3CRTA 3EINA 1OVNA 4HQSA 1JN5A 2YP6A 1XPVA 3I69A 2QGUA 4GQFA 1PKZA 3EMXA 1RGFA 4X43A 4R80A 2OOVC 4XS1A 1ILOA 1YEPA 4O5QA 5GAND 3RAZA 1GOYA 3U5RE 3K5TA 3QPMA 3FKFA 3Q90A 3TOTA 3F14A 3QOUA 1N9EA 3O8YA 5D93A 1RKYA 4TR1A 3Q2PA 3LYPA 1PL1A 3ZVJA 2C0FA 4BTWA 3DXBA 1US1A 5IERA 1NB5I 2ZCTA 5DVBA 3SOAA 2FCHA 1VQM3 2X8CA 4POLA 2WFCA 5G2ZA 1W2B2 4PXOA 1NHYA 3WODG 2R5GA 1EGRA 3NHXA 5C00A 3LH4A 1SKSB 1BSCA 1QALA 2B6MA 2WGQA 5DRVA 4HZBB 3FZ9A 4G0KA 1BNGA 3EU3A 2IMKA 4GQCA 2PMTA 4HZ4A 4XRAA 2F98A 1BJXA 3LGCA 4XHMA 4OK0A 2HRNA 1A2PA 5AISA 3EE2A 3FEUA 2O85A 5DJMA 4CDOA 3LOYA 3QMXA 2F8FA 3QFAC 2WGRA 2F3MA 1SL0B 3QR6A 3T8NA 3SVAA 4HU9A 2K54A 5ECRB 3CRUA 2BMRB 2L4QA 2FGTA 3L0HA 3AHSA 3URPA 3GSTA 5ECIB 3WOFB 3VI7A 2L5OA 1U8CB 4HOHA 1K734 3AMOA 4X0XA 3H4KA 4OUQA 1U88A 1O7MB 1OCVA 1N8QA 1ERVA 1XWGA 3CQFA 14GSA 3BIRA 3CCV3 2AJQB 2LKUA 3S67A 3NIVA 3HKRA 1JBTA 3PXMA 3AHWA 3D22A 4HM3B 1M7TA 3EURA 2K3DA 3WA3A 2F9SA 3M3MA 1XFLA 3F4SA 3L9SA 4I4KA 4KCAA 2RFRA 1QJGA 4HM2B 1OF5B 1OGZA 1TK0B 2IJYA 4Z7XA 3JUQA 1A2KA 2DMLA 3FR9A 1X1UA 4KZ1A 2PVOC 1LRAA 3EC9A 2YOIA 2XR8B 1JLVA 5IENA 1F37A 5G1LA 6RNTA 1VQQA 3OWYA 2UGIA 3TKQA 3FHKA 1ZGXA 4TR4A 1FW1A 2I81A 4HBRA 3EN1B 1PN9A 3GH6A 3ZFZA 1EWXA 4ECCA 1O7UA 1NW2A 2DIYA 3WHOA 4HJMA 2CH9A 1MNLA 4RNZA 2YZUA 5CF1A 1GUKA 5ECLB 5ID2A 1AR0A 4YKGA 2O7KA 2LYXA 4HQZA 1UDII 1IQ8A 5AN1A 3LT8A 3ZYWA 2R0PA 1V9WA 2IUJA 2OBKA 4OVMA 3F4RA 2AAEA 5IG0A 1PRXA 2R41A 3BNBA 4HZ2A 3FK8A 3IRAA 4ZIJA 1OE8A 4WXTA 2JDIH 1OAZA 5G5EA 5IPHA 5JBSA 1GY6A 1BQ7A 1SPUA 2H73A 4CW9A 2VM1A 4FMAA 1Z5YE 3CMA3 2XHFA 5D96A 3EBTA 2M46A 3MWZA 4K1UA 1JHBA 2OOVA 2AUVA 2P31A 3B7CA 2SARA 5LC6A 1BUQA 1X5EA 3QFBC 2QIYA 1B2XA 4KW6A 4EYCA 3Q3FA 5M18A 3FZAA 2GEYA 4JF8A 2ZNMA 2HYXA 3C1SA 3UVTA 3QK9A 2LRCA 1RDSA 3DM8A 1F3BA 4JR4A 2CFGA 2HZEA 4HKVB 4K7NA 4WR5A 1WOUA 1GD4A 4CY8A 1MD3A 4JBBA 3CSJA 1K0NA 3D5JA 4OD7A 2JZSA 3HI7A 1GSQA 4WEYA 3LYGA 2L59A 3C7MA 3NV0B 4OCEA 2QC7A 5M19A 2ZUPA 4FYUA 4GSTA 2C0GA 1SK0A 4WBJA 3TKSA 1S3RA 5D73A 1YZXA 2C3TA 1OH0A 5E4WA 3H1NA 4K1FA 1NM3A 3L78A 4R4KA 1V40A 3WA2X 1NU3A 3OWUA 8CHOA 5HR2A 1K0AA 3FG3A 4WF4A 3PZWA 1RMSA 1UCIA 3G0KA 7STDA 4MLYA 5B6MA 2FXTA 3IR4A 3DGMA 4PQHA 2W6JH 1F8NA 3BNCA 1ERUA 4L7KA 3H51A 1BSBA 4IIAA 1B21A 4N30A 3UARA 2IY2A 3IPTA 4K7OA 4JU5A 2CZ3A 1TRWA 3IHGA 3CSHA 3MAKA 2MC8A 1BG5A 4CCVA 3GL5A 4RQXA 2ZHXB 3HD5A 1RW1A 1SJZA 4KX4A 3ZFBA 4IVFA 2CX1A 4H61A 1LU4A 1M1XB 1FB0A 1Q98A 3VF1A 1AC1A 1BSDA 1GP1A 5EEOA 2ML6A 6GSPA 3ALAA 3QAWA 3LG6A 5AIHA 1OC9B 3X42A 4EF0A 3LZAA 3KFQC 3BD2A 3EU4A 1JFUA 5ECOB 3ZRDA 4OFTA 1GSDA 2XGNA 5DREA 1YGWA 1GNEA 1RCLA 1O7PB 4I5QA 1VQ73 2MMZA 4O5RA 2OE3A 1BNFA 1VF4A 2K6VA 5KN0A 2HT9A 1RN1A 2JSZA 2OTJ3 1MGWA 4AJ6A 1ST9A 4AKZA 1HNCA 4IT7A 1A67A 1RGLA 4XB5A 1VQO3 1HKXA 4GB5A 4O3VA 1O73A 2AHEA 5IG3A 1QFNA 3NM7A 4MJBA 1ZYNA 3GRDA 1I70A 5L71A 2LTKA 5EVHA 1X5CA 3SXXA 4EC6A 1EV9A 2E2MA 3LXTA 1RGGA 4MJCA 1VQ53 1MTCA 1V58A 1ZS7A 1M2BA 2GSRA 4KDUA 4ZB9A 5ELJA 4HSCX 4O8SA 1FGMA 3RGAA 3HA9A 3QAVA 3KKGA 1AQWA 2BIRA 3EX9A 3CTFA 2XGLA 5JCWA 1PFPA 2IPAA 2A2PA 1K41A 4OWYA 3KE7A 4GSSA 1T2IA 4MJAA 1J0FA 4TRXA 2ZA4A 4E8HA 1J9BA 4EBGA 2HXKA 1OPYA 1W7CA 3V98A 1O8XA 2YJHA 1T5YA 3KJYA 1H75A 3ZIVA 1ZGNA 1AAZA 1U87A 2XPDA 1R26A 2H6XA 2GVPA 1AUCA 2N5BA 2V6OA 1RGKA 2IA7A 1VQK3 1GH2A 3PCSA 3JUMA 1NNVA 5G30A 1EA2A 2GGTA 3OXAA 5KN2A 2C0EA 1RHLA 1MWRA 2WULA 2DKIA 4IQ1A 4N6OB 1ON4A 1TDIA 2CG1A 1SU9A 2XSHB 2FWHA 1SJWA 1TOFA 3EWLA 4D73A 2B5EA 5G2GA 1WPIA 4ML1A 2E2UA 3HDCA 2VCXA 3FG4A 1TFOA 1JKGB 2GSQA 3UMAA 3M9JA 4KNDA 4HJLB 4PTSA 4QL7A 1O6JA 5KOWA 1RN7A 3UIWA 2IIYA 2H8LA 4RQRA 2GDRA 1LQMB 1MDKA 4BIRA 1K0OA 3CCE3 4D73B 1BX9A 4GF0A 5D9TA 1XWAA 3HJOA 2GEXA 4MCUA 1SYRA 5KOXA 1EEMA 3V1WA 1X9WB 1D6YA 2CWTA 2KOKA 4N6MA 4J5GA 3IHQA 4A5PA 2VCWA 3BCIA 2OACA
chains in the Genus database with same CATH topology
2MBTA 1JLWA 4V2NA 1K0CA 3EMPA 2RIIA 3Q74A 3P2AA 3W6GA 4J57E 3M9KA 4ECJA 2EC4A 4L5OA 5D9WA 1IYIA 3QD9A 1Z9HA 1HNBA 1Z7PA 2X8HA 1K3YA 2PN8A 3BCKA 1PQNA 4XIHA 1EOGA 2H0IA 4OFMA 3HJPA 4MF7A 1XW6A 3PINA 4KA0A 3US3A 5F0GA 4LL1B 1WMJA 2A4HA 2B7KA 4IJ3A 2H76A 4OO5A 4I8BA 3MYDA 3F8UA 3BOAA 3EVIA 1HD2A 4G0IA 3UVHA 3M1GA 4WR4A 5KEJA 3GX8A 2HZEB 1JZOA 4PUFC 2FHEA 3BJ5A 2IL3A 3VWXA 5A4VA 2TRCP 4KCEA 4XCSA 1KBNA 4V1Ag 3ZREA 2OA7A 5ECQB 3RHCA 1K3OA 4YAVA 3CBUA 2E7PA 1G6WA 2GQMA 5F07A 4WF5A 3UEMA 4PGTA 3L9UA 4J2FA 2XC2A 3KD0A 3TRXA 1XCCA 4HU7A 2DIZA 4BL7B 4EIPA 4DVCA 3EYTA 2DC5A 1K3LA 3LW9A 1XWCA 4ULXA 5KN3A 3FZ4A 4DSSB 3G9BA 5DQYA 1WIKA 2ON7A 1QUWA 2YWOA 4TN8A 1XVWA 4OFNA 5IIZA 2VCQA 4GTUA 4L5LA 5F8BA 2EIOA 5DBQA 2P5QA 2TRXA 4F82A 2OBIA 4POMA 5J5NA 3UBLA 3ZZXA 2VIMA 5DAKA 1OC8A 2KLXA 4BVYB 1GNWA 2B7JA 5LD0A 3KH7A 1K0BA 3ERWA 1ML6A 4ILFA 1BYEA 1WE0A 2NBSA 4PNFA 1M2DA 4N10A 5J4UA 3ZVJD 1K0MA 1N2AA 1F2EA 1XW5A 3IAM2 3L9VA 1PL2A 5D9XA 1AQVA 2JADA 1AIUA 1YQ1A 4RI7A 5B6NA 3LEFA 3H93A 4K0GA 1TXXA 3IE3A 5COHA 4TR0A 1V98A 4ZL7A 3TJBA 1G6YA 5IMAA 4FYCA 3MIXA 1K0DA 1OKTA 2OE0A 2VLVA 2M80A 5HFGA 3GUSA 1HQOA 1GRXA 2YWIA 2VL3A 2R6KA 1IYHA 1LJRA 5IQYA 4K6XA 2H6ZA 3DGQA 3F0IA 3ZLPA 1SK1A 4IP1A 2LV3A 5IMVA 2L6DA 2CVBA 5CRWA 2LEGA 2CZ2A 2GS3A 3G7YA 5ELAA 1MDJA 4OO4A 3U6VA 4NHWA 3EC3A 2A2SA 1SKRB 1TU8A 1LBKA 3FMWA 4BVXA 1G7OA 2C0DA 2H1GA 5CP1A 3WD6A 2K8VA 1R7HA 2BMXA 4TR1B 3GH9A 3ZMKA 3FY7A 2FY6A 6GSWA 3GA4A 3N9JA 3Q18A 1S3DA 2WDUA 2CVDA 4NMUA 2J23A 2I4AA 1GULA 3HVXA 2FWFA 2H1DA 2NDOA 2LQQA 1PKWA 1YY7A 1O8WA 2D2ZA 4K9ZA 1ZYEA 1GUHA 1PD21 2R37A 2HNLA 3CYNA 2L5LA 3J7Yk 1A24A 1T3BA 4YQMA 4F2IA 3FZ5A 4IP6A 1SJ6A 2J9HA 5ECNB 1T8EB 4JEDA 3BBYA 3DYRA 1MD4A 1TRVA 5H5SA 3K8NA 1ABAA 2H1AA 2H30A 2VD1A 1GUMA 1AQXA 1A2MA 3I9V2 4FIWA 4WKWA 5IMCA 4MZBA 3WGEA 4N0ZA 2C1YA 3LWAA 4KUNA 2MMNA 3TOUA 3UL3A 6GSVA 1PA3A 5INYA 1TK8B 3D6IA 1HYUA 1TKDB 3A2VA 2HI7A 5ABRA 3GKXA 4IELA 2RM6A 5CO3A 1FHEA 11GSA 5HFIA 3RHBA 2YCDA 22GSA 3TKPA 4ISDA 1RK4A 3IBHA 1GWCA 2UZ8A 4KGIA 4PX1A 2I9HA 3IA1A 3DVWA 4V2LA 6GSSA 1SKWB 3APQA 4GXZA 2CA8A 4RI6A 1B8XA 3WT2A 5LNKe 2B5XA 3G7IA 5AGYA 1FG4A 2YPMA 3GL3A 2DJKA 2QSIA 1H4OA 3QCPA 3A2WA 2FGXA 1VGLA 2DJ3A 3LORA 4USSA 4IHUA 1W4VA 3IAS2 2VCZA 1YEXA 3VWVA 2O8VB 3H8QA 2VL2C 4EKZA 3Q19A 5HQPA 2H0HA 1JZRA 2VAFA 3GRXA 3KMNA 3KTLA 4PUAA 8GSSA 4LMWA 3VFIA 1XWKA 3OR5A 4Q5RA 1TP9A 3DIEA 3GV1A 2FWGA 1SL1B 1YJ6A 3GN3A 4YQVA 2H0GA 20GSA 4G0LA 4K5SA 4GRFA 4OCFA 4IGJA 17GSA 4XTSA 1TTZA 2DJJA 3P7XA 4XS4A 2B3SA 2REMA 2CT6A 2HE3A 1S3AA 4Q5FA 2FNOA 2A2RA 1NHOA 1GTAA 2EIQA 1SD8A 3LXZA 1FAAA 2OKAA 1UVZA 2PPTA 3IXRA 1PMTA 3KGKA 4EL1A 3EPTA 2X99A 4G10A 3ERGA 12GSA 4ZL9A 3KXOA 3UBKA 5IO2A 1T4YA 3C71A 2RM5A 4Q5QA 2H74A 1OE7A 4EIQA 4DSRA 4BPYA 5E59A 4PNGA 2YANA 3DEXA 1M9BA 2YV9A 4MPFA 2V41A 4N11A 1XZOA 1ACVA 3DD3A 1XIYA 1Z6MA 3HHVA 5B7CA 2DLXA 9GSSA 3VPQA 1UA5A 4JZQA 2C3NA 3HJMA 2BJXA 2DMMA 4IQAA 3JCML 3HY2A 2OE1A 2GT6A 4K0NA 3WYWA 3P90A 3DVXA 4HI7A 3G7JA 2GQLA 3IDVA 4MF6A 3RBTA 2MMAA 1XXUA 4F0CA 16GSA 5AIXA 1URMA 1OC9A 3IV4A 2GTUA 1OYJA 3PPUA 2IMDA 1MEKA 3GMFA 5GZZB 4MK3A 1ZYQB 2HRAA 2TIRA 5B8BA 1X0RA 5FT3A 2L57A 3LYKA 3NZNA 1PSQA 1A23A 1TK5B 1THXA 4YQUA 4IBPA 5DQSA 2R3XA 3ISOA 1OC3A 2O87A 4GWRA 3C8EA 4MH2A 4TXOB 1DUGA 1TRSA 4MP4A 2GSSA 3QAGA 2B1KA 1M99A 2G2QA 4MABA 4LLRA 3HXSA 1GTIA 2IFQA 4XS4B 3DMLA 1BEDA 2DJ1A 4QQ7A 2O89A 3GURA 4ZXGA 1F6MC 1SD9A 3F63A 1AW9A 5ECMB 4F03A 4BWSA 5DCHA 3LSZA 3TJJA 1GSYA 5JWRB 1XBSA 1YKCA 3ZTLA 2G0FA 5G1KA 5F05A 3O76A 5CNWA 5FWGA 1Z7RA 1U3IA 3F3QA 1ZMAA 3C1RA 2V32A 5ECKB 1Y25A 1V57A 2CV4A 2QKEA 5H5QA 3TRQA 3FW2A 4BVXB 2H6YA 4IN0A 2VM2A 4ZL8A 4FQUA 3AY8A 1FB6A 4IS0A 3GSSA 2XPEA 5ECSA 1N8JA 3DKSA 2H66A 5A5KA 3NOFA 5HFKA 2WZ9A 3GKKA 5A4WA 2LRTA 2HSYA 2MBSA 2JACA 5DDLA 3VPTA 5BMUA 3VI5A 3HVVA 3KM6A 2I3YA 2IMFA 1O81A 4Z2UA 5CREA 4O92A 5EVOA 1A0FA 1V2AA 2LSTA 1EP7A 1GL8A 7GSSA 1I5GA 2C3QA 2H01A 1PN0A 2DBCA 1EP8A 2RLIA 4LL4B 2HSHA 2IYJA 4MDCA 2K8SA 1Y6EA 1MDIA 3TUEA 3GNJA 2JZTA 3F6DA 5IMFA 4L8EA 1FOHA 1GTUA 1M9AA 2JZRA 2K9FA 2LJAA 1ERWA 1THOA 4K2XA 4KAEA 5GSTA 3UAPA 1S3CA 2PU9C 4I97A 1X5DA 2HFDA 1YF1A 3GX0A 2P5RA 3LFLA 2IFQB 2F51A 3UOMA 3GTUB 1KTEA 1B9YC 10GSA 1B9XC 2IWTA 4ZBAA 4L0UA 2XBIA 1TJDA 3GHAA 3D21A 1KEBA 3GFKA 2MZCA 1T00A 3ME7A 1WRYA 1SL2B 5EPFA 4JRRA 2LJKA 1R5AA 2QA1A 4KB3A 3PGTA 2ES7A 2Z9SA 1EEJA 3HYPA 5ELGA 1QGVA 3TKSE 3A2XA 2GZPA 2HRFA 2M72A 3KP8A 3ED3A 3DWVA 5JCUA 2GSTA 2PBJA 4MMMA 4POBA 4DSQA 18GSA 1F3AA 2DJ0A 2WJUA 4TKYA 4EDZA 3CSIA 4BL7A 4KDYA 5ECHB 2EIRA 4KH7A 3TRPA 5IMDA 2VL9A 2E2GA 2B1LA 3MSZA 4HUAA 3D4TA 1QXHA 1SENA 2LRNA 3HZ4A 3TDGA 4NXIA 5HR3A 4JE1A 2YZHA 3HZ8A 1E2YA 1GSSA 5CRGA 3KMOA 3KP9A 4TR3A 3UJ1A 4XS6A 2H1BA 4RUVA 4NWYA 1SJIA 5CYYA 1TI1A 3FR6A 2YJ7A 2R0CA 4POKA 3F4TA 4N0VA 2GZYA 2R2JA 1G7EA 1X9MB 1KNGA 3ZMLA 4O7HA 3E3EA 3TKSC 4ID0A 3SBCA 4XRDA 4KSMA 2HSMA 4TXOA 3I43A 4Z2TA 1O85A 2VO4A 2KHPA 2YN1A 4NAXA 4G9HA 3KCMA 2KP2A 2ALBA 4HEA2 4DEJA 5H5RA 2C80A 2X49A 3MDKA 3ZFLA 1FVJA 5D9VA 4AF2A 5DCGA 1M0UA 2A4VA 5J3RA 4Z2RA 5GAPD 1QK8A 1JZDA 2WCIA 1BAYA 4AJ8A 2I1UA 3IOSA 2JSYA 3VK9A 4LMVA 1FOVA 1ZOFA 3I6AA 4HDEA 3MWHA 3HCZA 3TJGA 5JCGA 2C8UA 5IO0A 3Q6OA 2YWMA 1EZKA 3A3TA 3IC4A 5DALA 3M8NA 2PWJA 5IM9A 5JWQB 2VOCA 4HS1A 1PX6A 1YDKA 1FVKA 1C72A 3WGXA 1UC7A 5IOXA 1DE2A 1T4ZA 4H86A 3F3RA 2DJ2A 1ERTA 5DALB 1Q4JA 2FA8A 4EE0A 2FWEA 1XW9A 3DRNA 4E8EA 2AYTA 3TCOA 5KN1A 6GSTA 2NTOA 1DE1A 2FD3A 2GQKA 3TJFA 3WGDA 3RPNA 4ECIA 2LUSA 3TB2A 3KH9A 2PGTA 3CMIA 4QL9A 4IJIA 1R4WA 3F6FA 3GKNA 3FR3A 4I2UA 1QMVA 1DBYA 3ME8A 4YH2A 2KP1A 4TXVA 2V1MA 2VLTA 4FO5A 3R3EA 3TGZA 5B8AA 6GSUA 1WP0A 2E0QA 3TJKA 4BVYA 4MH3A 4J56E 3N5OA 2WS2A 4EUYA 4ICYA 2H72A 4MZCA 6GSYA 4ZB8A 2MMOA 3W8SA 3W8JA 1PGTA 4ACSA 3FRCA 1YKAA 2FUG2 2PVQA 4GCIA 2H19A 3ZL5A 1FO5A 3D4MA 1A2LA 3MNGA 3CXGA 1NSWA 2MYGA 3LJRA 4MNNA 5F06A 1Z6NA 2VCVA 4GLTA 3GKMA 3ZIJA 2GLRA 2X64A 5CRHA 4NV5A 1VRSD 3GTUA 1CQGA 4TVEA 1I9DA 2AB6A 4PQIA 3D0ZA 2GT5A 3VWUA 3H79A 2DSAA 4I2TA 2WRTA 1F9MA 3PR8A 3RDWA 4GSNA 2R0GA 2YV7A 1T1VA 1GLPA 1EOHA 4F9ZA 1J08A 1B4PA 1JZWA 4O5UA 1YF0A 2PERA 2HRKA 2CVKA 4ML6A 3FYGA 2CX4A 4NPBA 2R4VA 3WT1A 1GLQA 1SYXA 1USBA 4O32A 1WJKA 2CAIA 5AIVA 2RUEA 5IOWA 2H71A 2V6KA 4I6XA 4MPGA 2DKHA 4K5RA 1TRUA 3E0UA 1TW9A 5CAXA 1ZZYA 4EC0A 4V2MA 4CHSA 4F0BA 5IPGA 3KEBA 4NV2A 4YAPA 1B48A 2OJLA 1U6TA 5IMZA 1OKDA 4LA1A 1ZYPA 3S9FA 1XWBA 3IPZA 3RPPA 4ECBA 5J41A 5G31A 1A8LA 5C04A 3L4NA 2NVLA 2YNXA 5ENUA 1CQHA 4MZWA 3P8WA 5BRTA 2CX3A 3M0FA 4EVMA 2QGVA 2VL2A 3SWLA 2LNSA 4K7IA 1R5PA 1G0TA 3APSA 2H70A 2OADA 4G2EA 3A5IA 4KF9A 3ERFA 1XOAA 2VCTA 1EV4A 3A5WA 1A8YA 4L0WA 3QDNA 2JL4A 5J9BA 4NHZA 3IK7A 3IK9A 4TOPA 1EGOA 2L6CA 4FYBA 2X8GA 3O6TA 1GSEA 5JWOB 3J7Yb 4Q5NA 5HR0A 1HNAA 2LQOA 1U3AA 4X4JA 4IKHA 2RUFA 2FA4A 2X4AA 3ZITA 2LNTA 4CY6A 13GSA 3CTGA 4YKFA 3F9UA 2H75A 2IMIA 1VF3A 4MA9A 5ID2B 1UN2A 1Z3EA 1TU7A 4BWQA 1WWJA 3R2QA 19GSA 3GIXA 4AGSA 4BA7A 1GSFA 2XBQA 5CRDA 1ZL9A 3KZQA 1XVQA 4X1UA 4KE3A 1QQ2A 1X9SB 2NPBA 4AJ7A 1DSBA 1SK2A 2QA2A 2FLSA 4ZBBA 2PUKC 4PQ1A 5D8IA 2CAQA 4HJ2A 4ZILA 3O3TA 5EY6A 1RQMA 3E9JB 5ECPB 3VWWA 6GSXA 1W89A 3VLNA 4DSSA 4EXJA 1VF1A 4JR6A 1M2AA 5FHIA 2ON5A 2GZZA 5EL8A 1A2JA 5LCZA 5DAKB 2C4JA 3C73A 4KDXA 2KUCA 1PX7A 2IN3A 3KTBA 2LS5A 2K18A 4TW5A 2HZFA 3LQ7A 4FH8A 4WBRD 4MF5A 4PURA 2P0GA 5A4UA 4HOJA 4IW9A 1GSUA 4OMVA 3VURA 2F8AA 2CQ9A 3TKRA 1E6BA 2VLUA 3KIJA 3GYKA 1B4QA 1T7PB 5GSSA 1A0RP 4ZB6A 2V2GA 4WETA 4G19A 3HVSA 2WB9A 4MJEA 2YWNA 3IC8A 5J9CA 4K2DA 3PH9A 4P3YB 2BTOT 2N5AA 5HR1A 2AV4A 3APOA 2B5YA 2IMEA 1GTBA 2HLSA 5DJLA 2VD0A 4K8MA 2N5FA 4EDYA 1XOBA 2VUPA 4V1Ap 2LJRA 4ZBDA 1AXDA 4EO3A 1TI3A 5G5FA 2AAWA 2JU5A 1ZCPA 4KSOA 1VF2A 2L4CA 3CRTA 3EINA 1OVNA 4HQSA 2YP6A 1XPVA 3I69A 4GQFA 3EMXA 1PKZA 4X43A 4XS1A 1ILOA 1YEPA 4O5QA 5GAND 3RAZA 3U5RE 3QPMA 3FKFA 3TOTA 3QOUA 5D93A 4TR1A 3LYPA 1PL1A 3ZVJA 2C0FA 3DXBA 2ZCTA 5DVBA 2FCHA 2X8CA 4POLA 2WFCA 5G2ZA 4PXOA 1NHYA 2R5GA 1EGRA 5C00A 1SKSB 2B6MA 3FZ9A 4G0KA 3EU3A 2IMKA 4GQCA 2PMTA 4HZ4A 4XRAA 1BJXA 3LGCA 4XHMA 2HRNA 5AISA 3EE2A 3FEUA 2O85A 5DJMA 4CDOA 3QMXA 2F8FA 3QFAC 2WGRA 2F3MA 1SL0B 3QR6A 4HU9A 5ECRB 3CRUA 2L4QA 3L0HA 3VI7A 3GSTA 5ECIB 2L5OA 4X0XA 3H4KA 1U88A 1XWGA 1ERVA 14GSA 2AJQB 2LKUA 3NIVA 3HKRA 3D22A 1M7TA 3EURA 2F9SA 3M3MA 1XFLA 3F4SA 3L9SA 4KCAA 1TK0B 2IJYA 4Z7XA 2DMLA 3FR9A 2PVOC 2YOIA 1JLVA 1F37A 5G1LA 3TKQA 3FHKA 4TR4A 1FW1A 2I81A 3GH6A 1PN9A 1EWXA 4ECCA 1O7UA 1NW2A 2DIYA 4HJMA 2YZUA 1GUKA 5ECLB 5ID2A 4YKGA 2O7KA 4HQZA 5AN1A 3ZYWA 2R0PA 1V9WA 2OBKA 3F4RA 1PRXA 4HZ2A 3FK8A 3IRAA 4ZIJA 1OE8A 4WXTA 1OAZA 5G5EA 5IPHA 1BQ7A 2H73A 4CW9A 2VM1A 1Z5YE 2XHFA 5D96A 2M46A 1JHBA 2AUVA 2P31A 1X5EA 3QFBC 4KW6A 3FZAA 2ZNMA 2HYXA 3C1SA 3UVTA 2LRCA 1F3BA 4JR4A 2HZEA 4K7NA 4WR5A 1WOUA 4CY8A 1MD3A 4JBBA 3CSJA 1K0NA 3D5JA 4OD7A 2JZSA 1GSQA 4WEYA 2L59A 3C7MA 4OCEA 2QC7A 4FYUA 4GSTA 2ZUPA 2C0GA 1SK0A 3TKSA 4WBJA 5D73A 1YZXA 2C3TA 5E4WA 3H1NA 4K1FA 1NM3A 3L78A 1V40A 5HR2A 1K0AA 4WF4A 4MLYA 5B6MA 3IR4A 4PQHA 1ERUA 4N30A 3UARA 2IY2A 4K7OA 4JU5A 2CZ3A 1TRWA 3IHGA 3CSHA 3MAKA 1BG5A 3GL5A 4RQXA 3HD5A 1RW1A 1SJZA 4KX4A 3ZFBA 4IVFA 1LU4A 1FB0A 1Q98A 1AC1A 1GP1A 3QAWA 3LG6A 1OC9B 4EF0A 3BD2A 3EU4A 1JFUA 5ECOB 3ZRDA 4OFTA 1GSDA 1GNEA 4I5QA 2MMZA 4O5RA 2OE3A 1VF4A 2K6VA 5KN0A 2HT9A 2JSZA 4AJ6A 1ST9A 1HNCA 1O73A 2AHEA 1QFNA 4MJBA 1ZYNA 5L71A 2LTKA 1X5CA 1EV9A 2E2MA 3LXTA 4MJCA 1M2BA 1V58A 1MTCA 2GSRA 4KDUA 4ZB9A 3HA9A 3QAVA 1AQWA 3CTFA 5JCWA 2IPAA 2A2PA 4OWYA 4GSSA 4MJAA 1J0FA 4TRXA 4E8HA 1J9BA 2HXKA 1O8XA 2YJHA 3KJYA 1H75A 3ZIVA 1ZGNA 1AAZA 1U87A 2XPDA 1R26A 2H6XA 2GVPA 1AUCA 2N5BA 2V6OA 1GH2A 5G30A 2GGTA 5KN2A 2C0EA 2WULA 2DKIA 4IQ1A 1ON4A 1TDIA 1SU9A 2FWHA 1TOFA 3EWLA 4D73A 2B5EA 1WPIA 4ML1A 3HDCA 2VCXA 2GSQA 3UMAA 3M9JA 4KNDA 4PTSA 4QL7A 1O6JA 5KOWA 3UIWA 2IIYA 2H8LA 4RQRA 2GDRA 1MDKA 1K0OA 4D73B 1BX9A 4GF0A 5D9TA 1XWAA 3HJOA 4MCUA 1SYRA 5KOXA 1EEMA 3V1WA 1X9WB 2KOKA 3IHQA 4A5PA 2VCWA 3BCIA 2OACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBT A;  1JLW A;  4V2N A;  1K0C A;  3EMP A;  2RII A;  3Q74 A;  3P2A A;  3W6G A;  4J57 E;  3M9K A;  4ECJ A;  2EC4 A;  4L5O A;  5D9W A;  1IYI A;  3QD9 A;  1Z9H A;  1HNB A;  1Z7P A;  2X8H A;  1K3Y A;  2PN8 A;  3BCK A;  1PQN A;  4XIH A;  1EOG A;  2H0I A;  4OFM A;  3HJP A;  4MF7 A;  1XW6 A;  3PIN A;  4KA0 A;  3US3 A;  5F0G A;  4LL1 B;  1WMJ A;  4I8B A;  2B7K A;  2H76 A;  4IJ3 A;  4OO5 A;  3F8U A;  3BOA A;  3EVI A;  1HD2 A;  3UVH A;  3M1G A;  4WR4 A;  5KEJ A;  3GX8 A;  2HZE B;  1JZO A;  4PUF C;  2FHE A;  3BJ5 A;  2IL3 A;  3VWX A;  5A4V A;  2TRC P;  4KCE A;  4XCS A;  1KBN A;  4V1A g;  3ZRE A;  2OA7 A;  5ECQ B;  3RHC A;  1K3O A;  4YAV A;  3CBU A;  2E7P A;  1G6W A;  2GQM A;  5F07 A;  4WF5 A;  3UEM A;  4PGT A;  3L9U A;  4J2F A;  2XC2 A;  3KD0 A;  3TRX A;  1XCC A;  4HU7 A;  2DIZ A;  4DVC A;  3EYT A;  2DC5 A;  1K3L A;  1XWC A;  4ULX A;  5KN3 A;  3FZ4 A;  4DSS B;  3G9B A;  5DQY A;  1WIK A;  2ON7 A;  1QUW A;  2YWO A;  4TN8 A;  1XVW A;  4OFN A;  5IIZ A;  2VCQ A;  4GTU A;  4L5L A;  5F8B A;  2EIO A;  5DBQ A;  2P5Q A;  2TRX A;  4F82 A;  2OBI A;  4POM A;  5J5N A;  3UBL A;  3ZZX A;  2VIM A;  5DAK A;  1OC8 A;  2KLX A;  1GNW A;  2B7J A;  5LD0 A;  3KH7 A;  1K0B A;  3ERW A;  1ML6 A;  4ILF A;  1BYE A;  1WE0 A;  2NBS A;  4PNF A;  1M2D A;  4N10 A;  5J4U A;  3ZVJ D;  1K0M A;  1N2A A;  1F2E A;  1XW5 A;  3IAM 2;  3L9V A;  1PL2 A;  5D9X A;  1AQV A;  2JAD A;  1AIU A;  1YQ1 A;  4RI7 A;  5B6N A;  3LEF A;  3H93 A;  4K0G A;  1TXX A;  3IE3 A;  5COH A;  4TR0 A;  1V98 A;  4ZL7 A;  3TJB A;  1G6Y A;  5IMA A;  4FYC A;  1K0D A;  1OKT A;  2OE0 A;  2VLV A;  2M80 A;  5HFG A;  3GUS A;  1HQO A;  1GRX A;  2YWI A;  2VL3 A;  2R6K A;  1IYH A;  1LJR A;  5IQY A;  4K6X A;  2H6Z A;  3DGQ A;  3F0I A;  3ZLP A;  1SK1 A;  4IP1 A;  2LV3 A;  5IMV A;  2L6D A;  2CVB A;  5CRW A;  2LEG A;  2CZ2 A;  2GS3 A;  3G7Y A;  5ELA A;  1MDJ A;  4OO4 A;  3U6V A;  4NHW A;  3EC3 A;  2A2S A;  1SKR B;  1TU8 A;  1LBK A;  4BVX A;  1G7O A;  2C0D A;  2H1G A;  5CP1 A;  3WD6 A;  2K8V A;  1R7H A;  2BMX A;  4TR1 B;  3GH9 A;  3ZMK A;  3FY7 A;  2FY6 A;  6GSW A;  3GA4 A;  3N9J A;  3Q18 A;  1S3D A;  2WDU A;  2CVD A;  4NMU A;  2J23 A;  2I4A A;  1GUL A;  3HVX A;  2FWF A;  2H1D A;  2NDO A;  2LQQ A;  1PKW A;  1YY7 A;  1O8W A;  2D2Z A;  4K9Z A;  1ZYE A;  1GUH A;  1PD2 1;  2R37 A;  2HNL A;  3CYN A;  2L5L A;  3J7Y k;  1A24 A;  1T3B A;  4YQM A;  4F2I A;  3FZ5 A;  4IP6 A;  1SJ6 A;  2J9H A;  5ECN B;  1T8E B;  4JED A;  3BBY A;  3DYR A;  1MD4 A;  1TRV A;  5H5S A;  3K8N A;  1ABA A;  2H1A A;  2H30 A;  2VD1 A;  1GUM A;  1AQX A;  1A2M A;  3I9V 2;  4FIW A;  4WKW A;  5IMC A;  4MZB A;  3WGE A;  4N0Z A;  2C1Y A;  3LWA A;  4KUN A;  2MMN A;  3TOU A;  3UL3 A;  6GSV A;  1PA3 A;  5INY A;  1TK8 B;  3D6I A;  1HYU A;  1TKD B;  3A2V A;  2HI7 A;  5ABR A;  3GKX A;  4IEL A;  2RM6 A;  5CO3 A;  1FHE A;  11GS A;  5HFI A;  3RHB A;  2YCD A;  22GS A;  3TKP A;  4ISD A;  1RK4 A;  3IBH A;  1GWC A;  4KGI A;  4PX1 A;  2I9H A;  3IA1 A;  3DVW A;  4V2L A;  6GSS A;  1SKW B;  3APQ A;  4GXZ A;  2CA8 A;  4RI6 A;  1B8X A;  3WT2 A;  5LNK e;  2B5X A;  3G7I A;  5AGY A;  1FG4 A;  2YPM A;  3GL3 A;  2DJK A;  2QSI A;  1H4O A;  3QCP A;  3A2W A;  2FGX A;  1VGL A;  2DJ3 A;  3LOR A;  4IHU A;  1W4V A;  3IAS 2;  2VCZ A;  1YEX A;  3VWV A;  2O8V B;  3H8Q A;  2VL2 C;  4EKZ A;  3Q19 A;  5HQP A;  2H0H A;  1JZR A;  2VAF A;  3GRX A;  3KMN A;  3KTL A;  4PUA A;  8GSS A;  4LMW A;  3VFI A;  1XWK A;  3OR5 A;  4Q5R A;  1TP9 A;  3DIE A;  3GV1 A;  2FWG A;  1SL1 B;  1YJ6 A;  3GN3 A;  4YQV A;  2H0G A;  20GS A;  4GRF A;  4OCF A;  4IGJ A;  17GS A;  4XTS A;  1TTZ A;  2DJJ A;  3P7X A;  4XS4 A;  2B3S A;  2REM A;  2CT6 A;  2HE3 A;  1S3A A;  4Q5F A;  2FNO A;  2A2R A;  1NHO A;  1GTA A;  2EIQ A;  1SD8 A;  3LXZ A;  1FAA A;  2OKA A;  1UVZ A;  2PPT A;  3IXR A;  1PMT A;  3KGK A;  4EL1 A;  2X99 A;  4G10 A;  3ERG A;  12GS A;  4ZL9 A;  3KXO A;  3UBK A;  5IO2 A;  1T4Y A;  3C71 A;  2RM5 A;  4Q5Q A;  2H74 A;  1OE7 A;  4DSR A;  4BPY A;  5E59 A;  4PNG A;  2YAN A;  3DEX A;  1M9B A;  2YV9 A;  4MPF A;  2V41 A;  4N11 A;  1XZO A;  1ACV A;  3DD3 A;  1XIY A;  1Z6M A;  3HHV A;  5B7C A;  2DLX A;  9GSS A;  3VPQ A;  1UA5 A;  4JZQ A;  2C3N A;  3HJM A;  2BJX A;  2DMM A;  4IQA A;  3JCM L;  3HY2 A;  2OE1 A;  2GT6 A;  4K0N A;  3WYW A;  3P90 A;  3DVX A;  4HI7 A;  3G7J A;  2GQL A;  3IDV A;  4MF6 A;  3RBT A;  2MMA A;  1XXU A;  4F0C A;  16GS A;  5AIX A;  1URM A;  1OC9 A;  3IV4 A;  2GTU A;  1OYJ A;  2IMD A;  1MEK A;  3GMF A;  5GZZ B;  4MK3 A;  1ZYQ B;  2TIR A;  5B8B A;  1X0R A;  5FT3 A;  2L57 A;  3LYK A;  3NZN A;  1PSQ A;  1A23 A;  1TK5 B;  1THX A;  4YQU A;  4IBP A;  5DQS A;  2R3X A;  3ISO A;  1OC3 A;  2O87 A;  4GWR A;  3C8E A;  4MH2 A;  4TXO B;  1DUG A;  1TRS A;  4MP4 A;  2GSS A;  3QAG A;  2B1K A;  1M99 A;  2G2Q A;  4MAB A;  4LLR A;  3HXS A;  1GTI A;  2IFQ A;  4XS4 B;  3DML A;  1BED A;  2DJ1 A;  4QQ7 A;  2O89 A;  3GUR A;  4ZXG A;  1F6M C;  1SD9 A;  3F63 A;  1AW9 A;  5ECM B;  4F03 A;  4BWS A;  5DCH A;  3LSZ A;  3TJJ A;  1GSY A;  5JWR B;  1XBS A;  1YKC A;  3ZTL A;  2G0F A;  5G1K A;  5F05 A;  3O76 A;  5CNW A;  5FWG A;  1Z7R A;  1U3I A;  3F3Q A;  1ZMA A;  3C1R A;  2V32 A;  5ECK B;  1Y25 A;  1V57 A;  2CV4 A;  2QKE A;  5H5Q A;  3TRQ A;  3FW2 A;  2H6Y A;  4IN0 A;  2VM2 A;  4ZL8 A;  3AY8 A;  1FB6 A;  4IS0 A;  3GSS A;  2XPE A;  5ECS A;  1N8J A;  3DKS A;  2H66 A;  5A5K A;  3NOF A;  5HFK A;  2WZ9 A;  3GKK A;  5A4W A;  2LRT A;  2HSY A;  2MBS A;  2JAC A;  5DDL A;  3VPT A;  3VI5 A;  3HVV A;  3KM6 A;  2I3Y A;  2IMF A;  1O81 A;  5CRE A;  4O92 A;  5EVO A;  1A0F A;  1V2A A;  2LST A;  1EP7 A;  1GL8 A;  7GSS A;  1I5G A;  2C3Q A;  2H01 A;  2DBC A;  1EP8 A;  2RLI A;  4LL4 B;  2HSH A;  2IYJ A;  4MDC A;  2K8S A;  1Y6E A;  1MDI A;  3TUE A;  3GNJ A;  2JZT A;  3F6D A;  5IMF A;  4L8E A;  1GTU A;  1M9A A;  2JZR A;  2K9F A;  2LJA A;  1ERW A;  1THO A;  4KAE A;  5GST A;  3UAP A;  1S3C A;  2PU9 C;  4I97 A;  1X5D A;  2HFD A;  1YF1 A;  3GX0 A;  2P5R A;  3LFL A;  2IFQ B;  2F51 A;  3UOM A;  3GTU B;  1KTE A;  1B9Y C;  10GS A;  1B9X C;  2IWT A;  4ZBA A;  4L0U A;  2XBI A;  1TJD A;  3GHA A;  3D21 A;  1KEB A;  3GFK A;  2MZC A;  1T00 A;  3ME7 A;  1WRY A;  1SL2 B;  5EPF A;  4JRR A;  2LJK A;  1R5A A;  4KB3 A;  3PGT A;  2ES7 A;  2Z9S A;  1EEJ A;  3HYP A;  5ELG A;  1QGV A;  3TKS E;  3A2X A;  2GZP A;  2HRF A;  2M72 A;  3KP8 A;  3ED3 A;  3DWV A;  5JCU A;  2GST A;  2PBJ A;  4MMM A;  4POB A;  4DSQ A;  18GS A;  1F3A A;  2DJ0 A;  2WJU A;  4TKY A;  4EDZ A;  3CSI A;  4BL7 A;  4KDY A;  5ECH B;  2EIR A;  4KH7 A;  3TRP A;  5IMD A;  2VL9 A;  2E2G A;  2B1L A;  3MSZ A;  4HUA A;  3D4T A;  1QXH A;  1SEN A;  2LRN A;  3HZ4 A;  3TDG A;  4NXI A;  5HR3 A;  4JE1 A;  2YZH A;  3HZ8 A;  1E2Y A;  1GSS A;  5CRG A;  3KMO A;  3KP9 A;  4TR3 A;  3UJ1 A;  4XS6 A;  2H1B A;  4RUV A;  4NWY A;  1SJI A;  5CYY A;  1TI1 A;  3FR6 A;  2YJ7 A;  4POK A;  3F4T A;  4N0V A;  2GZY A;  2R2J A;  1G7E A;  1X9M B;  1KNG A;  3ZML A;  4O7H A;  3E3E A;  3TKS C;  4ID0 A;  3SBC A;  4XRD A;  4KSM A;  4TXO A;  3I43 A;  1O85 A;  2VO4 A;  2KHP A;  2YN1 A;  4NAX A;  4G9H A;  3KCM A;  2KP2 A;  2ALB A;  4HEA 2;  4DEJ A;  5H5R A;  2C80 A;  3MDK A;  3ZFL A;  1FVJ A;  5D9V A;  4AF2 A;  5DCG A;  1M0U A;  2A4V A;  5J3R A;  5GAP D;  1QK8 A;  1JZD A;  2WCI A;  1BAY A;  4AJ8 A;  2I1U A;  3IOS A;  2JSY A;  3VK9 A;  4LMV A;  1FOV A;  1ZOF A;  3I6A A;  4HDE A;  3MWH A;  3HCZ A;  3TJG A;  5JCG A;  2C8U A;  5IO0 A;  3Q6O A;  2YWM A;  1EZK A;  3A3T A;  3IC4 A;  5DAL A;  3M8N A;  2PWJ A;  5IM9 A;  5JWQ B;  2VOC A;  4HS1 A;  1PX6 A;  1YDK A;  1FVK A;  1C72 A;  3WGX A;  1UC7 A;  5IOX A;  1DE2 A;  1T4Z A;  4H86 A;  3F3R A;  2DJ2 A;  1ERT A;  5DAL B;  1Q4J A;  2FA8 A;  4EE0 A;  2FWE A;  1XW9 A;  3DRN A;  4E8E A;  2AYT A;  3TCO A;  5KN1 A;  6GST A;  2NTO A;  1DE1 A;  2FD3 A;  2GQK A;  3TJF A;  3WGD A;  3RPN A;  4ECI A;  2LUS A;  3TB2 A;  3KH9 A;  2PGT A;  3CMI A;  4QL9 A;  4IJI A;  1R4W A;  3F6F A;  3GKN A;  3FR3 A;  4I2U A;  1QMV A;  1DBY A;  3ME8 A;  4YH2 A;  2KP1 A;  4TXV A;  2V1M A;  2VLT A;  4FO5 A;  3TGZ A;  5B8A A;  6GSU A;  1WP0 A;  2E0Q A;  3TJK A;  4BVY A;  4MH3 A;  4J56 E;  3N5O A;  2WS2 A;  4EUY A;  2H72 A;  4MZC A;  6GSY A;  4ZB8 A;  2MMO A;  3W8S A;  3W8J A;  1PGT A;  4ACS A;  3FRC A;  1YKA A;  2FUG 2;  2PVQ A;  4GCI A;  2H19 A;  3ZL5 A;  1FO5 A;  3D4M A;  1A2L A;  3MNG A;  3CXG A;  1NSW A;  2MYG A;  3LJR A;  5F06 A;  1Z6N A;  2VCV A;  4GLT A;  3GKM A;  3ZIJ A;  2GLR A;  2X64 A;  5CRH A;  4NV5 A;  1VRS D;  3GTU A;  1CQG A;  4TVE A;  1I9D A;  2AB6 A;  4PQI A;  3D0Z A;  2GT5 A;  3VWU A;  3H79 A;  2DSA A;  4I2T A;  2WRT A;  1F9M A;  3PR8 A;  3RDW A;  4GSN A;  2YV7 A;  1T1V A;  1GLP A;  1EOH A;  4F9Z A;  1J08 A;  1B4P A;  1JZW A;  1YF0 A;  2PER A;  2CVK A;  4ML6 A;  3FYG A;  2CX4 A;  4NPB A;  2R4V A;  3WT1 A;  1GLQ A;  1SYX A;  1USB A;  4O32 A;  1WJK A;  2CAI A;  5AIV A;  2RUE A;  5IOW A;  2H71 A;  2V6K A;  4I6X A;  4MPG A;  1TRU A;  3E0U A;  1TW9 A;  5CAX A;  1ZZY A;  4EC0 A;  4V2M A;  4CHS A;  4F0B A;  5IPG A;  3KEB A;  4NV2 A;  4YAP A;  1B48 A;  2OJL A;  1U6T A;  5IMZ A;  1OKD A;  4LA1 A;  3S9F A;  1XWB A;  3IPZ A;  3RPP A;  4ECB A;  5J41 A;  5G31 A;  1A8L A;  5C04 A;  3L4N A;  2NVL A;  2YNX A;  5ENU A;  1CQH A;  4MZW A;  3P8W A;  2CX3 A;  3M0F A;  4EVM A;  2QGV A;  2VL2 A;  3SWL A;  2LNS A;  4K7I A;  1R5P A;  1G0T A;  3APS A;  2H70 A;  2OAD A;  4G2E A;  3ERF A;  1XOA A;  2VCT A;  1EV4 A;  3A5W A;  1A8Y A;  4L0W A;  3QDN A;  2JL4 A;  5J9B A;  4NHZ A;  3IK7 A;  3IK9 A;  4TOP A;  1EGO A;  2L6C A;  4FYB A;  2X8G A;  3O6T A;  1GSE A;  5JWO B;  3J7Y b;  4Q5N A;  5HR0 A;  1HNA A;  2LQO A;  1U3A A;  4IKH A;  2RUF A;  2FA4 A;  3ZIT A;  2LNT A;  13GS A;  3CTG A;  3F9U A;  2H75 A;  2IMI A;  1VF3 A;  4MA9 A;  5ID2 B;  1UN2 A;  1Z3E A;  1TU7 A;  4BWQ A;  1WWJ A;  3R2Q A;  19GS A;  3GIX A;  4AGS A;  4BA7 A;  1GSF A;  2XBQ A;  5CRD A;  1ZL9 A;  3KZQ A;  1XVQ A;  4X1U A;  4KE3 A;  1QQ2 A;  1X9S B;  2NPB A;  4AJ7 A;  1DSB A;  1SK2 A;  2FLS A;  4ZBB A;  2PUK C;  4PQ1 A;  5D8I A;  2CAQ A;  4HJ2 A;  4ZIL A;  3O3T A;  5EY6 A;  1RQM A;  3E9J B;  5ECP B;  3VWW A;  6GSX A;  1W89 A;  3VLN A;  4DSS A;  4EXJ A;  1VF1 A;  4JR6 A;  1M2A A;  5FHI A;  2ON5 A;  2GZZ A;  5EL8 A;  1A2J A;  5LCZ A;  5DAK B;  2C4J A;  3C73 A;  4KDX A;  2KUC A;  1PX7 A;  2IN3 A;  3KTB A;  2LS5 A;  2K18 A;  4TW5 A;  2HZF A;  3LQ7 A;  4FH8 A;  4WBR D;  4MF5 A;  4PUR A;  2P0G A;  5A4U A;  4HOJ A;  4IW9 A;  1GSU A;  4OMV A;  3VUR A;  2F8A A;  2CQ9 A;  3TKR A;  1E6B A;  2VLU A;  3KIJ A;  3GYK A;  1B4Q A;  1T7P B;  5GSS A;  1A0R P;  4ZB6 A;  2V2G A;  4WET A;  4G19 A;  3HVS A;  2WB9 A;  4MJE A;  2YWN A;  5J9C A;  4K2D A;  3PH9 A;  4P3Y B;  2BTO T;  2N5A A;  5HR1 A;  2AV4 A;  3APO A;  2B5Y A;  2IME A;  1GTB A;  2HLS A;  5DJL A;  2VD0 A;  4K8M A;  2N5F A;  4EDY A;  1XOB A;  2VUP A;  4V1A p;  2LJR A;  4ZBD A;  1AXD A;  4EO3 A;  1TI3 A;  5G5F A;  2AAW A;  2JU5 A;  1ZCP A;  4KSO A;  1VF2 A;  2L4C A;  3CRT A;  3EIN A;  1OVN A;  4HQS A;  2YP6 A;  1XPV A;  3I69 A;  4GQF A;  3EMX A;  1PKZ A;  4X43 A;  4XS1 A;  1ILO A;  1YEP A;  5GAN D;  3RAZ A;  3U5R E;  3QPM A;  3FKF A;  3TOT A;  3QOU A;  5D93 A;  4TR1 A;  3LYP A;  1PL1 A;  3ZVJ A;  2C0F A;  3DXB A;  2ZCT A;  5DVB A;  2FCH A;  2X8C A;  4POL A;  2WFC A;  5G2Z A;  4PXO A;  1NHY A;  2R5G A;  1EGR A;  5C00 A;  1SKS B;  2B6M A;  3FZ9 A;  3EU3 A;  2IMK A;  4GQC A;  2PMT A;  4HZ4 A;  4XRA A;  1BJX A;  3LGC A;  4XHM A;  2HRN A;  5AIS A;  3EE2 A;  3FEU A;  2O85 A;  5DJM A;  4CDO A;  3QMX A;  2F8F A;  3QFA C;  2WGR A;  2F3M A;  1SL0 B;  3QR6 A;  4HU9 A;  5ECR B;  3CRU A;  2L4Q A;  3L0H A;  3VI7 A;  3GST A;  5ECI B;  2L5O A;  4X0X A;  3H4K A;  1U88 A;  1XWG A;  1ERV A;  14GS A;  2AJQ B;  2LKU A;  3NIV A;  3HKR A;  3D22 A;  1M7T A;  3EUR A;  2F9S A;  3M3M A;  1XFL A;  3F4S A;  3L9S A;  4KCA A;  1TK0 B;  2IJY A;  4Z7X A;  2DML A;  3FR9 A;  2PVO C;  2YOI A;  1JLV A;  1F37 A;  5G1L A;  3TKQ A;  3FHK A;  4TR4 A;  1FW1 A;  2I81 A;  3GH6 A;  1PN9 A;  1EWX A;  4ECC A;  1O7U A;  1NW2 A;  2DIY A;  4HJM A;  2YZU A;  1GUK A;  5ECL B;  5ID2 A;  2O7K A;  4HQZ A;  5AN1 A;  3ZYW A;  1V9W A;  2OBK A;  3F4R A;  1PRX A;  4HZ2 A;  3FK8 A;  3IRA A;  4ZIJ A;  1OE8 A;  4WXT A;  1OAZ A;  5G5E A;  5IPH A;  1BQ7 A;  2H73 A;  4CW9 A;  2VM1 A;  1Z5Y E;  2XHF A;  5D96 A;  2M46 A;  1JHB A;  2AUV A;  2P31 A;  1X5E A;  3QFB C;  4KW6 A;  3FZA A;  2ZNM A;  2HYX A;  3C1S A;  3UVT A;  2LRC A;  1F3B A;  4JR4 A;  2HZE A;  4K7N A;  4WR5 A;  1WOU A;  1MD3 A;  4JBB A;  3CSJ A;  1K0N A;  3D5J A;  4OD7 A;  2JZS A;  1GSQ A;  4WEY A;  2L59 A;  3C7M A;  4OCE A;  2QC7 A;  4FYU A;  4GST A;  2ZUP A;  2C0G A;  1SK0 A;  4WBJ A;  3TKS A;  5D73 A;  1YZX A;  2C3T A;  5E4W A;  3H1N A;  4K1F A;  1NM3 A;  3L78 A;  1V40 A;  5HR2 A;  1K0A A;  4WF4 A;  4MLY A;  5B6M A;  3IR4 A;  4PQH A;  1ERU A;  4N30 A;  3UAR A;  2IY2 A;  4K7O A;  4JU5 A;  2CZ3 A;  1TRW A;  3CSH A;  3MAK A;  1BG5 A;  3GL5 A;  4RQX A;  3HD5 A;  1RW1 A;  1SJZ A;  4KX4 A;  3ZFB A;  4IVF A;  1LU4 A;  1FB0 A;  1Q98 A;  1AC1 A;  1GP1 A;  3QAW A;  3LG6 A;  1OC9 B;  4EF0 A;  3BD2 A;  3EU4 A;  1JFU A;  5ECO B;  3ZRD A;  4OFT A;  1GSD A;  1GNE A;  4I5Q A;  2MMZ A;  4O5R A;  2OE3 A;  1VF4 A;  2K6V A;  5KN0 A;  2HT9 A;  2JSZ A;  4AJ6 A;  1ST9 A;  1HNC A;  1O73 A;  2AHE A;  1QFN A;  4MJB A;  5L71 A;  2LTK A;  1X5C A;  1EV9 A;  2E2M A;  3LXT A;  4MJC A;  1M2B A;  1V58 A;  1MTC A;  2GSR A;  4KDU A;  4ZB9 A;  3HA9 A;  3QAV A;  1AQW A;  3CTF A;  5JCW A;  2IPA A;  4OWY A;  4GSS A;  4MJA A;  1J0F A;  4TRX A;  4E8H A;  1J9B A;  2HXK A;  1O8X A;  2YJH A;  3KJY A;  1H75 A;  3ZIV A;  1ZGN A;  1AAZ A;  1U87 A;  2XPD A;  1R26 A;  2H6X A;  2GVP A;  1AUC A;  2N5B A;  2V6O A;  1GH2 A;  5G30 A;  2GGT A;  5KN2 A;  2C0E A;  2WUL A;  4IQ1 A;  1ON4 A;  1TDI A;  1SU9 A;  2FWH A;  1TOF A;  3EWL A;  4D73 A;  2B5E A;  1WPI A;  4ML1 A;  3HDC A;  2VCX A;  2GSQ A;  3UMA A;  3M9J A;  4KND A;  4QL7 A;  1O6J A;  3UIW A;  2IIY A;  2H8L A;  4RQR A;  2GDR A;  1MDK A;  1K0O A;  4D73 B;  1BX9 A;  4GF0 A;  5D9T A;  1XWA A;  3HJO A;  4MCU A;  1SYR A;  1EEM A;  3V1W A;  1X9W B;  2KOK A;  3IHQ A;  2VCW A;  3BCI A;  2OAC A; 
#chains in the Genus database with same CATH topology
 4N6T A;  2MBT A;  1Q40 B;  2BMQ B;  1JLW A;  4V2N A;  1K0C A;  3EMP A;  1VQ8 3;  2O3O A;  2RII A;  3Q74 A;  1B2M A;  3P2A A;  3W6G A;  4J57 E;  4HM1 B;  1BNJ A;  3M9K A;  1CQS A;  3CXC 2;  4ECJ A;  4EV5 A;  2EC4 A;  4L5O A;  5D9W A;  1IYI A;  3QD9 A;  1RGC A;  3FF0 A;  3SED A;  1Z9H A;  1HNB A;  1Z7P A;  2X8H A;  4BL2 A;  1K3Y A;  2PN8 A;  1Q40 A;  2W04 A;  3BCK A;  3LTC A;  1PQN A;  4XIH A;  1ASK A;  1RRL A;  1EOG A;  2H0I A;  4OFM A;  1BAN A;  3HJP A;  4MF7 A;  1BNS A;  1W5Z A;  1XW6 A;  1WMN A;  2KAA A;  3PIN A;  3S29 A;  4KA0 A;  3US3 A;  5F0G A;  1B27 A;  4LL1 B;  1WMJ A;  1E97 A;  2A4H A;  2B7K A;  2H76 A;  4I8B A;  4IJ3 A;  1VQN 3;  3MYD A;  3F8U A;  4OO5 A;  3BOA A;  3EVI A;  1HD2 A;  4G0I A;  3UVH A;  3ZG5 A;  3M1G A;  1W01 A;  4WR4 A;  5KEJ A;  3GX8 A;  2HZE B;  1JZO A;  4PUF C;  2FHE A;  3BJ5 A;  2IL3 A;  5AIF A;  3VWX A;  5A4V A;  2TRC P;  4KCE A;  4XCS A;  3M8C A;  1KBN A;  1I0V A;  4V1A g;  2OWP A;  5M1A A;  3ZRE A;  2OA7 A;  5ECQ B;  3RHC A;  1W2Z A;  3KN4 A;  1K3O A;  4YAV A;  3CBU A;  5D83 A;  2E7P A;  1G6W A;  3GSP A;  3ZG0 A;  2GQM A;  1Q82 4;  1OF5 A;  5F07 A;  2IMJ A;  2LQV A;  3NBB A;  4WF5 A;  3UEM A;  4PGT A;  3L9U A;  2GSP A;  2XC2 A;  4J2F A;  3KD0 A;  1HZ1 A;  3TRX A;  1XCC A;  1PYL A;  2W2C A;  5AIG A;  3DGN A;  1K28 A;  4HU7 A;  2I9W A;  1VQ9 3;  1Z1S A;  2DIZ A;  4BL7 B;  4EIP A;  1RJO A;  4DVC A;  4WHA A;  1FA3 A;  3D5G A;  2DC5 A;  3EYT A;  1K3L A;  3LW9 A;  1XWC A;  4ULX A;  5KN3 A;  3FZ4 A;  4DSS B;  3G9B A;  1JV2 B;  5DQY A;  2Y74 A;  1WIK A;  2ON7 A;  1QUW A;  2YWO A;  4TN8 A;  1YJN 3;  1XVW A;  4OFN A;  5IIZ A;  1LOY A;  2VCQ A;  4GTU A;  2OQE A;  4L5L A;  5F8B A;  2EIO A;  5DBQ A;  2P5Q A;  2TRX A;  3EJV A;  4F82 A;  2OBI A;  4POM A;  5J5N A;  3UBL A;  3ZZX A;  1FGQ A;  3CCQ 3;  2VIM A;  4HM4 B;  5DAK A;  1OC8 A;  1FUT A;  2KLX A;  4BVY B;  5FW5 A;  1HU9 A;  1GNW A;  2B7J A;  5LD0 A;  3KH7 A;  1UI7 A;  1K0B A;  3ERW A;  1ML6 A;  4ILF A;  1BYE A;  1WE0 A;  3QRD A;  2NBS A;  4PNF A;  1M2D A;  4N10 A;  5J4U A;  1JNQ A;  3ZVJ D;  1K0M A;  1N2A A;  2F5W A;  1F2E A;  1XW5 A;  1KWI A;  2B1X B;  2CFD A;  3IAM 2;  4GL6 A;  4AKY A;  1FGT A;  3L9V A;  1PL2 A;  5D9X A;  1AQV A;  2JAD A;  1AIU A;  1YQ1 A;  4RI7 A;  5B6N A;  3LEF A;  3H93 A;  4K0G A;  2CFK A;  1TXX A;  3IE3 A;  5COH A;  4TR0 A;  1V98 A;  2E2V A;  4ZL7 A;  3TJB A;  1G6Y A;  5IMA A;  3N8B A;  4FYC A;  3MIX A;  1K0D A;  1OKT A;  2OE0 A;  2VLV A;  2J8X B;  2M80 A;  5HFG A;  3GUS A;  2P0M A;  1HQO A;  3ER7 A;  1LOX A;  1GRX A;  2YWI A;  2VL3 A;  5AYS C;  2R6K A;  3K7C A;  1IYH A;  1LJR A;  5IQY A;  4K6X A;  2H6Z A;  4HVN A;  2YFJ B;  4O2H A;  1U5O A;  1BOX A;  4BL3 A;  3DGQ A;  3F0I A;  3ZLP A;  1M9G A;  1SK1 A;  1LOV A;  4IP1 A;  2LV3 A;  5IMV A;  2L6D A;  1BRJ A;  1DYU A;  2JQ5 A;  2CVB A;  2LEG A;  5CRW A;  2CZ2 A;  2GS3 A;  3G7Y A;  5ELA A;  1VQP 3;  1MDJ A;  3LML A;  4OO4 A;  1TUH A;  4NHW A;  3U6V A;  3EC3 A;  1JN5 B;  2OCT A;  2A2S A;  1N5H A;  1W02 A;  1SKR B;  5IW9 A;  1TU8 A;  4HM6 B;  3UJM A;  1LBK A;  3FMW A;  2HMJ B;  1RSN A;  4BVX A;  2BU4 A;  1G7O A;  3CCS 3;  2C0D A;  2H1G A;  2INX A;  2CIU A;  5CP1 A;  3WD6 A;  3X3Z A;  3VSY A;  2K8V A;  2V1L A;  3SOY A;  1R7H A;  2BMX A;  4TR1 B;  2CW9 A;  1C54 A;  4X2O A;  1UCL A;  2W9Q A;  3F9S A;  4QWT A;  3GH9 A;  3ZMK A;  3FY7 A;  2FY6 A;  6GSW A;  3GA4 A;  3N9J A;  3Q18 A;  4U13 A;  1S3D A;  2WDU A;  2CVD A;  1QAK A;  4NMU A;  2J23 A;  2I4A A;  4PEJ A;  4L8O A;  1AY7 A;  1GUL A;  3HVX A;  1UW1 A;  1W6Y A;  2FWF A;  1IQX A;  2H1D A;  2NDO A;  1OHS A;  2LQQ A;  1PKW A;  1YY7 A;  3WMD A;  1O8W A;  1M1K 4;  3EF8 A;  2D2Z A;  4K9Z A;  1ZYE A;  1GUH A;  1PD2 1;  4KT3 B;  2R37 A;  1RTU A;  2HNL A;  3CYN A;  1YVS A;  1GD3 A;  2L5L A;  5RNT A;  3J7Y k;  1A24 A;  1T3B A;  4YQM A;  1O7H B;  4F2I A;  3FZ5 A;  4IP6 A;  2WOH A;  1RGE A;  1Q81 4;  1SJ6 A;  2XF3 A;  2J9H A;  5ECN B;  1T8E B;  4JED A;  3E99 A;  3BBY A;  3DYR A;  1MD4 A;  1TRV A;  5H5S A;  3FLJ A;  2GBW B;  3K8N A;  1ABA A;  2H1A A;  3NQZ A;  2H30 A;  2VD1 A;  2F4Y A;  1GUM A;  2BMO B;  1AQX A;  2QEX 3;  1A2M A;  2R4I A;  1Q7Y 4;  1AV4 A;  3I9V 2;  4FIW A;  4WKW A;  1KD1 4;  3MG2 A;  5IMC A;  4MZB A;  3WGE A;  4N0Z A;  2C1Y A;  3LWA A;  4X2H A;  2IUK A;  2WO0 A;  1QVG 2;  1IYY A;  4KUN A;  2MMN A;  3TOU A;  3UL3 A;  6GSV A;  3K9M C;  1PA3 A;  1B3S A;  5INY A;  1TK8 B;  1X1W A;  3D6I A;  2CKF B;  1HYU A;  1FUS A;  3A2V A;  1TKD B;  2HI7 A;  5ABR A;  1W6G A;  3GKX A;  4IEL A;  1GY7 A;  2RM6 A;  5CO3 A;  1BNI A;  1FHE A;  1STD A;  5CXO A;  11GS A;  1BRH A;  3D3L A;  5HFI A;  3RHB A;  3EN8 A;  3AGO A;  2YCD A;  1IU7 A;  3LTA A;  22GS A;  3TKP A;  3UNL A;  4ISD A;  1BRK A;  1RK4 A;  3EBY A;  3IBH A;  1GWC A;  3FSD A;  3GZY B;  3U97 A;  2UZ8 A;  4KGI A;  4PX1 A;  2I9H A;  4FMD A;  3JUP A;  3IA1 A;  3DVW A;  1O7W B;  4V2L A;  6GSS A;  2AAD A;  4FMB A;  3APQ A;  1SKW B;  4GXZ A;  2CA8 A;  2YFI B;  4RI6 A;  3WOE B;  1B8X A;  3WT2 A;  5LNK e;  2B5X A;  3G7I A;  5AGY A;  4FMC A;  1FG4 A;  2YPM A;  3GL3 A;  1RGA A;  2L4V A;  2DJK A;  2QSI A;  5AEW B;  1H4O A;  1ZX2 A;  3QCP A;  3A2W A;  2FGX A;  1VGL A;  2DJ3 A;  3LOR A;  4USS A;  4IHU A;  1W4V A;  3IAS 2;  5CF2 A;  2VCZ A;  3BB9 A;  1QAF A;  1YEX A;  3VWV A;  1ZO2 A;  2O8V B;  3H8Q A;  3KCH A;  3PS8 A;  2VL2 C;  4N6N B;  4EKZ A;  3Q19 A;  5HQP A;  2H0H A;  1EUI C;  1JZR A;  2VAF A;  3GRX A;  3KMN A;  3KTL A;  4PUA A;  8GSS A;  1RNT A;  4LMW A;  4KFD A;  3VFI A;  1XWK A;  1GMR A;  3OR5 A;  4Q5R A;  2BT3 A;  1TP9 A;  3DIE A;  3GV1 A;  1G96 A;  2FWG A;  1SL1 B;  1YJ6 A;  3GN3 A;  4YQV A;  2H0G A;  4O02 B;  20GS A;  4HZ9 B;  4HM0 B;  4G0L A;  4GRF A;  4K5S A;  4OCF A;  2Q07 A;  1IT8 A;  3OW2 2;  4LEH A;  4IGJ A;  17GS A;  4XTS A;  1TTZ A;  2DJJ A;  3P7X A;  4XS4 A;  2WGO A;  2CWU A;  2B3S A;  2REM A;  2CT6 A;  2PZV A;  2HE3 A;  1S3A A;  4Q5F A;  2FNO A;  3UB1 A;  5D82 A;  1LQG C;  2A2R A;  1UUW B;  1I8V A;  1GTA A;  1NHO A;  2EIQ A;  1UGH I;  1SD8 A;  3LXZ A;  1FAA A;  2OKA A;  1UVZ A;  1MGR A;  2PPT A;  3IXR A;  2Z77 A;  1PMT A;  3NUV A;  3KGK A;  1TP6 A;  4EL1 A;  3EPT A;  2X99 A;  4G10 A;  4CDL A;  3GZR A;  2F86 B;  1CH0 A;  3ERG A;  12GS A;  4ZL9 A;  3KXO A;  3UBK A;  5IO2 A;  1T4Y A;  3C71 A;  3CNX A;  2RM5 A;  3LTD A;  4Q5Q A;  4XDV A;  4CPK A;  2H74 A;  5STD A;  1OE7 A;  4EIQ A;  4DSR A;  4BPY A;  3X3X A;  3DGY A;  5E59 A;  4PNG A;  2YAN A;  3DEX A;  3MYT A;  1M9B A;  2YV9 A;  3AMO B;  4MPF A;  2V41 A;  4WWU C;  4N11 A;  1XZO A;  1ACV A;  3DD3 A;  2FNQ A;  1XIY A;  1Z6M A;  3HHV A;  4J5K A;  3N9H A;  5B7C A;  2P09 A;  2DLX A;  3G8Z A;  9GSS A;  1IV9 A;  2XH9 A;  3VPQ A;  1RN4 A;  3B4O A;  3PGB A;  1UA5 A;  4JZQ A;  4R1K A;  3EB8 A;  2C3N A;  3HJM A;  2BJX A;  2DMM A;  1WQL B;  1A2V A;  4IQA A;  3JCM L;  1YVB I;  3HY2 A;  5KP3 A;  2OE1 A;  2GT6 A;  2BNG A;  2E2T A;  4K0N A;  1PY3 A;  3WYW A;  1LNH A;  3P90 A;  3DVX A;  4HI7 A;  3G7J A;  2GQL A;  3IDV A;  4MF6 A;  3RBT A;  3N54 B;  2MMA A;  2OTL 3;  1XXU A;  4F0C A;  16GS A;  5AIX A;  4R9K A;  1URM A;  1W4N A;  3WR2 A;  1OC9 A;  1CEW I;  5HOH A;  3IV4 A;  2GTU A;  1FGO A;  1OYJ A;  3PPU A;  2IMD A;  1MEK A;  1HYF A;  1KQS 2;  3F7X A;  3GMF A;  5GZZ B;  4TX4 A;  4MK3 A;  1ZYQ B;  2HRA A;  2TIR A;  5B8B A;  1X0R A;  5FT3 A;  2L57 A;  3LYK A;  3NZN A;  1ROA A;  2B24 B;  1PSQ A;  1A23 A;  3FF2 A;  1TK5 B;  1THX A;  4YQU A;  1UCK A;  4IBP A;  5DQS A;  2R3X A;  3ISO A;  1OC3 A;  2O87 A;  4AEQ A;  4GWR A;  3C8E A;  4MH2 A;  4TXO B;  1DUG A;  2ZDJ A;  1LVN A;  1TRS A;  4MP4 A;  3LT9 A;  2XRX B;  2GSS A;  3QAG A;  2B1K A;  1M99 A;  3D5I A;  2G2Q A;  1S5A A;  2QA4 3;  4MAB A;  4LLR A;  3HXS A;  5HGR A;  9RNT A;  5I97 A;  5CLK A;  3RGR A;  7RNT A;  1GTI A;  3V99 A;  3D4A A;  2IFQ A;  3NBR A;  4XS4 B;  3DML A;  1BED A;  2DJ1 A;  1VZZ A;  4QQ7 A;  4LMI A;  1EKM A;  1K9M 4;  1XG8 A;  2O89 A;  5ELU A;  1N8R 4;  2CFL A;  3GUR A;  4ZXG A;  4NHF A;  1F6M C;  1LXE A;  4G1M B;  1SD9 A;  2L1S A;  3F63 A;  1AW9 A;  5ECM B;  4F03 A;  4BWS A;  5DCH A;  3LSZ A;  3TJJ A;  3MHE A;  1WMP A;  2F5M A;  1GSY A;  3A5E A;  5JWR B;  1XBS A;  1DE3 A;  1UUG B;  3FG1 A;  1YKC A;  3ZTL A;  2G0F A;  4N3V A;  1UGI A;  3OX9 A;  3HK4 A;  5G1K A;  1C7H A;  3KII A;  5F05 A;  3O76 A;  3GZB A;  5CNW A;  1MWU A;  5FWG A;  4BTX A;  1Z7R A;  1U3I A;  3X3Y A;  1TFK A;  3F3Q A;  1ZMA A;  3C1R A;  4XBT A;  4HM8 B;  2V32 A;  3B8L A;  3NM2 A;  4KFF A;  5ECK B;  5LC7 A;  1DET A;  1Y25 A;  1V57 A;  2CV4 A;  2KF3 A;  2QKE A;  5H5Q A;  3TRQ A;  1SAR A;  4WP5 A;  3FW2 A;  2H6Y A;  1FGR A;  4BVX B;  4IN0 A;  2VM2 A;  1QVF 2;  1DVC A;  4ZL8 A;  2MF7 A;  4FQU A;  3AY8 A;  1FB6 A;  4IS0 A;  3GSS A;  2SBL A;  4R9L A;  2XPE A;  5ECS A;  1N8J A;  3DKS A;  1I2F A;  2H66 A;  1Q42 A;  5A5K A;  3NOF A;  1GMQ A;  5HFK A;  4ORL A;  1BGS A;  5KP1 A;  2WZ9 A;  3GKK A;  3CC2 3;  5A4W A;  2LRT A;  3BLZ A;  1UI8 A;  1ISK A;  2HSY A;  2MBS A;  2JAC A;  5DDL A;  3VPT A;  5BMU A;  1JJ2 2;  3VI5 A;  1A90 A;  1RLS A;  3HVV A;  3KM6 A;  1BNE A;  3DMC A;  2I3Y A;  2IMF A;  1D6Z A;  1O81 A;  3FKA A;  1DVD A;  4Z2U A;  5CRE A;  4O92 A;  2RCD A;  4K90 B;  5EVO A;  1A0F A;  1V2A A;  1WNH A;  3VGN A;  3H3H A;  2LST A;  3DGL A;  1EP7 A;  1GL8 A;  7GSS A;  1I5G A;  3F40 A;  2C3Q A;  1PFO A;  2H01 A;  1PN0 A;  2DBC A;  3STD A;  1EP8 A;  2RLI A;  3BND A;  4LL4 B;  1T2H A;  2HSH A;  2IYJ A;  3UL5 A;  4MDC A;  1GYB A;  2CFW A;  3DZL A;  2K8S A;  1Y6E A;  1MDI A;  1STF I;  3RDE A;  3DGO A;  1AVK A;  3GZX B;  2XFT A;  3TUE A;  3GNJ A;  1FYS A;  2JZT A;  4FCM A;  2YX9 A;  2RGQ A;  1BUJ A;  3F6D A;  5IMF A;  4L8E A;  3KSE D;  1FOH A;  1M9A A;  1GTU A;  1M3I A;  2JZR A;  2K9F A;  2LJA A;  1ERW A;  1THO A;  4K2X A;  4KAE A;  5GST A;  3UAP A;  1S3C A;  2PU9 C;  4I97 A;  1X5D A;  2HFD A;  3MPH A;  1YF1 A;  1ROV A;  3GX0 A;  2P5R A;  3LFL A;  4HM5 B;  2IFQ B;  3G16 A;  1WTH A;  2F51 A;  3UOM A;  3GTU B;  3X41 A;  1KTE A;  2CX0 A;  4IPB A;  1B9Y C;  3NQY A;  4NRE A;  1B9X C;  10GS A;  2IWT A;  3JUN A;  2M7O A;  4ZBA A;  1DMN A;  4L0U A;  3S27 A;  3I0Y A;  2XBI A;  1GOU A;  1W6C A;  1MOL A;  1TJD A;  3GHA A;  3D21 A;  2KF5 A;  1KEB A;  3GFK A;  1IQY A;  2MZC A;  1T00 A;  2KF4 A;  3ME7 A;  1WRY A;  3MSO A;  1SL2 B;  5EPF A;  4JRR A;  4N6L A;  3KZT A;  4J8T A;  2LJK A;  1R5A A;  1W00 A;  2QA1 A;  4KB3 A;  1PU4 A;  5IG5 A;  3PGT A;  1GOV A;  2ES7 A;  4N6V 0;  1EEJ A;  2Z9S A;  3HYP A;  1QGV A;  5ELG A;  3OWS A;  3A2X A;  3TKS E;  2KCD A;  1YHQ 3;  5TGN A;  2GZP A;  3NBJ A;  2HRF A;  2M72 A;  3KP8 A;  5IEP A;  1JRQ A;  3ED3 A;  1IDP A;  3DH2 A;  3DWV A;  4BU4 A;  2STD A;  5JCU A;  4H3U A;  2GST A;  2PBJ A;  4MMM A;  5IEO A;  2BO9 B;  4POB A;  4DSQ A;  18GS A;  2W56 A;  1BIR A;  3EE1 A;  1F3A A;  1YGE A;  2DJ0 A;  3SX1 A;  2WJU A;  1X1X A;  4TKY A;  4EDZ A;  3CSI A;  4BL7 A;  1BVI A;  4KDY A;  5ECH B;  2EIR A;  3D9R A;  4FCZ A;  3CPW 2;  4KH7 A;  3TRP A;  1I3F A;  5IMD A;  2VL9 A;  2E2G A;  2B1L A;  3MSZ A;  4HUA A;  1OUN A;  1B20 A;  3S28 A;  1QXH A;  1SEN A;  2LRN A;  3TDG A;  1BRN L;  1GSP A;  3D79 A;  3D4T A;  3HZ4 A;  1E3R A;  4NXI A;  4RNY A;  4EW5 A;  1K8A 4;  1DMQ A;  5HR3 A;  4JE1 A;  1QMA A;  2YZH A;  3HZ8 A;  2CG0 A;  1E2Y A;  1GS3 A;  4K1V A;  1S72 3;  3F8H A;  3HII A;  1GSS A;  5CRG A;  3KMO A;  3KP9 A;  4TR3 A;  3UJ1 A;  4XS6 A;  2H1B A;  5AEU B;  4HAA A;  4RUV A;  1TU5 A;  4NWY A;  3JUO A;  1SJI A;  2Z7A A;  2CK3 H;  5CYY A;  1TI1 A;  5IG4 A;  1CYV A;  3FR6 A;  2YJ7 A;  2R0C A;  1RRH A;  4POK A;  2GU1 A;  3F4T A;  1BU4 A;  4N0V A;  2GZY A;  1CYU A;  4XDW A;  2R2J A;  1G7E A;  1X9M B;  1EG9 B;  1RGH A;  1KNG A;  3ZML A;  1IK3 A;  4O7H A;  1I3I A;  2KF6 A;  4GSP A;  3E3E A;  3TKS C;  2A15 A;  4ID0 A;  1SII A;  1Q86 4;  3SBC A;  1IVX A;  4XRD A;  2HSM A;  1NB3 I;  4KSM A;  4TXO A;  3I43 A;  2XEP A;  3DUK A;  3K63 A;  4Z2T A;  1O85 A;  2VO4 A;  2KHP A;  2YN1 A;  4NAX A;  2D42 A;  4G9H A;  3KCM A;  2KP2 A;  2ALB A;  4HEA 2;  4DEJ A;  3CC4 3;  5H5R A;  2C80 A;  2X49 A;  3MDK A;  3ZFL A;  1FW7 A;  3PYJ A;  1FVJ A;  2CWV A;  5D9V A;  4AF2 A;  5DCG A;  1M0U A;  3V92 A;  2A4V A;  5J3R A;  4Z2R A;  5GAP D;  1YI2 3;  1QK8 A;  1JZD A;  3JVC A;  2WCI A;  4MMX B;  2Z6B A;  1BAY A;  4AJ8 A;  3HIG A;  2I1U A;  5BXQ A;  3IOS A;  2JSY A;  3VK9 A;  4BIK A;  4LMV A;  1FOV A;  1ZOF A;  4XBX A;  3I6A A;  4HDE A;  2W03 A;  3MWH A;  2BHM A;  3HCZ A;  3TJG A;  2K0M A;  5JCG A;  1YIJ 3;  1N9J A;  3NV0 A;  1NWW A;  2C8U A;  5IO0 A;  3Q6O A;  2YWM A;  1EZK A;  3A3T A;  3IC4 A;  5DAL A;  1AVL A;  1JB5 A;  1E3V A;  3M8N A;  2P0X A;  3HOH A;  2PWJ A;  4MMY B;  5IM9 A;  3T8U A;  5JWQ B;  2VOC A;  4HS1 A;  3IMA B;  5AII A;  7GSP A;  1PX6 A;  1YDK A;  2XSO B;  2PNC A;  1FVK A;  1JKG A;  2W56 B;  1IVV A;  1C72 A;  3WGX A;  3CME 3;  2P38 A;  1OGX A;  1UC7 A;  3FH1 A;  4BTY A;  5IOX A;  1DE2 A;  1T4Z A;  4H86 A;  1V74 A;  3F3R A;  1RNB A;  2HMM B;  3B4P A;  2DJ2 A;  1ERT A;  5DAL B;  1Q4J A;  2FA8 A;  4EE0 A;  4DKI A;  1SIH A;  2FWE A;  1XW9 A;  1LOW A;  1N5P A;  3DRN A;  1J2B A;  4E8E A;  2UUG C;  2AYT A;  3TCO A;  5KN1 A;  2KXG A;  2NTO A;  6GST A;  1DE1 A;  1WMO A;  2FD3 A;  1YIT 3;  2GQK A;  1VQ4 3;  3TJF A;  3WGD A;  3DXO A;  3RPN A;  4ECI A;  2LUS A;  4STD A;  2F99 A;  3TB2 A;  3KH9 A;  2RSX A;  2PGT A;  3CMI A;  4QL9 A;  1I0X A;  2CC3 A;  1Y4K A;  4IJI A;  3MG1 A;  1R4W A;  2D1W A;  3F6F A;  3GKN A;  3FR3 A;  3CNM A;  4I2U A;  1QMV A;  1JB4 A;  1KSI A;  1DBY A;  3ME8 A;  4YH2 A;  2KP1 A;  4TXV A;  1O7N B;  4LGQ A;  2V1M A;  2VLT A;  2W9P A;  4FO5 A;  2ZL8 A;  3R3E A;  3TGZ A;  3EQQ B;  5B8A A;  6GSU A;  3KSP A;  4Q53 A;  1WP0 A;  3LXU X;  3MKI A;  2E0Q A;  3TJK A;  2O9U X;  4BVY A;  3CU3 A;  4MH3 A;  3BNE A;  4J56 E;  1LNI A;  3N5O A;  2WS2 A;  4EUY A;  4ICY A;  2H72 A;  4LSO A;  4MZC A;  1BRG A;  6GSY A;  1X1Y A;  4ZB8 A;  3J7Y d;  2MMO A;  3W8S A;  3W8J A;  1PGT A;  1ULJ B;  3FRC A;  4ACS A;  1YKA A;  2FUG 2;  2PVQ A;  4GCI A;  5KP4 A;  1JB2 A;  2H19 A;  1YNV X;  1IT7 A;  3ZL5 A;  1FO5 A;  3NXJ A;  3D4M A;  1A2L A;  4WFO A;  3AGN A;  3MNG A;  3CXG A;  1NSW A;  2MYG A;  3LJR A;  4MNN A;  5F06 A;  1Z6N A;  2VCV A;  2CHC A;  3GKM A;  4GLT A;  2GLR A;  3ZIJ A;  2X64 A;  5CRH A;  4NV5 A;  3RNT A;  1VRS D;  3GTU A;  1CQG A;  4TVE A;  1I9D A;  1B2S A;  2AB6 A;  5AI1 A;  4PQI A;  3D0Z A;  2GT5 A;  3VWU A;  3H79 A;  2DSA A;  1BAO A;  3F8X A;  4I2T A;  3ECF A;  3U1W A;  2WRT A;  1ULI B;  1F9M A;  3PR8 A;  3RDW A;  4GSN A;  2R0G A;  2YV7 A;  1T1V A;  2HML B;  4GHO A;  1GLP A;  3I56 3;  1FUW A;  1EOH A;  4LYL B;  4F9Z A;  2XFS A;  1L5G B;  1J08 A;  1B4P A;  1JZW A;  4O5U A;  1G02 A;  1YF0 A;  2PER A;  2HRK A;  2CVK A;  4ML6 A;  4XM4 A;  3PCR A;  3FYG A;  3GWR A;  2CX4 A;  2HMN B;  3BU4 A;  2ML5 A;  3HX8 A;  3NX0 A;  4NPB A;  1RCK A;  2R4V A;  3WT1 A;  1GLQ A;  1SYX A;  1USB A;  4O32 A;  1TRP A;  1MWT A;  1WJK A;  2CAI A;  5AIV A;  2GXF A;  1NO3 A;  2RUE A;  5IOW A;  2H71 A;  2V6K A;  3F7S A;  4FR9 A;  4I6X A;  4MPG A;  2DKH A;  4K5R A;  1TRU A;  3E0U A;  1TW9 A;  5CAX A;  1ZZY A;  4EC0 A;  4V2M A;  4CHS A;  4F0B A;  5IPG A;  3KEB A;  4NV2 A;  5CK6 A;  1B48 A;  4YAP A;  5JPP A;  2OJL A;  1U6T A;  5IMZ A;  1OKD A;  4LA1 A;  1ZYP A;  3S9F A;  1XWB A;  2GU3 A;  1IVU A;  5IF6 A;  4MJD A;  3IPZ A;  3RPP A;  3FZW A;  4ECB A;  2P05 A;  5J41 A;  5G31 A;  1OAC A;  1A8L A;  3SYU A;  5C04 A;  3L4N A;  2NVL A;  2YNX A;  2C11 A;  4MEI A;  3T0U A;  5ENU A;  1CQH A;  1R4Y A;  4MZW A;  1R4C A;  3OV4 A;  3P8W A;  5BRT A;  3DY5 A;  2CX3 A;  3M0F A;  4WYK A;  4EVM A;  2QGV A;  2VL2 A;  4L8P A;  1BSA A;  3SWL A;  2LNS A;  3CCM 3;  3GAX A;  4K7I A;  1R5P A;  1G0T A;  1FZU A;  1GMP A;  3APS A;  2H70 A;  1SQW A;  3G71 3;  5BU4 A;  2OAD A;  4G2E A;  3A5I A;  1O7G B;  1OHO A;  3ERF A;  4KF9 A;  1XOA A;  2VCT A;  2W0Q A;  3A76 A;  4RZM A;  1EV4 A;  3A5W A;  1A8Y A;  4L0W A;  1OHP A;  3QDN A;  2C4B A;  4WYK B;  2JL4 A;  5J9B A;  1MWS A;  4NHZ A;  3IK7 A;  1JBS A;  3IK9 A;  4TOP A;  3CCL 3;  1YJW 3;  1EGO A;  2L6C A;  4FYB A;  3G4S 3;  2X8G A;  3O6T A;  3K0Z A;  1GSE A;  1M3J A;  5JWO B;  3J7Y b;  4Q5N A;  5AYR B;  4MMZ B;  5HR0 A;  3IJE B;  1JBR A;  3HVN A;  1HNA A;  2LQO A;  2C10 A;  1U3A A;  4IKH A;  4X4J A;  2RUF A;  1TIJ A;  3S5C A;  2FA4 A;  2X4A A;  3ZIT A;  2LNT A;  1BRS A;  4CY6 A;  2Y73 A;  13GS A;  3CTG A;  4YKF A;  3F9U A;  2H75 A;  2IMI A;  1VF3 A;  2HMO B;  4MA9 A;  5ID2 B;  1UN2 A;  1Z3E A;  1TU7 A;  4BWQ A;  1WWJ A;  3R2Q A;  19GS A;  3GIX A;  4AGS A;  5BVB A;  3X40 A;  4BA7 A;  1GSF A;  5A0O B;  2OQE C;  2GBX B;  2XBQ A;  3G6E 3;  5CRD A;  1ZL9 A;  3KZQ A;  4EXR A;  1DMM A;  1XVQ A;  4X1U A;  4KE3 A;  4J9A A;  3CC7 3;  4ZM8 A;  1TRQ A;  2KRT A;  4RBN A;  1QQ2 A;  1X9S B;  1D6U A;  2NPB A;  4AJ7 A;  1DSB A;  1SK2 A;  2QA2 A;  2FLS A;  4ZBB A;  2PUK C;  4PQ1 A;  8RNT A;  5D8I A;  3WDG B;  2RBI A;  5D81 A;  5FGO A;  3CCR 3;  2CAQ A;  4LZI A;  4HJ2 A;  5JPU A;  4ZIL A;  3O3T A;  5EY6 A;  1RQM A;  3E9J B;  5ECP B;  4FCJ A;  3VWW A;  1KC8 4;  3MG3 A;  6GSX A;  1W89 A;  1UCJ A;  4KVH A;  3VLN A;  4DSS A;  4EXJ A;  1GY5 A;  5EQL A;  1VF1 A;  4JR6 A;  3SLU A;  1M2A A;  3FCS B;  4JRF A;  2ON5 A;  5FHI A;  5BIR A;  4KFE A;  2GZZ A;  1Q9E A;  1I2E A;  1B2U A;  5EL8 A;  1A2J A;  5LCZ A;  3UL6 A;  5DAK B;  1IV7 A;  1NDO B;  2HOH A;  2C4J A;  3C73 A;  1BSE A;  1IVW A;  4KDX A;  4HYZ A;  4N6U A;  1UUV B;  2KUC A;  1PX7 A;  2IN3 A;  1VQL 3;  3KTB A;  3EHC A;  4HM7 B;  2LS5 A;  1VQ6 3;  2K18 A;  4TW5 A;  2HZF A;  3LQ7 A;  4FH8 A;  4WBR D;  3ROB A;  1B2Z A;  4MF5 A;  1EQK A;  4PUR A;  1NJI 4;  2P0G A;  5A4U A;  4HOJ A;  1YJ9 3;  4IW9 A;  4CJN A;  1I2G A;  1GSU A;  4OMV A;  3VUR A;  2F8A A;  2CQ9 A;  3TKR A;  1E6B A;  2VLU A;  3CCU 3;  3GYK A;  3KIJ A;  1B4Q A;  3CCJ 3;  1T7P B;  1AQZ A;  4XBY A;  1A0R P;  5GSS A;  3CPO A;  3HZP A;  4ZB6 A;  2V2G A;  3I55 3;  3FGY A;  4WET A;  5GSP A;  4G19 A;  3HVS A;  2WB9 A;  4MJE A;  2YWN A;  2F56 A;  3IC8 A;  5J9C A;  1Q7H A;  4K2D A;  3PH9 A;  4P3Y B;  2BTO T;  1M90 4;  2Z76 A;  2N5A A;  2AV4 A;  5HR1 A;  3APO A;  2YFL B;  2UX0 A;  6STD A;  2B5Y A;  2IME A;  4K61 A;  1GTB A;  2HLS A;  5DJL A;  2VD0 A;  1BRI A;  1BNR A;  1TTO A;  3CD6 3;  4K8M A;  2N5F A;  4EDY A;  2HMK B;  4RNT A;  1XOB A;  2VUP A;  4V1A p;  2LJR A;  4ZBD A;  3Q1C A;  1AXD A;  4EO3 A;  1TI3 A;  3L0R A;  5G5F A;  4EV2 A;  2AAW A;  2JU5 A;  1ZCP A;  4KSO A;  2WOF A;  1VF2 A;  2RNT A;  2L4C A;  3LTB A;  3CRT A;  3EIN A;  1OVN A;  4HQS A;  1JN5 A;  2YP6 A;  1XPV A;  3I69 A;  2QGU A;  4GQF A;  1PKZ A;  3EMX A;  1RGF A;  4X43 A;  4R80 A;  2OOV C;  4XS1 A;  1ILO A;  1YEP A;  4O5Q A;  5GAN D;  3RAZ A;  1GOY A;  3U5R E;  3K5T A;  3QPM A;  3FKF A;  3Q90 A;  3TOT A;  3F14 A;  3QOU A;  1N9E A;  3O8Y A;  5D93 A;  1RKY A;  4TR1 A;  3Q2P A;  3LYP A;  1PL1 A;  3ZVJ A;  2C0F A;  4BTW A;  3DXB A;  1US1 A;  5IER A;  1NB5 I;  2ZCT A;  5DVB A;  3SOA A;  2FCH A;  1VQM 3;  2X8C A;  4POL A;  2WFC A;  5G2Z A;  1W2B 2;  4PXO A;  1NHY A;  3WOD G;  2R5G A;  1EGR A;  3NHX A;  5C00 A;  3LH4 A;  1SKS B;  1BSC A;  1QAL A;  2B6M A;  2WGQ A;  5DRV A;  4HZB B;  3FZ9 A;  4G0K A;  1BNG A;  3EU3 A;  2IMK A;  4GQC A;  2PMT A;  4HZ4 A;  4XRA A;  2F98 A;  1BJX A;  3LGC A;  4XHM A;  4OK0 A;  2HRN A;  1A2P A;  5AIS A;  3EE2 A;  3FEU A;  2O85 A;  5DJM A;  4CDO A;  3LOY A;  3QMX A;  2F8F A;  3QFA C;  2WGR A;  2F3M A;  1SL0 B;  3QR6 A;  3T8N A;  3SVA A;  4HU9 A;  2K54 A;  5ECR B;  3CRU A;  2BMR B;  2L4Q A;  2FGT A;  3L0H A;  3AHS A;  3URP A;  3GST A;  5ECI B;  3WOF B;  3VI7 A;  2L5O A;  1U8C B;  4HOH A;  1K73 4;  3AMO A;  4X0X A;  3H4K A;  4OUQ A;  1U88 A;  1O7M B;  1OCV A;  1N8Q A;  1ERV A;  1XWG A;  3CQF A;  14GS A;  3BIR A;  3CCV 3;  2AJQ B;  2LKU A;  3S67 A;  3NIV A;  3HKR A;  1JBT A;  3PXM A;  3AHW A;  3D22 A;  4HM3 B;  1M7T A;  3EUR A;  2K3D A;  3WA3 A;  2F9S A;  3M3M A;  1XFL A;  3F4S A;  3L9S A;  4I4K A;  4KCA A;  2RFR A;  1QJG A;  4HM2 B;  1OF5 B;  1OGZ A;  1TK0 B;  2IJY A;  4Z7X A;  3JUQ A;  1A2K A;  2DML A;  3FR9 A;  1X1U A;  4KZ1 A;  2PVO C;  1LRA A;  3EC9 A;  2YOI A;  2XR8 B;  1JLV A;  5IEN A;  1F37 A;  5G1L A;  6RNT A;  1VQQ A;  3OWY A;  2UGI A;  3TKQ A;  3FHK A;  1ZGX A;  4TR4 A;  1FW1 A;  2I81 A;  4HBR A;  3EN1 B;  1PN9 A;  3GH6 A;  3ZFZ A;  1EWX A;  4ECC A;  1O7U A;  1NW2 A;  2DIY A;  3WHO A;  4HJM A;  2CH9 A;  1MNL A;  4RNZ A;  2YZU A;  5CF1 A;  1GUK A;  5ECL B;  5ID2 A;  1AR0 A;  4YKG A;  2O7K A;  2LYX A;  4HQZ A;  1UDI I;  1IQ8 A;  5AN1 A;  3LT8 A;  3ZYW A;  2R0P A;  1V9W A;  2IUJ A;  2OBK A;  4OVM A;  3F4R A;  2AAE A;  5IG0 A;  1PRX A;  2R41 A;  3BNB A;  4HZ2 A;  3FK8 A;  3IRA A;  4ZIJ A;  1OE8 A;  4WXT A;  2JDI H;  1OAZ A;  5G5E A;  5IPH A;  5JBS A;  1GY6 A;  1BQ7 A;  1SPU A;  2H73 A;  4CW9 A;  2VM1 A;  4FMA A;  1Z5Y E;  3CMA 3;  2XHF A;  5D96 A;  3EBT A;  2M46 A;  3MWZ A;  4K1U A;  1JHB A;  2OOV A;  2AUV A;  2P31 A;  3B7C A;  2SAR A;  5LC6 A;  1BUQ A;  1X5E A;  3QFB C;  2QIY A;  1B2X A;  4KW6 A;  4EYC A;  3Q3F A;  5M18 A;  3FZA A;  2GEY A;  4JF8 A;  2ZNM A;  2HYX A;  3C1S A;  3UVT A;  3QK9 A;  2LRC A;  1RDS A;  3DM8 A;  1F3B A;  4JR4 A;  2CFG A;  2HZE A;  4HKV B;  4K7N A;  4WR5 A;  1WOU A;  1GD4 A;  4CY8 A;  1MD3 A;  4JBB A;  3CSJ A;  1K0N A;  3D5J A;  4OD7 A;  2JZS A;  3HI7 A;  1GSQ A;  4WEY A;  3LYG A;  2L59 A;  3C7M A;  3NV0 B;  4OCE A;  2QC7 A;  5M19 A;  2ZUP A;  4FYU A;  4GST A;  2C0G A;  1SK0 A;  4WBJ A;  3TKS A;  1S3R A;  5D73 A;  1YZX A;  2C3T A;  1OH0 A;  5E4W A;  3H1N A;  4K1F A;  1NM3 A;  3L78 A;  4R4K A;  1V40 A;  3WA2 X;  1NU3 A;  3OWU A;  8CHO A;  5HR2 A;  1K0A A;  3FG3 A;  4WF4 A;  3PZW A;  1RMS A;  1UCI A;  3G0K A;  7STD A;  4MLY A;  5B6M A;  2FXT A;  3IR4 A;  3DGM A;  4PQH A;  2W6J H;  1F8N A;  3BNC A;  1ERU A;  4L7K A;  3H51 A;  1BSB A;  4IIA A;  1B21 A;  4N30 A;  3UAR A;  2IY2 A;  3IPT A;  4K7O A;  4JU5 A;  2CZ3 A;  1TRW A;  3IHG A;  3CSH A;  3MAK A;  2MC8 A;  1BG5 A;  4CCV A;  3GL5 A;  4RQX A;  2ZHX B;  3HD5 A;  1RW1 A;  1SJZ A;  4KX4 A;  3ZFB A;  4IVF A;  2CX1 A;  4H61 A;  1LU4 A;  1M1X B;  1FB0 A;  1Q98 A;  3VF1 A;  1AC1 A;  1BSD A;  1GP1 A;  5EEO A;  2ML6 A;  6GSP A;  3ALA A;  3QAW A;  3LG6 A;  5AIH A;  1OC9 B;  3X42 A;  4EF0 A;  3LZA A;  3KFQ C;  3BD2 A;  3EU4 A;  1JFU A;  5ECO B;  3ZRD A;  4OFT A;  1GSD A;  2XGN A;  5DRE A;  1YGW A;  1GNE A;  1RCL A;  1O7P B;  4I5Q A;  1VQ7 3;  2MMZ A;  4O5R A;  2OE3 A;  1BNF A;  1VF4 A;  2K6V A;  5KN0 A;  2HT9 A;  1RN1 A;  2JSZ A;  2OTJ 3;  1MGW A;  4AJ6 A;  1ST9 A;  4AKZ A;  1HNC A;  4IT7 A;  1A67 A;  1RGL A;  4XB5 A;  1VQO 3;  1HKX A;  4GB5 A;  4O3V A;  1O73 A;  2AHE A;  5IG3 A;  1QFN A;  3NM7 A;  4MJB A;  1ZYN A;  3GRD A;  1I70 A;  5L71 A;  2LTK A;  5EVH A;  1X5C A;  3SXX A;  4EC6 A;  1EV9 A;  2E2M A;  3LXT A;  1RGG A;  4MJC A;  1VQ5 3;  1MTC A;  1V58 A;  1ZS7 A;  1M2B A;  2GSR A;  4KDU A;  4ZB9 A;  5ELJ A;  4HSC X;  4O8S A;  1FGM A;  3RGA A;  3HA9 A;  3QAV A;  3KKG A;  1AQW A;  2BIR A;  3EX9 A;  3CTF A;  2XGL A;  5JCW A;  1PFP A;  2IPA A;  2A2P A;  1K41 A;  4OWY A;  3KE7 A;  4GSS A;  1T2I A;  4MJA A;  1J0F A;  4TRX A;  2ZA4 A;  4E8H A;  1J9B A;  4EBG A;  2HXK A;  1OPY A;  1W7C A;  3V98 A;  1O8X A;  2YJH A;  1T5Y A;  3KJY A;  1H75 A;  3ZIV A;  1ZGN A;  1AAZ A;  1U87 A;  2XPD A;  1R26 A;  2H6X A;  2GVP A;  1AUC A;  2N5B A;  2V6O A;  1RGK A;  2IA7 A;  1VQK 3;  1GH2 A;  3PCS A;  3JUM A;  1NNV A;  5G30 A;  1EA2 A;  2GGT A;  3OXA A;  5KN2 A;  2C0E A;  1RHL A;  1MWR A;  2WUL A;  2DKI A;  4IQ1 A;  4N6O B;  1ON4 A;  1TDI A;  2CG1 A;  1SU9 A;  2XSH B;  2FWH A;  1SJW A;  1TOF A;  3EWL A;  4D73 A;  2B5E A;  5G2G A;  1WPI A;  4ML1 A;  2E2U A;  3HDC A;  2VCX A;  3FG4 A;  1TFO A;  1JKG B;  2GSQ A;  3UMA A;  3M9J A;  4KND A;  4HJL B;  4PTS A;  4QL7 A;  1O6J A;  5KOW A;  1RN7 A;  3UIW A;  2IIY A;  2H8L A;  4RQR A;  2GDR A;  1LQM B;  1MDK A;  4BIR A;  1K0O A;  3CCE 3;  4D73 B;  1BX9 A;  4GF0 A;  5D9T A;  1XWA A;  3HJO A;  2GEX A;  4MCU A;  1SYR A;  5KOX A;  1EEM A;  3V1W A;  1X9W B;  1D6Y A;  2CWT A;  2KOK A;  4N6M A;  4J5G A;  3IHQ A;  4A5P A;  2VCW A;  3BCI A;  2OAC A; 
#chains in the Genus database with same CATH homology
 2MBT A;  1JLW A;  4V2N A;  1K0C A;  3EMP A;  2RII A;  3Q74 A;  3P2A A;  3W6G A;  4J57 E;  3M9K A;  4ECJ A;  2EC4 A;  4L5O A;  5D9W A;  1IYI A;  3QD9 A;  1Z9H A;  1HNB A;  1Z7P A;  2X8H A;  1K3Y A;  2PN8 A;  3BCK A;  1PQN A;  4XIH A;  1EOG A;  2H0I A;  4OFM A;  3HJP A;  4MF7 A;  1XW6 A;  3PIN A;  4KA0 A;  3US3 A;  5F0G A;  4LL1 B;  1WMJ A;  2A4H A;  2B7K A;  4IJ3 A;  2H76 A;  4OO5 A;  4I8B A;  3MYD A;  3F8U A;  3BOA A;  3EVI A;  1HD2 A;  4G0I A;  3UVH A;  3M1G A;  4WR4 A;  5KEJ A;  3GX8 A;  2HZE B;  1JZO A;  4PUF C;  2FHE A;  3BJ5 A;  2IL3 A;  3VWX A;  5A4V A;  2TRC P;  4KCE A;  4XCS A;  1KBN A;  4V1A g;  3ZRE A;  2OA7 A;  5ECQ B;  3RHC A;  1K3O A;  4YAV A;  3CBU A;  2E7P A;  1G6W A;  2GQM A;  5F07 A;  4WF5 A;  3UEM A;  4PGT A;  3L9U A;  4J2F A;  2XC2 A;  3KD0 A;  3TRX A;  1XCC A;  4HU7 A;  2DIZ A;  4BL7 B;  4EIP A;  4DVC A;  3EYT A;  2DC5 A;  1K3L A;  3LW9 A;  1XWC A;  4ULX A;  5KN3 A;  3FZ4 A;  4DSS B;  3G9B A;  5DQY A;  1WIK A;  2ON7 A;  1QUW A;  2YWO A;  4TN8 A;  1XVW A;  4OFN A;  5IIZ A;  2VCQ A;  4GTU A;  4L5L A;  5F8B A;  2EIO A;  5DBQ A;  2P5Q A;  2TRX A;  4F82 A;  2OBI A;  4POM A;  5J5N A;  3UBL A;  3ZZX A;  2VIM A;  5DAK A;  1OC8 A;  2KLX A;  4BVY B;  1GNW A;  2B7J A;  5LD0 A;  3KH7 A;  1K0B A;  3ERW A;  1ML6 A;  4ILF A;  1BYE A;  1WE0 A;  2NBS A;  4PNF A;  1M2D A;  4N10 A;  5J4U A;  3ZVJ D;  1K0M A;  1N2A A;  1F2E A;  1XW5 A;  3IAM 2;  3L9V A;  1PL2 A;  5D9X A;  1AQV A;  2JAD A;  1AIU A;  1YQ1 A;  4RI7 A;  5B6N A;  3LEF A;  3H93 A;  4K0G A;  1TXX A;  3IE3 A;  5COH A;  4TR0 A;  1V98 A;  4ZL7 A;  3TJB A;  1G6Y A;  5IMA A;  4FYC A;  3MIX A;  1K0D A;  1OKT A;  2OE0 A;  2VLV A;  2M80 A;  5HFG A;  3GUS A;  1HQO A;  1GRX A;  2YWI A;  2VL3 A;  2R6K A;  1IYH A;  1LJR A;  5IQY A;  4K6X A;  2H6Z A;  3DGQ A;  3F0I A;  3ZLP A;  1SK1 A;  4IP1 A;  2LV3 A;  5IMV A;  2L6D A;  2CVB A;  5CRW A;  2LEG A;  2CZ2 A;  2GS3 A;  3G7Y A;  5ELA A;  1MDJ A;  4OO4 A;  3U6V A;  4NHW A;  3EC3 A;  2A2S A;  1SKR B;  1TU8 A;  1LBK A;  3FMW A;  4BVX A;  1G7O A;  2C0D A;  2H1G A;  5CP1 A;  3WD6 A;  2K8V A;  1R7H A;  2BMX A;  4TR1 B;  3GH9 A;  3ZMK A;  3FY7 A;  2FY6 A;  6GSW A;  3GA4 A;  3N9J A;  3Q18 A;  1S3D A;  2WDU A;  2CVD A;  4NMU A;  2J23 A;  2I4A A;  1GUL A;  3HVX A;  2FWF A;  2H1D A;  2NDO A;  2LQQ A;  1PKW A;  1YY7 A;  1O8W A;  2D2Z A;  4K9Z A;  1ZYE A;  1GUH A;  1PD2 1;  2R37 A;  2HNL A;  3CYN A;  2L5L A;  3J7Y k;  1A24 A;  1T3B A;  4YQM A;  4F2I A;  3FZ5 A;  4IP6 A;  1SJ6 A;  2J9H A;  5ECN B;  1T8E B;  4JED A;  3BBY A;  3DYR A;  1MD4 A;  1TRV A;  5H5S A;  3K8N A;  1ABA A;  2H1A A;  2H30 A;  2VD1 A;  1GUM A;  1AQX A;  1A2M A;  3I9V 2;  4FIW A;  4WKW A;  5IMC A;  4MZB A;  3WGE A;  4N0Z A;  2C1Y A;  3LWA A;  4KUN A;  2MMN A;  3TOU A;  3UL3 A;  6GSV A;  1PA3 A;  5INY A;  1TK8 B;  3D6I A;  1HYU A;  1TKD B;  3A2V A;  2HI7 A;  5ABR A;  3GKX A;  4IEL A;  2RM6 A;  5CO3 A;  1FHE A;  11GS A;  5HFI A;  3RHB A;  2YCD A;  22GS A;  3TKP A;  4ISD A;  1RK4 A;  3IBH A;  1GWC A;  2UZ8 A;  4KGI A;  4PX1 A;  2I9H A;  3IA1 A;  3DVW A;  4V2L A;  6GSS A;  1SKW B;  3APQ A;  4GXZ A;  2CA8 A;  4RI6 A;  1B8X A;  3WT2 A;  5LNK e;  2B5X A;  3G7I A;  5AGY A;  1FG4 A;  2YPM A;  3GL3 A;  2DJK A;  2QSI A;  1H4O A;  3QCP A;  3A2W A;  2FGX A;  1VGL A;  2DJ3 A;  3LOR A;  4USS A;  4IHU A;  1W4V A;  3IAS 2;  2VCZ A;  1YEX A;  3VWV A;  2O8V B;  3H8Q A;  2VL2 C;  4EKZ A;  3Q19 A;  5HQP A;  2H0H A;  1JZR A;  2VAF A;  3GRX A;  3KMN A;  3KTL A;  4PUA A;  8GSS A;  4LMW A;  3VFI A;  1XWK A;  3OR5 A;  4Q5R A;  1TP9 A;  3DIE A;  3GV1 A;  2FWG A;  1SL1 B;  1YJ6 A;  3GN3 A;  4YQV A;  2H0G A;  20GS A;  4G0L A;  4K5S A;  4GRF A;  4OCF A;  4IGJ A;  17GS A;  4XTS A;  1TTZ A;  2DJJ A;  3P7X A;  4XS4 A;  2B3S A;  2REM A;  2CT6 A;  2HE3 A;  1S3A A;  4Q5F A;  2FNO A;  2A2R A;  1NHO A;  1GTA A;  2EIQ A;  1SD8 A;  3LXZ A;  1FAA A;  2OKA A;  1UVZ A;  2PPT A;  3IXR A;  1PMT A;  3KGK A;  4EL1 A;  3EPT A;  2X99 A;  4G10 A;  3ERG A;  12GS A;  4ZL9 A;  3KXO A;  3UBK A;  5IO2 A;  1T4Y A;  3C71 A;  2RM5 A;  4Q5Q A;  2H74 A;  1OE7 A;  4EIQ A;  4DSR A;  4BPY A;  5E59 A;  4PNG A;  2YAN A;  3DEX A;  1M9B A;  2YV9 A;  4MPF A;  2V41 A;  4N11 A;  1XZO A;  1ACV A;  3DD3 A;  1XIY A;  1Z6M A;  3HHV A;  5B7C A;  2DLX A;  9GSS A;  3VPQ A;  1UA5 A;  4JZQ A;  2C3N A;  3HJM A;  2BJX A;  2DMM A;  4IQA A;  3JCM L;  3HY2 A;  2OE1 A;  2GT6 A;  4K0N A;  3WYW A;  3P90 A;  3DVX A;  4HI7 A;  3G7J A;  2GQL A;  3IDV A;  4MF6 A;  3RBT A;  2MMA A;  1XXU A;  4F0C A;  16GS A;  5AIX A;  1URM A;  1OC9 A;  3IV4 A;  2GTU A;  1OYJ A;  3PPU A;  2IMD A;  1MEK A;  3GMF A;  5GZZ B;  4MK3 A;  1ZYQ B;  2HRA A;  2TIR A;  5B8B A;  1X0R A;  5FT3 A;  2L57 A;  3LYK A;  3NZN A;  1PSQ A;  1A23 A;  1TK5 B;  1THX A;  4YQU A;  4IBP A;  5DQS A;  2R3X A;  3ISO A;  1OC3 A;  2O87 A;  4GWR A;  3C8E A;  4MH2 A;  4TXO B;  1DUG A;  1TRS A;  4MP4 A;  2GSS A;  3QAG A;  2B1K A;  1M99 A;  2G2Q A;  4MAB A;  4LLR A;  3HXS A;  1GTI A;  2IFQ A;  4XS4 B;  3DML A;  1BED A;  2DJ1 A;  4QQ7 A;  2O89 A;  3GUR A;  4ZXG A;  1F6M C;  1SD9 A;  3F63 A;  1AW9 A;  5ECM B;  4F03 A;  4BWS A;  5DCH A;  3LSZ A;  3TJJ A;  1GSY A;  5JWR B;  1XBS A;  1YKC A;  3ZTL A;  2G0F A;  5G1K A;  5F05 A;  3O76 A;  5CNW A;  5FWG A;  1Z7R A;  1U3I A;  3F3Q A;  1ZMA A;  3C1R A;  2V32 A;  5ECK B;  1Y25 A;  1V57 A;  2CV4 A;  2QKE A;  5H5Q A;  3TRQ A;  3FW2 A;  4BVX B;  2H6Y A;  4IN0 A;  2VM2 A;  4ZL8 A;  4FQU A;  3AY8 A;  1FB6 A;  4IS0 A;  3GSS A;  2XPE A;  5ECS A;  1N8J A;  3DKS A;  2H66 A;  5A5K A;  3NOF A;  5HFK A;  2WZ9 A;  3GKK A;  5A4W A;  2LRT A;  2HSY A;  2MBS A;  2JAC A;  5DDL A;  3VPT A;  5BMU A;  3VI5 A;  3HVV A;  3KM6 A;  2I3Y A;  2IMF A;  1O81 A;  4Z2U A;  5CRE A;  4O92 A;  5EVO A;  1A0F A;  1V2A A;  2LST A;  1EP7 A;  1GL8 A;  7GSS A;  1I5G A;  2C3Q A;  2H01 A;  1PN0 A;  2DBC A;  1EP8 A;  2RLI A;  4LL4 B;  2HSH A;  2IYJ A;  4MDC A;  2K8S A;  1Y6E A;  1MDI A;  3TUE A;  3GNJ A;  2JZT A;  3F6D A;  5IMF A;  4L8E A;  1FOH A;  1GTU A;  1M9A A;  2JZR A;  2K9F A;  2LJA A;  1ERW A;  1THO A;  4K2X A;  4KAE A;  5GST A;  3UAP A;  1S3C A;  2PU9 C;  4I97 A;  1X5D A;  2HFD A;  1YF1 A;  3GX0 A;  2P5R A;  3LFL A;  2IFQ B;  2F51 A;  3UOM A;  3GTU B;  1KTE A;  1B9Y C;  10GS A;  1B9X C;  2IWT A;  4ZBA A;  4L0U A;  2XBI A;  1TJD A;  3GHA A;  3D21 A;  1KEB A;  3GFK A;  2MZC A;  1T00 A;  3ME7 A;  1WRY A;  1SL2 B;  5EPF A;  4JRR A;  2LJK A;  1R5A A;  2QA1 A;  4KB3 A;  3PGT A;  2ES7 A;  2Z9S A;  1EEJ A;  3HYP A;  5ELG A;  1QGV A;  3TKS E;  3A2X A;  2GZP A;  2HRF A;  2M72 A;  3KP8 A;  3ED3 A;  3DWV A;  5JCU A;  2GST A;  2PBJ A;  4MMM A;  4POB A;  4DSQ A;  18GS A;  1F3A A;  2DJ0 A;  2WJU A;  4TKY A;  4EDZ A;  3CSI A;  4BL7 A;  4KDY A;  5ECH B;  2EIR A;  4KH7 A;  3TRP A;  5IMD A;  2VL9 A;  2E2G A;  2B1L A;  3MSZ A;  4HUA A;  3D4T A;  1QXH A;  1SEN A;  2LRN A;  3HZ4 A;  3TDG A;  4NXI A;  5HR3 A;  4JE1 A;  2YZH A;  3HZ8 A;  1E2Y A;  1GSS A;  5CRG A;  3KMO A;  3KP9 A;  4TR3 A;  3UJ1 A;  4XS6 A;  2H1B A;  4RUV A;  4NWY A;  1SJI A;  5CYY A;  1TI1 A;  3FR6 A;  2YJ7 A;  2R0C A;  4POK A;  3F4T A;  4N0V A;  2GZY A;  2R2J A;  1G7E A;  1X9M B;  1KNG A;  3ZML A;  4O7H A;  3E3E A;  3TKS C;  4ID0 A;  3SBC A;  4XRD A;  4KSM A;  2HSM A;  4TXO A;  3I43 A;  4Z2T A;  1O85 A;  2VO4 A;  2KHP A;  2YN1 A;  4NAX A;  4G9H A;  3KCM A;  2KP2 A;  2ALB A;  4HEA 2;  4DEJ A;  5H5R A;  2C80 A;  2X49 A;  3MDK A;  3ZFL A;  1FVJ A;  5D9V A;  4AF2 A;  5DCG A;  1M0U A;  2A4V A;  5J3R A;  4Z2R A;  5GAP D;  1QK8 A;  1JZD A;  2WCI A;  1BAY A;  4AJ8 A;  2I1U A;  3IOS A;  2JSY A;  3VK9 A;  4LMV A;  1FOV A;  1ZOF A;  3I6A A;  4HDE A;  3MWH A;  3HCZ A;  3TJG A;  5JCG A;  2C8U A;  5IO0 A;  3Q6O A;  2YWM A;  1EZK A;  3A3T A;  3IC4 A;  5DAL A;  3M8N A;  2PWJ A;  5IM9 A;  5JWQ B;  2VOC A;  4HS1 A;  1PX6 A;  1YDK A;  1FVK A;  1C72 A;  3WGX A;  1UC7 A;  5IOX A;  1DE2 A;  1T4Z A;  4H86 A;  3F3R A;  2DJ2 A;  1ERT A;  5DAL B;  1Q4J A;  2FA8 A;  4EE0 A;  2FWE A;  1XW9 A;  3DRN A;  4E8E A;  2AYT A;  3TCO A;  5KN1 A;  6GST A;  2NTO A;  1DE1 A;  2FD3 A;  2GQK A;  3TJF A;  3WGD A;  3RPN A;  4ECI A;  2LUS A;  3TB2 A;  3KH9 A;  2PGT A;  3CMI A;  4QL9 A;  4IJI A;  1R4W A;  3F6F A;  3GKN A;  3FR3 A;  4I2U A;  1QMV A;  1DBY A;  3ME8 A;  4YH2 A;  2KP1 A;  4TXV A;  2V1M A;  2VLT A;  4FO5 A;  3R3E A;  3TGZ A;  5B8A A;  6GSU A;  1WP0 A;  2E0Q A;  3TJK A;  4BVY A;  4MH3 A;  4J56 E;  3N5O A;  2WS2 A;  4EUY A;  4ICY A;  2H72 A;  4MZC A;  6GSY A;  4ZB8 A;  2MMO A;  3W8S A;  3W8J A;  1PGT A;  4ACS A;  3FRC A;  1YKA A;  2FUG 2;  2PVQ A;  4GCI A;  2H19 A;  3ZL5 A;  1FO5 A;  3D4M A;  1A2L A;  3MNG A;  3CXG A;  1NSW A;  2MYG A;  3LJR A;  4MNN A;  5F06 A;  1Z6N A;  2VCV A;  4GLT A;  3GKM A;  3ZIJ A;  2GLR A;  2X64 A;  5CRH A;  4NV5 A;  1VRS D;  3GTU A;  1CQG A;  4TVE A;  1I9D A;  2AB6 A;  4PQI A;  3D0Z A;  2GT5 A;  3VWU A;  3H79 A;  2DSA A;  4I2T A;  2WRT A;  1F9M A;  3PR8 A;  3RDW A;  4GSN A;  2R0G A;  2YV7 A;  1T1V A;  1GLP A;  1EOH A;  4F9Z A;  1J08 A;  1B4P A;  1JZW A;  4O5U A;  1YF0 A;  2PER A;  2HRK A;  2CVK A;  4ML6 A;  3FYG A;  2CX4 A;  4NPB A;  2R4V A;  3WT1 A;  1GLQ A;  1SYX A;  1USB A;  4O32 A;  1WJK A;  2CAI A;  5AIV A;  2RUE A;  5IOW A;  2H71 A;  2V6K A;  4I6X A;  4MPG A;  2DKH A;  4K5R A;  1TRU A;  3E0U A;  1TW9 A;  5CAX A;  1ZZY A;  4EC0 A;  4V2M A;  4CHS A;  4F0B A;  5IPG A;  3KEB A;  4NV2 A;  4YAP A;  1B48 A;  2OJL A;  1U6T A;  5IMZ A;  1OKD A;  4LA1 A;  1ZYP A;  3S9F A;  1XWB A;  3IPZ A;  3RPP A;  4ECB A;  5J41 A;  5G31 A;  1A8L A;  5C04 A;  3L4N A;  2NVL A;  2YNX A;  5ENU A;  1CQH A;  4MZW A;  3P8W A;  5BRT A;  2CX3 A;  3M0F A;  4EVM A;  2QGV A;  2VL2 A;  3SWL A;  2LNS A;  4K7I A;  1R5P A;  1G0T A;  3APS A;  2H70 A;  2OAD A;  4G2E A;  3A5I A;  4KF9 A;  3ERF A;  1XOA A;  2VCT A;  1EV4 A;  3A5W A;  1A8Y A;  4L0W A;  3QDN A;  2JL4 A;  5J9B A;  4NHZ A;  3IK7 A;  3IK9 A;  4TOP A;  1EGO A;  2L6C A;  4FYB A;  2X8G A;  3O6T A;  1GSE A;  5JWO B;  3J7Y b;  4Q5N A;  5HR0 A;  1HNA A;  2LQO A;  1U3A A;  4X4J A;  4IKH A;  2RUF A;  2FA4 A;  2X4A A;  3ZIT A;  2LNT A;  4CY6 A;  13GS A;  3CTG A;  4YKF A;  3F9U A;  2H75 A;  2IMI A;  1VF3 A;  4MA9 A;  5ID2 B;  1UN2 A;  1Z3E A;  1TU7 A;  4BWQ A;  1WWJ A;  3R2Q A;  19GS A;  3GIX A;  4AGS A;  4BA7 A;  1GSF A;  2XBQ A;  5CRD A;  1ZL9 A;  3KZQ A;  1XVQ A;  4X1U A;  4KE3 A;  1QQ2 A;  1X9S B;  2NPB A;  4AJ7 A;  1DSB A;  1SK2 A;  2QA2 A;  2FLS A;  4ZBB A;  2PUK C;  4PQ1 A;  5D8I A;  2CAQ A;  4HJ2 A;  4ZIL A;  3O3T A;  5EY6 A;  1RQM A;  3E9J B;  5ECP B;  3VWW A;  6GSX A;  1W89 A;  3VLN A;  4DSS A;  4EXJ A;  1VF1 A;  4JR6 A;  1M2A A;  5FHI A;  2ON5 A;  2GZZ A;  5EL8 A;  1A2J A;  5LCZ A;  5DAK B;  2C4J A;  3C73 A;  4KDX A;  2KUC A;  1PX7 A;  2IN3 A;  3KTB A;  2LS5 A;  2K18 A;  4TW5 A;  2HZF A;  3LQ7 A;  4FH8 A;  4WBR D;  4MF5 A;  4PUR A;  2P0G A;  5A4U A;  4HOJ A;  4IW9 A;  1GSU A;  4OMV A;  3VUR A;  2F8A A;  2CQ9 A;  3TKR A;  1E6B A;  2VLU A;  3KIJ A;  3GYK A;  1B4Q A;  1T7P B;  5GSS A;  1A0R P;  4ZB6 A;  2V2G A;  4WET A;  4G19 A;  3HVS A;  2WB9 A;  4MJE A;  2YWN A;  3IC8 A;  5J9C A;  4K2D A;  3PH9 A;  4P3Y B;  2BTO T;  2N5A A;  5HR1 A;  2AV4 A;  3APO A;  2B5Y A;  2IME A;  1GTB A;  2HLS A;  5DJL A;  2VD0 A;  4K8M A;  2N5F A;  4EDY A;  1XOB A;  2VUP A;  4V1A p;  2LJR A;  4ZBD A;  1AXD A;  4EO3 A;  1TI3 A;  5G5F A;  2AAW A;  2JU5 A;  1ZCP A;  4KSO A;  1VF2 A;  2L4C A;  3CRT A;  3EIN A;  1OVN A;  4HQS A;  2YP6 A;  1XPV A;  3I69 A;  4GQF A;  3EMX A;  1PKZ A;  4X43 A;  4XS1 A;  1ILO A;  1YEP A;  4O5Q A;  5GAN D;  3RAZ A;  3U5R E;  3QPM A;  3FKF A;  3TOT A;  3QOU A;  5D93 A;  4TR1 A;  3LYP A;  1PL1 A;  3ZVJ A;  2C0F A;  3DXB A;  2ZCT A;  5DVB A;  2FCH A;  2X8C A;  4POL A;  2WFC A;  5G2Z A;  4PXO A;  1NHY A;  2R5G A;  1EGR A;  5C00 A;  1SKS B;  2B6M A;  3FZ9 A;  4G0K A;  3EU3 A;  2IMK A;  4GQC A;  2PMT A;  4HZ4 A;  4XRA A;  1BJX A;  3LGC A;  4XHM A;  2HRN A;  5AIS A;  3EE2 A;  3FEU A;  2O85 A;  5DJM A;  4CDO A;  3QMX A;  2F8F A;  3QFA C;  2WGR A;  2F3M A;  1SL0 B;  3QR6 A;  4HU9 A;  5ECR B;  3CRU A;  2L4Q A;  3L0H A;  3VI7 A;  3GST A;  5ECI B;  2L5O A;  4X0X A;  3H4K A;  1U88 A;  1XWG A;  1ERV A;  14GS A;  2AJQ B;  2LKU A;  3NIV A;  3HKR A;  3D22 A;  1M7T A;  3EUR A;  2F9S A;  3M3M A;  1XFL A;  3F4S A;  3L9S A;  4KCA A;  1TK0 B;  2IJY A;  4Z7X A;  2DML A;  3FR9 A;  2PVO C;  2YOI A;  1JLV A;  1F37 A;  5G1L A;  3TKQ A;  3FHK A;  4TR4 A;  1FW1 A;  2I81 A;  3GH6 A;  1PN9 A;  1EWX A;  4ECC A;  1O7U A;  1NW2 A;  2DIY A;  4HJM A;  2YZU A;  1GUK A;  5ECL B;  5ID2 A;  4YKG A;  2O7K A;  4HQZ A;  5AN1 A;  3ZYW A;  2R0P A;  1V9W A;  2OBK A;  3F4R A;  1PRX A;  4HZ2 A;  3FK8 A;  3IRA A;  4ZIJ A;  1OE8 A;  4WXT A;  1OAZ A;  5G5E A;  5IPH A;  1BQ7 A;  2H73 A;  4CW9 A;  2VM1 A;  1Z5Y E;  2XHF A;  5D96 A;  2M46 A;  1JHB A;  2AUV A;  2P31 A;  1X5E A;  3QFB C;  4KW6 A;  3FZA A;  2ZNM A;  2HYX A;  3C1S A;  3UVT A;  2LRC A;  1F3B A;  4JR4 A;  2HZE A;  4K7N A;  4WR5 A;  1WOU A;  4CY8 A;  1MD3 A;  4JBB A;  3CSJ A;  1K0N A;  3D5J A;  4OD7 A;  2JZS A;  1GSQ A;  4WEY A;  2L59 A;  3C7M A;  4OCE A;  2QC7 A;  4FYU A;  4GST A;  2ZUP A;  2C0G A;  1SK0 A;  3TKS A;  4WBJ A;  5D73 A;  1YZX A;  2C3T A;  5E4W A;  3H1N A;  4K1F A;  1NM3 A;  3L78 A;  1V40 A;  5HR2 A;  1K0A A;  4WF4 A;  4MLY A;  5B6M A;  3IR4 A;  4PQH A;  1ERU A;  4N30 A;  3UAR A;  2IY2 A;  4K7O A;  4JU5 A;  2CZ3 A;  1TRW A;  3IHG A;  3CSH A;  3MAK A;  1BG5 A;  3GL5 A;  4RQX A;  3HD5 A;  1RW1 A;  1SJZ A;  4KX4 A;  3ZFB A;  4IVF A;  1LU4 A;  1FB0 A;  1Q98 A;  1AC1 A;  1GP1 A;  3QAW A;  3LG6 A;  1OC9 B;  4EF0 A;  3BD2 A;  3EU4 A;  1JFU A;  5ECO B;  3ZRD A;  4OFT A;  1GSD A;  1GNE A;  4I5Q A;  2MMZ A;  4O5R A;  2OE3 A;  1VF4 A;  2K6V A;  5KN0 A;  2HT9 A;  2JSZ A;  4AJ6 A;  1ST9 A;  1HNC A;  1O73 A;  2AHE A;  1QFN A;  4MJB A;  1ZYN A;  5L71 A;  2LTK A;  1X5C A;  1EV9 A;  2E2M A;  3LXT A;  4MJC A;  1M2B A;  1V58 A;  1MTC A;  2GSR A;  4KDU A;  4ZB9 A;  3HA9 A;  3QAV A;  1AQW A;  3CTF A;  5JCW A;  2IPA A;  2A2P A;  4OWY A;  4GSS A;  4MJA A;  1J0F A;  4TRX A;  4E8H A;  1J9B A;  2HXK A;  1O8X A;  2YJH A;  3KJY A;  1H75 A;  3ZIV A;  1ZGN A;  1AAZ A;  1U87 A;  2XPD A;  1R26 A;  2H6X A;  2GVP A;  1AUC A;  2N5B A;  2V6O A;  1GH2 A;  5G30 A;  2GGT A;  5KN2 A;  2C0E A;  2WUL A;  2DKI A;  4IQ1 A;  1ON4 A;  1TDI A;  1SU9 A;  2FWH A;  1TOF A;  3EWL A;  4D73 A;  2B5E A;  1WPI A;  4ML1 A;  3HDC A;  2VCX A;  2GSQ A;  3UMA A;  3M9J A;  4KND A;  4PTS A;  4QL7 A;  1O6J A;  5KOW A;  3UIW A;  2IIY A;  2H8L A;  4RQR A;  2GDR A;  1MDK A;  1K0O A;  4D73 B;  1BX9 A;  4GF0 A;  5D9T A;  1XWA A;  3HJO A;  4MCU A;  1SYR A;  5KOX A;  1EEM A;  3V1W A;  1X9W B;  2KOK A;  3IHQ A;  4A5P A;  2VCW A;  3BCI A;  2OAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...