1JZOA

Dsbc c101s
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
b'DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN DSBC
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal Structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 67
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzoA02
2DJJA 1TRUA 4XS6A 3TKRA 1OC9B 4ZXGA 1V9WA 5B8BA 2KHPA 4ZL8A 5HR3A 2FWEA 3FK8A 3BCIA 3L0HA 4JBBA 1SL2B 2YOIA 2YPMA 2FA8A 2IMKA 1SL1B 4X1UA 1XWBA 2QGVA 4MPGA 1HYUA 1OAZA 3VURA 3L78A 3GMFA 4ECJA 2IYJA 3KD0A 2C0DA 2JACA 2AJQB 4N0VA 1B4PA 5HFIA 5INYA 3M0FA 2FCHA 1ERVA 2H72A 5G5EA 1OYJA 5DQSA 3ISOA 1ABAA 1M2BA 1ILOA 4XS4A 5IMVA 3ZVJA 1U87A 2MBTA 4PURA 3HD5A 2GT5A 1QFNA 5IMCA 3IDVA 4V1Ag 4WBJA 2IIYA 1VGLA 2VAFA 2I3YA 3VWXA 4Q5FA 4EL1A 2L6CA 1VF4A 1FO5A 1GL8A 3L9VA 3DVWA 3KXOA 5KEJA 4TR0A 1R4WA 1PD21 3FEUA 3VI5A 2HRNA 4EO3A 1XWKA 1Q4JA 3WGDA 3KMNA 3O76A 1TRSA 4F0CA 1MDIA 4GSNA 1M99A 4BVXA 1JFUA 4GXZA 1X5EA 2C8UA 4POBA 3F4RA 4NXIA 4ISDA 2F8FA 5G1KA 4CDOA 4HZ4A 1M9AA 2FD3A 1R26A 3MAKA 4TKYA 1U6TA 3TRXA 3IAS2 3HCZA 3ZFLA 1Z7PA 3KP8A 2YWMA 3C1SA 3C8EA 4LMWA 5CNWA 2LNTA 13GSA 4GRFA 2RM5A 2XHFA 3WD6A 4K0NA 3R2QA 3RHCA 3G7JA 2I9HA 3I43A 7GSSA 2F8AA 5GSTA 2HT9A 2MMNA 2VCVA 1H4OA 3EMXA 3IA1A 5JCWA 1XBSA 2YZHA 1V58A 4NMUA 5D93A 2IL3A 2GTUA 1EGOA 5ECNB 4JR4A 2GSTA 3H8QA 4HU9A 3HVVA 4TRXA 3UMAA 3FR6A 3EE2A 1SK2A 2JZSA 2CT6A 5ECKB 1G0TA 5A4UA 1GLPA 1N2AA 3LSZA 3DEXA 1SKSB 1T4ZA 2LTKA 4OO5A 5HR1A 4ZB6A 1SJZA 2VD1A 3GKXA 3TUEA 3GRXA 4OO4A 3GIXA 3OR5A 3Q74A 4ECBA 3CRTA 5DALB 2VLVA 1AXDA 2P0GA 2LNSA 1TRWA 1XZOA 1MD3A 2LS5A 1EZKA 1TW9A 1Z5YE 14GSA 4CW9A 3IBHA 4YH2A 2FWHA 2FUG2 1ACVA 1TK8B 2ZUPA 16GSA 2DLXA 3QOUA 2XPEA 3HVXA 4HJ2A 1ZCPA 1SD8A 3HZ4A 4K7OA 4WR5A 3D6IA 4IGJA 3TDGA 5ECMB 2VCTA 4J57E 2PMTA 1H75A 4BA7A 1NSWA 2VCXA 4HUAA 1TJDA 5B8AA 3J7Yb 2PVQA 2C0FA 5GSSA 4BVYA 2GSRA 2X8CA 3FHKA 5IO0A 4DEJA 1K0NA 1VF3A 1F37A 2YWNA 4POLA 2K8VA 1WJKA 1WWJA 5ECIB 4MABA 4HS1A 5DAKA 5AIVA 1YY7A 3G7IA 3GH6A 4QQ7A 2QC7A 3P2AA 3UEMA 1GSYA 3J7Yk 1FOVA 2NTOA 4HQZA 1OE8A 1RQMA 1O8XA 1YKCA 1XXUA 4ZL9A 1QGVA 2YJ7A 5IIZA 2E0QA 2PWJA 1PKZA 3FZ4A 3K8NA 1K0MA 1RK4A 2X8HA 1XCCA 4TXOB 1A24A 2DJ3A 4ML6A 2YWOA 4K2DA 3I9V2 2GQKA 1GNWA 2YCDA 4MA9A 3DKSA 2RUFA 1GSSA 2GDRA 1BX9A 2B6MA 5DDLA 3NIVA 1K0CA 3EVIA 1V40A 4NHZA 4L5OA 2RUEA 2IJYA 2BTOT 2WFCA 4O7HA 4Q5QA 3FR9A 3SWLA 5IOWA 3VK9A 5FWGA 5D9VA 5CRHA 1IYHA 4XRDA 4AJ8A 2HNLA 3IE3A 2E7PA 1K0OA 1GWCA 4MDCA 4MJAA 3HZ8A 1GP1A 2CVDA 3ZVJD 5KN0A 3ZYWA 4HI7A 3RPPA 4IHUA 1GSEA 2YP6A 2LQOA 2VM2A 4GCIA 3HJMA 4TOPA 2GZPA 4MF6A 4TR3A 2AAWA 3ZL5A 3GKNA 2GLRA 5G5FA 5AISA 4JE1A 2KLXA 1F9MA 3QFAC 2NVLA 2OJLA 3I69A 4KCEA 2WGRA 3BJ5A 1Y6EA 3L4NA 1WPIA 4XCSA 2AUVA 2VO4A 3MWHA 3TKSA 1T3BA 1JZWA 4MPFA 1FAAA 2K18A 1CQGA 4TR1B 1GSQA 5LCZA 3GA4A 3H93A 1UVZA 3UJ1A 2VIMA 3RBTA 5F0GA 2QKEA 1GUKA 3RDWA 2BJXA 1XWAA 3V1WA 2NBSA 2HSYA 5COHA 1F2EA 3GYKA 4IN0A 1TTZA 2G0FA 1A2LA 1PQNA 1SK0A 2XBIA 3FW2A 3LYKA 2E2GA 2KP2A 1EV9A 1BJXA 2MMZA 2R37A 3KMOA 1FB0A 3FZ5A 5L71A 5JWQB 2A4VA 2VL2A 3I6AA 4QL7A 2HZEA 2VD0A 10GSA 4TR1A 3A3TA 3TJJA 1GH2A 1BEDA 4PUFC 4H86A 2WJUA 2DIYA 5DQYA 3M1GA 3P90A 5HFGA 2C0GA 1PX7A 2L59A 1WIKA 6GSWA 2IPAA 4TVEA 3QFBC 3GL5A 2FNOA 6GSYA 4LL1B 1ZOFA 5IOXA 3LJRA 2VCZA 4PX1A 1OKDA 1I9DA 3WT2A 4XS4B 3QCPA 1GNEA 5A5KA 2FGXA 5J4UA 2JSZA 1QUWA 4MCUA 1JLVA 1XW6A 2H76A 5IMAA 2R3XA 2ON7A 4FYCA 4P3YB 1ZL9A 4EXJA 3ME8A 4IS0A 2LEGA 2V41A 5F07A 2IFQB 2DMMA 4IP1A 2OE3A 1ZYQB 2JU5A 3D0ZA 3G7YA 3RPNA 4HEA2 3TKSC 1ZYEA 3F0IA 3VFIA 2J9HA 2XC2A 1NW2A 3CSHA 3M9KA 2C0EA 2H1AA 17GSA 5LD0A 3GSTA 5AIXA 2JSYA 4K9ZA 2JL4A 2VLUA 2H70A 5E59A 1M2AA 1DUGA 3H4KA 5H5RA 4ZBBA 1XW9A 2F9SA 2OE1A 1BYEA 4MH3A 3ZZXA 4K6XA 3W6GA 2IMDA 2GSSA 5D9XA 4HZ2A 2H19A 2IFQA 4GSSA 4YQVA 2DJ1A 1PL2A 2OBIA 3ZTLA 4HOJA 1MD4A 1ZZYA 1YEXA 4MP4A 4QL9A 5G1LA 1I5GA 2VL2C 2B1KA 3IRAA 3QMXA 3APSA 3EYTA 4NWYA 1IYIA 2R4VA 1BG5A 2BMXA 1YZXA 5G2ZA 3DVXA 3SBCA 4F9ZA 2RM6A 1K3LA 2WB9A 1YEPA 4TW5A 1BQ7A 3DYRA 2LV3A 1YDKA 1TXXA 3GSSA 1EP8A 4Q5NA 1B4QA 1Z9HA 3TB2A 2GT6A 4KAEA 2CQ9A 2O89A 2YV9A 3WYWA 1MDJA 2CX3A 5G30A 1X9SB 4KSOA 2H30A 1F6MC 2HYXA 1ML6A 2P5RA 4NPBA 5IPHA 5AN1A 3EWLA 2H66A 2N5AA 3CXGA 3HJOA 1BAYA 1M2DA 9GSSA 1B48A 4K7NA 2CVBA 5A4WA 4WBRD 1TOFA 1PL1A 4XTSA 1UC7A 4PNFA 1OKTA 3GL3A 2GGTA 3EURA 2YNXA 3D22A 3D21A 2OA7A 1XOAA 5J9BA 3S9FA 2YZUA 5IMZA 3UARA 4WR4A 4L8EA 4JR6A 1Z6NA 4KDXA 1GTUA 4EC0A 4IW9A 3FR3A 3WT1A 3CRUA 2REMA 3M9JA 4Q5RA 2HE3A 2WS2A 2V2GA 3A2VA 3TCOA 2PBJA 1X9MB 4XRAA 3N5OA 2CA8A 2FHEA 1Z6MA 4WETA 2XPDA 1THXA 3HVSA 3ZFBA 3KH9A 1MTCA 2B5YA 2PGTA 2DJ2A 2K6VA 3W8SA 3KH7A 2H0IA 2CZ3A 3LXTA 5DVBA 1KEBA 2LRCA 3Q19A 1TU8A 4KDUA 4PUAA 4F82A 3UAPA 4BL7A 2H01A 2HZFA 1GTBA 4PQHA 2WCIA 2C3QA 5DAKB 1PSQA 2GVPA 4RI7A 5DBQA 1AW9A 1A8LA 3APQA 4X43A 4OFTA 1O85A 2O87A 2HLSA 4MZBA 4IP6A 2LJKA 2LJAA 3WGEA 3ZIVA 4MF7A 3ERFA 1ZGNA 3LXZA 1ON4A 4KUNA 4AJ6A 4WEYA 2KOKA 3FZAA 3P8WA 1HQOA 2LSTA 4DSRA 1XIYA 1JZOA 4V1Ap 1Z3EA 3IV4A 3CBUA 3KZQA 2C1YA 3F8UA 3DD3A 5B7CA 2X64A 4FIWA 4KSMA 1QQ2A 4L0WA 5J3RA 2M80A 3HA9A 5ECRB 3GV1A 1DE2A 1YQ1A 1USBA 5F8BA 1TK0B 5ECQB 4OCFA 4ZILA 3ERWA 5EY6A 4MJBA 4PQIA 4PXOA 1G6WA 4OFNA 5DCHA 1A23A 4MH2A 1K0AA 2JZTA 2PUKC 1TDIA 5DJMA 4IJ3A 3GUSA 1EV4A 4KW6A 1TKDB 1O7UA 4E8HA 5A4VA 2H0HA 2DJ0A 1S3DA 3NZNA 2CX4A 1AQWA 1M9BA 3H1NA 5GAND 1GLQA 5ECSA 3VLNA 5J9CA 2TIRA 2N5FA 3CMIA 4TR4A 5CYYA 3QAVA 20GSA 2I81A 1PX6A 4EKZA 2YV7A 4KNDA 5D73A 4ZBDA 2K8SA 1NM3A 2L4CA 3TOTA 4ZB9A 4NV5A 4G2EA 1N8JA 2HXKA 2O8VB 5EL8A 1K3OA 1UN2A 3D5JA 1O8WA 5C04A 2LKUA 1F3BA 4LL4B 4RQRA 4KGIA 4PGTA 2H71A 2FWFA 1HD2A 2L6DA 1THOA 3F4SA 2YANA 4ACSA 1U3AA 1ERUA 3LEFA 4JZQA 2RLIA 3UOMA 3ZREA 3W8JA 2H0GA 5IO2A 5HR0A 2HSHA 3KGKA 3DGQA 2WDUA 3HKRA 3LWAA 3KM6A 3C71A 4ZBAA 4NAXA 2R6KA 2H1BA 3IK9A 1R5PA 3TKSE 2YJHA 3QAGA 4E8EA 2X99A 2GZZA 4V2LA 4D73A 4X0XA 1GRXA 4KE3A 4O5RA 3GN3A 6GSUA 4POKA 2L5OA 3F63A 2A2RA 5JWRB 2QSIA 4AJ7A 4NHWA 3EC3A 2NDOA 4ECIA 4ZL7A 3HJPA 1OC3A 1XWGA 3GH9A 3TJGA 22GSA 4ML1A 2H8LA 1QMVA 2HZEB 1GTAA 5CRWA 3BBYA 3IPZA 1W4VA 2B3SA 4DSSB 2B5XA 4ZIJA 3P7XA 1F3AA 3AY8A 4IKHA 4OFMA 2ALBA 1X5DA 3FZ9A 4K8MA 3EU3A 3F3QA 3ME7A 3ZIJA 2IN3A 2LRNA 1XVQA 2I4AA 4POMA 4GLTA 3LFLA 4BPYA 2F51A 4WXTA 4PNGA 4DSQA 3FYGA 1OVNA 4EDZA 1JZDA 4N11A 3GURA 2VCQA 5D8IA 3TKQA 3CSJA 3CYNA 2PVOC 5IMDA 3ZMKA 4HU7A 2L4QA 1FVKA 1YF0A 1MEKA 1PN9A 4FH8A 2CZ2A 2EIRA 4WF4A 3LG6A 1GSFA 4I2UA 3A2XA 5DJLA 3GTUA 4TN8A 4WKWA 5D9TA 1SL0B 2RIIA 4DSSA 2MYGA 1AC1A 2K9FA 3C7MA 4OMVA 3TJFA 5CO3A 19GSA 3JCML 2DJKA 3KIJA 3PGTA 1ZMAA 4KCAA 2H75A 2EIQA 4MZWA 4OCEA 3CSIA 3LYPA 1XW5A 1O81A 2PPTA 4ZB8A 1CQHA 2C4JA 2IWTA 1A2MA 3TRPA 3LGCA 2C3TA 1S3AA 3EMPA 1K0DA 2OKAA 1K3YA 2VL9A 1GUMA 1T8EB 4MMMA 1B9YC 3IAM2 1PA3A 3GFKA 2YN1A 1J08A 3L9SA 5ID2A 4KH7A 1LJRA 3KTBA 5JCUA 1GSDA 3APOA 4YAVA 5CAXA 2B7KA 1S3CA 1A8YA 3O3TA 3DIEA 1G7OA 3LORA 2P31A 1AQXA 2CVKA 4HDEA 2L57A 2HFDA 5GZZB 4NV2A 1J0FA 2VCWA 1Z7RA 1SK1A 4J56E 2IY2A 1O6JA 3KP9A 5IQYA 5JCGA 2KUCA 2V1MA 4I2TA 1XFLA 5D9WA 3HYPA 5CREA 3TOUA 4KB3A 1KTEA 2D2ZA 2V32A 3TRQA 5GAPD 1KNGA 2LQQA 1SENA 1Q98A 3HHVA 2X8GA 2H74A 5B6NA 1T00A 3F9UA 4GTUA 1OC9A 5CRGA 4DVCA 1JHBA 1KBNA 1X5CA 1PKWA 1O73A 2VUPA 1V98A 4IQAA 2R2JA 2MMAA 2DC5A 1NHYA 3E9JB 5IM9A 4OWYA 1GUHA 2O7KA 5ECHB 2VL3A 1T4YA 8GSSA 1XWCA 2H1GA 3PH9A 4O32A 1ERWA 4N0ZA 3L9UA 3C1RA 2AV4A 3MSZA 1YF1A 5JWOB 2AB6A 5KN3A 2AHEA 1EEJA 3VPQA 4L5LA 3UBKA 4RI6A 3BCKA 4K1FA 5D96A 2IMIA 1T1VA 1XPVA 4PQ1A 3EU4A 3C73A 4YQUA 1FHEA 3A2WA 1A2JA 4I8BA 3HY2A 4MLYA 5ECPB 6GSTA 1SD9A 2WZ9A 4GSTA 5KN2A 1HNCA 1UA5A 3GHAA 2LJRA 3DMLA 5AGYA 1LU4A 2PERA 12GSA 4LA1A 1XOBA 2CAQA 2DIZA 3RAZA 3U6VA 4OD7A 4EVMA 5ELGA 1B9XC 2IMEA 2E2MA 4I6XA 4EDYA 1FG4A 4IJIA 3Q18A 2G2QA 3E3EA 1FB6A 3TKPA 4TXVA 2H6XA 2H73A 2VOCA 2V6OA 1SJ6A 3IC4A 3MNGA 4RQXA 4Z7XA 5LNKe 3CTFA 4F0BA 3GKMA 4K0GA 4GQFA 4AGSA 3DXBA 1EWXA 3UVTA 5F05A 2A2SA 4L0UA 1GULA 1X0RA 2CV4A 3KTLA 1NHOA 2M72A 4V2MA 3GNJA 1SJIA 1OC8A 4EE0A 3M3MA 1SKWB 2M46A 1WOUA 2OE0A 2H6ZA 4F2IA 3RHBA 5IPGA 3F3RA 1WRYA 2KP1A 3GX0A 3VWWA 3TGZA 3G9BA 3PINA 3BOAA 1AQVA 1SYXA 3FKFA 4G19A 3LQ7A 4MK3A 18GSA 2GQLA 1AUCA 1EP7A 2Z9SA 1LBKA 4LMVA 5FHIA 3M8NA 5EVOA 2FA4A 2N5BA 3VWVA 1Y25A 4I5QA 5J5NA 2FY6A 5ENUA 3ED3A 1G6YA 4MJEA 4MZCA 1SYRA 4IQ1A 4JRRA 1TP9A 5EPFA 1EOGA 5ELAA 2H1DA 3D4MA 4BWSA 3WGXA 1SU9A 3IXRA 1HNAA 2FWGA 3GKKA 3KCMA 1M0UA 2DMLA 3US3A 3NOFA 4RUVA 4ULXA 3QAWA 3ERGA 1J9BA 1A0FA 1AIUA 3UBLA 4YQMA 1FVJA 1A0RP 2YWIA 3F6DA 2AYTA 1AAZA 1URMA 4MJCA 1JZRA 5DALA 2DSAA 1MDKA 4N10A 4IVFA 1K0BA 1PMTA 2JADA 3TJBA 4XS1A 3QR6A 4CHSA 1JLWA 3Q6OA 2LRTA 1WE0A 3IHQA 2GSQA 2VLTA 3KEBA 1YJ6A 3QDNA 3U5RE 5F06A 3BD2A 1ERTA 2ES7A 2P5QA 3A5WA 4F03A 1WP0A 4D73B 1V57A 11GSA 3ZITA 5HFKA 2CAIA 1TK5B 5G31A 2EC4A 3QD9A 5DCGA 3TJKA 1TI1A 2J23A 3UL3A 5FT3A 1U3IA 1YKAA 1DSBA 1WMJA 3KJYA 1QXHA 1C72A 4AF2A 6GSVA 2R5GA 4BWQA 4HJMA 5CP1A 1X9WB 2B1LA 3CTGA 1E2YA 3H79A 2OBKA 2JZRA 2TRXA 2L5LA 3D4TA 1U88A 2V6KA 1VRSD 4KDYA 3ZMLA 4G10A 4J2FA 5H5QA 2GQMA 4LLRA 2WRTA 1TI3A 4TXOA 1VF2A 1ST9A 1E6BA 2ZNMA 1PGTA 6GSSA 1QK8A 2XBQA 1GTIA 3MDKA 1M7TA 4FYUA 2OADA 1T7PB 3ZRDA 4EF0A 3ZLPA 4O92A 4MF5A 2HI7A 6GSXA 3VPTA 2I1UA 3UVHA 2ZCTA 1EEMA 4ID0A 3E0UA 2LUSA 3GTUB 2MZCA 4G9HA 2O85A 1EGRA 4GF0A 5ECLB 1FW1A 2GZYA 1R5AA 2C80A 1SKRB 3DWVA 5C00A 2H6YA 4KX4A 2EIOA 5E4WA 3N9JA 5B6MA 4ILFA 2DBCA 3IK7A 3PR8A 4FO5A 2PN8A 3VI7A 3UIWA 2ON5A 4GQCA 1R7HA 3HXSA 2B7JA 4K7IA 3QPMA 2C3NA 3VWUA 4HQSA 4KA0A 3IOSA 1RW1A 2OACA 1OE7A 2MBSA 1TRVA 3O6TA 1GSUA 4I97A 3FRCA 3DRNA 5ID2B 5J41A 4V2NA 5HQPA 1DBYA 2FLSA 3F6FA 4EUYA 2VM1A 4FYBA 5H5SA 1TU7A 4N30A 2HRFA 2NPBA 2TRCP 5CRDA 1XVWA 5ABRA 1G7EA 3F4TA 3FY7A 1DE1A 3IR4A 5ECOB 4IELA 4WF5A 2IMFA 2PU9C 2GS3A 1W89A 1B8XA 2WULA 2MMOA 4JEDA 2F3MA 4YAPA 1HNBA 5KN1A 1EOHA 3EINA 4XIHA 5IMFA 4ECCA 1V2AA 3HDCA 4GWRA 4JU5A 1VF1A 3GX8A 1PRXA 4IBPA 2B5EA 5HR2A 4XHMA
chains in the Genus database with same CATH superfamily
2DJJA 1TRUA 4XS6A 5G2GA 4EXRA 3TKRA 1OC9B 1IT7A 4ZXGA 1V9WA 1OCVA 2HMNB 1Q7HA 5B8BA 2KHPA 4ZL8A 3U97A 5HR3A 2PZVA 1RGGA 2R0CA 2FWEA 3FK8A 3BCIA 3L0HA 4JBBA 4KFFA 1SL2B 2YOIA 2YPMA 2FA8A 2IMKA 1SL1B 4X1UA 5AYRB 4R9KA 1XWBA 2QGVA 4NHFA 1HYUA 4MPGA 3D5GA 1OAZA 3D5IA 3A5IA 3VURA 3L78A 4LYLB 3GMFA 1YJ93 2OQEC 4ECJA 2IYJA 3KD0A 3CU3A 2C0DA 2JACA 2AJQB 4N0VA 1W00A 1NWWA 1B4PA 4HAAA 5HFIA 5INYA 3M0FA 2FCHA 1ERVA 3FF2A 2H72A 5G5EA 3T8UA 3DZLA 1OYJA 1GY7A 5DQSA 3ISOA 1ABAA 3AGOA 1E3VA 1M2BA 1ILOA 3CC23 4K90B 5IENA 4XS4A 3CPOA 5IMVA 3ZVJA 1U87A 1RMSA 2MBTA 4PURA 2JQ5A 4WYKA 5M19A 3MIXA 3HD5A 2GT5A 1QFNA 5IMCA 3IDVA 3G4S3 4V1Ag 4WBJA 1KD14 2IIYA 1X1WA 4O8SA 4NREA 1W5ZA 1VGLA 2VAFA 2F98A 2I3YA 5A0OB 3VWXA 4Q5FA 4EL1A 9RNTA 4TX4A 4R80A 3UL6A 1NDOB 1BSAA 2L6CA 3OXAA 1VF4A 1FO5A 1GL8A 3L9VA 3DVWA 3PCRA 5STDA 3KXOA 1UI8A 5KEJA 4TR0A 1R4WA 1WMOA 1U5OA 4HM4B 4HOHA 1PD21 3FEUA 3VI5A 2HRNA 4EO3A 1XWKA 2J8XB 4X4JA 1Q4JA 2Z7AA 3WGDA 3KMNA 3O76A 1TRSA 4KFEA 4F0CA 3GSPA 1TU5A 1MDIA 1PFPA 4GSNA 1M99A 4BVXA 1JFUA 1YVSA 1DE3A 4GXZA 1LOWA 1X5EA 2C8UA 2HRAA 2UX0A 4POBA 1US1A 3F4RA 1WQLB 3MPHA 4NXIA 4FCZA 3H3HA 4ISDA 4KFDA 1UUWB 2F86B 2F8FA 5G1KA 4CDOA 3PS8A 4HZ4A 3VF1A 1M9AA 2FD3A 1R26A 3MAKA 4TKYA 1RHLA 3HIIA 1U6TA 3TRXA 3IAS2 3HCZA 3ZFLA 4AEQA 1Z7PA 1K28A 3BNEA 3KP8A 2YWMA 3IMAB 2KF3A 3C1SA 3C8EA 4LMWA 1FZUA 5CNWA 1FUSA 2LNTA 13GSA 1MGWA 1VQ93 4GRFA 2RM5A 2HMKB 2XHFA 3WD6A 4K0NA 1X1UA 3R2QA 3RHCA 3G7JA 4G0KA 2I9HA 1JKGB 1NB3I 3EBTA 3I43A 2QA2A 7GSSA 2F8AA 5GSTA 2HT9A 2MMNA 2CWVA 4O02B 2VCVA 1H4OA 4FMDA 1LNIA 2K3DA 3QRDA 3EMXA 1LRAA 3IA1A 3K5TA 5JCWA 3NM2A 1XBSA 2YZHA 1DMQA 1V58A 5CK6A 4NMUA 5D93A 1SPUA 3FG4A 2IL3A 2GTUA 5KOWA 1EGOA 5ECNB 4JR4A 4R4KA 2GSTA 3H8QA 3EB8A 4HU9A 1MWUA 3HVVA 4TRXA 3UMAA 1UUGB 3FR6A 1JN5A 3EE2A 1ZYNA 1SK2A 2JZSA 2CT6A 5ECKB 1G0TA 1BSBA 2SBLA 5A4UA 1VZZA 4HM5B 4L8OA 1GLPA 2YX9A 1N2AA 3LSZA 3DEXA 3SX1A 1SKSB 4KF9A 3F8XA 1T4ZA 2LTKA 4OO5A 2BMRB 5HR1A 4ZB6A 1SJZA 1Q864 2VD1A 3GKXA 1MNLA 3AMOB 3TUEA 3GRXA 4OO4A 3GIXA 1NJI4 3OR5A 2WO0A 3CXC2 3Q74A 1T5YA 4ECBA 1JBRA 1RN1A 5DREA 3CRTA 3NQYA 5DALB 4N6UA 3K7CA 5DRVA 4BVYB 1I2FA 2VLVA 4O5UA 1AXDA 3FG1A 2P0GA 1A2KA 4OUQA 1R4CA 2LNSA 2W6JH 3DGYA 1O7NB 1TRWA 1XZOA 3CCL3 1JBTA 1MD3A 2LS5A 1EZKA 1TW9A 4BIKA 1Z5YE 3ZG5A 14GSA 2Q07A 4CW9A 1HKXA 2D1WA 3OWYA 3IBHA 4YH2A 3DXOA 2FWHA 1BNFA 2FUG2 1ACVA 1TK8B 2ZUPA 5BVBA 16GSA 2DLXA 3QOUA 3CCM3 3S27A 2XPEA 2UZ8A 3DGLA 1STFI 3HVXA 1JB5A 4HJ2A 1ZCPA 2CX1A 2XF3A 3UB1A 1SD8A 1FGOA 3HZ4A 4K7OA 4WR5A 3D6IA 1W7CA 4IGJA 1Q7Y4 1VQQA 3TDGA 4RNZA 1BUQA 1TRQA 1VQM3 5ECMB 3LZAA 2VCTA 2KF5A 3AMOA 4J57E 2PMTA 1H75A 4BA7A 1NSWA 4STDA 2R41A 2VCXA 4HUAA 1TJDA 5B8AA 3J7Yb 3LT9A 2PVQA 2C0FA 5GSSA 4BVYA 1Q40A 2HMLB 2GSRA 2X8CA 3FHKA 5IO0A 4DEJA 1K0NA 1VF3A 1GMPA 4N6V0 1F37A 2YWNA 4POLA 2K8VA 1WJKA 1WWJA 5ECIB 3MSOA 4DKIA 3G0KA 4MABA 2HMJB 4HS1A 5DAKA 5AIVA 1YY7A 3G7IA 1RN4A 3GH6A 2O9UX 3Q2PA 2QC7A 4QQ7A 3P2AA 3UEMA 4XHMA 2E2UA 1GSYA 3J7Yk 4ORLA 1FOVA 2NTOA 4HQZA 1OE8A 1RQMA 1O8XA 1YKCA 3DGOA 1XXUA 4ZL9A 1QGVA 2YJ7A 1UI7A 3B4OA 5IIZA 2E0QA 2X49A 2PWJA 1PKZA 3FZ4A 2V1LA 4HZ9B 3K8NA 1K0MA 1RK4A 2X8HA 1XCCA 5ELUA 4TXOB 1A24A 2DJ3A 4ML6A 2YWOA 4K2DA 3I9V2 2HMOB 2GQKA 1GNWA 2YCDA 4MA9A 2HMMB 3DKSA 3PXMA 5JPUA 1GSSA 1YGEA 2RUFA 2KCDA 2GDRA 1BX9A 1W2B2 2B6MA 5DDLA 1R4YA 3NIVA 1K0CA 3EVIA 2GU3A 1RCLA 4XBYA 1V40A 4AKZA 4NHZA 1B2MA 4L5OA 2RUEA 1B2SA 2IJYA 2BTOT 2Z6BA 2WFCA 4O7HA 4Q5QA 3FR9A 2K54A 2XRXB 3SWLA 5IOWA 1QALA 3VK9A 4K1UA 5FWGA 5D9VA 4MMXB 5CRHA 1IYHA 4XRDA 4YKFA 4AJ8A 5BMUA 1ROVA 2HNLA 3IE3A 2E7PA 1K0OA 1BOXA 1N8QA 1GWCA 1W4NA 4CDLA 4I4KA 1BRSA 3LMLA 4MDCA 1E3RA 4MJAA 3HZ8A 3EN8A 1GP1A 2RNTA 2CVDA 3ZVJD 1F8NA 5KN0A 3ZYWA 4HI7A 3RPPA 3MYDA 4IHUA 1RDSA 1M904 1GSEA 2YP6A 3KCHA 2STDA 2LQOA 5EEOA 4XDWA 2VM2A 4GCIA 3HJMA 4TOPA 2GZPA 4MF6A 4TR3A 4QWTA 2AAWA 1I2EA 5KP3A 2RFRA 3I553 3GKNA 4JF8A 3ZL5A 2GLRA 5KP1A 4IIAA 5G5FA 1YJN3 4K5SA 5AISA 4JE1A 2KLXA 1F9MA 3QFAC 1YJW3 1WTHA 3HZPA 2NVLA 2OJLA 3I69A 3EJVA 2Z77A 4KCEA 2WGRA 3FKAA 3BJ5A 1Y6EA 3L4NA 1VQ73 2UUGC 1WPIA 4XCSA 4J5KA 2AUVA 1AVLA 3ECFA 3WDGB 1K9M4 2VO4A 3MWHA 3TKSA 4LGQA 1T3BA 1JZWA 1BUJA 4MPFA 1FAAA 3Q3FA 2K18A 1C54A 1CQGA 4TR1B 4HBRA 1GSQA 5LCZA 3HVNA 1IU7A 1IVVA 3GA4A 3WOEB 3H93A 4IPBA 3KN4A 1W01A 1DMNA 3F40A 1UVZA 1V74A 1KWIA 3UJ1A 4BIRA 2VIMA 3RBTA 1KQS2 5F0GA 2QKEA 3LW9A 1GUKA 2ML6A 3RDWA 2BJXA 1XWAA 2F4YA 3V1WA 3X41A 2NBSA 1N5HA 2HSYA 1JB2A 5COHA 3KKGA 1F2EA 3GYKA 1D6UA 4IN0A 3EN1B 1TTZA 1A2LA 2G0FA 3WA2X 1FGMA 1PQNA 4WHAA 1SK0A 3LTBA 2XBIA 3FW2A 3LYKA 2E2GA 2KF6A 1EV9A 2KP2A 1BJXA 3CCS3 2MMZA 2R37A 3WR2A 3KMOA 2IMJA 1FB0A 3FZ5A 4GL6A 1MGRA 5L71A 1RGLA 5JWQB 1RGEA 2A4VA 2VL2A 3I6AA 4QL7A 4L8PA 2HZEA 1AR0A 4H3UA 2VD0A 1RNTA 1ZO2A 1K41A 10GSA 1D6ZA 4TR1A 1GOUA 4KVHA 3A3TA 3TJJA 3OV4A 4K61A 1GH2A 1BEDA 4PUFC 2OTJ3 4H86A 1PYLA 3GZXB 2YFIB 2WJUA 2DIYA 2W9QA 5DQYA 4Z2RA 3MG2A 3M1GA 3P90A 2YFLB 5HFGA 2C0GA 3K63A 2M7OA 1PX7A 2L59A 1WIKA 1X1YA 6GSWA 2IPAA 4TVEA 3QFBC 2C11A 2FNOA 3GL5A 6GSYA 4HM6B 4CY6A 4LL1B 1ZOFA 5IOXA 3LJRA 1M1XB 2VCZA 1LXEA 4PX1A 1BNIA 1OKDA 1DETA 3T8NA 1I9DA 4RBNA 3RGRA 3WT2A 5KP4A 1YGWA 4XS4B 3QCPA 1GNEA 3V99A 4WYKB 4HVNA 1EUIC 5A5KA 3CCV3 2FGXA 5J4UA 2JSZA 1QUWA 4MCUA 3R3EA 4ZM8A 4LSOA 1JLVA 1XW6A 2H76A 5IMAA 1BSDA 2R3XA 1BIRA 2ON7A 1BANA 4FYCA 4P3YB 1ZL9A 4EXJA 3ME8A 4IS0A 2LEGA 2V41A 5F07A 1O7PB 3X40A 2IFQB 2DMMA 4IP1A 4LMIA 4XB5A 1S3RA 2OE3A 1GY5A 1GYBA 1ZYQB 2JU5A 3N8BA 5CF2A 1BGSA 3D0ZA 3CCE3 3G7YA 3RPNA 4HEA2 1FGTA 3CPW2 3TKSC 1Q814 4N6NB 1ZYEA 3F0IA 1IVWA 3VFIA 2J9HA 2XC2A 2R4IA 1NW2A 3CSHA 2ZDJA 3M9KA 2C0EA 2H1AA 17GSA 5LD0A 5IG4A 3GSTA 4BVXB 3NHXA 5AIXA 2JSYA 2UGIA 2C10A 3UJMA 7RNTA 4K9ZA 3PCSA 2JL4A 1JV2B 2VLUA 1EQKA 1EKMA 2H70A 5E59A 3OWSA 1M2AA 1JNQA 1DUGA 3KSED 4J5GA 3H4KA 4MMYB 5TGNA 4FQUA 5H5RA 4ZBBA 1XW9A 2F9SA 5RNTA 5JBSA 1BYEA 2OE1A 4MH3A 3ZZXA 4K6XA 3W6GA 2IMDA 2Y73A 3MG3A 4N3VA 2IUKA 2GSSA 5D9XA 4HZ2A 3OX9A 2QIYA 4PTSA 2H19A 2IFQA 3FSDA 4GSSA 1Y4KA 4YQVA 2DJ1A 1PL2A 2OBIA 3ZTLA 4HOJA 3SEDA 3LH4A 1MD4A 1ZZYA 1YEXA 4MP4A 4QL9A 5G1LA 1I5GA 4USSA 2VL2C 2B1KA 5AIFA 3IRAA 3QMXA 1ULIB 1GD4A 3S28A 1HZ1A 3APSA 1VQP3 3EYTA 4NWYA 1IYIA 2R4VA 1BG5A 2BMXA 1YZXA 5G2ZA 3FGYA 3DVXA 3SBCA 4F9ZA 2RM6A 1K3LA 3H51A 4CPKA 2WB9A 2CFKA 5BXQA 4EV2A 1YEPA 4TW5A 1BQ7A 3DYRA 2GEXA 2LV3A 1YDKA 2LYXA 1CEWI 1TXXA 3GSSA 4MJDA 1EP8A 2A2PA 4Q5NA 1B4QA 1Z9HA 3TB2A 2GT6A 1GMRA 1S5AA 4KAEA 4R1KA 1WNHA 2CQ9A 1TTOA 1JN5B 2O89A 2YV9A 3WYWA 1BAOA 1MDJA 2CX3A 5G30A 1X9SB 1IQYA 4KSOA 5LC6A 4BTXA 2H30A 1Q9EA 1F6MC 1AVKA 2HYXA 1B20A 1ML6A 2P5RA 2ZL8A 4NPBA 5IPHA 5AN1A 3EWLA 3X3ZA 2H66A 2N5AA 3CXGA 3HJOA 1BAYA 4HM0B 1M2DA 9GSSA 2F5MA 1B48A 2CVBA 4K7NA 5A4WA 4WBRD 1ZX2A 1TOFA 3LXUX 1PL1A 4XTSA 1UC7A 1A2PA 3AGNA 4PNFA 1OKTA 3GL3A 4BTWA 2CWTA 3KFQC 2GGTA 3EURA 2YNXA 1G96A 3D22A 5AIIA 3D21A 2OA7A 1XOAA 5J9BA 3S9FA 2YZUA 5IMZA 3UARA 4WR4A 4L8EA 4JR6A 1Z6NA 4KDXA 1GTUA 4EC0A 4IW9A 3FR3A 3WT1A 3CRUA 5IERA 2REMA 3M9JA 4Q5RA 2HE3A 2WS2A 3F14A 5FGOA 2V2GA 2W2CA 3CCU3 2XEPA 3A2VA 2QA1A 2PBJA 3TCOA 1X9MB 3WODG 1D6YA 4XRAA 3N5OA 1UGIA 1I3FA 3LTAA 2CA8A 2FHEA 5AI1A 1Z6MA 1YVBI 3X42A 2XPDA 4WETA 1THXA 2CG1A 3J7Yd 3HVSA 3ZFBA 3KH9A 1MTCA 1BNGA 3B8LA 8RNTA 2B5YA 2PGTA 2DJ2A 2K6VA 1T2HA 3W8SA 1RGHA 4XDVA 3CCJ3 3KH7A 2BU4A 4GHOA 2H0IA 2CZ3A 3LXTA 5DVBA 2CIUA 1KEBA 2LRCA 3Q19A 1TU8A 1Q40B 2X4AA 5IG3A 4KDUA 1BSEA 1EG9B 2WGOA 4F82A 1FGQA 3UAPA 4BL7A 2BNGA 2H01A 2HZFA 1GTBA 2K0MA 4PQHA 3K9MC 1I0VA 3G16A 3BIRA 1M3JA 2C3QA 2DKHA 2WCIA 5DAKB 1RRLA 1PSQA 2GVPA 3LTCA 4K5RA 4RI7A 5DBQA 6GSPA 1AW9A 1A8LA 3A76A 3APQA 4G1MB 2D42A 4HM3B 4X43A 1N9EA 4OFTA 1O85A 2O87A 2HLSA 3FCSB 3X3YA 4MZBA 4IP6A 2LJKA 1B2ZA 2LJAA 3WGEA 3CNXA 3ZIVA 4MF7A 3M8CA 3ERFA 1ZGNA 3MWZA 3LXZA 4RZMA 1KSIA 1GY6A 1OHPA 3OWUA 1ON4A 4KUNA 5IW9A 4AJ6A 4WEYA 1BRJA 3WA3A 3HI7A 2KOKA 3FZAA 3P8WA 1SIIA 1HQOA 2LSTA 4DSRA 1XIYA 1JZOA 1Z3EA 4V1Ap 3IV4A 3CBUA 3KZQA 2CKFB 2C1YA 3F8UA 2W56A 4Z2TA 3EQQB 3DD3A 5AYSC 1GOVA 5B7CA 1BNJA 2X64A 4FIWA 4KSMA 1QQ2A 4L0WA 5J3RA 2M80A 3N54B 3HA9A 5ECRB 4R9LA 3MG1A 3LT8A 3GV1A 1DE2A 3EF8A 1YQ1A 3D9RA 1USBA 5F8BA 1TK0B 4CCVA 5ECQB 4OCFA 2XGNA 4ZILA 2RSXA 3ERWA 5EY6A 3CME3 1K734 4MNNA 1I8VA 3SOAA 4MJBA 4PQIA 4PXOA 3EPTA 1G6WA 4OFNA 1IVXA 1W6GA 5DCHA 1W02A 1A23A 4MH2A 1K0AA 2JZTA 2PUKC 1TDIA 5DJMA 1I0XA 4IJ3A 4EIQA 3GUSA 4MMZB 1EV4A 4KW6A 1TKDB 4YKGA 1O7UA 4E8HA 5A4VA 3FMWA 2H0HA 2DJ0A 1S3DA 1SARA 3NZNA 1N5PA 2CX4A 1UDII 4MEIA 1AQWA 1WMPA 2F56A 1M9BA 3H1NA 5GAND 2XGLA 1GLQA 5ECSA 2CG0A 3VLNA 5J9CA 1QVG2 2TIRA 1PY3A 4BL3A 2N5FA 1HYFA 3CMIA 2KRTA 1CYVA 4K2XA 4TR4A 5CYYA 3QAVA 20GSA 2W9PA 1PX6A 2I81A 2QA43 4EKZA 2YV7A 4HM8B 4KNDA 5D73A 4ZBDA 2K8SA 1NM3A 2L4CA 3TOTA 4ZB9A 3QK9A 3JVCA 1OGXA 4NV5A 2KXGA 4G2EA 1N8JA 6RNTA 2HXKA 2O8VB 5IG5A 5EL8A 1K3OA 5IG0A 1UN2A 3D5JA 1O8WA 5C04A 2LKUA 1F3BA 4LL4B 4RQRA 4KGIA 4PGTA 2H71A 2FWFA 1HD2A 2L6DA 1THOA 1J2BA 3F4SA 2YANA 4ACSA 1U3AA 1ERUA 1L5GB 3LEFA 1SJWA 4GSPA 4JZQA 2RLIA 3UOMA 1PFOA 3MHEA 3ZREA 3W8JA 2H0GA 5IO2A 5HR0A 2HSHA 3KGKA 3DGQA 2WDUA 2YFJB 3HKRA 3LWAA 3GZRA 3S29A 3KM6A 3WMDA 3C71A 1O7WB 1UCKA 2Z76A 4ZBAA 4NAXA 2R6KA 1N8R4 4XM4A 3DM8A 2H1BA 3IK9A 1R5PA 3TKSE 1AY7A 2YJHA 3QAGA 4E8EA 4H61A 4IT7A 2A15A 3CQFA 5BRTA 2X99A 5M18A 1ULJB 2GZZA 1ZS7A 4V2LA 4D73A 4RNTA 1FW7A 3CCR3 4X0XA 2BHMA 4KE3A 1GRXA 4O5RA 3GN3A 6GSUA 4POKA 3EE1A 2L5OA 1W6YA 3F63A 2A2RA 5JWRB 2QSIA 1Z1SA 4AJ7A 1B2XA 4Q53A 4NHWA 3EC3A 2NDOA 4ECIA 4ZL7A 2XFTA 3AHSA 3HJPA 1OC3A 3BB9A 3BNCA 1XWGA 3GH9A 3TJGA 3JUNA 22GSA 4ML1A 2H8LA 1QMVA 3Q1CA 2HZEB 1QAKA 1GTAA 2W0QA 5CRWA 3VGNA 3BBYA 3SOYA 3IPZA 1M3IA 4LEHA 4N6MA 1W4VA 2CWUA 2B3SA 1B27A 4DSSB 4J9AA 1BRHA 2B5XA 1HU9A 4ZIJA 3P7XA 1F3AA 3AY8A 4IKHA 4OFMA 1BSCA 4KT3B 2ALBA 1X5DA 3FZ9A 4EC6A 4K8MA 3EU3A 3F3QA 3ME7A 3ZIJA 2IN3A 3F7XA 2LRNA 4EV5A 1XVQA 1UCLA 2I4AA 4POMA 1OPYA 8CHOA 4WFOA 4GLTA 1MWTA 3HX8A 3G713 4FCMA 3LFLA 4BPYA 2F51A 4WXTA 4PNGA 4DSQA 3BNDA 3FYGA 1OVNA 4EDZA 1JZDA 4N11A 3GURA 2VCQA 2OCTA 1RRHA 5D8IA 2DKIA 3TKQA 3CSJA 3CYNA 5HGRA 2PVOC 5IMDA 1MWSA 3ZMKA 1A67A 4HU7A 2L4QA 1FVKA 1YF0A 1IV9A 1BNEA 1T2IA 3N9HA 1MEKA 1PN9A 4FH8A 2CZ2A 2EIRA 4WF4A 1FYSA 3CMA3 1TRPA 3LG6A 3RNTA 1GSFA 4I2UA 3A2XA 3PGBA 3I563 5DJLA 3GTUA 4TN8A 4WKWA 1BRNL 1NO3A 5D9TA 1SL0B 2RIIA 4DSSA 2MYGA 1AC1A 2K9FA 3C7MA 1OHOA 4N6TA 4OMVA 3TJFA 5CO3A 2F5WA 1SQWA 1RTUA 2IUJA 19GSA 3JCML 1IQXA 1I3IA 1SIHA 2DJKA 3KIJA 3PGTA 1ZMAA 4KCAA 2H75A 3L0RA 2EIQA 4MZWA 1RGCA 4OCEA 2BMQB 2CX0A 3CSIA 3LYPA 3GWRA 4O5QA 1XW5A 1O81A 4LZIA 2PPTA 2CH9A 4ZB8A 1CQHA 1B2UA 2C4JA 2IWTA 2GBXB 1A2MA 3TRPA 3LGCA 2C3TA 2W04A 3HIGA 1S3AA 3EMPA 3ZFZA 1K0DA 2OKAA 7GSPA 1K3YA 2VL9A 1GUMA 2KAAA 1ZGXA 1T8EB 1U8CB 1B9YC 4MMMA 2GSPA 3IAM2 1YIT3 1PA3A 3GFKA 4HSCX 2YN1A 2W03A 3LOYA 1J08A 3L9SA 1OGZA 5ID2A 3HOHA 5FW5A 4KH7A 1ISKA 1LJRA 3KTBA 5JCUA 3KE7A 3NQZA 1GSDA 2HOHA 3IHGA 3APOA 2CFGA 3CC73 2P38A 3BNBA 1FUTA 4YAVA 5CAXA 3ZG0A 2B7KA 1S3CA 1JRQA 1A8YA 3O3TA 5EVHA 1VQO3 4ICYA 2I9WA 3A5EA 3DIEA 1A2VA 1G7OA 3LORA 2P31A 1AQXA 2CVKA 4HDEA 5I97A 2L57A 2HFDA 5GZZB 1G02A 3EX9A 1TFKA 1IV7A 4NV2A 1J0FA 3UL5A 3NV0A 2MC8A 2VCWA 3GZYB 1Z7RA 1UW1A 1SK1A 4J56E 2IY2A 3SVAA 2QEX3 6STDA 4J8TA 1O6JA 3KP9A 5IQYA 1AV4A 5JCGA 2KUCA 1YI23 5ELJA 2LQVA 4CY8A 2V1MA 1IK3A 4I2TA 1PN0A 4AKYA 2A4HA 1XFLA 5D9WA 1LOYA 3HYPA 5CREA 3TOUA 2C4BA 4KB3A 1KC84 1KTEA 2D2ZA 3ALAA 2V32A 3TRQA 4GB5A 5GAPD 1GD3A 1KNGA 2LQQA 1TP6A 1SENA 1Q98A 1CH0A 2X8GA 2H74A 3HHVA 1T00A 2XSOB 5B6NA 3F9UA 4GTUA 1OACA 5CF1A 1OC9A 5CRGA 4DVCA 1JHBA 1KBNA 1X5CA 3FLJA 1PKWA 4HM1B 1O73A 2VUPA 1V98A 4IQAA 2R2JA 2MMAA 2DC5A 1NHYA 3E9JB 5IM9A 1RGKA 4OWYA 1GUHA 2O7KA 5ECHB 2VL3A 1T4YA 3RGAA 8GSSA 3NBRA 1XWCA 2H1GA 3PH9A 4O32A 1ERWA 4N0ZA 3L9UA 5CLKA 3C1RA 2AV4A 2PNCA 1YF1A 3MSZA 5JWOB 2BIRA 2AB6A 1LOVA 3PPUA 4EIPA 5KN3A 2AHEA 1EEJA 2P09A 3VPQA 4L5LA 3UBKA 4RI6A 3BCKA 4K1FA 5D96A 2IMIA 4HM2B 2OOVA 1M1K4 1T1VA 1XPVA 2WGQA 3G8ZA 4JRFA 4PQ1A 3EU4A 3C73A 4YQUA 1FHEA 3A2WA 3DGNA 1A2JA 4I8BA 3HY2A 4MLYA 5ECPB 6GSTA 1SD9A 1C7HA 1VQ53 2FGTA 2WZ9A 4GSTA 1IQ8A 5KN2A 1HNCA 1UA5A 3GHAA 2CFLA 3IPTA 2LJRA 3DMLA 5AGYA 1TFOA 1LU4A 3B4PA 2PERA 12GSA 4LA1A 1XOBA 2CAQA 3DH2A 3IC8A 2DIZA 3RAZA 3U6VA 4OD7A 4N6OB 4BTYA 4EVMA 4X2OA 5ELGA 1YHQ3 1B9XC 2IMEA 3BU4A 2E2MA 4I6XA 4FR9A 4HM7B 5AIHA 4EDYA 4XBTA 3GAXA 1FG4A 4IJIA 3Q18A 4BL7B 1CYUA 1OUNA 2G2QA 5JPPA 3E3EA 5IEOA 2L1SA 1FB6A 4FCJA 3TKPA 4TXVA 1UCJA 2H6XA 4HYZA 3CD63 2H73A 2GBWB 4HKVB 1MOLA 2V6OA 2VOCA 1QVF2 4CJNA 1SJ6A 3IC4A 3MNGA 4RQXA 4Z7XA 1BRIA 1FGRA 5LNKe 3CTFA 4F0BA 3GKMA 4K0GA 4GQFA 3BLZA 1IYYA 4G0LA 2GXFA 1BU4A 4AGSA 3DXBA 1EWXA 3UVTA 5AEUB 2A2SA 5F05A 4L0UA 1GULA 1X0RA 2CV4A 1UUVB 3KTLA 1NHOA 2M72A 4V2MA 3GNJA 1SJIA 1GMQA 1OC8A 4EE0A 3M3MA 1SKWB 1GOYA 2XH9A 3KSPA 2M46A 2WOHA 2L4VA 1WOUA 2OE0A 1NNVA 2H6ZA 2ZHXB 3RHBA 4F2IA 3F3RA 5IPGA 1WRYA 3F9SA 2P0MA 2KP1A 1OHSA 3GX0A 3VWWA 3TGZA 3G9BA 3PINA 2W56B 2E2TA 3AHWA 5AIGA 1AQVA 4K1VA 3BOAA 1SYXA 4FMCA 3FKFA 3DUKA 5KOXA 4G19A 3LQ7A 2SARA 4MK3A 3DMCA 18GSA 2GQLA 4WWUC 4OK0A 1AUCA 1EP7A 2Z9SA 1JB4A 2CFWA 1EA2A 1LBKA 4LMVA 1JKGA 5FHIA 3M8NA 1I2GA 4KZ1A 3LTDA 5EVOA 2FA4A 1W6CA 1YIJ3 2N5BA 3VWVA 1Y25A 1AQZA 3ER7A 3NXJA 4I5QA 3F8HA 5J5NA 2FY6A 1UGHI 5ENUA 3ED3A 3IJEB 3PYJA 2B24B 2P05A 1G6YA 1BRGA 1VQK3 4MJEA 4MZCA 2ZA4A 3S67A 1SYRA 4IQ1A 4JRRA 3JUPA 1TP9A 3NBBA 5EPFA 2OOVC 1EOGA 3RDEA 5LC7A 1YNVX 5ELAA 2H1DA 3D4MA 4BWSA 2RBIA 3WGXA 1SU9A 3IXRA 1HNAA 2FWGA 3GKKA 3KCMA 1M0UA 2DMLA 3US3A 3NOFA 4O3VA 3EC9A 4WP5A 5EQLA 1Q824 4RUVA 4ULXA 1FOHA 1LOXA 3NM7A 1O7GB 3QAWA 2RGQA 3ERGA 1J9BA 1RGFA 1A0FA 2GEYA 1AIUA 3UBLA 4YQMA 4EW5A 1JJ22 1A0RP 1FVJA 2YWIA 2MF7A 2AYTA 1AAZA 1URMA 3F6DA 4MJCA 5BIRA 1JZRA 3JUMA 3SLUA 2HRKA 5DALA 2DSAA 1MDKA 4N10A 1BRKA 4IVFA 3K0ZA 1K0BA 3F7SA 1PMTA 2JADA 3TJBA 4XS1A 5AEWB 1S723 3V92A 3QR6A 4G0IA 1B21A 3JUOA 1OF5B 4CHSA 1JLWA 3Q6OA 1IDPA 3GRDA 3U1WA 2LRTA 1WE0A 3IHQA 2GSQA 2VLTA 1TIJA 3KEBA 1YJ6A 3QDNA 4O2HA 3U5RE 5F06A 3WOFB 1VQL3 3BD2A 1ERTA 2ES7A 4BU4A 2P5QA 2XR8B 3A5WA 4F03A 1WP0A 4D73B 1V57A 1RCKA 3OW22 11GSA 3ZITA 5HFKA 2BT3A 2CAIA 1FUWA 1TK5B 5G31A 2EC4A 2QGUA 3QD9A 2CFDA 5DCGA 1RGAA 1E97A 3TJKA 3NUVA 1CQSA 5HOHA 4N6LA 3EBYA 1TI1A 2J23A 3UL3A 5FT3A 5M1AA 1U3IA 2CW9A 1PU4A 1YKAA 1WMNA 1DSBA 1WMJA 3KJYA 1QXHA 2CHCA 1W2ZA 3FG3A 1C72A 2AAEA 1LQMB 3EHCA 4AF2A 1VQ43 2R0PA 6GSVA 1OF5A 2R5GA 4BWQA 4HJMA 3URPA 3DGMA 5CP1A 1X9WB 2FNQA 7STDA 2B1LA 3CTGA 1E2YA 1RNBA 3H79A 2OBKA 2JZRA 2TRXA 4EYCA 2HSMA 2L5LA 2JDIH 3KIIA 3ROBA 3D4TA 1U88A 3G6E3 2V6KA 1VRSD 4KDYA 3ZMLA 2BMOB 1MWRA 4RNYA 4G10A 5D82A 1RSNA 4J2FA 1K8A4 2INXA 1UCIA 5H5QA 1X1XA 3JUQA 2GQMA 3CCQ3 3O8YA 1STDA 2CK3H 2FXTA 1BNSA 4L7KA 5D83A 4LLRA 2WRTA 4U13A 5CXOA 4FMAA 1RKYA 1TI3A 3Q90A 4TXOA 1VF2A 1RN7A 1ST9A 3B7CA 1E6BA 2ZNMA 2RCDA 1PGTA 6GSSA 1QK8A 2XBQA 1O7HB 1GTIA 3CNMA 3MDKA 1M7TA 4FYUA 3UNLA 2KF4A 2OADA 1T7PB 2E2VA 3ZRDA 1RJOA 1NB5I 4EF0A 3ZLPA 3KZTA 5BU4A 4O92A 4MF5A 2HI7A 6GSXA 3PZWA 3VPTA 1N9JA 2I1UA 3UVHA 2ZCTA 1DYUA 1EEMA 4ID0A 5D81A 1VQ83 3E0UA 4OVMA 3S5CA 2LUSA 1TUHA 3GTUB 2MZCA 4G9HA 2O85A 2CC3A 1EGRA 1LNHA 4GF0A 3MYTA 5ECLB 1FW1A 2GZYA 2BO9B 3X3XA 3V98A 1GSPA 2OQEA 1R5AA 1QJGA 4EBGA 2C80A 1SKRB 3DWVA 2O3OA 1ASKA 5C00A 2H6YA 1BNRA 3VSYA 1DVCA 2OTL3 1O7MB 4KX4A 2EIOA 5E4WA 3N9JA 5B6MA 4ILFA 2DBCA 3IK7A 4FMBA 2ML5A 3PR8A 4BL2A 2PN8A 4FO5A 3D79A 3VI7A 1ROAA 3UIWA 2ON5A 3SXXA 4GQCA 1R7HA 3HXSA 2F99A 2AADA 3T0UA 2B7JA 3QPMA 4K7IA 2XFSA 2Y74A 2C3NA 3VWUA 4HQSA 1RLSA 4KA0A 1A90A 3IOSA 2OWPA 4PEJA 1RW1A 2OACA 5GSPA 1QMAA 1OE7A 3STDA 5IF6A 1JBSA 1Q42A 2MBSA 1TRVA 3O6TA 3CC43 1GSUA 4I97A 3FRCA 3FZWA 3SYUA 3DRNA 5ID2B 5J41A 4V2NA 1BVIA 3MKIA 5HQPA 1DBYA 3NBJA 5IEPA 2FLSA 1QAFA 3D4AA 1OH0A 4X2HA 3WHOA 3F6FA 4EUYA 1B3SA 1IT8A 2VM1A 4FYBA 5H5SA 1TU7A 1IVUA 3D3LA 4N30A 1DVDA 2HRFA 2NPBA 1VQN3 2TRCP 5CRDA 1FA3A 1XVWA 5ABRA 1LQGC 3GZBA 1G7EA 1VQ63 3F4TA 1LVNA 3FY7A 1DE1A 2GU1A 3NV0B 3HK4A 3IR4A 4IELA 5ECOB 3I0YA 2IA7A 2IMFA 4WF5A 4A5PA 2PU9C 2GS3A 2R0GA 4HZBB 1I70A 1W89A 1B8XA 2WOFA 2WULA 2MMOA 4HJLB 4JEDA 1GS3A 2F3MA 1DMMA 2B1XB 3FH1A 4YAPA 1HNBA 4Z2UA 1XG8A 1NU3A 5KN1A 1EOHA 3EINA 1M9GA 4XIHA 3FF0A 5IMFA 3NX0A 4ECCA 3LYGA 1V2AA 3HDCA 2XSHB 3E99A 4GWRA 4JU5A 4XBXA 1VF1A 3GX8A 3DY5A 1ZYPA 1PRXA 4IBPA 2P0XA 2B5EA 5HR2A 4PUAA
chains in the Genus database with same CATH topology
2DJJA 1TRUA 4XS6A 3TKRA 1OC9B 4ZXGA 1V9WA 5B8BA 2KHPA 4ZL8A 5HR3A 2R0CA 2FWEA 3FK8A 3BCIA 3L0HA 4JBBA 1SL2B 2YOIA 2YPMA 2FA8A 2IMKA 1SL1B 4X1UA 1XWBA 2QGVA 4MPGA 1HYUA 1OAZA 3A5IA 3VURA 3L78A 3GMFA 4ECJA 2IYJA 3KD0A 2C0DA 2JACA 2AJQB 4N0VA 1B4PA 5HFIA 5INYA 3M0FA 2FCHA 1ERVA 2H72A 5G5EA 1OYJA 5DQSA 3ISOA 1ABAA 1M2BA 1ILOA 4XS4A 5IMVA 3ZVJA 1U87A 2MBTA 4PURA 3MIXA 3HD5A 2GT5A 1QFNA 5IMCA 3IDVA 4V1Ag 4WBJA 2IIYA 1VGLA 2VAFA 2I3YA 3VWXA 4Q5FA 4EL1A 2L6CA 1VF4A 1FO5A 1GL8A 3L9VA 3DVWA 3KXOA 5KEJA 4TR0A 1R4WA 1PD21 3FEUA 3VI5A 2HRNA 4EO3A 1XWKA 4X4JA 1Q4JA 3WGDA 3KMNA 3O76A 1TRSA 4F0CA 1MDIA 4GSNA 1M99A 4BVXA 1JFUA 4GXZA 1X5EA 2C8UA 2HRAA 4POBA 3F4RA 4NXIA 4ISDA 2F8FA 5G1KA 4CDOA 4HZ4A 1M9AA 2FD3A 1R26A 3MAKA 4TKYA 1U6TA 3TRXA 3IAS2 3HCZA 3ZFLA 1Z7PA 3KP8A 2YWMA 3C1SA 3C8EA 4LMWA 5CNWA 2LNTA 13GSA 4GRFA 2RM5A 2XHFA 3WD6A 4K0NA 3R2QA 3RHCA 3G7JA 4G0KA 2I9HA 3I43A 2QA2A 7GSSA 2F8AA 5GSTA 2HT9A 2MMNA 2VCVA 1H4OA 3EMXA 3IA1A 5JCWA 1XBSA 2YZHA 1V58A 4NMUA 5D93A 2IL3A 2GTUA 5KOWA 1EGOA 5ECNB 4JR4A 2GSTA 3H8QA 4HU9A 3HVVA 4TRXA 3UMAA 3FR6A 3EE2A 1ZYNA 1SK2A 2JZSA 2CT6A 5ECKB 1G0TA 5A4UA 1GLPA 1N2AA 3LSZA 3DEXA 1SKSB 4KF9A 1T4ZA 2LTKA 4OO5A 5HR1A 4ZB6A 1SJZA 2VD1A 3GKXA 3TUEA 3GRXA 4OO4A 3GIXA 3OR5A 3Q74A 4ECBA 3CRTA 5DALB 4BVYB 2VLVA 4O5UA 1AXDA 2P0GA 2LNSA 1TRWA 1XZOA 1MD3A 2LS5A 1EZKA 1TW9A 1Z5YE 14GSA 4CW9A 3IBHA 4YH2A 2FWHA 2FUG2 1ACVA 1TK8B 2ZUPA 16GSA 2DLXA 3QOUA 2XPEA 2UZ8A 3HVXA 4HJ2A 1ZCPA 1SD8A 3HZ4A 4K7OA 4WR5A 3D6IA 4IGJA 3TDGA 5ECMB 2VCTA 4J57E 2PMTA 1H75A 4BA7A 1NSWA 2VCXA 4HUAA 1TJDA 5B8AA 3J7Yb 2PVQA 2C0FA 5GSSA 4BVYA 2GSRA 2X8CA 3FHKA 5IO0A 4DEJA 1K0NA 1VF3A 1F37A 2YWNA 4POLA 2K8VA 1WJKA 1WWJA 5ECIB 4MABA 4HS1A 5DAKA 5AIVA 1YY7A 3G7IA 3GH6A 4QQ7A 2QC7A 3P2AA 3UEMA 1GSYA 3J7Yk 1FOVA 2NTOA 4HQZA 1OE8A 1RQMA 1O8XA 1YKCA 1XXUA 4ZL9A 1QGVA 2YJ7A 5IIZA 2E0QA 2X49A 2PWJA 1PKZA 3FZ4A 3K8NA 1K0MA 1RK4A 2X8HA 1XCCA 4TXOB 1A24A 2DJ3A 4ML6A 2YWOA 4K2DA 3I9V2 2GQKA 1GNWA 2YCDA 4MA9A 3DKSA 2RUFA 1GSSA 2GDRA 1BX9A 2B6MA 5DDLA 3NIVA 1K0CA 3EVIA 1V40A 4NHZA 4L5OA 2RUEA 2IJYA 2BTOT 2WFCA 4O7HA 4Q5QA 3FR9A 3SWLA 5IOWA 3VK9A 5FWGA 5D9VA 5CRHA 1IYHA 4XRDA 4YKFA 4AJ8A 5BMUA 2HNLA 3IE3A 2E7PA 1K0OA 1GWCA 4MDCA 4MJAA 3HZ8A 1GP1A 2CVDA 3ZVJD 5KN0A 3ZYWA 4HI7A 3RPPA 3MYDA 4IHUA 1GSEA 2YP6A 2LQOA 2VM2A 4GCIA 3HJMA 4TOPA 2GZPA 4MF6A 4TR3A 2AAWA 3ZL5A 3GKNA 2GLRA 5G5FA 4K5SA 5AISA 4JE1A 2KLXA 1F9MA 3QFAC 2NVLA 2OJLA 3I69A 4KCEA 2WGRA 3BJ5A 1Y6EA 3L4NA 1WPIA 4XCSA 2AUVA 2VO4A 3MWHA 3TKSA 1T3BA 1JZWA 4MPFA 1FAAA 2K18A 1CQGA 4TR1B 1GSQA 5LCZA 3GA4A 3H93A 1UVZA 3UJ1A 2VIMA 3RBTA 5F0GA 2QKEA 3LW9A 1GUKA 3RDWA 2BJXA 1XWAA 3V1WA 2NBSA 2HSYA 5COHA 1F2EA 3GYKA 4IN0A 1TTZA 2G0FA 1A2LA 1PQNA 1SK0A 2XBIA 3FW2A 3LYKA 2E2GA 2KP2A 1EV9A 1BJXA 2MMZA 2R37A 3KMOA 1FB0A 3FZ5A 5L71A 5JWQB 2A4VA 2VL2A 3I6AA 4QL7A 2HZEA 2VD0A 10GSA 4TR1A 3A3TA 3TJJA 1GH2A 1BEDA 4PUFC 4H86A 2WJUA 2DIYA 5DQYA 4Z2RA 3M1GA 3P90A 5HFGA 2C0GA 1PX7A 2L59A 1WIKA 6GSWA 2IPAA 4TVEA 3QFBC 3GL5A 2FNOA 6GSYA 4CY6A 4LL1B 1ZOFA 5IOXA 3LJRA 2VCZA 4PX1A 1OKDA 1I9DA 3WT2A 4XS4B 3QCPA 1GNEA 5A5KA 2FGXA 5J4UA 2JSZA 1QUWA 4MCUA 3R3EA 1JLVA 1XW6A 2H76A 5IMAA 2R3XA 2ON7A 4FYCA 4P3YB 1ZL9A 4EXJA 3ME8A 4IS0A 2LEGA 2V41A 5F07A 2IFQB 2DMMA 4IP1A 2OE3A 1ZYQB 2JU5A 3D0ZA 3G7YA 3RPNA 4HEA2 3TKSC 1ZYEA 3F0IA 3VFIA 2J9HA 2XC2A 1NW2A 3CSHA 3M9KA 2C0EA 2H1AA 17GSA 5LD0A 3GSTA 4BVXB 5AIXA 2JSYA 4K9ZA 2JL4A 2VLUA 2H70A 5E59A 1M2AA 1DUGA 3H4KA 4FQUA 5H5RA 4ZBBA 1XW9A 2F9SA 2OE1A 1BYEA 4MH3A 3ZZXA 4K6XA 3W6GA 2IMDA 2GSSA 5D9XA 4HZ2A 4PTSA 2H19A 2IFQA 4GSSA 4YQVA 2DJ1A 1PL2A 2OBIA 3ZTLA 4HOJA 1MD4A 1ZZYA 1YEXA 4MP4A 4QL9A 5G1LA 1I5GA 4USSA 2VL2C 2B1KA 3IRAA 3QMXA 3APSA 3EYTA 4NWYA 1IYIA 2R4VA 1BG5A 2BMXA 1YZXA 5G2ZA 3DVXA 3SBCA 4F9ZA 2RM6A 1K3LA 2WB9A 1YEPA 4TW5A 1BQ7A 3DYRA 2LV3A 1YDKA 1TXXA 3GSSA 1EP8A 2A2PA 4Q5NA 1B4QA 1Z9HA 3TB2A 2GT6A 4KAEA 2CQ9A 2O89A 2YV9A 3WYWA 1MDJA 2CX3A 5G30A 1X9SB 4KSOA 2H30A 1F6MC 2HYXA 1ML6A 2P5RA 4NPBA 5IPHA 5AN1A 3EWLA 2H66A 2N5AA 3CXGA 3HJOA 1BAYA 1M2DA 9GSSA 1B48A 4K7NA 2CVBA 5A4WA 4WBRD 1TOFA 1PL1A 4XTSA 1UC7A 4PNFA 1OKTA 3GL3A 2GGTA 3EURA 2YNXA 3D22A 3D21A 2OA7A 1XOAA 5J9BA 3S9FA 2YZUA 5IMZA 3UARA 4WR4A 4L8EA 4JR6A 1Z6NA 4KDXA 1GTUA 4EC0A 4IW9A 3FR3A 3WT1A 3CRUA 2REMA 3M9JA 4Q5RA 2HE3A 2WS2A 2V2GA 3A2VA 2QA1A 2PBJA 3TCOA 1X9MB 4XRAA 3N5OA 2CA8A 2FHEA 1Z6MA 4WETA 2XPDA 1THXA 3HVSA 3ZFBA 3KH9A 1MTCA 2B5YA 2PGTA 2DJ2A 2K6VA 3W8SA 3KH7A 2H0IA 2CZ3A 3LXTA 5DVBA 1KEBA 2LRCA 3Q19A 1TU8A 2X4AA 4KDUA 4PUAA 4F82A 3UAPA 4BL7A 2H01A 2HZFA 1GTBA 4PQHA 2WCIA 2C3QA 2DKHA 5DAKB 1PSQA 2GVPA 4K5RA 4RI7A 5DBQA 1AW9A 1A8LA 3APQA 4X43A 4OFTA 1O85A 2O87A 2HLSA 4MZBA 4IP6A 2LJKA 2LJAA 3WGEA 3ZIVA 4MF7A 3ERFA 1ZGNA 3LXZA 1ON4A 4KUNA 4AJ6A 4WEYA 2KOKA 3FZAA 3P8WA 1HQOA 2LSTA 4DSRA 1XIYA 1JZOA 4V1Ap 1Z3EA 3IV4A 3CBUA 3KZQA 2C1YA 3F8UA 4Z2TA 3DD3A 5B7CA 2X64A 4FIWA 4KSMA 1QQ2A 4L0WA 5J3RA 2M80A 3HA9A 5ECRB 3GV1A 1DE2A 1YQ1A 1USBA 5F8BA 1TK0B 5ECQB 4OCFA 4ZILA 3ERWA 5EY6A 4MNNA 4MJBA 4PQIA 4PXOA 3EPTA 1G6WA 4OFNA 5DCHA 1A23A 4MH2A 1K0AA 2JZTA 2PUKC 1TDIA 5DJMA 4EIQA 4IJ3A 3GUSA 1EV4A 4KW6A 1TKDB 4YKGA 1O7UA 4E8HA 5A4VA 3FMWA 2H0HA 2DJ0A 1S3DA 3NZNA 2CX4A 1AQWA 1M9BA 3H1NA 5GAND 1GLQA 5ECSA 3VLNA 5J9CA 2TIRA 2N5FA 3CMIA 4K2XA 4TR4A 5CYYA 3QAVA 20GSA 2I81A 1PX6A 4EKZA 2YV7A 4KNDA 5D73A 4ZBDA 2K8SA 1NM3A 2L4CA 3TOTA 4ZB9A 4NV5A 4G2EA 1N8JA 2HXKA 2O8VB 5EL8A 1K3OA 1UN2A 3D5JA 1O8WA 5C04A 2LKUA 1F3BA 4LL4B 4RQRA 4KGIA 4PGTA 2H71A 2FWFA 1HD2A 2L6DA 1THOA 3F4SA 2YANA 4ACSA 1U3AA 1ERUA 3LEFA 4JZQA 2RLIA 3UOMA 3ZREA 3W8JA 2H0GA 5IO2A 5HR0A 2HSHA 3KGKA 3DGQA 2WDUA 3HKRA 3LWAA 3KM6A 3C71A 4ZBAA 4NAXA 2R6KA 2H1BA 3IK9A 1R5PA 3TKSE 2YJHA 3QAGA 4E8EA 5BRTA 2X99A 2GZZA 4V2LA 4D73A 4X0XA 1GRXA 4KE3A 4O5RA 3GN3A 6GSUA 4POKA 2L5OA 3F63A 2A2RA 5JWRB 2QSIA 4AJ7A 4NHWA 3EC3A 2NDOA 4ECIA 4ZL7A 3HJPA 1OC3A 1XWGA 3GH9A 3TJGA 22GSA 4ML1A 2H8LA 1QMVA 2HZEB 1GTAA 5CRWA 3BBYA 3IPZA 1W4VA 2B3SA 4DSSB 2B5XA 4ZIJA 3P7XA 1F3AA 3AY8A 4IKHA 4OFMA 2ALBA 1X5DA 3FZ9A 4K8MA 3EU3A 3F3QA 3ME7A 3ZIJA 2IN3A 2LRNA 1XVQA 2I4AA 4POMA 4GLTA 3LFLA 4BPYA 2F51A 4WXTA 4PNGA 4DSQA 3FYGA 1OVNA 4EDZA 1JZDA 4N11A 3GURA 2VCQA 5D8IA 2DKIA 3TKQA 3CSJA 3CYNA 2PVOC 5IMDA 3ZMKA 4HU7A 2L4QA 1FVKA 1YF0A 1MEKA 1PN9A 4FH8A 2CZ2A 2EIRA 4WF4A 3LG6A 1GSFA 4I2UA 3A2XA 5DJLA 3GTUA 4TN8A 4WKWA 5D9TA 1SL0B 2RIIA 4DSSA 2MYGA 1AC1A 2K9FA 3C7MA 4OMVA 3TJFA 5CO3A 19GSA 3JCML 2DJKA 3KIJA 3PGTA 1ZMAA 4KCAA 2H75A 2EIQA 4MZWA 4OCEA 3CSIA 3LYPA 4O5QA 1XW5A 1O81A 2PPTA 4ZB8A 1CQHA 2C4JA 2IWTA 1A2MA 3TRPA 3LGCA 2C3TA 1S3AA 3EMPA 1K0DA 2OKAA 1K3YA 2VL9A 1GUMA 1T8EB 4MMMA 1B9YC 3IAM2 1PA3A 3GFKA 2YN1A 1J08A 3L9SA 5ID2A 4KH7A 1LJRA 3KTBA 5JCUA 1GSDA 3IHGA 3APOA 4YAVA 5CAXA 2B7KA 1S3CA 1A8YA 3O3TA 4ICYA 3DIEA 1G7OA 3LORA 2P31A 1AQXA 2CVKA 4HDEA 2L57A 2HFDA 5GZZB 4NV2A 1J0FA 2VCWA 1Z7RA 1SK1A 4J56E 2IY2A 1O6JA 3KP9A 5IQYA 5JCGA 2KUCA 4CY8A 2V1MA 4I2TA 1PN0A 2A4HA 1XFLA 5D9WA 3HYPA 5CREA 3TOUA 4KB3A 1KTEA 2D2ZA 2V32A 3TRQA 5GAPD 1KNGA 2LQQA 1SENA 1Q98A 3HHVA 2X8GA 2H74A 5B6NA 1T00A 3F9UA 4GTUA 1OC9A 5CRGA 4DVCA 1JHBA 1KBNA 1X5CA 1PKWA 1O73A 2VUPA 1V98A 4IQAA 2R2JA 2MMAA 2DC5A 1NHYA 3E9JB 5IM9A 4OWYA 1GUHA 2O7KA 5ECHB 2VL3A 1T4YA 8GSSA 1XWCA 2H1GA 3PH9A 4O32A 1ERWA 4N0ZA 3L9UA 3C1RA 2AV4A 3MSZA 1YF1A 5JWOB 2AB6A 3PPUA 4EIPA 5KN3A 2AHEA 1EEJA 3VPQA 4L5LA 3UBKA 4RI6A 3BCKA 4K1FA 5D96A 2IMIA 1T1VA 1XPVA 4PQ1A 3EU4A 3C73A 4YQUA 1FHEA 3A2WA 1A2JA 4I8BA 3HY2A 4MLYA 5ECPB 6GSTA 1SD9A 2WZ9A 4GSTA 5KN2A 1HNCA 1UA5A 3GHAA 2LJRA 3DMLA 5AGYA 1LU4A 2PERA 12GSA 4LA1A 1XOBA 2CAQA 3IC8A 2DIZA 3RAZA 3U6VA 4OD7A 4EVMA 5ELGA 1B9XC 2IMEA 2E2MA 4I6XA 4EDYA 1FG4A 4IJIA 3Q18A 4BL7B 2G2QA 3E3EA 1FB6A 3TKPA 4TXVA 2H6XA 2H73A 2VOCA 2V6OA 1SJ6A 3IC4A 3MNGA 4RQXA 4Z7XA 5LNKe 3CTFA 4F0BA 3GKMA 4K0GA 4GQFA 4G0LA 4AGSA 3DXBA 1EWXA 3UVTA 5F05A 2A2SA 4L0UA 1GULA 1X0RA 2CV4A 3KTLA 1NHOA 2M72A 4V2MA 3GNJA 1SJIA 1OC8A 4EE0A 3M3MA 1SKWB 2M46A 1WOUA 2OE0A 2H6ZA 4F2IA 3RHBA 5IPGA 3F3RA 1WRYA 2KP1A 3GX0A 3VWWA 3TGZA 3G9BA 3PINA 3BOAA 1AQVA 1SYXA 3FKFA 5KOXA 4G19A 3LQ7A 4MK3A 18GSA 2GQLA 1AUCA 1EP7A 2Z9SA 1LBKA 4LMVA 5FHIA 3M8NA 5EVOA 2FA4A 2N5BA 3VWVA 1Y25A 4I5QA 5J5NA 2FY6A 5ENUA 3ED3A 1G6YA 4MJEA 4MZCA 1SYRA 4IQ1A 4JRRA 1TP9A 5EPFA 1EOGA 5ELAA 2H1DA 3D4MA 4BWSA 3WGXA 1SU9A 3IXRA 1HNAA 2FWGA 3GKKA 3KCMA 1M0UA 2DMLA 3US3A 3NOFA 4RUVA 4ULXA 1FOHA 3QAWA 3ERGA 1J9BA 1A0FA 1AIUA 3UBLA 4YQMA 1FVJA 1A0RP 2YWIA 3F6DA 2AYTA 1AAZA 1URMA 4MJCA 1JZRA 2HRKA 5DALA 2DSAA 1MDKA 4N10A 4IVFA 1K0BA 1PMTA 2JADA 3TJBA 4XS1A 3QR6A 4G0IA 4CHSA 1JLWA 3Q6OA 2LRTA 1WE0A 3IHQA 2GSQA 2VLTA 3KEBA 1YJ6A 3QDNA 3U5RE 5F06A 3BD2A 1ERTA 2ES7A 2P5QA 3A5WA 4F03A 1WP0A 4D73B 1V57A 11GSA 3ZITA 5HFKA 2CAIA 1TK5B 5G31A 2EC4A 3QD9A 5DCGA 3TJKA 1TI1A 2J23A 3UL3A 5FT3A 1U3IA 1YKAA 1DSBA 1WMJA 3KJYA 1QXHA 1C72A 4AF2A 2R0PA 6GSVA 2R5GA 4BWQA 4HJMA 5CP1A 1X9WB 2B1LA 3CTGA 1E2YA 3H79A 2OBKA 2JZRA 2TRXA 2HSMA 2L5LA 3D4TA 1U88A 2V6KA 1VRSD 4KDYA 3ZMLA 4G10A 4J2FA 5H5QA 2GQMA 4LLRA 2WRTA 1TI3A 4TXOA 1VF2A 1ST9A 1E6BA 2ZNMA 1PGTA 6GSSA 1QK8A 2XBQA 1GTIA 3MDKA 1M7TA 4FYUA 2OADA 1T7PB 3ZRDA 4EF0A 3ZLPA 4O92A 4MF5A 2HI7A 6GSXA 3VPTA 2I1UA 3UVHA 2ZCTA 1EEMA 4ID0A 3E0UA 2LUSA 3GTUB 2MZCA 4G9HA 2O85A 1EGRA 4GF0A 5ECLB 1FW1A 2GZYA 1R5AA 2C80A 1SKRB 3DWVA 5C00A 2H6YA 4KX4A 2EIOA 5E4WA 3N9JA 5B6MA 4ILFA 2DBCA 3IK7A 3PR8A 4FO5A 2PN8A 3VI7A 3UIWA 2ON5A 4GQCA 1R7HA 3HXSA 2B7JA 4K7IA 3QPMA 2C3NA 3VWUA 4HQSA 4KA0A 3IOSA 1RW1A 2OACA 1OE7A 2MBSA 1TRVA 3O6TA 1GSUA 4I97A 3FRCA 3DRNA 5ID2B 5J41A 4V2NA 5HQPA 1DBYA 2FLSA 3F6FA 4EUYA 2VM1A 4FYBA 5H5SA 1TU7A 4N30A 2HRFA 2NPBA 2TRCP 5CRDA 1XVWA 5ABRA 1G7EA 3F4TA 3FY7A 1DE1A 3IR4A 5ECOB 4IELA 4A5PA 4WF5A 2IMFA 2PU9C 2GS3A 2R0GA 1W89A 1B8XA 2WULA 2MMOA 4JEDA 2F3MA 4YAPA 1HNBA 4Z2UA 5KN1A 1EOHA 3EINA 4XIHA 5IMFA 4ECCA 1V2AA 3HDCA 4GWRA 4JU5A 1VF1A 3GX8A 1ZYPA 1PRXA 4IBPA 2B5EA 5HR2A 4XHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJJ A;  1TRU A;  4XS6 A;  3TKR A;  1OC9 B;  4ZXG A;  1V9W A;  5B8B A;  2KHP A;  4ZL8 A;  5HR3 A;  2FWE A;  3FK8 A;  3BCI A;  3L0H A;  4JBB A;  1SL2 B;  2YOI A;  2YPM A;  2FA8 A;  2IMK A;  1SL1 B;  4X1U A;  1XWB A;  2QGV A;  4MPG A;  1HYU A;  1OAZ A;  3VUR A;  3L78 A;  3GMF A;  4ECJ A;  2IYJ A;  3KD0 A;  2C0D A;  2JAC A;  2AJQ B;  4N0V A;  1B4P A;  5HFI A;  5INY A;  3M0F A;  2FCH A;  1ERV A;  2H72 A;  5G5E A;  1OYJ A;  5DQS A;  3ISO A;  1ABA A;  1M2B A;  1ILO A;  4XS4 A;  5IMV A;  3ZVJ A;  1U87 A;  2MBT A;  4PUR A;  3HD5 A;  2GT5 A;  1QFN A;  5IMC A;  3IDV A;  4V1A g;  4WBJ A;  2IIY A;  1VGL A;  2VAF A;  2I3Y A;  3VWX A;  4Q5F A;  4EL1 A;  2L6C A;  1VF4 A;  1FO5 A;  1GL8 A;  3L9V A;  3DVW A;  3KXO A;  5KEJ A;  4TR0 A;  1R4W A;  1PD2 1;  3FEU A;  3VI5 A;  2HRN A;  4EO3 A;  1XWK A;  1Q4J A;  3WGD A;  3KMN A;  3O76 A;  1TRS A;  4F0C A;  1MDI A;  4GSN A;  1M99 A;  4BVX A;  1JFU A;  4GXZ A;  1X5E A;  2C8U A;  4POB A;  3F4R A;  4NXI A;  4ISD A;  2F8F A;  5G1K A;  4CDO A;  4HZ4 A;  1M9A A;  2FD3 A;  1R26 A;  3MAK A;  4TKY A;  1U6T A;  3TRX A;  3IAS 2;  3HCZ A;  3ZFL A;  1Z7P A;  3KP8 A;  2YWM A;  3C1S A;  3C8E A;  4LMW A;  5CNW A;  2LNT A;  13GS A;  4GRF A;  2RM5 A;  2XHF A;  3WD6 A;  4K0N A;  3R2Q A;  3RHC A;  3G7J A;  2I9H A;  3I43 A;  7GSS A;  2F8A A;  5GST A;  2HT9 A;  2MMN A;  2VCV A;  1H4O A;  3EMX A;  3IA1 A;  5JCW A;  1XBS A;  2YZH A;  1V58 A;  4NMU A;  5D93 A;  2IL3 A;  2GTU A;  1EGO A;  5ECN B;  4JR4 A;  2GST A;  3H8Q A;  4HU9 A;  3HVV A;  4TRX A;  3UMA A;  3FR6 A;  3EE2 A;  1SK2 A;  2JZS A;  2CT6 A;  5ECK B;  1G0T A;  5A4U A;  1GLP A;  1N2A A;  3LSZ A;  3DEX A;  1SKS B;  1T4Z A;  2LTK A;  4OO5 A;  5HR1 A;  4ZB6 A;  1SJZ A;  2VD1 A;  3GKX A;  3TUE A;  3GRX A;  4OO4 A;  3GIX A;  3OR5 A;  3Q74 A;  4ECB A;  3CRT A;  5DAL B;  2VLV A;  1AXD A;  2P0G A;  2LNS A;  1TRW A;  1XZO A;  1MD3 A;  2LS5 A;  1EZK A;  1TW9 A;  1Z5Y E;  14GS A;  4CW9 A;  3IBH A;  4YH2 A;  2FWH A;  2FUG 2;  1ACV A;  1TK8 B;  2ZUP A;  16GS A;  2DLX A;  3QOU A;  2XPE A;  3HVX A;  4HJ2 A;  1ZCP A;  1SD8 A;  3HZ4 A;  4K7O A;  4WR5 A;  3D6I A;  4IGJ A;  3TDG A;  5ECM B;  2VCT A;  4J57 E;  2PMT A;  1H75 A;  4BA7 A;  1NSW A;  2VCX A;  4HUA A;  1TJD A;  5B8A A;  3J7Y b;  2PVQ A;  2C0F A;  5GSS A;  4BVY A;  2GSR A;  2X8C A;  3FHK A;  5IO0 A;  4DEJ A;  1K0N A;  1VF3 A;  1F37 A;  2YWN A;  4POL A;  2K8V A;  1WJK A;  1WWJ A;  5ECI B;  4MAB A;  4HS1 A;  5DAK A;  5AIV A;  1YY7 A;  3G7I A;  3GH6 A;  4QQ7 A;  2QC7 A;  3P2A A;  3UEM A;  1GSY A;  3J7Y k;  1FOV A;  2NTO A;  4HQZ A;  1OE8 A;  1RQM A;  1O8X A;  1YKC A;  1XXU A;  4ZL9 A;  1QGV A;  2YJ7 A;  5IIZ A;  2E0Q A;  2PWJ A;  1PKZ A;  3FZ4 A;  3K8N A;  1K0M A;  1RK4 A;  2X8H A;  1XCC A;  4TXO B;  1A24 A;  2DJ3 A;  4ML6 A;  2YWO A;  4K2D A;  3I9V 2;  2GQK A;  1GNW A;  2YCD A;  4MA9 A;  3DKS A;  2RUF A;  1GSS A;  2GDR A;  1BX9 A;  2B6M A;  5DDL A;  3NIV A;  1K0C A;  3EVI A;  1V40 A;  4NHZ A;  4L5O A;  2RUE A;  2IJY A;  2BTO T;  2WFC A;  4O7H A;  4Q5Q A;  3FR9 A;  3SWL A;  5IOW A;  3VK9 A;  5FWG A;  5D9V A;  5CRH A;  1IYH A;  4XRD A;  4AJ8 A;  2HNL A;  3IE3 A;  2E7P A;  1K0O A;  1GWC A;  4MDC A;  4MJA A;  3HZ8 A;  1GP1 A;  2CVD A;  3ZVJ D;  5KN0 A;  3ZYW A;  4HI7 A;  3RPP A;  4IHU A;  1GSE A;  2YP6 A;  2LQO A;  2VM2 A;  4GCI A;  3HJM A;  4TOP A;  2GZP A;  4MF6 A;  4TR3 A;  2AAW A;  3ZL5 A;  3GKN A;  2GLR A;  5G5F A;  5AIS A;  4JE1 A;  2KLX A;  1F9M A;  3QFA C;  2NVL A;  2OJL A;  3I69 A;  4KCE A;  2WGR A;  3BJ5 A;  1Y6E A;  3L4N A;  1WPI A;  4XCS A;  2AUV A;  2VO4 A;  3MWH A;  3TKS A;  1T3B A;  1JZW A;  4MPF A;  1FAA A;  2K18 A;  1CQG A;  4TR1 B;  1GSQ A;  5LCZ A;  3GA4 A;  3H93 A;  1UVZ A;  3UJ1 A;  2VIM A;  3RBT A;  5F0G A;  2QKE A;  1GUK A;  3RDW A;  2BJX A;  1XWA A;  3V1W A;  2NBS A;  2HSY A;  5COH A;  1F2E A;  3GYK A;  4IN0 A;  1TTZ A;  2G0F A;  1A2L A;  1PQN A;  1SK0 A;  2XBI A;  3FW2 A;  3LYK A;  2E2G A;  2KP2 A;  1EV9 A;  1BJX A;  2MMZ A;  2R37 A;  3KMO A;  1FB0 A;  3FZ5 A;  5L71 A;  5JWQ B;  2A4V A;  2VL2 A;  3I6A A;  4QL7 A;  2HZE A;  2VD0 A;  10GS A;  4TR1 A;  3A3T A;  3TJJ A;  1GH2 A;  1BED A;  4PUF C;  4H86 A;  2WJU A;  2DIY A;  5DQY A;  3M1G A;  3P90 A;  5HFG A;  2C0G A;  1PX7 A;  2L59 A;  1WIK A;  6GSW A;  2IPA A;  4TVE A;  3QFB C;  3GL5 A;  2FNO A;  6GSY A;  4LL1 B;  1ZOF A;  5IOX A;  3LJR A;  2VCZ A;  4PX1 A;  1OKD A;  1I9D A;  3WT2 A;  4XS4 B;  3QCP A;  1GNE A;  5A5K A;  2FGX A;  5J4U A;  2JSZ A;  1QUW A;  4MCU A;  1JLV A;  1XW6 A;  2H76 A;  5IMA A;  2R3X A;  2ON7 A;  4FYC A;  4P3Y B;  1ZL9 A;  4EXJ A;  3ME8 A;  4IS0 A;  2LEG A;  2V41 A;  5F07 A;  2IFQ B;  2DMM A;  4IP1 A;  2OE3 A;  1ZYQ B;  2JU5 A;  3D0Z A;  3G7Y A;  3RPN A;  4HEA 2;  3TKS C;  1ZYE A;  3F0I A;  3VFI A;  2J9H A;  2XC2 A;  1NW2 A;  3CSH A;  3M9K A;  2C0E A;  2H1A A;  17GS A;  5LD0 A;  3GST A;  5AIX A;  2JSY A;  4K9Z A;  2JL4 A;  2VLU A;  2H70 A;  5E59 A;  1M2A A;  1DUG A;  3H4K A;  5H5R A;  4ZBB A;  1XW9 A;  2F9S A;  2OE1 A;  1BYE A;  4MH3 A;  3ZZX A;  4K6X A;  3W6G A;  2IMD A;  2GSS A;  5D9X A;  4HZ2 A;  2H19 A;  2IFQ A;  4GSS A;  4YQV A;  2DJ1 A;  1PL2 A;  2OBI A;  3ZTL A;  4HOJ A;  1MD4 A;  1ZZY A;  1YEX A;  4MP4 A;  4QL9 A;  5G1L A;  1I5G A;  2VL2 C;  2B1K A;  3IRA A;  3QMX A;  3APS A;  3EYT A;  4NWY A;  1IYI A;  2R4V A;  1BG5 A;  2BMX A;  1YZX A;  5G2Z A;  3DVX A;  3SBC A;  4F9Z A;  2RM6 A;  1K3L A;  2WB9 A;  1YEP A;  4TW5 A;  1BQ7 A;  3DYR A;  2LV3 A;  1YDK A;  1TXX A;  3GSS A;  1EP8 A;  4Q5N A;  1B4Q A;  1Z9H A;  3TB2 A;  2GT6 A;  4KAE A;  2CQ9 A;  2O89 A;  2YV9 A;  3WYW A;  1MDJ A;  2CX3 A;  5G30 A;  1X9S B;  4KSO A;  2H30 A;  1F6M C;  2HYX A;  1ML6 A;  2P5R A;  4NPB A;  5IPH A;  5AN1 A;  3EWL A;  2H66 A;  2N5A A;  3CXG A;  3HJO A;  1BAY A;  1M2D A;  9GSS A;  1B48 A;  4K7N A;  2CVB A;  5A4W A;  4WBR D;  1TOF A;  1PL1 A;  4XTS A;  1UC7 A;  4PNF A;  1OKT A;  3GL3 A;  2GGT A;  3EUR A;  2YNX A;  3D22 A;  3D21 A;  2OA7 A;  1XOA A;  5J9B A;  3S9F A;  2YZU A;  5IMZ A;  3UAR A;  4WR4 A;  4L8E A;  4JR6 A;  1Z6N A;  4KDX A;  1GTU A;  4EC0 A;  4IW9 A;  3FR3 A;  3WT1 A;  3CRU A;  2REM A;  3M9J A;  4Q5R A;  2HE3 A;  2WS2 A;  2V2G A;  3A2V A;  3TCO A;  2PBJ A;  1X9M B;  4XRA A;  3N5O A;  2CA8 A;  2FHE A;  1Z6M A;  4WET A;  2XPD A;  1THX A;  3HVS A;  3ZFB A;  3KH9 A;  1MTC A;  2B5Y A;  2PGT A;  2DJ2 A;  2K6V A;  3W8S A;  3KH7 A;  2H0I A;  2CZ3 A;  3LXT A;  5DVB A;  1KEB A;  2LRC A;  3Q19 A;  1TU8 A;  4KDU A;  4PUA A;  4F82 A;  3UAP A;  4BL7 A;  2H01 A;  2HZF A;  1GTB A;  4PQH A;  2WCI A;  2C3Q A;  5DAK B;  1PSQ A;  2GVP A;  4RI7 A;  5DBQ A;  1AW9 A;  1A8L A;  3APQ A;  4X43 A;  4OFT A;  1O85 A;  2O87 A;  2HLS A;  4MZB A;  4IP6 A;  2LJK A;  2LJA A;  3WGE A;  3ZIV A;  4MF7 A;  3ERF A;  1ZGN A;  3LXZ A;  1ON4 A;  4KUN A;  4AJ6 A;  4WEY A;  2KOK A;  3FZA A;  3P8W A;  1HQO A;  2LST A;  4DSR A;  1XIY A;  1JZO A;  4V1A p;  1Z3E A;  3IV4 A;  3CBU A;  3KZQ A;  2C1Y A;  3F8U A;  3DD3 A;  5B7C A;  2X64 A;  4FIW A;  4KSM A;  1QQ2 A;  4L0W A;  5J3R A;  2M80 A;  3HA9 A;  5ECR B;  3GV1 A;  1DE2 A;  1YQ1 A;  1USB A;  5F8B A;  1TK0 B;  5ECQ B;  4OCF A;  4ZIL A;  3ERW A;  5EY6 A;  4MJB A;  4PQI A;  4PXO A;  1G6W A;  4OFN A;  5DCH A;  1A23 A;  4MH2 A;  1K0A A;  2JZT A;  2PUK C;  1TDI A;  5DJM A;  4IJ3 A;  3GUS A;  1EV4 A;  4KW6 A;  1TKD B;  1O7U A;  4E8H A;  5A4V A;  2H0H A;  2DJ0 A;  1S3D A;  3NZN A;  2CX4 A;  1AQW A;  1M9B A;  3H1N A;  5GAN D;  1GLQ A;  5ECS A;  3VLN A;  5J9C A;  2TIR A;  2N5F A;  3CMI A;  4TR4 A;  5CYY A;  3QAV A;  20GS A;  2I81 A;  1PX6 A;  4EKZ A;  2YV7 A;  4KND A;  5D73 A;  4ZBD A;  2K8S A;  1NM3 A;  2L4C A;  3TOT A;  4ZB9 A;  4NV5 A;  4G2E A;  1N8J A;  2HXK A;  2O8V B;  5EL8 A;  1K3O A;  1UN2 A;  3D5J A;  1O8W A;  5C04 A;  2LKU A;  1F3B A;  4LL4 B;  4RQR A;  4KGI A;  4PGT A;  2H71 A;  2FWF A;  1HD2 A;  2L6D A;  1THO A;  3F4S A;  2YAN A;  4ACS A;  1U3A A;  1ERU A;  3LEF A;  4JZQ A;  2RLI A;  3UOM A;  3ZRE A;  3W8J A;  2H0G A;  5IO2 A;  5HR0 A;  2HSH A;  3KGK A;  3DGQ A;  2WDU A;  3HKR A;  3LWA A;  3KM6 A;  3C71 A;  4ZBA A;  4NAX A;  2R6K A;  2H1B A;  3IK9 A;  1R5P A;  3TKS E;  2YJH A;  3QAG A;  4E8E A;  2X99 A;  2GZZ A;  4V2L A;  4D73 A;  4X0X A;  1GRX A;  4KE3 A;  4O5R A;  3GN3 A;  6GSU A;  4POK A;  2L5O A;  3F63 A;  2A2R A;  5JWR B;  2QSI A;  4AJ7 A;  4NHW A;  3EC3 A;  2NDO A;  4ECI A;  4ZL7 A;  3HJP A;  1OC3 A;  1XWG A;  3GH9 A;  3TJG A;  22GS A;  4ML1 A;  2H8L A;  1QMV A;  2HZE B;  1GTA A;  5CRW A;  3BBY A;  3IPZ A;  1W4V A;  2B3S A;  4DSS B;  2B5X A;  4ZIJ A;  3P7X A;  1F3A A;  3AY8 A;  4IKH A;  4OFM A;  2ALB A;  1X5D A;  3FZ9 A;  4K8M A;  3EU3 A;  3F3Q A;  3ME7 A;  3ZIJ A;  2IN3 A;  2LRN A;  1XVQ A;  2I4A A;  4POM A;  4GLT A;  3LFL A;  4BPY A;  2F51 A;  4WXT A;  4PNG A;  4DSQ A;  3FYG A;  1OVN A;  4EDZ A;  1JZD A;  4N11 A;  3GUR A;  2VCQ A;  5D8I A;  3TKQ A;  3CSJ A;  3CYN A;  2PVO C;  5IMD A;  3ZMK A;  4HU7 A;  2L4Q A;  1FVK A;  1YF0 A;  1MEK A;  1PN9 A;  4FH8 A;  2CZ2 A;  2EIR A;  4WF4 A;  3LG6 A;  1GSF A;  4I2U A;  3A2X A;  5DJL A;  3GTU A;  4TN8 A;  4WKW A;  5D9T A;  1SL0 B;  2RII A;  4DSS A;  2MYG A;  1AC1 A;  2K9F A;  3C7M A;  4OMV A;  3TJF A;  5CO3 A;  19GS A;  3JCM L;  2DJK A;  3KIJ A;  3PGT A;  1ZMA A;  4KCA A;  2H75 A;  2EIQ A;  4MZW A;  4OCE A;  3CSI A;  3LYP A;  1XW5 A;  1O81 A;  2PPT A;  4ZB8 A;  1CQH A;  2C4J A;  2IWT A;  1A2M A;  3TRP A;  3LGC A;  2C3T A;  1S3A A;  3EMP A;  1K0D A;  2OKA A;  1K3Y A;  2VL9 A;  1GUM A;  1T8E B;  4MMM A;  1B9Y C;  3IAM 2;  1PA3 A;  3GFK A;  2YN1 A;  1J08 A;  3L9S A;  5ID2 A;  4KH7 A;  1LJR A;  3KTB A;  5JCU A;  1GSD A;  3APO A;  4YAV A;  5CAX A;  2B7K A;  1S3C A;  1A8Y A;  3O3T A;  3DIE A;  1G7O A;  3LOR A;  2P31 A;  1AQX A;  2CVK A;  4HDE A;  2L57 A;  2HFD A;  5GZZ B;  4NV2 A;  1J0F A;  2VCW A;  1Z7R A;  1SK1 A;  4J56 E;  2IY2 A;  1O6J A;  3KP9 A;  5IQY A;  5JCG A;  2KUC A;  2V1M A;  4I2T A;  1XFL A;  5D9W A;  3HYP A;  5CRE A;  3TOU A;  4KB3 A;  1KTE A;  2D2Z A;  2V32 A;  3TRQ A;  5GAP D;  1KNG A;  2LQQ A;  1SEN A;  1Q98 A;  3HHV A;  2X8G A;  2H74 A;  5B6N A;  1T00 A;  3F9U A;  4GTU A;  1OC9 A;  5CRG A;  4DVC A;  1JHB A;  1KBN A;  1X5C A;  1PKW A;  1O73 A;  2VUP A;  1V98 A;  4IQA A;  2R2J A;  2MMA A;  2DC5 A;  1NHY A;  3E9J B;  5IM9 A;  4OWY A;  1GUH A;  2O7K A;  5ECH B;  2VL3 A;  1T4Y A;  8GSS A;  1XWC A;  2H1G A;  3PH9 A;  4O32 A;  1ERW A;  4N0Z A;  3L9U A;  3C1R A;  2AV4 A;  3MSZ A;  1YF1 A;  5JWO B;  2AB6 A;  5KN3 A;  2AHE A;  1EEJ A;  3VPQ A;  4L5L A;  3UBK A;  4RI6 A;  3BCK A;  4K1F A;  5D96 A;  2IMI A;  1T1V A;  1XPV A;  4PQ1 A;  3EU4 A;  3C73 A;  4YQU A;  1FHE A;  3A2W A;  1A2J A;  4I8B A;  3HY2 A;  4MLY A;  5ECP B;  6GST A;  1SD9 A;  2WZ9 A;  4GST A;  5KN2 A;  1HNC A;  1UA5 A;  3GHA A;  2LJR A;  3DML A;  5AGY A;  1LU4 A;  2PER A;  12GS A;  4LA1 A;  1XOB A;  2CAQ A;  2DIZ A;  3RAZ A;  3U6V A;  4OD7 A;  4EVM A;  5ELG A;  1B9X C;  2IME A;  2E2M A;  4I6X A;  4EDY A;  1FG4 A;  4IJI A;  3Q18 A;  2G2Q A;  3E3E A;  1FB6 A;  3TKP A;  4TXV A;  2H6X A;  2H73 A;  2VOC A;  2V6O A;  1SJ6 A;  3IC4 A;  3MNG A;  4RQX A;  4Z7X A;  5LNK e;  3CTF A;  4F0B A;  3GKM A;  4K0G A;  4GQF A;  4AGS A;  3DXB A;  1EWX A;  3UVT A;  5F05 A;  2A2S A;  4L0U A;  1GUL A;  1X0R A;  2CV4 A;  3KTL A;  1NHO A;  2M72 A;  4V2M A;  3GNJ A;  1SJI A;  1OC8 A;  4EE0 A;  3M3M A;  1SKW B;  2M46 A;  1WOU A;  2OE0 A;  2H6Z A;  4F2I A;  3RHB A;  5IPG A;  3F3R A;  1WRY A;  2KP1 A;  3GX0 A;  3VWW A;  3TGZ A;  3G9B A;  3PIN A;  3BOA A;  1AQV A;  1SYX A;  3FKF A;  4G19 A;  3LQ7 A;  4MK3 A;  18GS A;  2GQL A;  1AUC A;  1EP7 A;  2Z9S A;  1LBK A;  4LMV A;  5FHI A;  3M8N A;  5EVO A;  2FA4 A;  2N5B A;  3VWV A;  1Y25 A;  4I5Q A;  5J5N A;  2FY6 A;  5ENU A;  3ED3 A;  1G6Y A;  4MJE A;  4MZC A;  1SYR A;  4IQ1 A;  4JRR A;  1TP9 A;  5EPF A;  1EOG A;  5ELA A;  2H1D A;  3D4M A;  4BWS A;  3WGX A;  1SU9 A;  3IXR A;  1HNA A;  2FWG A;  3GKK A;  3KCM A;  1M0U A;  2DML A;  3US3 A;  3NOF A;  4RUV A;  4ULX A;  3QAW A;  3ERG A;  1J9B A;  1A0F A;  1AIU A;  3UBL A;  4YQM A;  1FVJ A;  1A0R P;  2YWI A;  3F6D A;  2AYT A;  1AAZ A;  1URM A;  4MJC A;  1JZR A;  5DAL A;  2DSA A;  1MDK A;  4N10 A;  4IVF A;  1K0B A;  1PMT A;  2JAD A;  3TJB A;  4XS1 A;  3QR6 A;  4CHS A;  1JLW A;  3Q6O A;  2LRT A;  1WE0 A;  3IHQ A;  2GSQ A;  2VLT A;  3KEB A;  1YJ6 A;  3QDN A;  3U5R E;  5F06 A;  3BD2 A;  1ERT A;  2ES7 A;  2P5Q A;  3A5W A;  4F03 A;  1WP0 A;  4D73 B;  1V57 A;  11GS A;  3ZIT A;  5HFK A;  2CAI A;  1TK5 B;  5G31 A;  2EC4 A;  3QD9 A;  5DCG A;  3TJK A;  1TI1 A;  2J23 A;  3UL3 A;  5FT3 A;  1U3I A;  1YKA A;  1DSB A;  1WMJ A;  3KJY A;  1QXH A;  1C72 A;  4AF2 A;  6GSV A;  2R5G A;  4BWQ A;  4HJM A;  5CP1 A;  1X9W B;  2B1L A;  3CTG A;  1E2Y A;  3H79 A;  2OBK A;  2JZR A;  2TRX A;  2L5L A;  3D4T A;  1U88 A;  2V6K A;  1VRS D;  4KDY A;  3ZML A;  4G10 A;  4J2F A;  5H5Q A;  2GQM A;  4LLR A;  2WRT A;  1TI3 A;  4TXO A;  1VF2 A;  1ST9 A;  1E6B A;  2ZNM A;  1PGT A;  6GSS A;  1QK8 A;  2XBQ A;  1GTI A;  3MDK A;  1M7T A;  4FYU A;  2OAD A;  1T7P B;  3ZRD A;  4EF0 A;  3ZLP A;  4O92 A;  4MF5 A;  2HI7 A;  6GSX A;  3VPT A;  2I1U A;  3UVH A;  2ZCT A;  1EEM A;  4ID0 A;  3E0U A;  2LUS A;  3GTU B;  2MZC A;  4G9H A;  2O85 A;  1EGR A;  4GF0 A;  5ECL B;  1FW1 A;  2GZY A;  1R5A A;  2C80 A;  1SKR B;  3DWV A;  5C00 A;  2H6Y A;  4KX4 A;  2EIO A;  5E4W A;  3N9J A;  5B6M A;  4ILF A;  2DBC A;  3IK7 A;  3PR8 A;  4FO5 A;  2PN8 A;  3VI7 A;  3UIW A;  2ON5 A;  4GQC A;  1R7H A;  3HXS A;  2B7J A;  4K7I A;  3QPM A;  2C3N A;  3VWU A;  4HQS A;  4KA0 A;  3IOS A;  1RW1 A;  2OAC A;  1OE7 A;  2MBS A;  1TRV A;  3O6T A;  1GSU A;  4I97 A;  3FRC A;  3DRN A;  5ID2 B;  5J41 A;  4V2N A;  5HQP A;  1DBY A;  2FLS A;  3F6F A;  4EUY A;  2VM1 A;  4FYB A;  5H5S A;  1TU7 A;  4N30 A;  2HRF A;  2NPB A;  2TRC P;  5CRD A;  1XVW A;  5ABR A;  1G7E A;  3F4T A;  3FY7 A;  1DE1 A;  3IR4 A;  5ECO B;  4IEL A;  4WF5 A;  2IMF A;  2PU9 C;  2GS3 A;  1W89 A;  1B8X A;  2WUL A;  2MMO A;  4JED A;  2F3M A;  4YAP A;  1HNB A;  5KN1 A;  1EOH A;  3EIN A;  4XIH A;  5IMF A;  4ECC A;  1V2A A;  3HDC A;  4GWR A;  4JU5 A;  1VF1 A;  3GX8 A;  1PRX A;  4IBP A;  2B5E A;  5HR2 A;  4XHM A; 
#chains in the Genus database with same CATH topology
 2DJJ A;  1TRU A;  4XS6 A;  5G2G A;  4EXR A;  3TKR A;  1OC9 B;  1IT7 A;  4ZXG A;  1V9W A;  1OCV A;  2HMN B;  1Q7H A;  5B8B A;  2KHP A;  4ZL8 A;  3U97 A;  5HR3 A;  2PZV A;  1RGG A;  2R0C A;  2FWE A;  3FK8 A;  3BCI A;  3L0H A;  4JBB A;  4KFF A;  1SL2 B;  2YOI A;  2YPM A;  2FA8 A;  2IMK A;  1SL1 B;  4X1U A;  5AYR B;  4R9K A;  1XWB A;  2QGV A;  4NHF A;  1HYU A;  4MPG A;  3D5G A;  1OAZ A;  3D5I A;  3A5I A;  3VUR A;  3L78 A;  4LYL B;  3GMF A;  1YJ9 3;  2OQE C;  4ECJ A;  2IYJ A;  3KD0 A;  3CU3 A;  2C0D A;  2JAC A;  2AJQ B;  4N0V A;  1W00 A;  1NWW A;  1B4P A;  4HAA A;  5HFI A;  5INY A;  3M0F A;  2FCH A;  1ERV A;  3FF2 A;  2H72 A;  5G5E A;  3T8U A;  3DZL A;  1OYJ A;  1GY7 A;  5DQS A;  3ISO A;  1ABA A;  3AGO A;  1E3V A;  1M2B A;  1ILO A;  3CC2 3;  4K90 B;  5IEN A;  4XS4 A;  3CPO A;  5IMV A;  3ZVJ A;  1U87 A;  1RMS A;  2MBT A;  4PUR A;  2JQ5 A;  4WYK A;  5M19 A;  3MIX A;  3HD5 A;  2GT5 A;  1QFN A;  5IMC A;  3IDV A;  3G4S 3;  4V1A g;  4WBJ A;  1KD1 4;  2IIY A;  1X1W A;  4O8S A;  4NRE A;  1W5Z A;  1VGL A;  2VAF A;  2F98 A;  2I3Y A;  5A0O B;  3VWX A;  4Q5F A;  4EL1 A;  9RNT A;  4TX4 A;  4R80 A;  3UL6 A;  1NDO B;  1BSA A;  2L6C A;  3OXA A;  1VF4 A;  1FO5 A;  1GL8 A;  3L9V A;  3DVW A;  3PCR A;  5STD A;  3KXO A;  1UI8 A;  5KEJ A;  4TR0 A;  1R4W A;  1WMO A;  1U5O A;  4HM4 B;  4HOH A;  1PD2 1;  3FEU A;  3VI5 A;  2HRN A;  4EO3 A;  1XWK A;  2J8X B;  4X4J A;  1Q4J A;  2Z7A A;  3WGD A;  3KMN A;  3O76 A;  1TRS A;  4KFE A;  4F0C A;  3GSP A;  1TU5 A;  1MDI A;  1PFP A;  4GSN A;  1M99 A;  4BVX A;  1JFU A;  1YVS A;  1DE3 A;  4GXZ A;  1LOW A;  1X5E A;  2C8U A;  2HRA A;  2UX0 A;  4POB A;  1US1 A;  3F4R A;  1WQL B;  3MPH A;  4NXI A;  4FCZ A;  3H3H A;  4ISD A;  4KFD A;  1UUW B;  2F86 B;  2F8F A;  5G1K A;  4CDO A;  3PS8 A;  4HZ4 A;  3VF1 A;  1M9A A;  2FD3 A;  1R26 A;  3MAK A;  4TKY A;  1RHL A;  3HII A;  1U6T A;  3TRX A;  3IAS 2;  3HCZ A;  3ZFL A;  4AEQ A;  1Z7P A;  1K28 A;  3BNE A;  3KP8 A;  2YWM A;  3IMA B;  2KF3 A;  3C1S A;  3C8E A;  4LMW A;  1FZU A;  5CNW A;  1FUS A;  2LNT A;  13GS A;  1MGW A;  1VQ9 3;  4GRF A;  2RM5 A;  2HMK B;  2XHF A;  3WD6 A;  4K0N A;  1X1U A;  3R2Q A;  3RHC A;  3G7J A;  4G0K A;  2I9H A;  1JKG B;  1NB3 I;  3EBT A;  3I43 A;  2QA2 A;  7GSS A;  2F8A A;  5GST A;  2HT9 A;  2MMN A;  2CWV A;  4O02 B;  2VCV A;  1H4O A;  4FMD A;  1LNI A;  2K3D A;  3QRD A;  3EMX A;  1LRA A;  3IA1 A;  3K5T A;  5JCW A;  3NM2 A;  1XBS A;  2YZH A;  1DMQ A;  1V58 A;  5CK6 A;  4NMU A;  5D93 A;  1SPU A;  3FG4 A;  2IL3 A;  2GTU A;  5KOW A;  1EGO A;  5ECN B;  4JR4 A;  4R4K A;  2GST A;  3H8Q A;  3EB8 A;  4HU9 A;  1MWU A;  3HVV A;  4TRX A;  3UMA A;  1UUG B;  3FR6 A;  1JN5 A;  3EE2 A;  1ZYN A;  1SK2 A;  2JZS A;  2CT6 A;  5ECK B;  1G0T A;  1BSB A;  2SBL A;  5A4U A;  1VZZ A;  4HM5 B;  4L8O A;  1GLP A;  2YX9 A;  1N2A A;  3LSZ A;  3DEX A;  3SX1 A;  1SKS B;  4KF9 A;  3F8X A;  1T4Z A;  2LTK A;  4OO5 A;  2BMR B;  5HR1 A;  4ZB6 A;  1SJZ A;  1Q86 4;  2VD1 A;  3GKX A;  1MNL A;  3AMO B;  3TUE A;  3GRX A;  4OO4 A;  3GIX A;  1NJI 4;  3OR5 A;  2WO0 A;  3CXC 2;  3Q74 A;  1T5Y A;  4ECB A;  1JBR A;  1RN1 A;  5DRE A;  3CRT A;  3NQY A;  5DAL B;  4N6U A;  3K7C A;  5DRV A;  4BVY B;  1I2F A;  2VLV A;  4O5U A;  1AXD A;  3FG1 A;  2P0G A;  1A2K A;  4OUQ A;  1R4C A;  2LNS A;  2W6J H;  3DGY A;  1O7N B;  1TRW A;  1XZO A;  3CCL 3;  1JBT A;  1MD3 A;  2LS5 A;  1EZK A;  1TW9 A;  4BIK A;  1Z5Y E;  3ZG5 A;  14GS A;  2Q07 A;  4CW9 A;  1HKX A;  2D1W A;  3OWY A;  3IBH A;  4YH2 A;  3DXO A;  2FWH A;  1BNF A;  2FUG 2;  1ACV A;  1TK8 B;  2ZUP A;  5BVB A;  16GS A;  2DLX A;  3QOU A;  3CCM 3;  3S27 A;  2XPE A;  2UZ8 A;  3DGL A;  1STF I;  3HVX A;  1JB5 A;  4HJ2 A;  1ZCP A;  2CX1 A;  2XF3 A;  3UB1 A;  1SD8 A;  1FGO A;  3HZ4 A;  4K7O A;  4WR5 A;  3D6I A;  1W7C A;  4IGJ A;  1Q7Y 4;  1VQQ A;  3TDG A;  4RNZ A;  1BUQ A;  1TRQ A;  1VQM 3;  5ECM B;  3LZA A;  2VCT A;  2KF5 A;  3AMO A;  4J57 E;  2PMT A;  1H75 A;  4BA7 A;  1NSW A;  4STD A;  2R41 A;  2VCX A;  4HUA A;  1TJD A;  5B8A A;  3J7Y b;  3LT9 A;  2PVQ A;  2C0F A;  5GSS A;  4BVY A;  1Q40 A;  2HML B;  2GSR A;  2X8C A;  3FHK A;  5IO0 A;  4DEJ A;  1K0N A;  1VF3 A;  1GMP A;  4N6V 0;  1F37 A;  2YWN A;  4POL A;  2K8V A;  1WJK A;  1WWJ A;  5ECI B;  3MSO A;  4DKI A;  3G0K A;  4MAB A;  2HMJ B;  4HS1 A;  5DAK A;  5AIV A;  1YY7 A;  3G7I A;  1RN4 A;  3GH6 A;  2O9U X;  3Q2P A;  2QC7 A;  4QQ7 A;  3P2A A;  3UEM A;  4XHM A;  2E2U A;  1GSY A;  3J7Y k;  4ORL A;  1FOV A;  2NTO A;  4HQZ A;  1OE8 A;  1RQM A;  1O8X A;  1YKC A;  3DGO A;  1XXU A;  4ZL9 A;  1QGV A;  2YJ7 A;  1UI7 A;  3B4O A;  5IIZ A;  2E0Q A;  2X49 A;  2PWJ A;  1PKZ A;  3FZ4 A;  2V1L A;  4HZ9 B;  3K8N A;  1K0M A;  1RK4 A;  2X8H A;  1XCC A;  5ELU A;  4TXO B;  1A24 A;  2DJ3 A;  4ML6 A;  2YWO A;  4K2D A;  3I9V 2;  2HMO B;  2GQK A;  1GNW A;  2YCD A;  4MA9 A;  2HMM B;  3DKS A;  3PXM A;  5JPU A;  1GSS A;  1YGE A;  2RUF A;  2KCD A;  2GDR A;  1BX9 A;  1W2B 2;  2B6M A;  5DDL A;  1R4Y A;  3NIV A;  1K0C A;  3EVI A;  2GU3 A;  1RCL A;  4XBY A;  1V40 A;  4AKZ A;  4NHZ A;  1B2M A;  4L5O A;  2RUE A;  1B2S A;  2IJY A;  2BTO T;  2Z6B A;  2WFC A;  4O7H A;  4Q5Q A;  3FR9 A;  2K54 A;  2XRX B;  3SWL A;  5IOW A;  1QAL A;  3VK9 A;  4K1U A;  5FWG A;  5D9V A;  4MMX B;  5CRH A;  1IYH A;  4XRD A;  4YKF A;  4AJ8 A;  5BMU A;  1ROV A;  2HNL A;  3IE3 A;  2E7P A;  1K0O A;  1BOX A;  1N8Q A;  1GWC A;  1W4N A;  4CDL A;  4I4K A;  1BRS A;  3LML A;  4MDC A;  1E3R A;  4MJA A;  3HZ8 A;  3EN8 A;  1GP1 A;  2RNT A;  2CVD A;  3ZVJ D;  1F8N A;  5KN0 A;  3ZYW A;  4HI7 A;  3RPP A;  3MYD A;  4IHU A;  1RDS A;  1M90 4;  1GSE A;  2YP6 A;  3KCH A;  2STD A;  2LQO A;  5EEO A;  4XDW A;  2VM2 A;  4GCI A;  3HJM A;  4TOP A;  2GZP A;  4MF6 A;  4TR3 A;  4QWT A;  2AAW A;  1I2E A;  5KP3 A;  2RFR A;  3I55 3;  3GKN A;  4JF8 A;  3ZL5 A;  2GLR A;  5KP1 A;  4IIA A;  5G5F A;  1YJN 3;  4K5S A;  5AIS A;  4JE1 A;  2KLX A;  1F9M A;  3QFA C;  1YJW 3;  1WTH A;  3HZP A;  2NVL A;  2OJL A;  3I69 A;  3EJV A;  2Z77 A;  4KCE A;  2WGR A;  3FKA A;  3BJ5 A;  1Y6E A;  3L4N A;  1VQ7 3;  2UUG C;  1WPI A;  4XCS A;  4J5K A;  2AUV A;  1AVL A;  3ECF A;  3WDG B;  1K9M 4;  2VO4 A;  3MWH A;  3TKS A;  4LGQ A;  1T3B A;  1JZW A;  1BUJ A;  4MPF A;  1FAA A;  3Q3F A;  2K18 A;  1C54 A;  1CQG A;  4TR1 B;  4HBR A;  1GSQ A;  5LCZ A;  3HVN A;  1IU7 A;  1IVV A;  3GA4 A;  3WOE B;  3H93 A;  4IPB A;  3KN4 A;  1W01 A;  1DMN A;  3F40 A;  1UVZ A;  1V74 A;  1KWI A;  3UJ1 A;  4BIR A;  2VIM A;  3RBT A;  1KQS 2;  5F0G A;  2QKE A;  3LW9 A;  1GUK A;  2ML6 A;  3RDW A;  2BJX A;  1XWA A;  2F4Y A;  3V1W A;  3X41 A;  2NBS A;  1N5H A;  2HSY A;  1JB2 A;  5COH A;  3KKG A;  1F2E A;  3GYK A;  1D6U A;  4IN0 A;  3EN1 B;  1TTZ A;  1A2L A;  2G0F A;  3WA2 X;  1FGM A;  1PQN A;  4WHA A;  1SK0 A;  3LTB A;  2XBI A;  3FW2 A;  3LYK A;  2E2G A;  2KF6 A;  1EV9 A;  2KP2 A;  1BJX A;  3CCS 3;  2MMZ A;  2R37 A;  3WR2 A;  3KMO A;  2IMJ A;  1FB0 A;  3FZ5 A;  4GL6 A;  1MGR A;  5L71 A;  1RGL A;  5JWQ B;  1RGE A;  2A4V A;  2VL2 A;  3I6A A;  4QL7 A;  4L8P A;  2HZE A;  1AR0 A;  4H3U A;  2VD0 A;  1RNT A;  1ZO2 A;  1K41 A;  10GS A;  1D6Z A;  4TR1 A;  1GOU A;  4KVH A;  3A3T A;  3TJJ A;  3OV4 A;  4K61 A;  1GH2 A;  1BED A;  4PUF C;  2OTJ 3;  4H86 A;  1PYL A;  3GZX B;  2YFI B;  2WJU A;  2DIY A;  2W9Q A;  5DQY A;  4Z2R A;  3MG2 A;  3M1G A;  3P90 A;  2YFL B;  5HFG A;  2C0G A;  3K63 A;  2M7O A;  1PX7 A;  2L59 A;  1WIK A;  1X1Y A;  6GSW A;  2IPA A;  4TVE A;  3QFB C;  2C11 A;  2FNO A;  3GL5 A;  6GSY A;  4HM6 B;  4CY6 A;  4LL1 B;  1ZOF A;  5IOX A;  3LJR A;  1M1X B;  2VCZ A;  1LXE A;  4PX1 A;  1BNI A;  1OKD A;  1DET A;  3T8N A;  1I9D A;  4RBN A;  3RGR A;  3WT2 A;  5KP4 A;  1YGW A;  4XS4 B;  3QCP A;  1GNE A;  3V99 A;  4WYK B;  4HVN A;  1EUI C;  5A5K A;  3CCV 3;  2FGX A;  5J4U A;  2JSZ A;  1QUW A;  4MCU A;  3R3E A;  4ZM8 A;  4LSO A;  1JLV A;  1XW6 A;  2H76 A;  5IMA A;  1BSD A;  2R3X A;  1BIR A;  2ON7 A;  1BAN A;  4FYC A;  4P3Y B;  1ZL9 A;  4EXJ A;  3ME8 A;  4IS0 A;  2LEG A;  2V41 A;  5F07 A;  1O7P B;  3X40 A;  2IFQ B;  2DMM A;  4IP1 A;  4LMI A;  4XB5 A;  1S3R A;  2OE3 A;  1GY5 A;  1GYB A;  1ZYQ B;  2JU5 A;  3N8B A;  5CF2 A;  1BGS A;  3D0Z A;  3CCE 3;  3G7Y A;  3RPN A;  4HEA 2;  1FGT A;  3CPW 2;  3TKS C;  1Q81 4;  4N6N B;  1ZYE A;  3F0I A;  1IVW A;  3VFI A;  2J9H A;  2XC2 A;  2R4I A;  1NW2 A;  3CSH A;  2ZDJ A;  3M9K A;  2C0E A;  2H1A A;  17GS A;  5LD0 A;  5IG4 A;  3GST A;  4BVX B;  3NHX A;  5AIX A;  2JSY A;  2UGI A;  2C10 A;  3UJM A;  7RNT A;  4K9Z A;  3PCS A;  2JL4 A;  1JV2 B;  2VLU A;  1EQK A;  1EKM A;  2H70 A;  5E59 A;  3OWS A;  1M2A A;  1JNQ A;  1DUG A;  3KSE D;  4J5G A;  3H4K A;  4MMY B;  5TGN A;  4FQU A;  5H5R A;  4ZBB A;  1XW9 A;  2F9S A;  5RNT A;  5JBS A;  1BYE A;  2OE1 A;  4MH3 A;  3ZZX A;  4K6X A;  3W6G A;  2IMD A;  2Y73 A;  3MG3 A;  4N3V A;  2IUK A;  2GSS A;  5D9X A;  4HZ2 A;  3OX9 A;  2QIY A;  4PTS A;  2H19 A;  2IFQ A;  3FSD A;  4GSS A;  1Y4K A;  4YQV A;  2DJ1 A;  1PL2 A;  2OBI A;  3ZTL A;  4HOJ A;  3SED A;  3LH4 A;  1MD4 A;  1ZZY A;  1YEX A;  4MP4 A;  4QL9 A;  5G1L A;  1I5G A;  4USS A;  2VL2 C;  2B1K A;  5AIF A;  3IRA A;  3QMX A;  1ULI B;  1GD4 A;  3S28 A;  1HZ1 A;  3APS A;  1VQP 3;  3EYT A;  4NWY A;  1IYI A;  2R4V A;  1BG5 A;  2BMX A;  1YZX A;  5G2Z A;  3FGY A;  3DVX A;  3SBC A;  4F9Z A;  2RM6 A;  1K3L A;  3H51 A;  4CPK A;  2WB9 A;  2CFK A;  5BXQ A;  4EV2 A;  1YEP A;  4TW5 A;  1BQ7 A;  3DYR A;  2GEX A;  2LV3 A;  1YDK A;  2LYX A;  1CEW I;  1TXX A;  3GSS A;  4MJD A;  1EP8 A;  2A2P A;  4Q5N A;  1B4Q A;  1Z9H A;  3TB2 A;  2GT6 A;  1GMR A;  1S5A A;  4KAE A;  4R1K A;  1WNH A;  2CQ9 A;  1TTO A;  1JN5 B;  2O89 A;  2YV9 A;  3WYW A;  1BAO A;  1MDJ A;  2CX3 A;  5G30 A;  1X9S B;  1IQY A;  4KSO A;  5LC6 A;  4BTX A;  2H30 A;  1Q9E A;  1F6M C;  1AVK A;  2HYX A;  1B20 A;  1ML6 A;  2P5R A;  2ZL8 A;  4NPB A;  5IPH A;  5AN1 A;  3EWL A;  3X3Z A;  2H66 A;  2N5A A;  3CXG A;  3HJO A;  1BAY A;  4HM0 B;  1M2D A;  9GSS A;  2F5M A;  1B48 A;  2CVB A;  4K7N A;  5A4W A;  4WBR D;  1ZX2 A;  1TOF A;  3LXU X;  1PL1 A;  4XTS A;  1UC7 A;  1A2P A;  3AGN A;  4PNF A;  1OKT A;  3GL3 A;  4BTW A;  2CWT A;  3KFQ C;  2GGT A;  3EUR A;  2YNX A;  1G96 A;  3D22 A;  5AII A;  3D21 A;  2OA7 A;  1XOA A;  5J9B A;  3S9F A;  2YZU A;  5IMZ A;  3UAR A;  4WR4 A;  4L8E A;  4JR6 A;  1Z6N A;  4KDX A;  1GTU A;  4EC0 A;  4IW9 A;  3FR3 A;  3WT1 A;  3CRU A;  5IER A;  2REM A;  3M9J A;  4Q5R A;  2HE3 A;  2WS2 A;  3F14 A;  5FGO A;  2V2G A;  2W2C A;  3CCU 3;  2XEP A;  3A2V A;  2QA1 A;  2PBJ A;  3TCO A;  1X9M B;  3WOD G;  1D6Y A;  4XRA A;  3N5O A;  1UGI A;  1I3F A;  3LTA A;  2CA8 A;  2FHE A;  5AI1 A;  1Z6M A;  1YVB I;  3X42 A;  2XPD A;  4WET A;  1THX A;  2CG1 A;  3J7Y d;  3HVS A;  3ZFB A;  3KH9 A;  1MTC A;  1BNG A;  3B8L A;  8RNT A;  2B5Y A;  2PGT A;  2DJ2 A;  2K6V A;  1T2H A;  3W8S A;  1RGH A;  4XDV A;  3CCJ 3;  3KH7 A;  2BU4 A;  4GHO A;  2H0I A;  2CZ3 A;  3LXT A;  5DVB A;  2CIU A;  1KEB A;  2LRC A;  3Q19 A;  1TU8 A;  1Q40 B;  2X4A A;  5IG3 A;  4KDU A;  1BSE A;  1EG9 B;  2WGO A;  4F82 A;  1FGQ A;  3UAP A;  4BL7 A;  2BNG A;  2H01 A;  2HZF A;  1GTB A;  2K0M A;  4PQH A;  3K9M C;  1I0V A;  3G16 A;  3BIR A;  1M3J A;  2C3Q A;  2DKH A;  2WCI A;  5DAK B;  1RRL A;  1PSQ A;  2GVP A;  3LTC A;  4K5R A;  4RI7 A;  5DBQ A;  6GSP A;  1AW9 A;  1A8L A;  3A76 A;  3APQ A;  4G1M B;  2D42 A;  4HM3 B;  4X43 A;  1N9E A;  4OFT A;  1O85 A;  2O87 A;  2HLS A;  3FCS B;  3X3Y A;  4MZB A;  4IP6 A;  2LJK A;  1B2Z A;  2LJA A;  3WGE A;  3CNX A;  3ZIV A;  4MF7 A;  3M8C A;  3ERF A;  1ZGN A;  3MWZ A;  3LXZ A;  4RZM A;  1KSI A;  1GY6 A;  1OHP A;  3OWU A;  1ON4 A;  4KUN A;  5IW9 A;  4AJ6 A;  4WEY A;  1BRJ A;  3WA3 A;  3HI7 A;  2KOK A;  3FZA A;  3P8W A;  1SII A;  1HQO A;  2LST A;  4DSR A;  1XIY A;  1JZO A;  1Z3E A;  4V1A p;  3IV4 A;  3CBU A;  3KZQ A;  2CKF B;  2C1Y A;  3F8U A;  2W56 A;  4Z2T A;  3EQQ B;  3DD3 A;  5AYS C;  1GOV A;  5B7C A;  1BNJ A;  2X64 A;  4FIW A;  4KSM A;  1QQ2 A;  4L0W A;  5J3R A;  2M80 A;  3N54 B;  3HA9 A;  5ECR B;  4R9L A;  3MG1 A;  3LT8 A;  3GV1 A;  1DE2 A;  3EF8 A;  1YQ1 A;  3D9R A;  1USB A;  5F8B A;  1TK0 B;  4CCV A;  5ECQ B;  4OCF A;  2XGN A;  4ZIL A;  2RSX A;  3ERW A;  5EY6 A;  3CME 3;  1K73 4;  4MNN A;  1I8V A;  3SOA A;  4MJB A;  4PQI A;  4PXO A;  3EPT A;  1G6W A;  4OFN A;  1IVX A;  1W6G A;  5DCH A;  1W02 A;  1A23 A;  4MH2 A;  1K0A A;  2JZT A;  2PUK C;  1TDI A;  5DJM A;  1I0X A;  4IJ3 A;  4EIQ A;  3GUS A;  4MMZ B;  1EV4 A;  4KW6 A;  1TKD B;  4YKG A;  1O7U A;  4E8H A;  5A4V A;  3FMW A;  2H0H A;  2DJ0 A;  1S3D A;  1SAR A;  3NZN A;  1N5P A;  2CX4 A;  1UDI I;  4MEI A;  1AQW A;  1WMP A;  2F56 A;  1M9B A;  3H1N A;  5GAN D;  2XGL A;  1GLQ A;  5ECS A;  2CG0 A;  3VLN A;  5J9C A;  1QVG 2;  2TIR A;  1PY3 A;  4BL3 A;  2N5F A;  1HYF A;  3CMI A;  2KRT A;  1CYV A;  4K2X A;  4TR4 A;  5CYY A;  3QAV A;  20GS A;  2W9P A;  1PX6 A;  2I81 A;  2QA4 3;  4EKZ A;  2YV7 A;  4HM8 B;  4KND A;  5D73 A;  4ZBD A;  2K8S A;  1NM3 A;  2L4C A;  3TOT A;  4ZB9 A;  3QK9 A;  3JVC A;  1OGX A;  4NV5 A;  2KXG A;  4G2E A;  1N8J A;  6RNT A;  2HXK A;  2O8V B;  5IG5 A;  5EL8 A;  1K3O A;  5IG0 A;  1UN2 A;  3D5J A;  1O8W A;  5C04 A;  2LKU A;  1F3B A;  4LL4 B;  4RQR A;  4KGI A;  4PGT A;  2H71 A;  2FWF A;  1HD2 A;  2L6D A;  1THO A;  1J2B A;  3F4S A;  2YAN A;  4ACS A;  1U3A A;  1ERU A;  1L5G B;  3LEF A;  1SJW A;  4GSP A;  4JZQ A;  2RLI A;  3UOM A;  1PFO A;  3MHE A;  3ZRE A;  3W8J A;  2H0G A;  5IO2 A;  5HR0 A;  2HSH A;  3KGK A;  3DGQ A;  2WDU A;  2YFJ B;  3HKR A;  3LWA A;  3GZR A;  3S29 A;  3KM6 A;  3WMD A;  3C71 A;  1O7W B;  1UCK A;  2Z76 A;  4ZBA A;  4NAX A;  2R6K A;  1N8R 4;  4XM4 A;  3DM8 A;  2H1B A;  3IK9 A;  1R5P A;  3TKS E;  1AY7 A;  2YJH A;  3QAG A;  4E8E A;  4H61 A;  4IT7 A;  2A15 A;  3CQF A;  5BRT A;  2X99 A;  5M18 A;  1ULJ B;  2GZZ A;  1ZS7 A;  4V2L A;  4D73 A;  4RNT A;  1FW7 A;  3CCR 3;  4X0X A;  2BHM A;  4KE3 A;  1GRX A;  4O5R A;  3GN3 A;  6GSU A;  4POK A;  3EE1 A;  2L5O A;  1W6Y A;  3F63 A;  2A2R A;  5JWR B;  2QSI A;  1Z1S A;  4AJ7 A;  1B2X A;  4Q53 A;  4NHW A;  3EC3 A;  2NDO A;  4ECI A;  4ZL7 A;  2XFT A;  3AHS A;  3HJP A;  1OC3 A;  3BB9 A;  3BNC A;  1XWG A;  3GH9 A;  3TJG A;  3JUN A;  22GS A;  4ML1 A;  2H8L A;  1QMV A;  3Q1C A;  2HZE B;  1QAK A;  1GTA A;  2W0Q A;  5CRW A;  3VGN A;  3BBY A;  3SOY A;  3IPZ A;  1M3I A;  4LEH A;  4N6M A;  1W4V A;  2CWU A;  2B3S A;  1B27 A;  4DSS B;  4J9A A;  1BRH A;  2B5X A;  1HU9 A;  4ZIJ A;  3P7X A;  1F3A A;  3AY8 A;  4IKH A;  4OFM A;  1BSC A;  4KT3 B;  2ALB A;  1X5D A;  3FZ9 A;  4EC6 A;  4K8M A;  3EU3 A;  3F3Q A;  3ME7 A;  3ZIJ A;  2IN3 A;  3F7X A;  2LRN A;  4EV5 A;  1XVQ A;  1UCL A;  2I4A A;  4POM A;  1OPY A;  8CHO A;  4WFO A;  4GLT A;  1MWT A;  3HX8 A;  3G71 3;  4FCM A;  3LFL A;  4BPY A;  2F51 A;  4WXT A;  4PNG A;  4DSQ A;  3BND A;  3FYG A;  1OVN A;  4EDZ A;  1JZD A;  4N11 A;  3GUR A;  2VCQ A;  2OCT A;  1RRH A;  5D8I A;  2DKI A;  3TKQ A;  3CSJ A;  3CYN A;  5HGR A;  2PVO C;  5IMD A;  1MWS A;  3ZMK A;  1A67 A;  4HU7 A;  2L4Q A;  1FVK A;  1YF0 A;  1IV9 A;  1BNE A;  1T2I A;  3N9H A;  1MEK A;  1PN9 A;  4FH8 A;  2CZ2 A;  2EIR A;  4WF4 A;  1FYS A;  3CMA 3;  1TRP A;  3LG6 A;  3RNT A;  1GSF A;  4I2U A;  3A2X A;  3PGB A;  3I56 3;  5DJL A;  3GTU A;  4TN8 A;  4WKW A;  1BRN L;  1NO3 A;  5D9T A;  1SL0 B;  2RII A;  4DSS A;  2MYG A;  1AC1 A;  2K9F A;  3C7M A;  1OHO A;  4N6T A;  4OMV A;  3TJF A;  5CO3 A;  2F5W A;  1SQW A;  1RTU A;  2IUJ A;  19GS A;  3JCM L;  1IQX A;  1I3I A;  1SIH A;  2DJK A;  3KIJ A;  3PGT A;  1ZMA A;  4KCA A;  2H75 A;  3L0R A;  2EIQ A;  4MZW A;  1RGC A;  4OCE A;  2BMQ B;  2CX0 A;  3CSI A;  3LYP A;  3GWR A;  4O5Q A;  1XW5 A;  1O81 A;  4LZI A;  2PPT A;  2CH9 A;  4ZB8 A;  1CQH A;  1B2U A;  2C4J A;  2IWT A;  2GBX B;  1A2M A;  3TRP A;  3LGC A;  2C3T A;  2W04 A;  3HIG A;  1S3A A;  3EMP A;  3ZFZ A;  1K0D A;  2OKA A;  7GSP A;  1K3Y A;  2VL9 A;  1GUM A;  2KAA A;  1ZGX A;  1T8E B;  1U8C B;  1B9Y C;  4MMM A;  2GSP A;  3IAM 2;  1YIT 3;  1PA3 A;  3GFK A;  4HSC X;  2YN1 A;  2W03 A;  3LOY A;  1J08 A;  3L9S A;  1OGZ A;  5ID2 A;  3HOH A;  5FW5 A;  4KH7 A;  1ISK A;  1LJR A;  3KTB A;  5JCU A;  3KE7 A;  3NQZ A;  1GSD A;  2HOH A;  3IHG A;  3APO A;  2CFG A;  3CC7 3;  2P38 A;  3BNB A;  1FUT A;  4YAV A;  5CAX A;  3ZG0 A;  2B7K A;  1S3C A;  1JRQ A;  1A8Y A;  3O3T A;  5EVH A;  1VQO 3;  4ICY A;  2I9W A;  3A5E A;  3DIE A;  1A2V A;  1G7O A;  3LOR A;  2P31 A;  1AQX A;  2CVK A;  4HDE A;  5I97 A;  2L57 A;  2HFD A;  5GZZ B;  1G02 A;  3EX9 A;  1TFK A;  1IV7 A;  4NV2 A;  1J0F A;  3UL5 A;  3NV0 A;  2MC8 A;  2VCW A;  3GZY B;  1Z7R A;  1UW1 A;  1SK1 A;  4J56 E;  2IY2 A;  3SVA A;  2QEX 3;  6STD A;  4J8T A;  1O6J A;  3KP9 A;  5IQY A;  1AV4 A;  5JCG A;  2KUC A;  1YI2 3;  5ELJ A;  2LQV A;  4CY8 A;  2V1M A;  1IK3 A;  4I2T A;  1PN0 A;  4AKY A;  2A4H A;  1XFL A;  5D9W A;  1LOY A;  3HYP A;  5CRE A;  3TOU A;  2C4B A;  4KB3 A;  1KC8 4;  1KTE A;  2D2Z A;  3ALA A;  2V32 A;  3TRQ A;  4GB5 A;  5GAP D;  1GD3 A;  1KNG A;  2LQQ A;  1TP6 A;  1SEN A;  1Q98 A;  1CH0 A;  2X8G A;  2H74 A;  3HHV A;  1T00 A;  2XSO B;  5B6N A;  3F9U A;  4GTU A;  1OAC A;  5CF1 A;  1OC9 A;  5CRG A;  4DVC A;  1JHB A;  1KBN A;  1X5C A;  3FLJ A;  1PKW A;  4HM1 B;  1O73 A;  2VUP A;  1V98 A;  4IQA A;  2R2J A;  2MMA A;  2DC5 A;  1NHY A;  3E9J B;  5IM9 A;  1RGK A;  4OWY A;  1GUH A;  2O7K A;  5ECH B;  2VL3 A;  1T4Y A;  3RGA A;  8GSS A;  3NBR A;  1XWC A;  2H1G A;  3PH9 A;  4O32 A;  1ERW A;  4N0Z A;  3L9U A;  5CLK A;  3C1R A;  2AV4 A;  2PNC A;  1YF1 A;  3MSZ A;  5JWO B;  2BIR A;  2AB6 A;  1LOV A;  3PPU A;  4EIP A;  5KN3 A;  2AHE A;  1EEJ A;  2P09 A;  3VPQ A;  4L5L A;  3UBK A;  4RI6 A;  3BCK A;  4K1F A;  5D96 A;  2IMI A;  4HM2 B;  2OOV A;  1M1K 4;  1T1V A;  1XPV A;  2WGQ A;  3G8Z A;  4JRF A;  4PQ1 A;  3EU4 A;  3C73 A;  4YQU A;  1FHE A;  3A2W A;  3DGN A;  1A2J A;  4I8B A;  3HY2 A;  4MLY A;  5ECP B;  6GST A;  1SD9 A;  1C7H A;  1VQ5 3;  2FGT A;  2WZ9 A;  4GST A;  1IQ8 A;  5KN2 A;  1HNC A;  1UA5 A;  3GHA A;  2CFL A;  3IPT A;  2LJR A;  3DML A;  5AGY A;  1TFO A;  1LU4 A;  3B4P A;  2PER A;  12GS A;  4LA1 A;  1XOB A;  2CAQ A;  3DH2 A;  3IC8 A;  2DIZ A;  3RAZ A;  3U6V A;  4OD7 A;  4N6O B;  4BTY A;  4EVM A;  4X2O A;  5ELG A;  1YHQ 3;  1B9X C;  2IME A;  3BU4 A;  2E2M A;  4I6X A;  4FR9 A;  4HM7 B;  5AIH A;  4EDY A;  4XBT A;  3GAX A;  1FG4 A;  4IJI A;  3Q18 A;  4BL7 B;  1CYU A;  1OUN A;  2G2Q A;  5JPP A;  3E3E A;  5IEO A;  2L1S A;  1FB6 A;  4FCJ A;  3TKP A;  4TXV A;  1UCJ A;  2H6X A;  4HYZ A;  3CD6 3;  2H73 A;  2GBW B;  4HKV B;  1MOL A;  2V6O A;  2VOC A;  1QVF 2;  4CJN A;  1SJ6 A;  3IC4 A;  3MNG A;  4RQX A;  4Z7X A;  1BRI A;  1FGR A;  5LNK e;  3CTF A;  4F0B A;  3GKM A;  4K0G A;  4GQF A;  3BLZ A;  1IYY A;  4G0L A;  2GXF A;  1BU4 A;  4AGS A;  3DXB A;  1EWX A;  3UVT A;  5AEU B;  2A2S A;  5F05 A;  4L0U A;  1GUL A;  1X0R A;  2CV4 A;  1UUV B;  3KTL A;  1NHO A;  2M72 A;  4V2M A;  3GNJ A;  1SJI A;  1GMQ A;  1OC8 A;  4EE0 A;  3M3M A;  1SKW B;  1GOY A;  2XH9 A;  3KSP A;  2M46 A;  2WOH A;  2L4V A;  1WOU A;  2OE0 A;  1NNV A;  2H6Z A;  2ZHX B;  3RHB A;  4F2I A;  3F3R A;  5IPG A;  1WRY A;  3F9S A;  2P0M A;  2KP1 A;  1OHS A;  3GX0 A;  3VWW A;  3TGZ A;  3G9B A;  3PIN A;  2W56 B;  2E2T A;  3AHW A;  5AIG A;  1AQV A;  4K1V A;  3BOA A;  1SYX A;  4FMC A;  3FKF A;  3DUK A;  5KOX A;  4G19 A;  3LQ7 A;  2SAR A;  4MK3 A;  3DMC A;  18GS A;  2GQL A;  4WWU C;  4OK0 A;  1AUC A;  1EP7 A;  2Z9S A;  1JB4 A;  2CFW A;  1EA2 A;  1LBK A;  4LMV A;  1JKG A;  5FHI A;  3M8N A;  1I2G A;  4KZ1 A;  3LTD A;  5EVO A;  2FA4 A;  1W6C A;  1YIJ 3;  2N5B A;  3VWV A;  1Y25 A;  1AQZ A;  3ER7 A;  3NXJ A;  4I5Q A;  3F8H A;  5J5N A;  2FY6 A;  1UGH I;  5ENU A;  3ED3 A;  3IJE B;  3PYJ A;  2B24 B;  2P05 A;  1G6Y A;  1BRG A;  1VQK 3;  4MJE A;  4MZC A;  2ZA4 A;  3S67 A;  1SYR A;  4IQ1 A;  4JRR A;  3JUP A;  1TP9 A;  3NBB A;  5EPF A;  2OOV C;  1EOG A;  3RDE A;  5LC7 A;  1YNV X;  5ELA A;  2H1D A;  3D4M A;  4BWS A;  2RBI A;  3WGX A;  1SU9 A;  3IXR A;  1HNA A;  2FWG A;  3GKK A;  3KCM A;  1M0U A;  2DML A;  3US3 A;  3NOF A;  4O3V A;  3EC9 A;  4WP5 A;  5EQL A;  1Q82 4;  4RUV A;  4ULX A;  1FOH A;  1LOX A;  3NM7 A;  1O7G B;  3QAW A;  2RGQ A;  3ERG A;  1J9B A;  1RGF A;  1A0F A;  2GEY A;  1AIU A;  3UBL A;  4YQM A;  4EW5 A;  1JJ2 2;  1A0R P;  1FVJ A;  2YWI A;  2MF7 A;  2AYT A;  1AAZ A;  1URM A;  3F6D A;  4MJC A;  5BIR A;  1JZR A;  3JUM A;  3SLU A;  2HRK A;  5DAL A;  2DSA A;  1MDK A;  4N10 A;  1BRK A;  4IVF A;  3K0Z A;  1K0B A;  3F7S A;  1PMT A;  2JAD A;  3TJB A;  4XS1 A;  5AEW B;  1S72 3;  3V92 A;  3QR6 A;  4G0I A;  1B21 A;  3JUO A;  1OF5 B;  4CHS A;  1JLW A;  3Q6O A;  1IDP A;  3GRD A;  3U1W A;  2LRT A;  1WE0 A;  3IHQ A;  2GSQ A;  2VLT A;  1TIJ A;  3KEB A;  1YJ6 A;  3QDN A;  4O2H A;  3U5R E;  5F06 A;  3WOF B;  1VQL 3;  3BD2 A;  1ERT A;  2ES7 A;  4BU4 A;  2P5Q A;  2XR8 B;  3A5W A;  4F03 A;  1WP0 A;  4D73 B;  1V57 A;  1RCK A;  3OW2 2;  11GS A;  3ZIT A;  5HFK A;  2BT3 A;  2CAI A;  1FUW A;  1TK5 B;  5G31 A;  2EC4 A;  2QGU A;  3QD9 A;  2CFD A;  5DCG A;  1RGA A;  1E97 A;  3TJK A;  3NUV A;  1CQS A;  5HOH A;  4N6L A;  3EBY A;  1TI1 A;  2J23 A;  3UL3 A;  5FT3 A;  5M1A A;  1U3I A;  2CW9 A;  1PU4 A;  1YKA A;  1WMN A;  1DSB A;  1WMJ A;  3KJY A;  1QXH A;  2CHC A;  1W2Z A;  3FG3 A;  1C72 A;  2AAE A;  1LQM B;  3EHC A;  4AF2 A;  1VQ4 3;  2R0P A;  6GSV A;  1OF5 A;  2R5G A;  4BWQ A;  4HJM A;  3URP A;  3DGM A;  5CP1 A;  1X9W B;  2FNQ A;  7STD A;  2B1L A;  3CTG A;  1E2Y A;  1RNB A;  3H79 A;  2OBK A;  2JZR A;  2TRX A;  4EYC A;  2HSM A;  2L5L A;  2JDI H;  3KII A;  3ROB A;  3D4T A;  1U88 A;  3G6E 3;  2V6K A;  1VRS D;  4KDY A;  3ZML A;  2BMO B;  1MWR A;  4RNY A;  4G10 A;  5D82 A;  1RSN A;  4J2F A;  1K8A 4;  2INX A;  1UCI A;  5H5Q A;  1X1X A;  3JUQ A;  2GQM A;  3CCQ 3;  3O8Y A;  1STD A;  2CK3 H;  2FXT A;  1BNS A;  4L7K A;  5D83 A;  4LLR A;  2WRT A;  4U13 A;  5CXO A;  4FMA A;  1RKY A;  1TI3 A;  3Q90 A;  4TXO A;  1VF2 A;  1RN7 A;  1ST9 A;  3B7C A;  1E6B A;  2ZNM A;  2RCD A;  1PGT A;  6GSS A;  1QK8 A;  2XBQ A;  1O7H B;  1GTI A;  3CNM A;  3MDK A;  1M7T A;  4FYU A;  3UNL A;  2KF4 A;  2OAD A;  1T7P B;  2E2V A;  3ZRD A;  1RJO A;  1NB5 I;  4EF0 A;  3ZLP A;  3KZT A;  5BU4 A;  4O92 A;  4MF5 A;  2HI7 A;  6GSX A;  3PZW A;  3VPT A;  1N9J A;  2I1U A;  3UVH A;  2ZCT A;  1DYU A;  1EEM A;  4ID0 A;  5D81 A;  1VQ8 3;  3E0U A;  4OVM A;  3S5C A;  2LUS A;  1TUH A;  3GTU B;  2MZC A;  4G9H A;  2O85 A;  2CC3 A;  1EGR A;  1LNH A;  4GF0 A;  3MYT A;  5ECL B;  1FW1 A;  2GZY A;  2BO9 B;  3X3X A;  3V98 A;  1GSP A;  2OQE A;  1R5A A;  1QJG A;  4EBG A;  2C80 A;  1SKR B;  3DWV A;  2O3O A;  1ASK A;  5C00 A;  2H6Y A;  1BNR A;  3VSY A;  1DVC A;  2OTL 3;  1O7M B;  4KX4 A;  2EIO A;  5E4W A;  3N9J A;  5B6M A;  4ILF A;  2DBC A;  3IK7 A;  4FMB A;  2ML5 A;  3PR8 A;  4BL2 A;  2PN8 A;  4FO5 A;  3D79 A;  3VI7 A;  1ROA A;  3UIW A;  2ON5 A;  3SXX A;  4GQC A;  1R7H A;  3HXS A;  2F99 A;  2AAD A;  3T0U A;  2B7J A;  3QPM A;  4K7I A;  2XFS A;  2Y74 A;  2C3N A;  3VWU A;  4HQS A;  1RLS A;  4KA0 A;  1A90 A;  3IOS A;  2OWP A;  4PEJ A;  1RW1 A;  2OAC A;  5GSP A;  1QMA A;  1OE7 A;  3STD A;  5IF6 A;  1JBS A;  1Q42 A;  2MBS A;  1TRV A;  3O6T A;  3CC4 3;  1GSU A;  4I97 A;  3FRC A;  3FZW A;  3SYU A;  3DRN A;  5ID2 B;  5J41 A;  4V2N A;  1BVI A;  3MKI A;  5HQP A;  1DBY A;  3NBJ A;  5IEP A;  2FLS A;  1QAF A;  3D4A A;  1OH0 A;  4X2H A;  3WHO A;  3F6F A;  4EUY A;  1B3S A;  1IT8 A;  2VM1 A;  4FYB A;  5H5S A;  1TU7 A;  1IVU A;  3D3L A;  4N30 A;  1DVD A;  2HRF A;  2NPB A;  1VQN 3;  2TRC P;  5CRD A;  1FA3 A;  1XVW A;  5ABR A;  1LQG C;  3GZB A;  1G7E A;  1VQ6 3;  3F4T A;  1LVN A;  3FY7 A;  1DE1 A;  2GU1 A;  3NV0 B;  3HK4 A;  3IR4 A;  4IEL A;  5ECO B;  3I0Y A;  2IA7 A;  2IMF A;  4WF5 A;  4A5P A;  2PU9 C;  2GS3 A;  2R0G A;  4HZB B;  1I70 A;  1W89 A;  1B8X A;  2WOF A;  2WUL A;  2MMO A;  4HJL B;  4JED A;  1GS3 A;  2F3M A;  1DMM A;  2B1X B;  3FH1 A;  4YAP A;  1HNB A;  4Z2U A;  1XG8 A;  1NU3 A;  5KN1 A;  1EOH A;  3EIN A;  1M9G A;  4XIH A;  3FF0 A;  5IMF A;  3NX0 A;  4ECC A;  3LYG A;  1V2A A;  3HDC A;  2XSH B;  3E99 A;  4GWR A;  4JU5 A;  4XBX A;  1VF1 A;  3GX8 A;  3DY5 A;  1ZYP A;  1PRX A;  4IBP A;  2P0X A;  2B5E A;  5HR2 A;  4PUA A; 
#chains in the Genus database with same CATH homology
 2DJJ A;  1TRU A;  4XS6 A;  3TKR A;  1OC9 B;  4ZXG A;  1V9W A;  5B8B A;  2KHP A;  4ZL8 A;  5HR3 A;  2R0C A;  2FWE A;  3FK8 A;  3BCI A;  3L0H A;  4JBB A;  1SL2 B;  2YOI A;  2YPM A;  2FA8 A;  2IMK A;  1SL1 B;  4X1U A;  1XWB A;  2QGV A;  4MPG A;  1HYU A;  1OAZ A;  3A5I A;  3VUR A;  3L78 A;  3GMF A;  4ECJ A;  2IYJ A;  3KD0 A;  2C0D A;  2JAC A;  2AJQ B;  4N0V A;  1B4P A;  5HFI A;  5INY A;  3M0F A;  2FCH A;  1ERV A;  2H72 A;  5G5E A;  1OYJ A;  5DQS A;  3ISO A;  1ABA A;  1M2B A;  1ILO A;  4XS4 A;  5IMV A;  3ZVJ A;  1U87 A;  2MBT A;  4PUR A;  3MIX A;  3HD5 A;  2GT5 A;  1QFN A;  5IMC A;  3IDV A;  4V1A g;  4WBJ A;  2IIY A;  1VGL A;  2VAF A;  2I3Y A;  3VWX A;  4Q5F A;  4EL1 A;  2L6C A;  1VF4 A;  1FO5 A;  1GL8 A;  3L9V A;  3DVW A;  3KXO A;  5KEJ A;  4TR0 A;  1R4W A;  1PD2 1;  3FEU A;  3VI5 A;  2HRN A;  4EO3 A;  1XWK A;  4X4J A;  1Q4J A;  3WGD A;  3KMN A;  3O76 A;  1TRS A;  4F0C A;  1MDI A;  4GSN A;  1M99 A;  4BVX A;  1JFU A;  4GXZ A;  1X5E A;  2C8U A;  2HRA A;  4POB A;  3F4R A;  4NXI A;  4ISD A;  2F8F A;  5G1K A;  4CDO A;  4HZ4 A;  1M9A A;  2FD3 A;  1R26 A;  3MAK A;  4TKY A;  1U6T A;  3TRX A;  3IAS 2;  3HCZ A;  3ZFL A;  1Z7P A;  3KP8 A;  2YWM A;  3C1S A;  3C8E A;  4LMW A;  5CNW A;  2LNT A;  13GS A;  4GRF A;  2RM5 A;  2XHF A;  3WD6 A;  4K0N A;  3R2Q A;  3RHC A;  3G7J A;  4G0K A;  2I9H A;  3I43 A;  2QA2 A;  7GSS A;  2F8A A;  5GST A;  2HT9 A;  2MMN A;  2VCV A;  1H4O A;  3EMX A;  3IA1 A;  5JCW A;  1XBS A;  2YZH A;  1V58 A;  4NMU A;  5D93 A;  2IL3 A;  2GTU A;  5KOW A;  1EGO A;  5ECN B;  4JR4 A;  2GST A;  3H8Q A;  4HU9 A;  3HVV A;  4TRX A;  3UMA A;  3FR6 A;  3EE2 A;  1ZYN A;  1SK2 A;  2JZS A;  2CT6 A;  5ECK B;  1G0T A;  5A4U A;  1GLP A;  1N2A A;  3LSZ A;  3DEX A;  1SKS B;  4KF9 A;  1T4Z A;  2LTK A;  4OO5 A;  5HR1 A;  4ZB6 A;  1SJZ A;  2VD1 A;  3GKX A;  3TUE A;  3GRX A;  4OO4 A;  3GIX A;  3OR5 A;  3Q74 A;  4ECB A;  3CRT A;  5DAL B;  4BVY B;  2VLV A;  4O5U A;  1AXD A;  2P0G A;  2LNS A;  1TRW A;  1XZO A;  1MD3 A;  2LS5 A;  1EZK A;  1TW9 A;  1Z5Y E;  14GS A;  4CW9 A;  3IBH A;  4YH2 A;  2FWH A;  2FUG 2;  1ACV A;  1TK8 B;  2ZUP A;  16GS A;  2DLX A;  3QOU A;  2XPE A;  2UZ8 A;  3HVX A;  4HJ2 A;  1ZCP A;  1SD8 A;  3HZ4 A;  4K7O A;  4WR5 A;  3D6I A;  4IGJ A;  3TDG A;  5ECM B;  2VCT A;  4J57 E;  2PMT A;  1H75 A;  4BA7 A;  1NSW A;  2VCX A;  4HUA A;  1TJD A;  5B8A A;  3J7Y b;  2PVQ A;  2C0F A;  5GSS A;  4BVY A;  2GSR A;  2X8C A;  3FHK A;  5IO0 A;  4DEJ A;  1K0N A;  1VF3 A;  1F37 A;  2YWN A;  4POL A;  2K8V A;  1WJK A;  1WWJ A;  5ECI B;  4MAB A;  4HS1 A;  5DAK A;  5AIV A;  1YY7 A;  3G7I A;  3GH6 A;  4QQ7 A;  2QC7 A;  3P2A A;  3UEM A;  1GSY A;  3J7Y k;  1FOV A;  2NTO A;  4HQZ A;  1OE8 A;  1RQM A;  1O8X A;  1YKC A;  1XXU A;  4ZL9 A;  1QGV A;  2YJ7 A;  5IIZ A;  2E0Q A;  2X49 A;  2PWJ A;  1PKZ A;  3FZ4 A;  3K8N A;  1K0M A;  1RK4 A;  2X8H A;  1XCC A;  4TXO B;  1A24 A;  2DJ3 A;  4ML6 A;  2YWO A;  4K2D A;  3I9V 2;  2GQK A;  1GNW A;  2YCD A;  4MA9 A;  3DKS A;  2RUF A;  1GSS A;  2GDR A;  1BX9 A;  2B6M A;  5DDL A;  3NIV A;  1K0C A;  3EVI A;  1V40 A;  4NHZ A;  4L5O A;  2RUE A;  2IJY A;  2BTO T;  2WFC A;  4O7H A;  4Q5Q A;  3FR9 A;  3SWL A;  5IOW A;  3VK9 A;  5FWG A;  5D9V A;  5CRH A;  1IYH A;  4XRD A;  4YKF A;  4AJ8 A;  5BMU A;  2HNL A;  3IE3 A;  2E7P A;  1K0O A;  1GWC A;  4MDC A;  4MJA A;  3HZ8 A;  1GP1 A;  2CVD A;  3ZVJ D;  5KN0 A;  3ZYW A;  4HI7 A;  3RPP A;  3MYD A;  4IHU A;  1GSE A;  2YP6 A;  2LQO A;  2VM2 A;  4GCI A;  3HJM A;  4TOP A;  2GZP A;  4MF6 A;  4TR3 A;  2AAW A;  3ZL5 A;  3GKN A;  2GLR A;  5G5F A;  4K5S A;  5AIS A;  4JE1 A;  2KLX A;  1F9M A;  3QFA C;  2NVL A;  2OJL A;  3I69 A;  4KCE A;  2WGR A;  3BJ5 A;  1Y6E A;  3L4N A;  1WPI A;  4XCS A;  2AUV A;  2VO4 A;  3MWH A;  3TKS A;  1T3B A;  1JZW A;  4MPF A;  1FAA A;  2K18 A;  1CQG A;  4TR1 B;  1GSQ A;  5LCZ A;  3GA4 A;  3H93 A;  1UVZ A;  3UJ1 A;  2VIM A;  3RBT A;  5F0G A;  2QKE A;  3LW9 A;  1GUK A;  3RDW A;  2BJX A;  1XWA A;  3V1W A;  2NBS A;  2HSY A;  5COH A;  1F2E A;  3GYK A;  4IN0 A;  1TTZ A;  2G0F A;  1A2L A;  1PQN A;  1SK0 A;  2XBI A;  3FW2 A;  3LYK A;  2E2G A;  2KP2 A;  1EV9 A;  1BJX A;  2MMZ A;  2R37 A;  3KMO A;  1FB0 A;  3FZ5 A;  5L71 A;  5JWQ B;  2A4V A;  2VL2 A;  3I6A A;  4QL7 A;  2HZE A;  2VD0 A;  10GS A;  4TR1 A;  3A3T A;  3TJJ A;  1GH2 A;  1BED A;  4PUF C;  4H86 A;  2WJU A;  2DIY A;  5DQY A;  4Z2R A;  3M1G A;  3P90 A;  5HFG A;  2C0G A;  1PX7 A;  2L59 A;  1WIK A;  6GSW A;  2IPA A;  4TVE A;  3QFB C;  3GL5 A;  2FNO A;  6GSY A;  4CY6 A;  4LL1 B;  1ZOF A;  5IOX A;  3LJR A;  2VCZ A;  4PX1 A;  1OKD A;  1I9D A;  3WT2 A;  4XS4 B;  3QCP A;  1GNE A;  5A5K A;  2FGX A;  5J4U A;  2JSZ A;  1QUW A;  4MCU A;  3R3E A;  1JLV A;  1XW6 A;  2H76 A;  5IMA A;  2R3X A;  2ON7 A;  4FYC A;  4P3Y B;  1ZL9 A;  4EXJ A;  3ME8 A;  4IS0 A;  2LEG A;  2V41 A;  5F07 A;  2IFQ B;  2DMM A;  4IP1 A;  2OE3 A;  1ZYQ B;  2JU5 A;  3D0Z A;  3G7Y A;  3RPN A;  4HEA 2;  3TKS C;  1ZYE A;  3F0I A;  3VFI A;  2J9H A;  2XC2 A;  1NW2 A;  3CSH A;  3M9K A;  2C0E A;  2H1A A;  17GS A;  5LD0 A;  3GST A;  4BVX B;  5AIX A;  2JSY A;  4K9Z A;  2JL4 A;  2VLU A;  2H70 A;  5E59 A;  1M2A A;  1DUG A;  3H4K A;  4FQU A;  5H5R A;  4ZBB A;  1XW9 A;  2F9S A;  2OE1 A;  1BYE A;  4MH3 A;  3ZZX A;  4K6X A;  3W6G A;  2IMD A;  2GSS A;  5D9X A;  4HZ2 A;  4PTS A;  2H19 A;  2IFQ A;  4GSS A;  4YQV A;  2DJ1 A;  1PL2 A;  2OBI A;  3ZTL A;  4HOJ A;  1MD4 A;  1ZZY A;  1YEX A;  4MP4 A;  4QL9 A;  5G1L A;  1I5G A;  4USS A;  2VL2 C;  2B1K A;  3IRA A;  3QMX A;  3APS A;  3EYT A;  4NWY A;  1IYI A;  2R4V A;  1BG5 A;  2BMX A;  1YZX A;  5G2Z A;  3DVX A;  3SBC A;  4F9Z A;  2RM6 A;  1K3L A;  2WB9 A;  1YEP A;  4TW5 A;  1BQ7 A;  3DYR A;  2LV3 A;  1YDK A;  1TXX A;  3GSS A;  1EP8 A;  2A2P A;  4Q5N A;  1B4Q A;  1Z9H A;  3TB2 A;  2GT6 A;  4KAE A;  2CQ9 A;  2O89 A;  2YV9 A;  3WYW A;  1MDJ A;  2CX3 A;  5G30 A;  1X9S B;  4KSO A;  2H30 A;  1F6M C;  2HYX A;  1ML6 A;  2P5R A;  4NPB A;  5IPH A;  5AN1 A;  3EWL A;  2H66 A;  2N5A A;  3CXG A;  3HJO A;  1BAY A;  1M2D A;  9GSS A;  1B48 A;  4K7N A;  2CVB A;  5A4W A;  4WBR D;  1TOF A;  1PL1 A;  4XTS A;  1UC7 A;  4PNF A;  1OKT A;  3GL3 A;  2GGT A;  3EUR A;  2YNX A;  3D22 A;  3D21 A;  2OA7 A;  1XOA A;  5J9B A;  3S9F A;  2YZU A;  5IMZ A;  3UAR A;  4WR4 A;  4L8E A;  4JR6 A;  1Z6N A;  4KDX A;  1GTU A;  4EC0 A;  4IW9 A;  3FR3 A;  3WT1 A;  3CRU A;  2REM A;  3M9J A;  4Q5R A;  2HE3 A;  2WS2 A;  2V2G A;  3A2V A;  2QA1 A;  2PBJ A;  3TCO A;  1X9M B;  4XRA A;  3N5O A;  2CA8 A;  2FHE A;  1Z6M A;  4WET A;  2XPD A;  1THX A;  3HVS A;  3ZFB A;  3KH9 A;  1MTC A;  2B5Y A;  2PGT A;  2DJ2 A;  2K6V A;  3W8S A;  3KH7 A;  2H0I A;  2CZ3 A;  3LXT A;  5DVB A;  1KEB A;  2LRC A;  3Q19 A;  1TU8 A;  2X4A A;  4KDU A;  4PUA A;  4F82 A;  3UAP A;  4BL7 A;  2H01 A;  2HZF A;  1GTB A;  4PQH A;  2WCI A;  2C3Q A;  2DKH A;  5DAK B;  1PSQ A;  2GVP A;  4K5R A;  4RI7 A;  5DBQ A;  1AW9 A;  1A8L A;  3APQ A;  4X43 A;  4OFT A;  1O85 A;  2O87 A;  2HLS A;  4MZB A;  4IP6 A;  2LJK A;  2LJA A;  3WGE A;  3ZIV A;  4MF7 A;  3ERF A;  1ZGN A;  3LXZ A;  1ON4 A;  4KUN A;  4AJ6 A;  4WEY A;  2KOK A;  3FZA A;  3P8W A;  1HQO A;  2LST A;  4DSR A;  1XIY A;  1JZO A;  4V1A p;  1Z3E A;  3IV4 A;  3CBU A;  3KZQ A;  2C1Y A;  3F8U A;  4Z2T A;  3DD3 A;  5B7C A;  2X64 A;  4FIW A;  4KSM A;  1QQ2 A;  4L0W A;  5J3R A;  2M80 A;  3HA9 A;  5ECR B;  3GV1 A;  1DE2 A;  1YQ1 A;  1USB A;  5F8B A;  1TK0 B;  5ECQ B;  4OCF A;  4ZIL A;  3ERW A;  5EY6 A;  4MNN A;  4MJB A;  4PQI A;  4PXO A;  3EPT A;  1G6W A;  4OFN A;  5DCH A;  1A23 A;  4MH2 A;  1K0A A;  2JZT A;  2PUK C;  1TDI A;  5DJM A;  4EIQ A;  4IJ3 A;  3GUS A;  1EV4 A;  4KW6 A;  1TKD B;  4YKG A;  1O7U A;  4E8H A;  5A4V A;  3FMW A;  2H0H A;  2DJ0 A;  1S3D A;  3NZN A;  2CX4 A;  1AQW A;  1M9B A;  3H1N A;  5GAN D;  1GLQ A;  5ECS A;  3VLN A;  5J9C A;  2TIR A;  2N5F A;  3CMI A;  4K2X A;  4TR4 A;  5CYY A;  3QAV A;  20GS A;  2I81 A;  1PX6 A;  4EKZ A;  2YV7 A;  4KND A;  5D73 A;  4ZBD A;  2K8S A;  1NM3 A;  2L4C A;  3TOT A;  4ZB9 A;  4NV5 A;  4G2E A;  1N8J A;  2HXK A;  2O8V B;  5EL8 A;  1K3O A;  1UN2 A;  3D5J A;  1O8W A;  5C04 A;  2LKU A;  1F3B A;  4LL4 B;  4RQR A;  4KGI A;  4PGT A;  2H71 A;  2FWF A;  1HD2 A;  2L6D A;  1THO A;  3F4S A;  2YAN A;  4ACS A;  1U3A A;  1ERU A;  3LEF A;  4JZQ A;  2RLI A;  3UOM A;  3ZRE A;  3W8J A;  2H0G A;  5IO2 A;  5HR0 A;  2HSH A;  3KGK A;  3DGQ A;  2WDU A;  3HKR A;  3LWA A;  3KM6 A;  3C71 A;  4ZBA A;  4NAX A;  2R6K A;  2H1B A;  3IK9 A;  1R5P A;  3TKS E;  2YJH A;  3QAG A;  4E8E A;  5BRT A;  2X99 A;  2GZZ A;  4V2L A;  4D73 A;  4X0X A;  1GRX A;  4KE3 A;  4O5R A;  3GN3 A;  6GSU A;  4POK A;  2L5O A;  3F63 A;  2A2R A;  5JWR B;  2QSI A;  4AJ7 A;  4NHW A;  3EC3 A;  2NDO A;  4ECI A;  4ZL7 A;  3HJP A;  1OC3 A;  1XWG A;  3GH9 A;  3TJG A;  22GS A;  4ML1 A;  2H8L A;  1QMV A;  2HZE B;  1GTA A;  5CRW A;  3BBY A;  3IPZ A;  1W4V A;  2B3S A;  4DSS B;  2B5X A;  4ZIJ A;  3P7X A;  1F3A A;  3AY8 A;  4IKH A;  4OFM A;  2ALB A;  1X5D A;  3FZ9 A;  4K8M A;  3EU3 A;  3F3Q A;  3ME7 A;  3ZIJ A;  2IN3 A;  2LRN A;  1XVQ A;  2I4A A;  4POM A;  4GLT A;  3LFL A;  4BPY A;  2F51 A;  4WXT A;  4PNG A;  4DSQ A;  3FYG A;  1OVN A;  4EDZ A;  1JZD A;  4N11 A;  3GUR A;  2VCQ A;  5D8I A;  2DKI A;  3TKQ A;  3CSJ A;  3CYN A;  2PVO C;  5IMD A;  3ZMK A;  4HU7 A;  2L4Q A;  1FVK A;  1YF0 A;  1MEK A;  1PN9 A;  4FH8 A;  2CZ2 A;  2EIR A;  4WF4 A;  3LG6 A;  1GSF A;  4I2U A;  3A2X A;  5DJL A;  3GTU A;  4TN8 A;  4WKW A;  5D9T A;  1SL0 B;  2RII A;  4DSS A;  2MYG A;  1AC1 A;  2K9F A;  3C7M A;  4OMV A;  3TJF A;  5CO3 A;  19GS A;  3JCM L;  2DJK A;  3KIJ A;  3PGT A;  1ZMA A;  4KCA A;  2H75 A;  2EIQ A;  4MZW A;  4OCE A;  3CSI A;  3LYP A;  4O5Q A;  1XW5 A;  1O81 A;  2PPT A;  4ZB8 A;  1CQH A;  2C4J A;  2IWT A;  1A2M A;  3TRP A;  3LGC A;  2C3T A;  1S3A A;  3EMP A;  1K0D A;  2OKA A;  1K3Y A;  2VL9 A;  1GUM A;  1T8E B;  4MMM A;  1B9Y C;  3IAM 2;  1PA3 A;  3GFK A;  2YN1 A;  1J08 A;  3L9S A;  5ID2 A;  4KH7 A;  1LJR A;  3KTB A;  5JCU A;  1GSD A;  3IHG A;  3APO A;  4YAV A;  5CAX A;  2B7K A;  1S3C A;  1A8Y A;  3O3T A;  4ICY A;  3DIE A;  1G7O A;  3LOR A;  2P31 A;  1AQX A;  2CVK A;  4HDE A;  2L57 A;  2HFD A;  5GZZ B;  4NV2 A;  1J0F A;  2VCW A;  1Z7R A;  1SK1 A;  4J56 E;  2IY2 A;  1O6J A;  3KP9 A;  5IQY A;  5JCG A;  2KUC A;  4CY8 A;  2V1M A;  4I2T A;  1PN0 A;  2A4H A;  1XFL A;  5D9W A;  3HYP A;  5CRE A;  3TOU A;  4KB3 A;  1KTE A;  2D2Z A;  2V32 A;  3TRQ A;  5GAP D;  1KNG A;  2LQQ A;  1SEN A;  1Q98 A;  3HHV A;  2X8G A;  2H74 A;  5B6N A;  1T00 A;  3F9U A;  4GTU A;  1OC9 A;  5CRG A;  4DVC A;  1JHB A;  1KBN A;  1X5C A;  1PKW A;  1O73 A;  2VUP A;  1V98 A;  4IQA A;  2R2J A;  2MMA A;  2DC5 A;  1NHY A;  3E9J B;  5IM9 A;  4OWY A;  1GUH A;  2O7K A;  5ECH B;  2VL3 A;  1T4Y A;  8GSS A;  1XWC A;  2H1G A;  3PH9 A;  4O32 A;  1ERW A;  4N0Z A;  3L9U A;  3C1R A;  2AV4 A;  3MSZ A;  1YF1 A;  5JWO B;  2AB6 A;  3PPU A;  4EIP A;  5KN3 A;  2AHE A;  1EEJ A;  3VPQ A;  4L5L A;  3UBK A;  4RI6 A;  3BCK A;  4K1F A;  5D96 A;  2IMI A;  1T1V A;  1XPV A;  4PQ1 A;  3EU4 A;  3C73 A;  4YQU A;  1FHE A;  3A2W A;  1A2J A;  4I8B A;  3HY2 A;  4MLY A;  5ECP B;  6GST A;  1SD9 A;  2WZ9 A;  4GST A;  5KN2 A;  1HNC A;  1UA5 A;  3GHA A;  2LJR A;  3DML A;  5AGY A;  1LU4 A;  2PER A;  12GS A;  4LA1 A;  1XOB A;  2CAQ A;  3IC8 A;  2DIZ A;  3RAZ A;  3U6V A;  4OD7 A;  4EVM A;  5ELG A;  1B9X C;  2IME A;  2E2M A;  4I6X A;  4EDY A;  1FG4 A;  4IJI A;  3Q18 A;  4BL7 B;  2G2Q A;  3E3E A;  1FB6 A;  3TKP A;  4TXV A;  2H6X A;  2H73 A;  2VOC A;  2V6O A;  1SJ6 A;  3IC4 A;  3MNG A;  4RQX A;  4Z7X A;  5LNK e;  3CTF A;  4F0B A;  3GKM A;  4K0G A;  4GQF A;  4G0L A;  4AGS A;  3DXB A;  1EWX A;  3UVT A;  5F05 A;  2A2S A;  4L0U A;  1GUL A;  1X0R A;  2CV4 A;  3KTL A;  1NHO A;  2M72 A;  4V2M A;  3GNJ A;  1SJI A;  1OC8 A;  4EE0 A;  3M3M A;  1SKW B;  2M46 A;  1WOU A;  2OE0 A;  2H6Z A;  4F2I A;  3RHB A;  5IPG A;  3F3R A;  1WRY A;  2KP1 A;  3GX0 A;  3VWW A;  3TGZ A;  3G9B A;  3PIN A;  3BOA A;  1AQV A;  1SYX A;  3FKF A;  5KOX A;  4G19 A;  3LQ7 A;  4MK3 A;  18GS A;  2GQL A;  1AUC A;  1EP7 A;  2Z9S A;  1LBK A;  4LMV A;  5FHI A;  3M8N A;  5EVO A;  2FA4 A;  2N5B A;  3VWV A;  1Y25 A;  4I5Q A;  5J5N A;  2FY6 A;  5ENU A;  3ED3 A;  1G6Y A;  4MJE A;  4MZC A;  1SYR A;  4IQ1 A;  4JRR A;  1TP9 A;  5EPF A;  1EOG A;  5ELA A;  2H1D A;  3D4M A;  4BWS A;  3WGX A;  1SU9 A;  3IXR A;  1HNA A;  2FWG A;  3GKK A;  3KCM A;  1M0U A;  2DML A;  3US3 A;  3NOF A;  4RUV A;  4ULX A;  1FOH A;  3QAW A;  3ERG A;  1J9B A;  1A0F A;  1AIU A;  3UBL A;  4YQM A;  1FVJ A;  1A0R P;  2YWI A;  3F6D A;  2AYT A;  1AAZ A;  1URM A;  4MJC A;  1JZR A;  2HRK A;  5DAL A;  2DSA A;  1MDK A;  4N10 A;  4IVF A;  1K0B A;  1PMT A;  2JAD A;  3TJB A;  4XS1 A;  3QR6 A;  4G0I A;  4CHS A;  1JLW A;  3Q6O A;  2LRT A;  1WE0 A;  3IHQ A;  2GSQ A;  2VLT A;  3KEB A;  1YJ6 A;  3QDN A;  3U5R E;  5F06 A;  3BD2 A;  1ERT A;  2ES7 A;  2P5Q A;  3A5W A;  4F03 A;  1WP0 A;  4D73 B;  1V57 A;  11GS A;  3ZIT A;  5HFK A;  2CAI A;  1TK5 B;  5G31 A;  2EC4 A;  3QD9 A;  5DCG A;  3TJK A;  1TI1 A;  2J23 A;  3UL3 A;  5FT3 A;  1U3I A;  1YKA A;  1DSB A;  1WMJ A;  3KJY A;  1QXH A;  1C72 A;  4AF2 A;  2R0P A;  6GSV A;  2R5G A;  4BWQ A;  4HJM A;  5CP1 A;  1X9W B;  2B1L A;  3CTG A;  1E2Y A;  3H79 A;  2OBK A;  2JZR A;  2TRX A;  2HSM A;  2L5L A;  3D4T A;  1U88 A;  2V6K A;  1VRS D;  4KDY A;  3ZML A;  4G10 A;  4J2F A;  5H5Q A;  2GQM A;  4LLR A;  2WRT A;  1TI3 A;  4TXO A;  1VF2 A;  1ST9 A;  1E6B A;  2ZNM A;  1PGT A;  6GSS A;  1QK8 A;  2XBQ A;  1GTI A;  3MDK A;  1M7T A;  4FYU A;  2OAD A;  1T7P B;  3ZRD A;  4EF0 A;  3ZLP A;  4O92 A;  4MF5 A;  2HI7 A;  6GSX A;  3VPT A;  2I1U A;  3UVH A;  2ZCT A;  1EEM A;  4ID0 A;  3E0U A;  2LUS A;  3GTU B;  2MZC A;  4G9H A;  2O85 A;  1EGR A;  4GF0 A;  5ECL B;  1FW1 A;  2GZY A;  1R5A A;  2C80 A;  1SKR B;  3DWV A;  5C00 A;  2H6Y A;  4KX4 A;  2EIO A;  5E4W A;  3N9J A;  5B6M A;  4ILF A;  2DBC A;  3IK7 A;  3PR8 A;  4FO5 A;  2PN8 A;  3VI7 A;  3UIW A;  2ON5 A;  4GQC A;  1R7H A;  3HXS A;  2B7J A;  4K7I A;  3QPM A;  2C3N A;  3VWU A;  4HQS A;  4KA0 A;  3IOS A;  1RW1 A;  2OAC A;  1OE7 A;  2MBS A;  1TRV A;  3O6T A;  1GSU A;  4I97 A;  3FRC A;  3DRN A;  5ID2 B;  5J41 A;  4V2N A;  5HQP A;  1DBY A;  2FLS A;  3F6F A;  4EUY A;  2VM1 A;  4FYB A;  5H5S A;  1TU7 A;  4N30 A;  2HRF A;  2NPB A;  2TRC P;  5CRD A;  1XVW A;  5ABR A;  1G7E A;  3F4T A;  3FY7 A;  1DE1 A;  3IR4 A;  5ECO B;  4IEL A;  4A5P A;  4WF5 A;  2IMF A;  2PU9 C;  2GS3 A;  2R0G A;  1W89 A;  1B8X A;  2WUL A;  2MMO A;  4JED A;  2F3M A;  4YAP A;  1HNB A;  4Z2U A;  5KN1 A;  1EOH A;  3EIN A;  4XIH A;  5IMF A;  4ECC A;  1V2A A;  3HDC A;  4GWR A;  4JU5 A;  1VF1 A;  3GX8 A;  1ZYP A;  1PRX A;  4IBP A;  2B5E A;  5HR2 A;  4XHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...