1JZOA

Dsbc c101s
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN DSBC
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal Structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 67
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzoA02
1GSUA 3GFKA 3VK9A 3ME8A 1A0RP 1TOFA 4ML6A 4IELA 4KH7A 2L4QA 3Q74A 2X8CA 1GTIA 3VI7A 4IQAA 3ZFBA 1JHBA 3DMLA 1M7TA 2DBCA 4L0WA 1G0TA 1SJIA 2IFQB 20GSA 2CZ3A 2M46A 1XW9A 1S3CA 3F0IA 3MSZA 1PX7A 4IJIA 1LU4A 1R4WA 3A2WA 4GF0A 2H30A 4QQ7A 2RM6A 2IMKA 3IBHA 1J08A 4DVCA 3I43A 1UN2A 2CAIA 1ERVA 3HJMA 5G5FA 2CZ2A 3GUSA 2VOCA 2LUSA 3TKRA 3NIVA 3WD6A 1BAYA 4MJAA 3WGXA 3A2XA 5DVBA 1TDIA 3C71A 1E6BA 2CAQA 2FD3A 2KP2A 4KW6A 4PXOA 1B4QA 4IN0A 3KTBA 3ZMLA 4JE1A 4TR3A 1U87A 1R26A 2WCIA 5JWQB 4TR0A 5F0GA 3KMNA 3L9VA 2FWGA 1YZXA 1GSYA 4KCAA 4OCEA 5F06A 1DE1A 5DCHA 4MJBA 3KP9A 3W8JA 3KD0A 2B3SA 2HLSA 3O3TA 1PRXA 4HZ2A 2O87A 1XVWA 4HJ2A 4Z7XA 4EUYA 1V40A 1FG4A 2MMAA 3L0HA 3DIEA 3TCOA 1K0MA 1OAZA 1SD9A 4MCUA 1KTEA 1YF0A 1OE8A 3ZYWA 2IFQA 2FWEA 4O92A 2F51A 4OFNA 2C80A 2AB6A 3QDNA 4LMWA 5CNWA 2FNOA 4LMVA 2PWJA 4K7NA 2JSYA 3IRAA 2X8HA 2PU9C 3D5JA 3GX8A 3ERGA 3ZREA 2TRCP 3GSTA 5H5SA 4FIWA 3KJYA 1QQ2A 2IY2A 1WRYA 5ECRB 5HR1A 2RUEA 1FHEA 1YQ1A 4P3YB 2WB9A 3I9V2 1N2AA 3KEBA 1XOAA 1NHYA 2VO4A 3TKSE 4ZBDA 3TRXA 2CX4A 2X99A 4L0UA 2Z9SA 1QUWA 4FYCA 5AISA 2BTOT 2CQ9A 2O7KA 4TRXA 4AGSA 2B7JA 1XIYA 5LD0A 1K3OA 4L5OA 1TKDB 1FVJA 4EE0A 2H74A 1K0DA 2NDOA 4JU5A 3IDVA 2LJRA 2VL3A 1Z9HA 2OE3A 2JADA 3FR6A 1K0NA 1EOHA 2JACA 4WR5A 12GSA 2NVLA 4POKA 1SYRA 1PN9A 3QCPA 1YY7A 4AJ6A 2E0QA 4KSOA 2JZRA 5GSSA 1M99A 1M2BA 4K6XA 2IMIA 1XWCA 3F6FA 3H79A 3GA4A 1QK8A 4K0GA 1G6WA 5FT3A 3KZQA 5HR2A 2F8AA 3APOA 2VUPA 5G1KA 2GTUA 2P31A 3DVWA 1B8XA 1G7EA 3U6VA 2HYXA 3ZTLA 1HYUA 5EL8A 2WS2A 2JSZA 1OC9A 1X9SB 3FZAA 2B1LA 3ZL5A 2B5XA 1XZOA 3FK8A 5DJLA 4FH8A 3C7MA 1W4VA 1ZL9A 3KMOA 3CRUA 2IIYA 3GYKA 4GRFA 3IV4A 4JZQA 2GDRA 2PPTA 3FW2A 4TR1B 2H19A 1NHOA 1X5EA 2E7PA 3ME7A 1YKAA 1XWAA 2PN8A 2VM2A 5ECKB 5IMVA 2HE3A 2YN1A 1FB0A 1K3LA 4KNDA 2C3QA 5EPFA 1A2JA 3FHKA 5AIVA 1SL2B 2VIMA 1SL1B 3EVIA 4GXZA 4XIHA 2YNXA 1GLPA 3A5WA 2WRTA 5KEJA 2H66A 1PQNA 2VD0A 2YV7A 2YJHA 5ID2A 3IK7A 2FLSA 2R5GA 4IKHA 3APSA 2NPBA 1MTCA 1EEJA 1O73A 3KTLA 3ZFLA 1V58A 1W89A 1XW5A 1PGTA 4I8BA 3GTUA 2GZPA 3M0FA 2QKEA 3E3EA 3DVXA 5IMFA 1O85A 1SENA 5B7CA 2N5FA 2IMFA 2JZSA 3QAGA 1J9BA 3CRTA 4V2MA 1OC3A 1CQGA 3FR9A 3BOAA 4ZL7A 2LJKA 5E4WA 3EINA 4DSSB 4K1FA 5ENUA 2L6DA 3IOSA 3N9JA 4I2TA 1SK0A 4O32A 4V1Ap 2DJ3A 3TJGA 4KX4A 4ZILA 2L59A 2MMOA 4D73A 2WFCA 1N8JA 4I2UA 2VCZA 1GUKA 1JZWA 4GSSA 1SKRB 3TB2A 2EIQA 1AXDA 4N10A 4V2LA 5INYA 1JZOA 3ERWA 1HNCA 1JLVA 3R2QA 2LQQA 1EZKA 1VF4A 2IYJA 4HZ4A 3MDKA 4PX1A 4IBPA 2YWNA 3D21A 5F07A 2FA4A 4GWRA 3UEMA 3HJPA 3GKMA 4BL7A 2YWOA 4JRRA 2VAFA 4ID0A 3LG6A 4IP6A 4G2EA 3ZVJA 1K0CA 4PUFC 2C0GA 5H5RA 2PVQA 2MYGA 3EU4A 2I4AA 3IE3A 5HQPA 1JZDA 3EU3A 4MK3A 2GSRA 3H1NA 4JR4A 3VPTA 3NZNA 2TIRA 1PL1A 1QMVA 2MMZA 2FA8A 2H1BA 4WR4A 5CRWA 3O76A 4GQFA 4TVEA 4KUNA 4ZL8A 1TI3A 3H8QA 1ACVA 4GSNA 1UA5A 3APQA 3LORA 4X1UA 3SWLA 2KOKA 2H8LA 3P90A 1YF1A 2E2GA 2BMXA 1OKTA 3ZRDA 17GSA 3PH9A 3VFIA 1A8YA 1RW1A 2RM5A 3QFAC 11GSA 2KP1A 2V41A 1BX9A 3C8EA 3UIWA 1DE2A 5G30A 4AJ7A 2C8UA 1A2MA 4E8EA 2DIYA 2B5YA 1UVZA 3GKNA 3HHVA 3TKQA 2H71A 10GSA 1T1VA 2L6CA 1G6YA 5IQYA 1V57A 2GSQA 1A24A 3TOTA 1MEKA 4TXOB 4F9ZA 2YOIA 3TJBA 1XVQA 5D96A 3VWXA 2DJ2A 1EP7A 4GTUA 4MJCA 5IMCA 5IMDA 2IMEA 3F4TA 2WJUA 4F82A 5D93A 2R2JA 3EURA 4TR4A 4IQ1A 4MZWA 4Q5NA 4KA0A 2LNTA 4GQCA 1JLWA 3F3RA 4KCEA 4J57E 1YEPA 3VLNA 1BEDA 2YWMA 4RUVA 3AY8A 1GULA 1FVKA 4MH2A 5IPHA 4WF5A 1O81A 3J7Yb 1PKWA 1NM3A 1O7UA 2F3MA 2FGXA 1PKZA 2YPMA 3UJ1A 2CVKA 4NMUA 3FZ4A 1TU8A 3C1RA 3UL3A 2VD1A 4PNFA 4HU7A 3K8NA 5DQYA 1U6TA 2H75A 2KHPA 1T8EB 3WGDA 2LSTA 1GTBA 5CAXA 1Z7PA 5AN1A 2YV9A 1O6JA 3F63A 3CMIA 2HI7A 4TXOA 4IHUA 1OKDA 2K9FA 4POLA 5IPGA 5JWOB 1EOGA 3L4NA 2MBTA 3FZ5A 3U5RE 9GSSA 5ECLB 2NBSA 5HFKA 1WIKA 5HR3A 4FO5A 3CSIA 3DKSA 2DJKA 3KH9A 1S3AA 19GSA 3O6TA 5A4UA 1IYIA 1U3AA 3QOUA 4XCSA 2B6MA 1GP1A 3NOFA 5D9XA 2O85A 2I3YA 1FO5A 4K7IA 3ERFA 4LL1B 1FW1A 2N5BA 3I69A 2MZCA 2GQKA 3P8WA 1Z5YE 4N30A 4ZB6A 4V2NA 1TRWA 5B8BA 4IS0A 1GUMA 3US3A 2R37A 1ZOFA 3WYWA 4NXIA 2V1MA 3ZMKA 1GSSA 2OKAA 1M9BA 2P5QA 2AJQB 2OA7A 1OC9B 1H4OA 4CHSA 3HJOA 4MF5A 3HXSA 2GS3A 3LEFA 4K9ZA 3GHAA 4BA7A 1GH2A 3EC3A 4LL4B 4KDUA 2IJYA 2VL2C 3HDCA 4RI6A 5C04A 4BVXA 2GQLA 4TOPA 3HZ4A 4WKWA 3UOMA 1QXHA 3MNGA 4RQRA 4YQVA 2ALBA 4GSTA 5CP1A 4XS4A 3QAWA 2DMLA 3BCKA 18GSA 3F8UA 2A2SA 2IWTA 4I5QA 1R7HA 1WJKA 4YQMA 2V32A 1TK8B 5ID2B 4NHZA 2XHFA 4NPBA 4I97A 1ML6A 2J9HA 1M0UA 3VWUA 5IM9A 1ZZYA 1XWKA 1GSFA 5F05A 4WEYA 1TI1A 5J9BA 4HEA2 1T7PB 2YCDA 1XW6A 2LRCA 4WBRD 1KEBA 1ERUA 1AQVA 3GTUB 2DJ1A 1LBKA 1K0AA 3IHQA 3KGKA 2HZEB 3IC4A 1F37A 4MP4A 4PQHA 2XBIA 5DAKB 4QL7A 1Q98A 5D8IA 14GSA 16GSA 2QSIA 5CRGA 4POBA 4OFMA 4PUAA 2H1AA 2I9HA 4ZIJA 1TTZA 4FYBA 2K18A 1BQ7A 1GTUA 2X64A 5KN1A 2JZTA 2DLXA 4D73B 1QFNA 4ZB8A 4K0NA 2DJ0A 3GMFA 2K6VA 1Z6NA 3KCMA 1TU7A 5FHIA 3RPNA 2HXKA 2TRXA 3RDWA 1ERWA 1F9MA 5IIZA 2H76A 3EYTA 1MD3A 3FEUA 3N5OA 3GNJA 5LNKe 2WULA 6GSYA 4MF6A 1J0FA 4AJ8A 1K3YA 4JR6A 3DD3A 2DIZA 6GSSA 4NAXA 4XS1A 5JCWA 4Q5QA 4DSQA 2CT6A 4WETA 5JWRB 1EV4A 5ECIB 3Q18A 4XS6A 4KAEA 4HQZA 4Q5FA 1DBYA 3TDGA 3LYPA 2P0GA 3HCZA 4F2IA 1RQMA 1GTAA 5IOXA 3FR3A 2HZEA 2H70A 5E59A 1A8LA 2HSHA 5DAKA 4YQUA 4KSMA 1HQOA 1GLQA 3GRXA 2CA8A 4ULXA 4LA1A 1PMTA 2OADA 1B9YC 1VF3A 4N11A 3ZVJD 3GSSA 5D9VA 4PNGA 5KN2A 1EV9A 1R5PA 2B1KA 4PQIA 1KNGA 3F9UA 1G7OA 4EO3A 2GVPA 1JZRA 4Q5RA 3E9JB 2H6XA 2KUCA 3ZZXA 4ZL9A 2GZZA 3L78A 3ZIVA 2PERA 4F0BA 2L4CA 5ELGA 1WOUA 5CREA 2P5RA 1HD2A 4MH3A 5KN3A 1XBSA 5L71A 1Q4JA 3GL3A 2YANA 3G7YA 1X5CA 3GKKA 5CRDA 6GSWA 1FAAA 4PQ1A 1A23A 1JFUA 2LRNA 1O8XA 5IO2A 4JEDA 2H73A 1I9DA 2GT6A 3CXGA 4HQSA 3WT1A 5ELAA 2K8VA 2J23A 1AAZA 1H75A 4G19A 4OWYA 5KN0A 3GKXA 3IK9A 3HYPA 3OR5A 2OBKA 3UBLA 22GSA 2YWIA 3H93A 4EC0A 2C0EA 1M2AA 3C1SA 1GSDA 2EC4A 1A2LA 4HU9A 1TXXA 3TRQA 2IMDA 1F2EA 4JBBA 1ZYQB 5C00A 3ZITA 5ECHB 4J56E 3HVXA 3GL5A 1AIUA 2X8GA 4OO5A 3LJRA 1TK5B 4WBJA 2RIIA 3G9BA 1V9WA 1GWCA 5A4WA 2AAWA 1U3IA 3QPMA 4TW5A 3UBKA 2V6KA 1XOBA 1TRUA 2XPEA 1A0FA 2FWFA 1VF2A 3LYKA 4KDYA 2GQMA 4IVFA 1X5DA 1Z6MA 3SBCA 1ZCPA 4BWSA 2RUFA 4TKYA 2DMMA 3A3TA 5B8AA 3DYRA 2ES7A 2PVOC 2C0FA 3HZ8A 4ML1A 2C3NA 2AUVA 3KH7A 4N0VA 3H4KA 4L5LA 2LEGA 3M1GA 4K7OA 5ECPB 1MD4A 2I81A 3TOUA 3HA9A 2EIOA 6GSXA 1EEMA 1F3AA 5DALA 3GV1A 4ECJA 2WZ9A 4ZBBA 3QD9A 2OBIA 5JCGA 3CSJA 4FYUA 4YAVA 1F3BA 2WGRA 2VCXA 4KB3A 1AUCA 1USBA 2FHEA 1TP9A 5A5KA 3FZ9A 2GSTA 2OE0A 4RQXA 4F0CA 2XC2A 3PGTA 1PD21 3GN3A 3FYGA 3ISOA 5G1LA 2GLRA 4MABA 5ECNB 3G7IA 1YDKA 2K8SA 2L5LA 3FKFA 1WP0A 1IYHA 1QGVA 2ZNMA 3CBUA 3DEXA 3LGCA 3RBTA 5FWGA 1SU9A 1SJ6A 4ZBAA 3UVHA 2IPAA 1TW9A 3LSZA 2FCHA 3TJFA 3MAKA 3GURA 2HRFA 2LS5A 2D2ZA 4MDCA 1URMA 3BJ5A 1E2YA 4OCFA 5HFIA 2B5EA 2R4VA 1EGOA 1VF1A 4K8MA 2HRNA 4KE3A 2VLUA 3UVTA 2H6ZA 3IR4A 4ECBA 5CRHA 2HT9A 1YEXA 4XHMA 4RI7A 2OACA 2MBSA 5G31A 3LXZA 4YH2A 4XS4B 5EVOA 2FY6A 4X0XA 1YJ6A 2IN3A 1M2DA 3BCIA 1OC8A 2JU5A 3TKSC 5LCZA 3HD5A 4MPFA 4NV5A 2AV4A 4CDOA 4ECCA 3LWAA 3L9SA 5G5EA 3D4MA 1VRSD 2ON7A 2YZHA 1GSEA 5DCGA 6GSUA 5GSTA 2QGVA 4HJMA 4ECIA 1X9MB 2VCWA 1XCCA 1V98A 4AF2A 1EGRA 3QAVA 2HNLA 2VLTA 3P7XA 1HNBA 1OYJA 4WF4A 4H86A 4X43A 2VCQA 3D0ZA 2H01A 2HSYA 1ABAA 3EMPA 5IOWA 1T00A 1SJZA 4ZXGA 3EWLA 3FRCA 1AW9A 2H1GA 3M9JA 2FWHA 3UAPA 1GNWA 3D22A 4I6XA 2OJLA 2FUG2 2WDUA 3V1WA 1SYXA 1Z3EA 2VM1A 2NTOA 2GT5A 1OVNA 5ECQB 1GSQA 3D6IA 4MLYA 3TKSA 3D4TA 5A4VA 3ED3A 3EE2A 1T4ZA 3DGQA 3QR6A 2LRTA 1EP8A 2XBQA 1ZYEA 2VCVA 1Z7RA 3M3MA 2VLVA 5DJMA 4XTSA 4V1Ag 4MMMA 1X9WB 2ZUPA 2LQOA 1SD8A 4N0ZA 2AYTA 2O89A 3VURA 3E0UA 5J41A 3KXOA 2L57A 4G10A 5DQSA 3W6GA 5CO3A 5IO0A 1AQXA 2CVBA 3WGEA 3M9KA 5F8BA 1TRSA 1LJRA 4MPGA 4TXVA 1ILOA 1RK4A 1M9AA 3VWVA 3KP8A 3CYNA 5HR0A 4IJ3A 2V6OA 5GAND 4YAPA 3QFBC 3HY2A 4EDZA 4XRDA 2R3XA 2RLIA 5ECMB 3JCML 1BJXA 1BG5A 4MF7A 2H0GA 3GH6A 1FB6A 4TN8A 2VL2A 4OD7A 2A4VA 4LLRA 4GCIA 1THOA 1SKWB 2F8FA 1XWBA 2CVDA 1O8WA 5D9WA 2HFDA 4J2FA 3Q19A 1THXA 1DUGA 1XFLA 3RHCA 2H6YA 3PINA 1K0BA 5IMAA 3GIXA 5D73A 1MDJA 4EDYA 5DDLA 3TJJA 5G2ZA 1UC7A 3I6AA 4EXJA 6GSTA 3KIJA 3WT2A 3VI5A 5J3RA 2JL4A 4NHWA 1AC1A 6GSVA 3CTFA 2DSAA 4KGIA 2H0IA 2C4JA 2B7KA 4IW9A 2G0FA 1ST9A 4OMVA 1WWJA 3IXRA 2KLXA 3ZLPA 5J9CA 3VWWA 1GL8A 4ILFA 4XRAA 2A2RA 2MMNA 4HOJA 3UARA 5JCUA 1TK0B 2I1UA 1DSBA 1EWXA 1S3DA 4CW9A 5GZZB 3A2VA 5H5QA 3G7JA 3BD2A 2L5OA 1MDKA 2OE1A 1WMJA 4ZB9A 1FOVA 3L9UA 1X0RA 2YJ7A 2AHEA 1AQWA 2V2GA 2GGTA 5ECSA 5ABRA 1I5GA 4HS1A 1OE7A 2LKUA 4K2DA 3LXTA 1B48A 4BWQA 2LJAA 2PGTA 1CQHA 2GZYA 2YP6A 2C0DA 1GRXA 1SL0B 5CYYA 3EMXA 3RAZA 3S9FA 1PX6A 2EIRA 5AGYA 2H1DA 4DEJA 2DJJA 4POMA 1T4YA 1ON4A 5J5NA 1F6MC 4BPYA 4HI7A 5AIXA 3HKRA 4GLTA 1V2AA 1PL2A 2BJXA 1ZGNA 13GSA 3GX0A 4TR1A 1Y6EA 2H0HA 1Y25A 3HVSA 1GUHA 5B6NA 3IAS2 3ZIJA 1B4PA 4KDXA 3IAM2 4DSRA 3M8NA 2C1YA 2PBJA 3IA1A 2N5AA 3DXBA 1NSWA 3P2AA 3BBYA 1YKCA 3VPQA 4OFTA 2HZFA 4EVMA 2CV4A 1WE0A 2IL3A 4F03A 4WXTA 3F3QA 1C72A 1WPIA 4EL1A 5DALB 7GSSA 4NWYA 4L8EA 1NW2A 4MJEA 5GAPD 2LTKA 1SK2A 2LV3A 3CTGA 3TJKA 4MZBA 1SKSB 2C3TA 3MWHA 1K0OA 1ZMAA 1B9XC 1T3BA 3TRPA 3LFLA 2H72A 1ERTA 4E8HA 3F6DA 4ACSA 3QMXA 2ON5A 3C73A 3TGZA 4IGJA 1BYEA 1TJDA 2DC5A 2PUKC 1MDIA 2LNSA 2M72A 1VGLA 1PA3A 3TKPA 1SK1A 4DSSA 4O5RA 5IMZA 2R6KA 1XPVA 2VCTA 2YZUA 1R5AA 3F4SA 4IP1A 5DBQA 4HUAA 4MA9A 4EF0A 3FY7A 2M80A 3IPZA 3UMAA 1U88A 3DWVA 2QC7A 4PGTA 3RPPA 3GH9A 2GSSA 4OO4A 1PSQA 4ISDA 1XWGA 2CX3A 5HFGA 1HNAA 2XPDA 5COHA 5EY6A 3DRNA 2E2MA 1XXUA 2ZCTA 8GSSA 4MZCA 4QL9A 4PURA 3RHBA 4O7HA 5ECOB 3TUEA 3W8SA 2PMTA 2O8VB 2REMA 5J4UA 4EKZA 3F4RA 3HVVA 4HDEA 2VL9A 3LQ7A 4G9HA 2F9SA 5B6MA 1GNEA 3Q6OA 2G2QA 1TRVA 3PR8A 1KBNA 5D9TA 3KM6A 3CSHA 3J7Yk 4BVYA 4NV2A
chains in the Genus database with same CATH superfamily
5TGNA 1GSUA 3GFKA 3VK9A 3N54B 1J2BA 3ME8A 1A0RP 3D5IA 1TOFA 1GD3A 1YHQ3 4ML6A 4IELA 4KH7A 2L4QA 3Q74A 2A15A 2X8CA 1NJI4 1BRSA 4HM3B 1GTIA 3VI7A 4IQAA 3ZFBA 1JHBA 3DMLA 1M7TA 3BNEA 5IEOA 1QALA 2KF5A 4FCMA 2DBCA 4L0WA 1G0TA 2E2TA 1Z1SA 4FQUA 1RRLA 2BMQB 5AIIA 3G6E3 3ALAA 1SJIA 20GSA 2IFQB 2UZ8A 2CZ3A 4K90B 5BXQA 2M46A 1XW9A 1S3CA 3F0IA 3MSZA 3SEDA 1PX7A 4IJIA 2INXA 1LU4A 1R4WA 1KC84 3A2WA 2K0MA 3MHEA 4HM2B 4GF0A 3MG2A 2H30A 4QQ7A 2RM6A 4BTYA 2IMKA 3IBHA 2P38A 1J08A 4DVCA 2AAEA 3I43A 1UN2A 2CAIA 1ERVA 5M1AA 3HJMA 5G5FA 2A2PA 2CZ2A 3KN4A 1RSNA 1I2EA 3GUSA 2VOCA 1X1XA 2LUSA 3TKRA 3NIVA 3WD6A 3FZWA 4DKIA 1BAYA 2D1WA 4MJAA 1Y4KA 3WGXA 3OWSA 3A2XA 5DVBA 1TDIA 2D42A 3C71A 1E6BA 3KIIA 2CAQA 2FD3A 2KP2A 4KW6A 4PXOA 2P0MA 1B4QA 4IN0A 3KTBA 3ZMLA 4JE1A 4TR3A 1U87A 1R26A 1I70A 2WCIA 1MWUA 5JWQB 4TR0A 5F0GA 3KMNA 5AIHA 3L9VA 1RGGA 1JBRA 2FWGA 1YZXA 4WP5A 1GSYA 4KCAA 4OCEA 4RNYA 5F06A 3LT9A 1DE1A 5DCHA 1ZYNA 4MJBA 3KP9A 3W8JA 3KD0A 2B3SA 1S5AA 2HLSA 3WA3A 3O3TA 1YIJ3 3UNLA 1WNHA 3GZRA 1RGCA 1PRXA 4J9AA 3GSPA 4HZ2A 2O87A 5IW9A 3SLUA 1XVWA 4HJ2A 1EG9B 4Z7XA 4EUYA 1V40A 1FG4A 2MMAA 3BNBA 3L0HA 3DIEA 5JPUA 3TCOA 4XBXA 1K0MA 4BL3A 1OAZA 1SD9A 4MCUA 5AIFA 1KTEA 1YF0A 1OE8A 3ZYWA 1VQ73 3MSOA 2IFQA 4MEIA 2FWEA 4O92A 2F51A 4OFNA 1NO3A 2C80A 1QMAA 2AB6A 3QDNA 4LMWA 5CNWA 2FNOA 1K8A4 4LMVA 2ZDJA 1N5PA 2PWJA 4K7NA 2JSYA 5AEWB 1I0XA 3IRAA 2X8HA 2PU9C 3D5JA 3GX8A 1CYUA 3ERGA 2XFTA 3EN8A 3ZREA 3NBJA 4EV2A 2TRCP 3GSTA 1LRAA 3IHGA 5H5SA 4FIWA 1D6ZA 4FMBA 1QQ2A 3KJYA 2IY2A 1VQL3 1WRYA 5ECRB 5KP3A 5HR1A 1R4CA 2RUEA 1FHEA 4BL2A 1YQ1A 2WB9A 4P3YB 4USSA 3I9V2 2DKIA 1N2AA 2RSXA 3KEBA 1XOAA 2R0GA 1YJN3 1NHYA 3HVNA 2VO4A 1GYBA 3TKSE 2CW9A 4ZBDA 3TRXA 2CX4A 2X99A 4L0UA 1O7PB 2Z9SA 1JB5A 3CCE3 1QUWA 1IVVA 4FYCA 5AISA 1YNVX 3MG1A 5CK6A 2BTOT 2CQ9A 2O7KA 4TRXA 4AGSA 2B7JA 1XIYA 5LD0A 3CMA3 1TIJA 1K3OA 4L5OA 1TKDB 1W2B2 1FVJA 4EE0A 2H74A 1K0DA 2NDOA 4JU5A 3IDVA 2F98A 3X3XA 2LJRA 2VL3A 1Z9HA 2OE3A 2WOFA 1RGEA 2JADA 1S723 3FR6A 1K0NA 4HM7B 3CCR3 1EOHA 2JACA 4WR5A 12GSA 2NVLA 4N6UA 4POKA 1SYRA 1PN9A 3QCPA 1BVIA 1YY7A 3MG3A 3HOHA 4AJ6A 4G0IA 2E0QA 4KSOA 2J8XB 1BAOA 2JZRA 5GSSA 1YVSA 1M99A 1M2BA 1M3IA 2XGLA 4K6XA 2L1SA 2IMIA 4QWTA 1XWCA 1YGEA 1B3SA 2OOVC 3F6FA 3GA4A 3GRDA 3H79A 1QK8A 2M7OA 1G6WA 4K0GA 5KP1A 1PFOA 5FT3A 3KZQA 3WODG 5HR2A 2F8AA 3APOA 2VUPA 5G1KA 3B7CA 9RNTA 2GTUA 2P31A 3DVWA 3FGYA 1B8XA 2BMRB 1G7EA 4LMIA 3U6VA 2HYXA 3ZTLA 1BRGA 1HYUA 2BHMA 5EL8A 2WS2A 2JSZA 1LNHA 1OC9A 4XBYA 3MWZA 2Z77A 1BRJA 1X9SB 1W01A 4K2XA 3F40A 3NQZA 3FZAA 1GMRA 1TFKA 2B1LA 3ZL5A 3HIIA 3E99A 1XZOA 2B5XA 1GY5A 3AMOB 3FK8A 5DJLA 4FH8A 3C7MA 1W4VA 1FUSA 1D6UA 1ZL9A 2PNCA 3KMOA 3DY5A 3NV0A 3CRUA 2IIYA 3GYKA 4GRFA 3IV4A 4JZQA 1BNEA 2W0QA 2GDRA 2PPTA 3FW2A 4TR1B 2H19A 3HK4A 3EN1B 1NHOA 1X5EA 5D83A 8CHOA 1ROAA 2E7PA 3ME7A 1YKAA 1XWAA 1ZYPA 2PN8A 2VM2A 5ECKB 1VQ53 5IMVA 2HE3A 3DGNA 2QIYA 2YN1A 4CJNA 1FB0A 1K3LA 4KNDA 2C3QA 5EPFA 1A2JA 3FHKA 4BIKA 5AIVA 1SL2B 3T0UA 3CCS3 2W2CA 2VIMA 1SL1B 1IYYA 3EVIA 4GXZA 1RGKA 1UCJA 2YNXA 4XIHA 1GLPA 3A5WA 2WRTA 5KEJA 2H66A 1PQNA 1T5YA 1TFOA 3X42A 2VD0A 2YV7A 2YJHA 5ID2A 3JUPA 3IK7A 1MNLA 2FLSA 2R5GA 4IKHA 3APSA 3BU4A 2NPBA 1MTCA 1EEJA 1O73A 2OOVA 3KTLA 3ZFLA 1V58A 1VQ63 1W89A 1XW5A 1PGTA 4I8BA 3GTUA 2GZPA 2MF7A 3M0FA 2QKEA 3E3EA 3DVXA 5IMFA 1O85A 1SENA 5B7CA 2A4HA 1RLSA 2IMFA 2JZSA 2N5FA 3QAGA 1J9BA 3CRTA 4V2MA 4TX4A 2KF6A 3NQYA 1OC3A 1CQGA 2W9PA 3URPA 2MC8A 3A5IA 4N6NB 3FR9A 3BOAA 4ZL7A 2LJKA 5E4WA 3J7Yd 3EINA 1HKXA 4DSSB 3AHSA 1FOHA 2HMJB 2ZL8A 4K1FA 1NU3A 5ENUA 1O7WB 2L6DA 3IOSA 1FA3A 3N9JA 4I2TA 1SK0A 4KZ1A 4O32A 4V1Ap 2DJ3A 3TJGA 1IV7A 4KX4A 1YVBI 3GZXB 4ZILA 2L59A 2MMOA 4D73A 2WFCA 1N8JA 4X2HA 4WHAA 4I2UA 2XRXB 2VCZA 1WMPA 1GUKA 1JZWA 4GSSA 3IMAB 1SKRB 1UDII 1PU4A 3MYTA 1Q864 3TB2A 1JNQA 2EIQA 4BU4A 1AXDA 4N10A 4HZ9B 4V2LA 5INYA 1JZOA 2F99A 3ERWA 1ULJB 3G16A 4CDLA 4EBGA 1HNCA 2CFDA 1BSCA 1JLVA 3R2QA 2LQQA 2K3DA 2IA7A 1EZKA 4R80A 1VF4A 7STDA 2IYJA 4HZ4A 3MDKA 4PX1A 4N6MA 4IBPA 2YWNA 2IUKA 1MWSA 3D21A 2W6JH 5F07A 2FA4A 2OWPA 5IG5A 4GWRA 1JRQA 3B4PA 3G8ZA 2GXFA 1VQN3 3UEMA 3HJPA 4HAAA 3GKMA 4BL7A 5ELJA 2YWOA 3WA2X 4IIAA 4JRRA 1NB3I 2VAFA 4ID0A 3LG6A 2CFLA 4IP6A 4G2EA 3ZVJA 1K0CA 4PUFC 1RKYA 3S29A 2C0GA 4BIRA 5H5RA 2PVQA 2MYGA 3F8HA 3EU4A 1WMNA 2I4AA 3IE3A 4KVHA 5HQPA 1JZDA 3EU3A 4MK3A 2GSRA 4KFEA 2BIRA 4LEHA 1LOWA 2CWTA 3H3HA 3SVAA 3H1NA 3PYJA 4JR4A 3VPTA 3NZNA 2TIRA 1PL1A 1QMVA 2MMZA 4EYCA 1IV9A 1SIHA 2FA8A 2H1BA 4WR4A 5CRWA 3O76A 4GQFA 3G713 3FCSB 4TVEA 3K5TA 4KUNA 4ZL8A 2XGNA 3NXJA 1TI3A 3H8QA 1ACVA 4GSNA 2GSPA 2CFGA 3CC23 1UA5A 3APQA 3LORA 4X1UA 3SWLA 1Q42A 3EE1A 2KOKA 2H8LA 3P90A 2XF3A 4HBRA 5IEPA 1VQO3 4HOHA 2OCTA 1YF1A 2E2GA 2BMXA 1OKTA 3ZRDA 2YX9A 1A2VA 3QRDA 17GSA 3PH9A 3L0RA 3VFIA 1A8YA 1FZUA 1RW1A 3CME3 3LOYA 2RM5A 2GU1A 3BNCA 3QFAC 11GSA 2KP1A 2V41A 1BX9A 3C8EA 3UIWA 1DE2A 5G30A 4AJ7A 5HGRA 3ECFA 2R0CA 3DGOA 3I553 4K5SA 2C8UA 1A2MA 4E8EA 2DIYA 2B5YA 1UVZA 3GKNA 3HHVA 3TKQA 2H71A 10GSA 1T1VA 2L6CA 1FUTA 1G6YA 1B21A 1DYUA 5IQYA 1V57A 2BU4A 2GSQA 1A24A 4XB5A 3TOTA 1MEKA 4TXOB 4F9ZA 1OHPA 1LOXA 3ROBA 2YFIB 1Q40B 2YOIA 3TJBA 1RGHA 4RNTA 3SOAA 1XVQA 5D96A 3VWXA 4CY6A 2DJ2A 1EP7A 1E3RA 2HMMB 1NB5I 2WOHA 4GTUA 4MJCA 5IMCA 2CG1A 3EB8A 5IMDA 2IMEA 5KOWA 4HM6B 1I0VA 3F4TA 2CFWA 1EA2A 2WJUA 3WR2A 4F82A 5D93A 3LXUX 2R2JA 1RHLA 3EURA 4TR4A 4PTSA 3G0KA 4IQ1A 3KSED 2ML6A 3CPW2 4MZWA 4Q5NA 4KA0A 3K7CA 1HYFA 3GAXA 4GSPA 2LNTA 4XM4A 4GQCA 1JLWA 4H3UA 4YKGA 1CYVA 1BUJA 3F3RA 3D3LA 4J57E 1YEPA 4KCEA 3VLNA 1BEDA 3BNDA 2YWMA 4J5GA 4RUVA 3AY8A 1GULA 1FVKA 4MH2A 1DMMA 5IPHA 1BSDA 3WHOA 2HMKB 4WF5A 1O81A 3J7Yb 1O7NB 1TRQA 4Z2TA 1PKWA 3CCL3 1NM3A 1O7UA 2F3MA 3OX9A 4RNZA 2FGXA 1PKZA 2XFSA 2YPMA 5DREA 2CVKA 3UJ1A 4NMUA 3FZ4A 1TU8A 3C1RA 3UL3A 2VD1A 4PNFA 4HU7A 1GOYA 3K8NA 4NREA 5DQYA 1U6TA 3KCHA 3V98A 2H75A 2KHPA 1T8EB 2X49A 3WGDA 3K0ZA 2LSTA 3GZYB 1BNSA 1LQMB 1GTBA 1BSAA 5CAXA 1LXEA 1Z7PA 5AN1A 3D79A 2YV9A 1VQK3 3D5GA 1O6JA 1G02A 3F63A 1BGSA 3CMIA 3BIRA 2HI7A 4TXOA 4IHUA 2KRTA 1OKDA 3CU3A 2QA43 2K9FA 4POLA 1Q40A 2KCDA 3PGBA 1VQ83 3DH2A 5IPGA 5JWOB 1A2KA 1EOGA 2MBTA 3L4NA 3FZ5A 3KFQC 3U5RE 9GSSA 1DVDA 2RFRA 2NBSA 5ECLB 5HFKA 3VSYA 1WIKA 1QAFA 2RBIA 5HR3A 2E2UA 4FO5A 3CSIA 3DKSA 2DJKA 3KH9A 1S3AA 3NUVA 19GSA 3O6TA 5A4UA 1IYIA 1U3AA 4G1MB 3UB1A 4FR9A 3QOUA 4XCSA 2B6MA 1OHOA 1GP1A 3EQQB 3NOFA 5D9XA 2O85A 1M1XB 1RTUA 3ER7A 2I3YA 1FO5A 4K7IA 3ERFA 4LL1B 1FW1A 2N5BA 2ZA4A 3I69A 2MZCA 2KAAA 2GQKA 3F7SA 3P8WA 1Z5YE 4N30A 3RDEA 3HZPA 4ZB6A 4V2NA 1TRWA 3D4AA 1Q7HA 1ROVA 3KZTA 5B8BA 4IS0A 1GUMA 3US3A 2LYXA 5LC7A 1EUIC 5BMUA 2R37A 1ZOFA 3WYWA 1B2ZA 4NXIA 2V1MA 2CFKA 3ZMKA 1JN5A 4OK0A 1GSSA 2OKAA 1M9BA 2P5QA 2AJQB 1STDA 4BTXA 2OA7A 1OC9B 1H4OA 7RNTA 4HYZA 4CHSA 4IPBA 3HJOA 4U13A 3DGMA 4MF5A 3HXSA 2GS3A 3LEFA 4K9ZA 4FCJA 3GHAA 1U5OA 1AVKA 4BA7A 1GH2A 3EC3A 4LL4B 4KDUA 2IJYA 2VL2C 1W6CA 1W6YA 3PPUA 3NV0B 4L8OA 3HDCA 1RDSA 5IG0A 4RI6A 1JB2A 3RGRA 5C04A 4BVXA 2GU3A 4LZIA 2GQLA 4TOPA 3Q3FA 3HZ4A 4WKWA 3UOMA 1QXHA 3MNGA 2F4YA 3EHCA 4RQRA 4YQVA 2ALBA 4GSTA 5CP1A 4XS4A 3QAWA 2DMLA 3X40A 1BRKA 3BCKA 5IF6A 1TRPA 5BIRA 1JKGA 18GSA 4Q53A 3F8UA 3FF2A 1MWRA 3OXAA 2A2SA 2IWTA 4I5QA 1M904 1R7HA 4HM4B 4A5PA 1N9JA 1FW7A 1WJKA 4YQMA 3FMWA 5AYRB 1RRHA 2V32A 1TK8B 2CC3A 5ID2B 4NHZA 1TP6A 4NPBA 2XHFA 4I97A 1ML6A 2J9HA 1M0UA 3VWUA 1X1WA 1ZZYA 1XWKA 5IM9A 1GSFA 5F05A 4WEYA 1TI1A 5J9BA 6STDA 4HEA2 1T7PB 2YCDA 1XW6A 2LRCA 4WBRD 1IQ8A 1KEBA 3DGYA 1ERUA 3JUOA 1AQVA 3GTUB 5KOXA 1VQ43 2DJ1A 1LBKA 1K0AA 1UW1A 3IHQA 3KGKA 2HZEB 3NHXA 3IC4A 2OTL3 1IQXA 4HVNA 1F37A 4MP4A 1W02A 4PQHA 2XBIA 5DAKB 1OGXA 4K5RA 4QL7A 1Q98A 5D8IA 14GSA 1GOUA 3U1WA 2STDA 3WMDA 2CH9A 16GSA 2HOHA 4L7KA 5DRVA 1W00A 2QSIA 4HM5B 1IVUA 5CRGA 4POBA 1AV4A 1BOXA 4OFMA 3Q1CA 3EPTA 4PUAA 4ZM8A 2H1AA 1XG8A 5FGOA 2CX1A 3N9HA 5D82A 2I9HA 4ZIJA 2E2VA 1TTZA 4FYBA 5IENA 1IDPA 2K18A 1BQ7A 1GTUA 2X64A 5KN1A 2DLXA 2JZTA 4D73B 2XSHB 1QFNA 1JJ22 2PZVA 2XR8B 4ZB8A 4K0NA 2DJ0A 3M8CA 3QK9A 1I3FA 3GMFA 3PCSA 2K6VA 1Z6NA 1DVCA 1B2MA 2QA1A 5CLKA 3KCMA 1TU7A 4EIPA 1Q814 1RMSA 1GY6A 5FHIA 3RPNA 2AADA 2HXKA 1NDOB 2O3OA 1F8NA 1OF5A 2TRXA 3S28A 3RDWA 2CKFB 1M3JA 1ERWA 1F9MA 5IIZA 2H76A 3EYTA 1MD3A 3FEUA 3N5OA 3GNJA 5LNKe 1LOVA 2WULA 6GSYA 2IMJA 4CCVA 1BNRA 1IT7A 4MF6A 1J0FA 4AJ8A 1K3YA 4JR6A 3DD3A 2DIZA 6GSSA 4NAXA 4XS1A 5JCWA 2W03A 4Q5QA 4BL7B 4DSQA 1PY3A 2CK3H 2CT6A 1VQM3 4WETA 3I563 2W9QA 5JWRB 4IT7A 5AEUB 1EV4A 1MOLA 3FH1A 1A2PA 1MGRA 4GB5A 5ECIB 3Q18A 4XS6A 3JUMA 4KFFA 4KAEA 4HQZA 4Q5FA 1DBYA 3TDGA 4LGQA 3LYPA 2P0GA 3HCZA 2OQEC 1PYLA 4F2IA 1RQMA 1GTAA 3NM7A 5IOXA 3FR3A 1B27A 2H70A 1A67A 2HZEA 5E59A 5RNTA 2P09A 1W2ZA 1A8LA 1DE3A 2HSHA 1UUVB 1LVNA 5DAKA 1KQS2 4FMCA 4YQUA 4KSMA 1BUQA 1HQOA 5IERA 1FGQA 2LQVA 1BRNL 1GLQA 3GRXA 1HU9A 2XH9A 4GL6A 2CA8A 4ULXA 1N8QA 5GSPA 4LA1A 1PMTA 2OADA 4N6TA 1B9YC 1VF3A 3LW9A 4N11A 3ZVJD 1ASKA 3GSSA 4EXRA 5D9VA 4CPKA 4PNGA 5KN2A 1EV9A 1R5PA 2B1KA 4PQIA 1KNGA 3F9UA 1G7OA 2GBWB 2UX0A 4EO3A 2GVPA 1JZRA 4Q5RA 1B2UA 2QA2A 3E9JB 2H6XA 2KUCA 3MIXA 3ZZXA 1OPYA 4MJDA 4ZL9A 2GZZA 3L78A 1Q9EA 3ZIVA 2PERA 4F0BA 1LOYA 1GOVA 2L4CA 5ELGA 1N5HA 1WOUA 5CREA 1NWWA 2P5RA 1HD2A 4MH3A 5KN3A 1XBSA 5L71A 1GMPA 1Q4JA 3GL3A 1AQZA 3OWUA 2YANA 5BRTA 1Q7Y4 2QEX3 1RN7A 2QGUA 3PCRA 3WOEB 3G7YA 3IJEB 2ZHXB 1X5CA 2XSOB 3GKKA 5CRDA 2RCDA 6GSWA 1FAAA 4PQ1A 1A23A 1JFUA 4OUQA 2LRNA 4WFOA 2WGQA 1O8XA 5IO2A 1RCKA 4JEDA 1BRHA 3B4OA 2H73A 1I9DA 2GT6A 3CXGA 4HQSA 3WT1A 1G96A 2F5MA 1FUWA 5ELAA 1OCVA 1BSEA 3LTCA 2K8VA 2J23A 4KFDA 1IQYA 1AAZA 2OQEA 2YFJB 1H75A 3EF8A 4K61A 4G19A 3S27A 4OWYA 5KN0A 6RNTA 1E3VA 3GKXA 1SARA 3IK9A 3Q2PA 3HYPA 1I3IA 4FMAA 3OR5A 2OBKA 3UBLA 22GSA 2YWIA 4BTWA 3H93A 5I97A 1SJWA 4EC0A 1TTOA 2C0EA 1M2AA 3C1SA 1GSDA 2EC4A 1W6GA 2CG0A 1A2LA 4HU9A 3CPOA 3G4S3 1TXXA 3TRQA 1MWTA 2IMDA 3JVCA 1F2EA 1K9M4 3B8LA 3EJVA 1JV2B 4JBBA 5C00A 1ZYQB 3ZITA 5ECHB 4J56E 3HVXA 3ZG0A 3GL5A 1SQWA 1AIUA 5BVBA 4AKYA 2X8GA 1B2SA 1K28A 4OO5A 5CF1A 3LJRA 1TK5B 1STFI 4WBJA 2RIIA 3G9BA 1V9WA 3K63A 1GWCA 5A4WA 1VQP3 3CCQ3 2AAWA 1W4NA 1U3IA 3QPMA 4TW5A 3UBKA 4J5KA 2V6KA 1XOBA 3LTAA 4O3VA 1TRUA 1NNVA 2XPEA 4HM0B 1W5ZA 1A0FA 2FWFA 1VF2A 3CC73 4RZMA 3EC9A 3LYKA 4KDYA 1SIIA 2RNTA 2GQMA 4RBNA 4IVFA 1X5DA 1Z6MA 1YGWA 3MYDA 3CD63 2KF3A 3SOYA 1IVWA 1TU5A 3SBCA 3CCU3 1ZCPA 4BWSA 1US1A 2RUFA 4TKYA 4XDVA 2DMMA 3A3TA 5B8AA 3DYRA 1GSPA 3RNTA 2ES7A 1RN1A 3DMCA 3ZFZA 2PVOC 2C0FA 4O8SA 3HZ8A 4ML1A 3SYUA 2AUVA 2C3NA 3KH7A 4N0VA 3H4KA 4L5LA 2LEGA 3M1GA 4K1VA 4K7OA 5ECPB 3VGNA 1WMOA 1MD4A 2I81A 3TOUA 3UL6A 1O7HB 5HOHA 4EC6A 1JBTA 3HA9A 3N8BA 2CIUA 3CCV3 3FLJA 2FXTA 3LH4A 2EIOA 1EEMA 1F3AA 5DALA 6GSXA 4N6OB 3GV1A 4ECJA 3DXOA 2WZ9A 4HM1B 4ZBBA 2BMOB 2BO9B 1LQGC 3QD9A 2OBIA 4CY8A 4Z2RA 5JCGA 3CSJA 4FYUA 2CWUA 2HMNB 4N6V0 4YAVA 1F3BA 1CQSA 2CHCA 2WGRA 1YJW3 5M18A 1BNJA 3LMLA 2VCXA 4KB3A 1AUCA 1USBA 3OV4A 3STDA 2FHEA 1B20A 3CCJ3 4MMYB 1TP9A 1C7HA 5A5KA 3FZ9A 2GSTA 2OE0A 3CQFA 4RQXA 4F0CA 2XC2A 3PGTA 4GHOA 1PD21 2OTJ3 1UGIA 3GN3A 3FYGA 3ISOA 5G1LA 2GLRA 4MABA 5ECNB 2Q07A 3G7IA 1YDKA 4G0KA 2K8SA 3LZAA 1L5GB 2GEXA 4O02B 2L5LA 1E97A 1UI8A 1WP0A 3FKFA 1IYHA 1QGVA 2ZNMA 3CBUA 3DEXA 3LGCA 2Z7AA 5CF2A 3RBTA 1JN5B 5FWGA 1SU9A 5EEOA 1SJ6A 4N6LA 4ZBAA 3UVHA 2IPAA 3OW22 1TW9A 3LSZA 5IG3A 2SBLA 2FCHA 3TJFA 2R4IA 1T2HA 3MAKA 3GURA 2HRFA 5EQLA 2LS5A 2D2ZA 4MDCA 2HMOB 1URMA 2Z6BA 3BJ5A 1E2YA 5STDA 4OCFA 2RGQA 5HFIA 2B5EA 3GZBA 2R4VA 1EGOA 5M19A 1VF1A 4K8MA 5KP4A 2HRNA 4KE3A 2VLUA 3CNXA 3MKIA 3UVTA 2H6ZA 2P05A 3IR4A 4ECBA 4BVXB 5CRHA 4WYKA 2HT9A 7GSPA 1YEXA 4XHMA 1RGLA 4RI7A 2OACA 3BB9A 2MBSA 2CX0A 5G31A 2W56A 3LXZA 4YH2A 1W7CA 4XS4B 5EVOA 2FY6A 4X0XA 1YJ6A 1WTHA 2IN3A 1JKGB 1ULIB 1M2DA 3BCIA 1OC8A 1B2XA 2JU5A 3TKSC 1RJOA 1FGOA 5LCZA 3HD5A 4MPFA 4NV5A 2AV4A 3CCM3 2ML5A 1Q824 4CDOA 3KE7A 2R0PA 4ECCA 3LWAA 4AEQA 3LYGA 1CEWI 1YJ93 1N8R4 3L9SA 1K41A 5G5EA 4FCZA 3D4MA 2K54A 1CH0A 1R4YA 4ORLA 1OHSA 1VRSD 2ON7A 4JRFA 2YZHA 5ELUA 3FG4A 3NM2A 3H51A 1GSEA 5DCGA 5GSTA 6GSUA 3NX0A 2QGVA 4HJMA 4ECIA 1UGHI 1X9MB 2VCWA 1XCCA 5AYSC 3DGLA 2Y74A 3EBYA 3S67A 2Z76A 3NBBA 1V98A 1BSBA 4AF2A 1PFPA 4STDA 3S5CA 1EGRA 1BNIA 4Z2UA 3QAVA 2HNLA 2VLTA 3P7XA 3F9SA 3DM8A 1HNBA 1OYJA 3T8NA 4WF4A 4H86A 4X43A 2B1XB 2VCQA 3D0ZA 2H01A 2HSYA 2X4AA 1ABAA 4X4JA 3EMPA 5IOWA 1T00A 1SJZA 3V92A 4ZXGA 3EWLA 3FRCA 1N9EA 1AW9A 1AVLA 2H1GA 4KF9A 3M9JA 3HX8A 2FWHA 3UAPA 1GNWA 3D22A 4I6XA 4G0LA 4N3VA 2OJLA 2FUG2 1JBSA 2WDUA 1QVF2 4ICYA 4JF8A 5AIGA 4LYLB 1SYXA 1Z3EA 3V1WA 1GD4A 2VM1A 1T2IA 5BU4A 2NTOA 2GT5A 1OVNA 5ECQB 1PN0A 3FG1A 1GSQA 1ZS7A 3D6IA 4LSOA 4MLYA 1OF5B 1IK3A 3TKSA 1I2FA 3D4TA 2FNQA 5A4VA 3PZWA 3ED3A 3EE2A 1T4ZA 3DGQA 1S3RA 3QR6A 2LRTA 1EP8A 2XBQA 4EIQA 1ZYEA 2VCVA 1Z7RA 3M3MA 2VLVA 5DJMA 4XTSA 1UUGB 4V1Ag 4MMMA 1ZO2A 3F7XA 1X9WB 2ZUPA 2LQOA 1FYSA 1SD8A 1LNIA 4N0ZA 2AYTA 1WQLB 1OUNA 2O89A 3VURA 1VZZA 3E0UA 8RNTA 5J41A 1I2GA 2L57A 3KXOA 4G10A 2UUGC 1RCLA 5DQSA 3W6GA 5CO3A 5IO0A 1AQXA 2CVBA 3WGEA 3M9KA 5F8BA 1TRSA 1D6YA 1LJRA 4MPGA 4TXVA 1ILOA 4KT3B 3JUQA 4K1UA 1RK4A 2P0XA 1M9AA 3HIGA 3VWVA 3KP8A 3CYNA 5HR0A 4IJ3A 2V6OA 3U97A 3PXMA 5GAND 4YAPA 2O9UX 1V74A 3QFBC 1UCLA 3HY2A 4XRDA 2I9WA 4EDZA 2R3XA 2RLIA 5ECMB 1JB4A 4OVMA 3JCML 1BJXA 1BG5A 4MF7A 2H0GA 2C10A 3GH6A 2C11A 1FB6A 4TN8A 2VL2A 1HZ1A 4HM8B 4OD7A 2A4VA 4LLRA 4GCIA 3X3YA 1THOA 1SKWB 3X3ZA 2UGIA 2F8FA 1XWBA 2CVDA 1O8WA 5D9WA 3AGNA 1DMNA 2HFDA 4J2FA 3Q19A 2KXGA 1THXA 3CC43 1DUGA 1XFLA 3RHCA 2H6YA 3PINA 1BNGA 3A5EA 3AHWA 1K0BA 5IMAA 3GIXA 5D73A 1MDJA 4EDYA 5DDLA 3TJJA 5G2ZA 1UC7A 3I6AA 3R3EA 4EXJA 6GSTA 3DZLA 3DUKA 3KIJA 3FF0A 1EKMA 4MNNA 3LTDA 3WT2A 3VI5A 5G2GA 1DMQA 1O7MB 3SXXA 5J3RA 1GS3A 1I8VA 2JL4A 4NHWA 3ZG5A 1AC1A 6GSVA 3CTFA 2DSAA 4KGIA 2H0IA 2C4JA 2B7KA 3F14A 1IT8A 2IUJA 4IW9A 3MPHA 1QAKA 1K734 3F8XA 2G0FA 1ST9A 2R41A 4OMVA 1WWJA 3IXRA 2KLXA 1YI23 2WGOA 4R4KA 3ZLPA 5J9CA 3VWWA 1GL8A 1BU4A 4ILFA 4XRAA 2A2RA 2MMNA 4HOJA 3UARA 1O7GB 5JCUA 1TK0B 1AY7A 2I1UA 1DSBA 1EWXA 1S3DA 4CW9A 2YFLB 5GZZB 3A2VA 5H5QA 1MGWA 1OH0A 3G7JA 4O5UA 1VQQA 3BD2A 3CNMA 2L5OA 1MDKA 3WOFB 2OE1A 3KSPA 1WMJA 3UJMA 3GWRA 4ZB9A 1FOVA 1OGZA 3L9UA 3PS8A 1X0RA 2YJ7A 2AHEA 5JBSA 1AQWA 3X41A 2CWVA 2V2GA 2GGTA 4J8TA 5ECSA 5ABRA 1I5GA 1VQ93 4HS1A 1OE7A 2GEYA 4HSCX 4YKFA 1DETA 2WO0A 2LKUA 2Y73A 4K2DA 4R9KA 3LXTA 1B48A 3D9RA 1C54A 1FGMA 1M1K4 3HI7A 4BWQA 2LJAA 2PGTA 3UL5A 1KSIA 1CQHA 2GZYA 2YP6A 3JUNA 2C0DA 1GRXA 2B24B 3OWYA 1SL0B 5CYYA 1BANA 3EMXA 1UUWB 3RAZA 3S9FA 1PX6A 2EIRA 5AGYA 2H1DA 4DEJA 4FMDA 2DJJA 4POMA 1T4YA 2L4VA 1ON4A 4AKZA 5J5NA 3AMOA 1F6MC 3I0YA 4BPYA 4HI7A 1ZX2A 5AIXA 3BLZA 3HKRA 2BNGA 4GLTA 4H61A 3EX9A 1V2AA 1PL2A 2BJXA 1ZGNA 13GSA 3GX0A 1KD14 5AI1A 4TR1A 1RN4A 1Y6EA 2H0HA 1Y25A 2HMLB 1GY7A 3HVSA 1GUHA 5FW5A 5B6NA 3A76A 4I4KA 3NBRA 2KF4A 1A90A 3IAS2 3ZIJA 1B4PA 4KDXA 3IAM2 4DSRA 3M8NA 2C1YA 2PBJA 3IA1A 2N5AA 3DXBA 2V1LA 1TUHA 4HKVB 1NSWA 1YKCA 3BBYA 3P2AA 1FGTA 3VPQA 4OFTA 2HZFA 2W04A 1BIRA 4EVMA 2F56A 1SPUA 4XDWA 3VF1A 3IPTA 4EW5A 2CV4A 1WE0A 2IL3A 1IVXA 1UCIA 4F03A 4WXTA 5LC6A 1OACA 3F3QA 3O8YA 1C72A 1WPIA 4EL1A 5DALB 7GSSA 2SARA 4NWYA 4L8EA 1NW2A 4MJEA 5GAPD 1RGAA 3WDGB 2LTKA 2XEPA 1SK2A 2LV3A 3FKAA 3CTGA 3TJKA 4MZBA 1SKSB 2F86B 2C3TA 3MWHA 3EBTA 1K0OA 1BNFA 1ZMAA 1B9XC 1T3BA 3TRPA 3AGOA 3LFLA 2H72A 1ERTA 1QJGA 4E8HA 3F6DA 4ACSA 1QVG2 3QMXA 4BVYB 2ON5A 3Q90A 4EV5A 3C73A 3TGZA 4IGJA 1X1UA 1BYEA 1TJDA 5A0OB 2DC5A 2HRAA 2PUKC 1ZGXA 1MDIA 2LNSA 2M72A 3RGAA 1EQKA 1VGLA 1PA3A 3TKPA 1SK1A 2F5WA 4DSSA 1UI7A 4O5RA 2GBXB 5IMZA 2R6KA 1XPVA 1BRIA 2JDIH 3V99A 4L8PA 2VCTA 3SX1A 2YZUA 4O5QA 1R5AA 3F4SA 2FGTA 1GMQA 4IP1A 1X1YA 5DBQA 4HUAA 4MA9A 4EF0A 1ISKA 4MMXB 3FY7A 2M80A 3LTBA 3IPZA 1YIT3 3UMAA 1IU7A 1RGFA 1U88A 3DWVA 3FSDA 2HRKA 5JPPA 1M9GA 2QC7A 4PGTA 3RPPA 5IG4A 4WWUC 3GH9A 4MMZB 4R9LA 2GSSA 4OO4A 1PSQA 3CXC2 4ISDA 1FGRA 1XWGA 2CX3A 5HFGA 4R1KA 3KKGA 1HNAA 2XPDA 5COHA 5EY6A 3DRNA 4XBTA 4X2OA 2E2MA 5D81A 1XXUA 2ZCTA 8GSSA 2HSMA 4O2HA 2BT3A 2C4BA 4HZBB 1AR0A 1RNTA 2JQ5A 3IC8A 4MZCA 5EVHA 4QL9A 4PURA 3RHBA 4O7HA 5ECOB 3TUEA 1U8CB 3W8SA 2PMTA 2O8VB 2REMA 5J4UA 4WYKB 1UCKA 4EKZA 1RNBA 3FG3A 3F4RA 3HVVA 4HDEA 2VL9A 2W56B 3LQ7A 4G9HA 2F9SA 4PEJA 5B6MA 4NHFA 3K9MC 1GNEA 3Q6OA 2G2QA 1TRVA 1KWIA 3PR8A 2DKHA 1KBNA 5D9TA 3KM6A 5CXOA 3CSHA 4HJLB 3J7Yk 6GSPA 3T8UA 4BVYA 3LT8A 4NV2A
chains in the Genus database with same CATH topology
1GSUA 3GFKA 3VK9A 3ME8A 1A0RP 1TOFA 4ML6A 4IELA 4KH7A 2L4QA 3Q74A 2X8CA 1GTIA 3VI7A 4IQAA 3ZFBA 1JHBA 3DMLA 1M7TA 2DBCA 4L0WA 1G0TA 4FQUA 1SJIA 2UZ8A 2IFQB 20GSA 2CZ3A 2M46A 1XW9A 1S3CA 3F0IA 3MSZA 1PX7A 4IJIA 1LU4A 1R4WA 3A2WA 4GF0A 2H30A 4QQ7A 2RM6A 2IMKA 3IBHA 1J08A 4DVCA 3I43A 1UN2A 2CAIA 1ERVA 3HJMA 5G5FA 2A2PA 2CZ2A 3GUSA 2VOCA 2LUSA 3TKRA 3NIVA 3WD6A 1BAYA 4MJAA 3WGXA 3A2XA 5DVBA 1TDIA 3C71A 1E6BA 2CAQA 2FD3A 2KP2A 4KW6A 4PXOA 1B4QA 4IN0A 3KTBA 3ZMLA 4JE1A 4TR3A 1U87A 1R26A 2WCIA 5JWQB 4TR0A 5F0GA 3KMNA 3L9VA 2FWGA 1YZXA 1GSYA 4KCAA 4OCEA 5F06A 1DE1A 5DCHA 1ZYNA 4MJBA 3KP9A 3W8JA 3KD0A 2B3SA 2HLSA 3O3TA 1PRXA 4HZ2A 2O87A 1XVWA 4HJ2A 4Z7XA 4EUYA 1V40A 1FG4A 2MMAA 3L0HA 3DIEA 3TCOA 1K0MA 1OAZA 1SD9A 4MCUA 1KTEA 1YF0A 1OE8A 3ZYWA 2IFQA 2FWEA 4O92A 2F51A 4OFNA 2C80A 2AB6A 3QDNA 4LMWA 5CNWA 2FNOA 4LMVA 2PWJA 4K7NA 2JSYA 3IRAA 2X8HA 2PU9C 3D5JA 3GX8A 3ERGA 3ZREA 2TRCP 3GSTA 3IHGA 5H5SA 4FIWA 3KJYA 1QQ2A 2IY2A 1WRYA 5ECRB 5HR1A 2RUEA 1FHEA 1YQ1A 4P3YB 2WB9A 4USSA 3I9V2 2DKIA 1N2AA 3KEBA 1XOAA 2R0GA 1NHYA 2VO4A 3TKSE 4ZBDA 3TRXA 2CX4A 2X99A 4L0UA 2Z9SA 1QUWA 4FYCA 5AISA 2BTOT 2CQ9A 2O7KA 4TRXA 4AGSA 2B7JA 1XIYA 5LD0A 1K3OA 4L5OA 1TKDB 1FVJA 4EE0A 2H74A 1K0DA 2NDOA 4JU5A 3IDVA 2LJRA 2VL3A 1Z9HA 2OE3A 2JADA 3FR6A 1K0NA 1EOHA 2JACA 4WR5A 12GSA 2NVLA 4POKA 1SYRA 1PN9A 3QCPA 1YY7A 4AJ6A 4G0IA 2E0QA 4KSOA 2JZRA 5GSSA 1M99A 1M2BA 4K6XA 2IMIA 1XWCA 3F6FA 3H79A 3GA4A 1QK8A 4K0GA 1G6WA 5FT3A 3KZQA 5HR2A 2F8AA 3APOA 2VUPA 5G1KA 2GTUA 2P31A 3DVWA 1B8XA 1G7EA 3U6VA 2HYXA 3ZTLA 1HYUA 5EL8A 2WS2A 2JSZA 1OC9A 1X9SB 4K2XA 3FZAA 2B1LA 3ZL5A 2B5XA 1XZOA 3FK8A 5DJLA 4FH8A 3C7MA 1W4VA 1ZL9A 3KMOA 3CRUA 2IIYA 3GYKA 4GRFA 3IV4A 4JZQA 2GDRA 2PPTA 3FW2A 4TR1B 2H19A 1NHOA 1X5EA 2E7PA 3ME7A 1YKAA 1XWAA 1ZYPA 2PN8A 2VM2A 5ECKB 5IMVA 2HE3A 2YN1A 1FB0A 1K3LA 4KNDA 2C3QA 5EPFA 1A2JA 3FHKA 5AIVA 1SL2B 2VIMA 1SL1B 3EVIA 4GXZA 4XIHA 2YNXA 1GLPA 3A5WA 2WRTA 5KEJA 2H66A 1PQNA 2VD0A 2YV7A 2YJHA 5ID2A 3IK7A 2FLSA 2R5GA 4IKHA 3APSA 2NPBA 1MTCA 1EEJA 1O73A 3KTLA 3ZFLA 1V58A 1W89A 1XW5A 1PGTA 4I8BA 3GTUA 2GZPA 3M0FA 2QKEA 3E3EA 3DVXA 5IMFA 1O85A 1SENA 5B7CA 2A4HA 2IMFA 2JZSA 2N5FA 3QAGA 1J9BA 3CRTA 4V2MA 1OC3A 1CQGA 3A5IA 3FR9A 3BOAA 4ZL7A 2LJKA 5E4WA 3EINA 4DSSB 1FOHA 4K1FA 5ENUA 2L6DA 3IOSA 3N9JA 4I2TA 1SK0A 4O32A 4V1Ap 2DJ3A 3TJGA 4KX4A 4ZILA 2L59A 2MMOA 4D73A 2WFCA 1N8JA 4I2UA 2VCZA 1GUKA 1JZWA 4GSSA 1SKRB 3TB2A 2EIQA 1AXDA 4N10A 4V2LA 5INYA 1JZOA 3ERWA 1HNCA 1JLVA 3R2QA 2LQQA 1EZKA 1VF4A 2IYJA 4HZ4A 3MDKA 4PX1A 4IBPA 2YWNA 3D21A 5F07A 2FA4A 4GWRA 3UEMA 3HJPA 3GKMA 4BL7A 2YWOA 4JRRA 2VAFA 4ID0A 3LG6A 4IP6A 4G2EA 3ZVJA 1K0CA 4PUFC 2C0GA 5H5RA 2PVQA 2MYGA 3EU4A 2I4AA 3IE3A 5HQPA 1JZDA 3EU3A 4MK3A 2GSRA 3H1NA 4JR4A 3VPTA 3NZNA 2TIRA 1PL1A 1QMVA 2MMZA 2FA8A 2H1BA 4WR4A 5CRWA 3O76A 4GQFA 4TVEA 4KUNA 4ZL8A 1TI3A 3H8QA 1ACVA 4GSNA 1UA5A 3APQA 3LORA 4X1UA 3SWLA 2KOKA 2H8LA 3P90A 1YF1A 2E2GA 2BMXA 1OKTA 3ZRDA 17GSA 3PH9A 3VFIA 1A8YA 1RW1A 2RM5A 3QFAC 11GSA 2KP1A 2V41A 1BX9A 3C8EA 3UIWA 1DE2A 5G30A 4AJ7A 2R0CA 4K5SA 2C8UA 1A2MA 4E8EA 2DIYA 2B5YA 1UVZA 3GKNA 3HHVA 3TKQA 2H71A 10GSA 1T1VA 2L6CA 1G6YA 5IQYA 1V57A 2GSQA 1A24A 3TOTA 1MEKA 4TXOB 4F9ZA 2YOIA 3TJBA 1XVQA 5D96A 3VWXA 4CY6A 2DJ2A 1EP7A 4GTUA 4MJCA 5IMCA 5IMDA 2IMEA 5KOWA 3F4TA 2WJUA 4F82A 5D93A 2R2JA 3EURA 4TR4A 4PTSA 4IQ1A 4MZWA 4Q5NA 4KA0A 2LNTA 4GQCA 1JLWA 4YKGA 3F3RA 4KCEA 4J57E 1YEPA 3VLNA 1BEDA 2YWMA 4RUVA 3AY8A 1GULA 1FVKA 4MH2A 5IPHA 4WF5A 1O81A 3J7Yb 4Z2TA 1PKWA 1NM3A 1O7UA 2F3MA 2FGXA 1PKZA 2YPMA 3UJ1A 2CVKA 4NMUA 3FZ4A 1TU8A 3C1RA 3UL3A 2VD1A 4PNFA 4HU7A 3K8NA 5DQYA 1U6TA 2H75A 2KHPA 1T8EB 2X49A 3WGDA 2LSTA 1GTBA 5CAXA 1Z7PA 5AN1A 2YV9A 1O6JA 3F63A 3CMIA 2HI7A 4TXOA 4IHUA 1OKDA 2K9FA 4POLA 5IPGA 5JWOB 1EOGA 3L4NA 2MBTA 3FZ5A 3U5RE 9GSSA 5ECLB 2NBSA 5HFKA 1WIKA 5HR3A 4FO5A 3CSIA 3DKSA 2DJKA 3KH9A 1S3AA 19GSA 3O6TA 5A4UA 1IYIA 1U3AA 3QOUA 4XCSA 2B6MA 1GP1A 3NOFA 5D9XA 2O85A 2I3YA 1FO5A 4K7IA 3ERFA 4LL1B 1FW1A 2N5BA 3I69A 2MZCA 2GQKA 3P8WA 1Z5YE 4N30A 4ZB6A 4V2NA 1TRWA 5B8BA 4IS0A 1GUMA 3US3A 5BMUA 2R37A 1ZOFA 3WYWA 4NXIA 2V1MA 3ZMKA 1GSSA 2OKAA 1M9BA 2P5QA 2AJQB 2OA7A 1OC9B 1H4OA 4CHSA 3HJOA 4MF5A 3HXSA 2GS3A 3LEFA 4K9ZA 3GHAA 4BA7A 1GH2A 3EC3A 4LL4B 4KDUA 2IJYA 2VL2C 3PPUA 3HDCA 4RI6A 5C04A 4BVXA 2GQLA 4TOPA 3HZ4A 4WKWA 3UOMA 1QXHA 3MNGA 4RQRA 4YQVA 2ALBA 4GSTA 5CP1A 4XS4A 3QAWA 2DMLA 3BCKA 18GSA 3F8UA 2A2SA 2IWTA 4I5QA 1R7HA 4A5PA 1WJKA 4YQMA 3FMWA 2V32A 1TK8B 5ID2B 4NHZA 2XHFA 4NPBA 4I97A 1ML6A 2J9HA 1M0UA 3VWUA 5IM9A 1ZZYA 1XWKA 1GSFA 5F05A 4WEYA 1TI1A 5J9BA 4HEA2 1T7PB 2YCDA 1XW6A 2LRCA 4WBRD 1KEBA 1ERUA 1AQVA 3GTUB 5KOXA 2DJ1A 1LBKA 1K0AA 3IHQA 3KGKA 2HZEB 3IC4A 1F37A 4MP4A 4PQHA 2XBIA 5DAKB 4K5RA 4QL7A 1Q98A 5D8IA 14GSA 16GSA 2QSIA 5CRGA 4POBA 4OFMA 3EPTA 4PUAA 2H1AA 2I9HA 4ZIJA 1TTZA 4FYBA 2K18A 1BQ7A 1GTUA 2X64A 5KN1A 2JZTA 2DLXA 4D73B 1QFNA 4ZB8A 4K0NA 2DJ0A 3GMFA 2K6VA 1Z6NA 2QA1A 3KCMA 1TU7A 4EIPA 5FHIA 3RPNA 2HXKA 2TRXA 3RDWA 1ERWA 1F9MA 5IIZA 2H76A 3EYTA 1MD3A 3FEUA 3N5OA 3GNJA 5LNKe 2WULA 6GSYA 4MF6A 1J0FA 4AJ8A 1K3YA 4JR6A 3DD3A 2DIZA 6GSSA 4NAXA 4XS1A 5JCWA 4Q5QA 4BL7B 4DSQA 2CT6A 4WETA 5JWRB 1EV4A 5ECIB 3Q18A 4XS6A 4KAEA 4HQZA 4Q5FA 1DBYA 3TDGA 3LYPA 2P0GA 3HCZA 4F2IA 1RQMA 1GTAA 5IOXA 3FR3A 2HZEA 2H70A 5E59A 1A8LA 2HSHA 5DAKA 4YQUA 4KSMA 1HQOA 1GLQA 3GRXA 2CA8A 4ULXA 4LA1A 1PMTA 2OADA 1B9YC 1VF3A 3LW9A 4N11A 3ZVJD 3GSSA 5D9VA 4PNGA 5KN2A 1EV9A 1R5PA 2B1KA 4PQIA 1KNGA 3F9UA 1G7OA 4EO3A 2GVPA 4Q5RA 1JZRA 2QA2A 3E9JB 2H6XA 2KUCA 3MIXA 3ZZXA 4ZL9A 2GZZA 3L78A 3ZIVA 2PERA 4F0BA 2L4CA 5ELGA 1WOUA 5CREA 2P5RA 1HD2A 4MH3A 5KN3A 1XBSA 5L71A 1Q4JA 3GL3A 2YANA 5BRTA 3G7YA 1X5CA 3GKKA 5CRDA 6GSWA 1FAAA 4PQ1A 1A23A 1JFUA 2LRNA 1O8XA 5IO2A 4JEDA 2H73A 1I9DA 2GT6A 3CXGA 4HQSA 3WT1A 5ELAA 2K8VA 2J23A 1AAZA 1H75A 4G19A 4OWYA 5KN0A 3GKXA 3IK9A 3HYPA 3OR5A 2OBKA 3UBLA 22GSA 2YWIA 3H93A 4EC0A 2C0EA 1M2AA 3C1SA 1GSDA 2EC4A 1A2LA 4HU9A 1TXXA 3TRQA 2IMDA 1F2EA 4JBBA 1ZYQB 5C00A 3ZITA 5ECHB 4J56E 3HVXA 3GL5A 1AIUA 2X8GA 4OO5A 3LJRA 1TK5B 4WBJA 2RIIA 3G9BA 1V9WA 1GWCA 5A4WA 2AAWA 1U3IA 3QPMA 4TW5A 3UBKA 2V6KA 1XOBA 1TRUA 2XPEA 1A0FA 2FWFA 1VF2A 3LYKA 4KDYA 2GQMA 4IVFA 1X5DA 1Z6MA 3MYDA 3SBCA 1ZCPA 4BWSA 2RUFA 4TKYA 2DMMA 3A3TA 5B8AA 3DYRA 2ES7A 2PVOC 2C0FA 3HZ8A 4ML1A 2C3NA 2AUVA 3KH7A 4N0VA 3H4KA 4L5LA 2LEGA 3M1GA 4K7OA 5ECPB 1MD4A 2I81A 3TOUA 3HA9A 2EIOA 6GSXA 1EEMA 1F3AA 5DALA 3GV1A 4ECJA 2WZ9A 4ZBBA 3QD9A 2OBIA 4CY8A 4Z2RA 5JCGA 3CSJA 4FYUA 4YAVA 1F3BA 2WGRA 2VCXA 4KB3A 1AUCA 1USBA 2FHEA 1TP9A 5A5KA 3FZ9A 2GSTA 2OE0A 4RQXA 4F0CA 2XC2A 3PGTA 1PD21 3GN3A 3FYGA 3ISOA 5G1LA 2GLRA 4MABA 5ECNB 3G7IA 1YDKA 4G0KA 2K8SA 2L5LA 3FKFA 1WP0A 1IYHA 1QGVA 2ZNMA 3CBUA 3DEXA 3LGCA 3RBTA 5FWGA 1SU9A 1SJ6A 4ZBAA 3UVHA 2IPAA 1TW9A 3LSZA 2FCHA 3TJFA 3MAKA 3GURA 2HRFA 2LS5A 2D2ZA 4MDCA 1URMA 3BJ5A 1E2YA 4OCFA 5HFIA 2B5EA 2R4VA 1EGOA 1VF1A 4K8MA 2HRNA 4KE3A 2VLUA 3UVTA 2H6ZA 3IR4A 4ECBA 4BVXB 5CRHA 2HT9A 1YEXA 4XHMA 4RI7A 2OACA 2MBSA 5G31A 3LXZA 4YH2A 4XS4B 5EVOA 2FY6A 4X0XA 1YJ6A 2IN3A 1M2DA 3BCIA 1OC8A 2JU5A 3TKSC 5LCZA 3HD5A 4MPFA 4NV5A 2AV4A 4CDOA 2R0PA 4ECCA 3LWAA 3L9SA 5G5EA 3D4MA 1VRSD 2ON7A 2YZHA 1GSEA 5DCGA 6GSUA 5GSTA 2QGVA 4HJMA 4ECIA 1X9MB 2VCWA 1XCCA 1V98A 4AF2A 1EGRA 4Z2UA 3QAVA 2HNLA 2VLTA 3P7XA 1HNBA 1OYJA 4WF4A 4H86A 4X43A 2VCQA 3D0ZA 2H01A 2HSYA 2X4AA 1ABAA 4X4JA 3EMPA 5IOWA 1T00A 1SJZA 4ZXGA 3EWLA 3FRCA 1AW9A 2H1GA 4KF9A 3M9JA 2FWHA 3UAPA 1GNWA 3D22A 4I6XA 4G0LA 2OJLA 2FUG2 2WDUA 4ICYA 3V1WA 1SYXA 1Z3EA 2VM1A 2NTOA 2GT5A 1OVNA 5ECQB 1PN0A 1GSQA 3D6IA 4MLYA 3TKSA 3D4TA 5A4VA 3ED3A 3EE2A 1T4ZA 3DGQA 3QR6A 2LRTA 1EP8A 2XBQA 4EIQA 1ZYEA 2VCVA 1Z7RA 3M3MA 2VLVA 5DJMA 4XTSA 4V1Ag 4MMMA 1X9WB 2ZUPA 2LQOA 1SD8A 4N0ZA 2AYTA 2O89A 3VURA 3E0UA 5J41A 3KXOA 2L57A 4G10A 5DQSA 3W6GA 5CO3A 5IO0A 1AQXA 2CVBA 3WGEA 3M9KA 5F8BA 1TRSA 1LJRA 4MPGA 4TXVA 1ILOA 1RK4A 1M9AA 3VWVA 3KP8A 3CYNA 5HR0A 4IJ3A 2V6OA 5GAND 4YAPA 3QFBC 3HY2A 4EDZA 4XRDA 2R3XA 2RLIA 5ECMB 3JCML 1BJXA 1BG5A 4MF7A 2H0GA 3GH6A 1FB6A 4TN8A 2VL2A 4OD7A 2A4VA 4LLRA 4GCIA 1THOA 1SKWB 2F8FA 1XWBA 2CVDA 1O8WA 5D9WA 2HFDA 4J2FA 3Q19A 1THXA 1DUGA 1XFLA 3RHCA 2H6YA 3PINA 1K0BA 5IMAA 3GIXA 5D73A 1MDJA 4EDYA 5DDLA 3TJJA 5G2ZA 1UC7A 3I6AA 3R3EA 4EXJA 6GSTA 3KIJA 4MNNA 3WT2A 3VI5A 5J3RA 2JL4A 4NHWA 1AC1A 6GSVA 3CTFA 2DSAA 4KGIA 2H0IA 2C4JA 2B7KA 4IW9A 2G0FA 1ST9A 4OMVA 1WWJA 3IXRA 2KLXA 3ZLPA 5J9CA 3VWWA 1GL8A 4ILFA 4XRAA 2A2RA 2MMNA 4HOJA 3UARA 5JCUA 1TK0B 2I1UA 1DSBA 1EWXA 1S3DA 4CW9A 5GZZB 3A2VA 5H5QA 3G7JA 4O5UA 3BD2A 2L5OA 1MDKA 2OE1A 1WMJA 4ZB9A 1FOVA 3L9UA 1X0RA 2YJ7A 2AHEA 1AQWA 2V2GA 2GGTA 5ECSA 5ABRA 1I5GA 4HS1A 1OE7A 4YKFA 2LKUA 4K2DA 3LXTA 1B48A 4BWQA 2LJAA 2PGTA 1CQHA 2GZYA 2YP6A 2C0DA 1GRXA 1SL0B 5CYYA 3EMXA 3RAZA 3S9FA 1PX6A 2EIRA 5AGYA 2H1DA 4DEJA 2DJJA 4POMA 1T4YA 1ON4A 5J5NA 1F6MC 4BPYA 4HI7A 5AIXA 3HKRA 4GLTA 1V2AA 1PL2A 2BJXA 1ZGNA 13GSA 3GX0A 4TR1A 1Y6EA 2H0HA 1Y25A 3HVSA 1GUHA 5B6NA 3IAS2 3ZIJA 1B4PA 4KDXA 3IAM2 4DSRA 3M8NA 2C1YA 2PBJA 3IA1A 2N5AA 3DXBA 1NSWA 3P2AA 3BBYA 1YKCA 3VPQA 4OFTA 2HZFA 4EVMA 2CV4A 1WE0A 2IL3A 4F03A 4WXTA 3F3QA 1C72A 1WPIA 4EL1A 5DALB 7GSSA 4NWYA 4L8EA 1NW2A 4MJEA 5GAPD 2LTKA 1SK2A 2LV3A 3CTGA 3TJKA 4MZBA 1SKSB 2C3TA 3MWHA 1K0OA 1ZMAA 1B9XC 1T3BA 3TRPA 3LFLA 2H72A 1ERTA 4E8HA 3F6DA 4ACSA 3QMXA 4BVYB 2ON5A 3C73A 3TGZA 4IGJA 1BYEA 1TJDA 2DC5A 2HRAA 2PUKC 1MDIA 2LNSA 2M72A 1VGLA 1PA3A 3TKPA 1SK1A 4DSSA 4O5RA 5IMZA 2R6KA 1XPVA 4O5QA 2VCTA 2YZUA 1R5AA 3F4SA 4IP1A 5DBQA 4HUAA 4MA9A 4EF0A 3FY7A 2M80A 3IPZA 3UMAA 1U88A 3DWVA 2HRKA 2QC7A 4PGTA 3RPPA 3GH9A 2GSSA 4OO4A 1PSQA 4ISDA 1XWGA 2CX3A 5HFGA 1HNAA 2XPDA 5COHA 5EY6A 3DRNA 2E2MA 1XXUA 2ZCTA 8GSSA 2HSMA 3IC8A 4MZCA 4QL9A 4PURA 3RHBA 4O7HA 5ECOB 3TUEA 3W8SA 2PMTA 2O8VB 2REMA 5J4UA 4EKZA 3F4RA 3HVVA 4HDEA 2VL9A 3LQ7A 4G9HA 2F9SA 5B6MA 1GNEA 3Q6OA 2G2QA 1TRVA 3PR8A 2DKHA 1KBNA 5D9TA 3KM6A 3CSHA 3J7Yk 4BVYA 4NV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSU A;  3GFK A;  3VK9 A;  3ME8 A;  1A0R P;  1TOF A;  4ML6 A;  4IEL A;  4KH7 A;  2L4Q A;  3Q74 A;  2X8C A;  1GTI A;  3VI7 A;  4IQA A;  3ZFB A;  1JHB A;  3DML A;  1M7T A;  2DBC A;  4L0W A;  1G0T A;  1SJI A;  2IFQ B;  20GS A;  2CZ3 A;  2M46 A;  1XW9 A;  1S3C A;  3F0I A;  3MSZ A;  1PX7 A;  4IJI A;  1LU4 A;  1R4W A;  3A2W A;  4GF0 A;  2H30 A;  4QQ7 A;  2RM6 A;  2IMK A;  3IBH A;  1J08 A;  4DVC A;  3I43 A;  1UN2 A;  2CAI A;  1ERV A;  3HJM A;  5G5F A;  2CZ2 A;  3GUS A;  2VOC A;  2LUS A;  3TKR A;  3NIV A;  3WD6 A;  1BAY A;  4MJA A;  3WGX A;  3A2X A;  5DVB A;  1TDI A;  3C71 A;  1E6B A;  2CAQ A;  2FD3 A;  2KP2 A;  4KW6 A;  4PXO A;  1B4Q A;  4IN0 A;  3KTB A;  3ZML A;  4JE1 A;  4TR3 A;  1U87 A;  1R26 A;  2WCI A;  5JWQ B;  4TR0 A;  5F0G A;  3KMN A;  3L9V A;  2FWG A;  1YZX A;  1GSY A;  4KCA A;  4OCE A;  5F06 A;  1DE1 A;  5DCH A;  4MJB A;  3KP9 A;  3W8J A;  3KD0 A;  2B3S A;  2HLS A;  3O3T A;  1PRX A;  4HZ2 A;  2O87 A;  1XVW A;  4HJ2 A;  4Z7X A;  4EUY A;  1V40 A;  1FG4 A;  2MMA A;  3L0H A;  3DIE A;  3TCO A;  1K0M A;  1OAZ A;  1SD9 A;  4MCU A;  1KTE A;  1YF0 A;  1OE8 A;  3ZYW A;  2IFQ A;  2FWE A;  4O92 A;  2F51 A;  4OFN A;  2C80 A;  2AB6 A;  3QDN A;  4LMW A;  5CNW A;  2FNO A;  4LMV A;  2PWJ A;  4K7N A;  2JSY A;  3IRA A;  2X8H A;  2PU9 C;  3D5J A;  3GX8 A;  3ERG A;  3ZRE A;  2TRC P;  3GST A;  5H5S A;  4FIW A;  3KJY A;  1QQ2 A;  2IY2 A;  1WRY A;  5ECR B;  5HR1 A;  2RUE A;  1FHE A;  1YQ1 A;  4P3Y B;  2WB9 A;  3I9V 2;  1N2A A;  3KEB A;  1XOA A;  1NHY A;  2VO4 A;  3TKS E;  4ZBD A;  3TRX A;  2CX4 A;  2X99 A;  4L0U A;  2Z9S A;  1QUW A;  4FYC A;  5AIS A;  2BTO T;  2CQ9 A;  2O7K A;  4TRX A;  4AGS A;  2B7J A;  1XIY A;  5LD0 A;  1K3O A;  4L5O A;  1TKD B;  1FVJ A;  4EE0 A;  2H74 A;  1K0D A;  2NDO A;  4JU5 A;  3IDV A;  2LJR A;  2VL3 A;  1Z9H A;  2OE3 A;  2JAD A;  3FR6 A;  1K0N A;  1EOH A;  2JAC A;  4WR5 A;  12GS A;  2NVL A;  4POK A;  1SYR A;  1PN9 A;  3QCP A;  1YY7 A;  4AJ6 A;  2E0Q A;  4KSO A;  2JZR A;  5GSS A;  1M99 A;  1M2B A;  4K6X A;  2IMI A;  1XWC A;  3F6F A;  3H79 A;  3GA4 A;  1QK8 A;  4K0G A;  1G6W A;  5FT3 A;  3KZQ A;  5HR2 A;  2F8A A;  3APO A;  2VUP A;  5G1K A;  2GTU A;  2P31 A;  3DVW A;  1B8X A;  1G7E A;  3U6V A;  2HYX A;  3ZTL A;  1HYU A;  5EL8 A;  2WS2 A;  2JSZ A;  1OC9 A;  1X9S B;  3FZA A;  2B1L A;  3ZL5 A;  2B5X A;  1XZO A;  3FK8 A;  5DJL A;  4FH8 A;  3C7M A;  1W4V A;  1ZL9 A;  3KMO A;  3CRU A;  2IIY A;  3GYK A;  4GRF A;  3IV4 A;  4JZQ A;  2GDR A;  2PPT A;  3FW2 A;  4TR1 B;  2H19 A;  1NHO A;  1X5E A;  2E7P A;  3ME7 A;  1YKA A;  1XWA A;  2PN8 A;  2VM2 A;  5ECK B;  5IMV A;  2HE3 A;  2YN1 A;  1FB0 A;  1K3L A;  4KND A;  2C3Q A;  5EPF A;  1A2J A;  3FHK A;  5AIV A;  1SL2 B;  2VIM A;  1SL1 B;  3EVI A;  4GXZ A;  4XIH A;  2YNX A;  1GLP A;  3A5W A;  2WRT A;  5KEJ A;  2H66 A;  1PQN A;  2VD0 A;  2YV7 A;  2YJH A;  5ID2 A;  3IK7 A;  2FLS A;  2R5G A;  4IKH A;  3APS A;  2NPB A;  1MTC A;  1EEJ A;  1O73 A;  3KTL A;  3ZFL A;  1V58 A;  1W89 A;  1XW5 A;  1PGT A;  4I8B A;  3GTU A;  2GZP A;  3M0F A;  2QKE A;  3E3E A;  3DVX A;  5IMF A;  1O85 A;  1SEN A;  5B7C A;  2N5F A;  2IMF A;  2JZS A;  3QAG A;  1J9B A;  3CRT A;  4V2M A;  1OC3 A;  1CQG A;  3FR9 A;  3BOA A;  4ZL7 A;  2LJK A;  5E4W A;  3EIN A;  4DSS B;  4K1F A;  5ENU A;  2L6D A;  3IOS A;  3N9J A;  4I2T A;  1SK0 A;  4O32 A;  4V1A p;  2DJ3 A;  3TJG A;  4KX4 A;  4ZIL A;  2L59 A;  2MMO A;  4D73 A;  2WFC A;  1N8J A;  4I2U A;  2VCZ A;  1GUK A;  1JZW A;  4GSS A;  1SKR B;  3TB2 A;  2EIQ A;  1AXD A;  4N10 A;  4V2L A;  5INY A;  1JZO A;  3ERW A;  1HNC A;  1JLV A;  3R2Q A;  2LQQ A;  1EZK A;  1VF4 A;  2IYJ A;  4HZ4 A;  3MDK A;  4PX1 A;  4IBP A;  2YWN A;  3D21 A;  5F07 A;  2FA4 A;  4GWR A;  3UEM A;  3HJP A;  3GKM A;  4BL7 A;  2YWO A;  4JRR A;  2VAF A;  4ID0 A;  3LG6 A;  4IP6 A;  4G2E A;  3ZVJ A;  1K0C A;  4PUF C;  2C0G A;  5H5R A;  2PVQ A;  2MYG A;  3EU4 A;  2I4A A;  3IE3 A;  5HQP A;  1JZD A;  3EU3 A;  4MK3 A;  2GSR A;  3H1N A;  4JR4 A;  3VPT A;  3NZN A;  2TIR A;  1PL1 A;  1QMV A;  2MMZ A;  2FA8 A;  2H1B A;  4WR4 A;  5CRW A;  3O76 A;  4GQF A;  4TVE A;  4KUN A;  4ZL8 A;  1TI3 A;  3H8Q A;  1ACV A;  4GSN A;  1UA5 A;  3APQ A;  3LOR A;  4X1U A;  3SWL A;  2KOK A;  2H8L A;  3P90 A;  1YF1 A;  2E2G A;  2BMX A;  1OKT A;  3ZRD A;  17GS A;  3PH9 A;  3VFI A;  1A8Y A;  1RW1 A;  2RM5 A;  3QFA C;  11GS A;  2KP1 A;  2V41 A;  1BX9 A;  3C8E A;  3UIW A;  1DE2 A;  5G30 A;  4AJ7 A;  2C8U A;  1A2M A;  4E8E A;  2DIY A;  2B5Y A;  1UVZ A;  3GKN A;  3HHV A;  3TKQ A;  2H71 A;  10GS A;  1T1V A;  2L6C A;  1G6Y A;  5IQY A;  1V57 A;  2GSQ A;  1A24 A;  3TOT A;  1MEK A;  4TXO B;  4F9Z A;  2YOI A;  3TJB A;  1XVQ A;  5D96 A;  3VWX A;  2DJ2 A;  1EP7 A;  4GTU A;  4MJC A;  5IMC A;  5IMD A;  2IME A;  3F4T A;  2WJU A;  4F82 A;  5D93 A;  2R2J A;  3EUR A;  4TR4 A;  4IQ1 A;  4MZW A;  4Q5N A;  4KA0 A;  2LNT A;  4GQC A;  1JLW A;  3F3R A;  4KCE A;  4J57 E;  1YEP A;  3VLN A;  1BED A;  2YWM A;  4RUV A;  3AY8 A;  1GUL A;  1FVK A;  4MH2 A;  5IPH A;  4WF5 A;  1O81 A;  3J7Y b;  1PKW A;  1NM3 A;  1O7U A;  2F3M A;  2FGX A;  1PKZ A;  2YPM A;  3UJ1 A;  2CVK A;  4NMU A;  3FZ4 A;  1TU8 A;  3C1R A;  3UL3 A;  2VD1 A;  4PNF A;  4HU7 A;  3K8N A;  5DQY A;  1U6T A;  2H75 A;  2KHP A;  1T8E B;  3WGD A;  2LST A;  1GTB A;  5CAX A;  1Z7P A;  5AN1 A;  2YV9 A;  1O6J A;  3F63 A;  3CMI A;  2HI7 A;  4TXO A;  4IHU A;  1OKD A;  2K9F A;  4POL A;  5IPG A;  5JWO B;  1EOG A;  3L4N A;  2MBT A;  3FZ5 A;  3U5R E;  9GSS A;  5ECL B;  2NBS A;  5HFK A;  1WIK A;  5HR3 A;  4FO5 A;  3CSI A;  3DKS A;  2DJK A;  3KH9 A;  1S3A A;  19GS A;  3O6T A;  5A4U A;  1IYI A;  1U3A A;  3QOU A;  4XCS A;  2B6M A;  1GP1 A;  3NOF A;  5D9X A;  2O85 A;  2I3Y A;  1FO5 A;  4K7I A;  3ERF A;  4LL1 B;  1FW1 A;  2N5B A;  3I69 A;  2MZC A;  2GQK A;  3P8W A;  1Z5Y E;  4N30 A;  4ZB6 A;  4V2N A;  1TRW A;  5B8B A;  4IS0 A;  1GUM A;  3US3 A;  2R37 A;  1ZOF A;  3WYW A;  4NXI A;  2V1M A;  3ZMK A;  1GSS A;  2OKA A;  1M9B A;  2P5Q A;  2AJQ B;  2OA7 A;  1OC9 B;  1H4O A;  4CHS A;  3HJO A;  4MF5 A;  3HXS A;  2GS3 A;  3LEF A;  4K9Z A;  3GHA A;  4BA7 A;  1GH2 A;  3EC3 A;  4LL4 B;  4KDU A;  2IJY A;  2VL2 C;  3HDC A;  4RI6 A;  5C04 A;  4BVX A;  2GQL A;  4TOP A;  3HZ4 A;  4WKW A;  3UOM A;  1QXH A;  3MNG A;  4RQR A;  4YQV A;  2ALB A;  4GST A;  5CP1 A;  4XS4 A;  3QAW A;  2DML A;  3BCK A;  18GS A;  3F8U A;  2A2S A;  2IWT A;  4I5Q A;  1R7H A;  1WJK A;  4YQM A;  2V32 A;  1TK8 B;  5ID2 B;  4NHZ A;  2XHF A;  4NPB A;  4I97 A;  1ML6 A;  2J9H A;  1M0U A;  3VWU A;  5IM9 A;  1ZZY A;  1XWK A;  1GSF A;  5F05 A;  4WEY A;  1TI1 A;  5J9B A;  4HEA 2;  1T7P B;  2YCD A;  1XW6 A;  2LRC A;  4WBR D;  1KEB A;  1ERU A;  1AQV A;  3GTU B;  2DJ1 A;  1LBK A;  1K0A A;  3IHQ A;  3KGK A;  2HZE B;  3IC4 A;  1F37 A;  4MP4 A;  4PQH A;  2XBI A;  5DAK B;  4QL7 A;  1Q98 A;  5D8I A;  14GS A;  16GS A;  2QSI A;  5CRG A;  4POB A;  4OFM A;  4PUA A;  2H1A A;  2I9H A;  4ZIJ A;  1TTZ A;  4FYB A;  2K18 A;  1BQ7 A;  1GTU A;  2X64 A;  5KN1 A;  2JZT A;  2DLX A;  4D73 B;  1QFN A;  4ZB8 A;  4K0N A;  2DJ0 A;  3GMF A;  2K6V A;  1Z6N A;  3KCM A;  1TU7 A;  5FHI A;  3RPN A;  2HXK A;  2TRX A;  3RDW A;  1ERW A;  1F9M A;  5IIZ A;  2H76 A;  3EYT A;  1MD3 A;  3FEU A;  3N5O A;  3GNJ A;  5LNK e;  2WUL A;  6GSY A;  4MF6 A;  1J0F A;  4AJ8 A;  1K3Y A;  4JR6 A;  3DD3 A;  2DIZ A;  6GSS A;  4NAX A;  4XS1 A;  5JCW A;  4Q5Q A;  4DSQ A;  2CT6 A;  4WET A;  5JWR B;  1EV4 A;  5ECI B;  3Q18 A;  4XS6 A;  4KAE A;  4HQZ A;  4Q5F A;  1DBY A;  3TDG A;  3LYP A;  2P0G A;  3HCZ A;  4F2I A;  1RQM A;  1GTA A;  5IOX A;  3FR3 A;  2HZE A;  2H70 A;  5E59 A;  1A8L A;  2HSH A;  5DAK A;  4YQU A;  4KSM A;  1HQO A;  1GLQ A;  3GRX A;  2CA8 A;  4ULX A;  4LA1 A;  1PMT A;  2OAD A;  1B9Y C;  1VF3 A;  4N11 A;  3ZVJ D;  3GSS A;  5D9V A;  4PNG A;  5KN2 A;  1EV9 A;  1R5P A;  2B1K A;  4PQI A;  1KNG A;  3F9U A;  1G7O A;  4EO3 A;  2GVP A;  1JZR A;  4Q5R A;  3E9J B;  2H6X A;  2KUC A;  3ZZX A;  4ZL9 A;  2GZZ A;  3L78 A;  3ZIV A;  2PER A;  4F0B A;  2L4C A;  5ELG A;  1WOU A;  5CRE A;  2P5R A;  1HD2 A;  4MH3 A;  5KN3 A;  1XBS A;  5L71 A;  1Q4J A;  3GL3 A;  2YAN A;  3G7Y A;  1X5C A;  3GKK A;  5CRD A;  6GSW A;  1FAA A;  4PQ1 A;  1A23 A;  1JFU A;  2LRN A;  1O8X A;  5IO2 A;  4JED A;  2H73 A;  1I9D A;  2GT6 A;  3CXG A;  4HQS A;  3WT1 A;  5ELA A;  2K8V A;  2J23 A;  1AAZ A;  1H75 A;  4G19 A;  4OWY A;  5KN0 A;  3GKX A;  3IK9 A;  3HYP A;  3OR5 A;  2OBK A;  3UBL A;  22GS A;  2YWI A;  3H93 A;  4EC0 A;  2C0E A;  1M2A A;  3C1S A;  1GSD A;  2EC4 A;  1A2L A;  4HU9 A;  1TXX A;  3TRQ A;  2IMD A;  1F2E A;  4JBB A;  1ZYQ B;  5C00 A;  3ZIT A;  5ECH B;  4J56 E;  3HVX A;  3GL5 A;  1AIU A;  2X8G A;  4OO5 A;  3LJR A;  1TK5 B;  4WBJ A;  2RII A;  3G9B A;  1V9W A;  1GWC A;  5A4W A;  2AAW A;  1U3I A;  3QPM A;  4TW5 A;  3UBK A;  2V6K A;  1XOB A;  1TRU A;  2XPE A;  1A0F A;  2FWF A;  1VF2 A;  3LYK A;  4KDY A;  2GQM A;  4IVF A;  1X5D A;  1Z6M A;  3SBC A;  1ZCP A;  4BWS A;  2RUF A;  4TKY A;  2DMM A;  3A3T A;  5B8A A;  3DYR A;  2ES7 A;  2PVO C;  2C0F A;  3HZ8 A;  4ML1 A;  2C3N A;  2AUV A;  3KH7 A;  4N0V A;  3H4K A;  4L5L A;  2LEG A;  3M1G A;  4K7O A;  5ECP B;  1MD4 A;  2I81 A;  3TOU A;  3HA9 A;  2EIO A;  6GSX A;  1EEM A;  1F3A A;  5DAL A;  3GV1 A;  4ECJ A;  2WZ9 A;  4ZBB A;  3QD9 A;  2OBI A;  5JCG A;  3CSJ A;  4FYU A;  4YAV A;  1F3B A;  2WGR A;  2VCX A;  4KB3 A;  1AUC A;  1USB A;  2FHE A;  1TP9 A;  5A5K A;  3FZ9 A;  2GST A;  2OE0 A;  4RQX A;  4F0C A;  2XC2 A;  3PGT A;  1PD2 1;  3GN3 A;  3FYG A;  3ISO A;  5G1L A;  2GLR A;  4MAB A;  5ECN B;  3G7I A;  1YDK A;  2K8S A;  2L5L A;  3FKF A;  1WP0 A;  1IYH A;  1QGV A;  2ZNM A;  3CBU A;  3DEX A;  3LGC A;  3RBT A;  5FWG A;  1SU9 A;  1SJ6 A;  4ZBA A;  3UVH A;  2IPA A;  1TW9 A;  3LSZ A;  2FCH A;  3TJF A;  3MAK A;  3GUR A;  2HRF A;  2LS5 A;  2D2Z A;  4MDC A;  1URM A;  3BJ5 A;  1E2Y A;  4OCF A;  5HFI A;  2B5E A;  2R4V A;  1EGO A;  1VF1 A;  4K8M A;  2HRN A;  4KE3 A;  2VLU A;  3UVT A;  2H6Z A;  3IR4 A;  4ECB A;  5CRH A;  2HT9 A;  1YEX A;  4XHM A;  4RI7 A;  2OAC A;  2MBS A;  5G31 A;  3LXZ A;  4YH2 A;  4XS4 B;  5EVO A;  2FY6 A;  4X0X A;  1YJ6 A;  2IN3 A;  1M2D A;  3BCI A;  1OC8 A;  2JU5 A;  3TKS C;  5LCZ A;  3HD5 A;  4MPF A;  4NV5 A;  2AV4 A;  4CDO A;  4ECC A;  3LWA A;  3L9S A;  5G5E A;  3D4M A;  1VRS D;  2ON7 A;  2YZH A;  1GSE A;  5DCG A;  6GSU A;  5GST A;  2QGV A;  4HJM A;  4ECI A;  1X9M B;  2VCW A;  1XCC A;  1V98 A;  4AF2 A;  1EGR A;  3QAV A;  2HNL A;  2VLT A;  3P7X A;  1HNB A;  1OYJ A;  4WF4 A;  4H86 A;  4X43 A;  2VCQ A;  3D0Z A;  2H01 A;  2HSY A;  1ABA A;  3EMP A;  5IOW A;  1T00 A;  1SJZ A;  4ZXG A;  3EWL A;  3FRC A;  1AW9 A;  2H1G A;  3M9J A;  2FWH A;  3UAP A;  1GNW A;  3D22 A;  4I6X A;  2OJL A;  2FUG 2;  2WDU A;  3V1W A;  1SYX A;  1Z3E A;  2VM1 A;  2NTO A;  2GT5 A;  1OVN A;  5ECQ B;  1GSQ A;  3D6I A;  4MLY A;  3TKS A;  3D4T A;  5A4V A;  3ED3 A;  3EE2 A;  1T4Z A;  3DGQ A;  3QR6 A;  2LRT A;  1EP8 A;  2XBQ A;  1ZYE A;  2VCV A;  1Z7R A;  3M3M A;  2VLV A;  5DJM A;  4XTS A;  4V1A g;  4MMM A;  1X9W B;  2ZUP A;  2LQO A;  1SD8 A;  4N0Z A;  2AYT A;  2O89 A;  3VUR A;  3E0U A;  5J41 A;  3KXO A;  2L57 A;  4G10 A;  5DQS A;  3W6G A;  5CO3 A;  5IO0 A;  1AQX A;  2CVB A;  3WGE A;  3M9K A;  5F8B A;  1TRS A;  1LJR A;  4MPG A;  4TXV A;  1ILO A;  1RK4 A;  1M9A A;  3VWV A;  3KP8 A;  3CYN A;  5HR0 A;  4IJ3 A;  2V6O A;  5GAN D;  4YAP A;  3QFB C;  3HY2 A;  4EDZ A;  4XRD A;  2R3X A;  2RLI A;  5ECM B;  3JCM L;  1BJX A;  1BG5 A;  4MF7 A;  2H0G A;  3GH6 A;  1FB6 A;  4TN8 A;  2VL2 A;  4OD7 A;  2A4V A;  4LLR A;  4GCI A;  1THO A;  1SKW B;  2F8F A;  1XWB A;  2CVD A;  1O8W A;  5D9W A;  2HFD A;  4J2F A;  3Q19 A;  1THX A;  1DUG A;  1XFL A;  3RHC A;  2H6Y A;  3PIN A;  1K0B A;  5IMA A;  3GIX A;  5D73 A;  1MDJ A;  4EDY A;  5DDL A;  3TJJ A;  5G2Z A;  1UC7 A;  3I6A A;  4EXJ A;  6GST A;  3KIJ A;  3WT2 A;  3VI5 A;  5J3R A;  2JL4 A;  4NHW A;  1AC1 A;  6GSV A;  3CTF A;  2DSA A;  4KGI A;  2H0I A;  2C4J A;  2B7K A;  4IW9 A;  2G0F A;  1ST9 A;  4OMV A;  1WWJ A;  3IXR A;  2KLX A;  3ZLP A;  5J9C A;  3VWW A;  1GL8 A;  4ILF A;  4XRA A;  2A2R A;  2MMN A;  4HOJ A;  3UAR A;  5JCU A;  1TK0 B;  2I1U A;  1DSB A;  1EWX A;  1S3D A;  4CW9 A;  5GZZ B;  3A2V A;  5H5Q A;  3G7J A;  3BD2 A;  2L5O A;  1MDK A;  2OE1 A;  1WMJ A;  4ZB9 A;  1FOV A;  3L9U A;  1X0R A;  2YJ7 A;  2AHE A;  1AQW A;  2V2G A;  2GGT A;  5ECS A;  5ABR A;  1I5G A;  4HS1 A;  1OE7 A;  2LKU A;  4K2D A;  3LXT A;  1B48 A;  4BWQ A;  2LJA A;  2PGT A;  1CQH A;  2GZY A;  2YP6 A;  2C0D A;  1GRX A;  1SL0 B;  5CYY A;  3EMX A;  3RAZ A;  3S9F A;  1PX6 A;  2EIR A;  5AGY A;  2H1D A;  4DEJ A;  2DJJ A;  4POM A;  1T4Y A;  1ON4 A;  5J5N A;  1F6M C;  4BPY A;  4HI7 A;  5AIX A;  3HKR A;  4GLT A;  1V2A A;  1PL2 A;  2BJX A;  1ZGN A;  13GS A;  3GX0 A;  4TR1 A;  1Y6E A;  2H0H A;  1Y25 A;  3HVS A;  1GUH A;  5B6N A;  3IAS 2;  3ZIJ A;  1B4P A;  4KDX A;  3IAM 2;  4DSR A;  3M8N A;  2C1Y A;  2PBJ A;  3IA1 A;  2N5A A;  3DXB A;  1NSW A;  3P2A A;  3BBY A;  1YKC A;  3VPQ A;  4OFT A;  2HZF A;  4EVM A;  2CV4 A;  1WE0 A;  2IL3 A;  4F03 A;  4WXT A;  3F3Q A;  1C72 A;  1WPI A;  4EL1 A;  5DAL B;  7GSS A;  4NWY A;  4L8E A;  1NW2 A;  4MJE A;  5GAP D;  2LTK A;  1SK2 A;  2LV3 A;  3CTG A;  3TJK A;  4MZB A;  1SKS B;  2C3T A;  3MWH A;  1K0O A;  1ZMA A;  1B9X C;  1T3B A;  3TRP A;  3LFL A;  2H72 A;  1ERT A;  4E8H A;  3F6D A;  4ACS A;  3QMX A;  2ON5 A;  3C73 A;  3TGZ A;  4IGJ A;  1BYE A;  1TJD A;  2DC5 A;  2PUK C;  1MDI A;  2LNS A;  2M72 A;  1VGL A;  1PA3 A;  3TKP A;  1SK1 A;  4DSS A;  4O5R A;  5IMZ A;  2R6K A;  1XPV A;  2VCT A;  2YZU A;  1R5A A;  3F4S A;  4IP1 A;  5DBQ A;  4HUA A;  4MA9 A;  4EF0 A;  3FY7 A;  2M80 A;  3IPZ A;  3UMA A;  1U88 A;  3DWV A;  2QC7 A;  4PGT A;  3RPP A;  3GH9 A;  2GSS A;  4OO4 A;  1PSQ A;  4ISD A;  1XWG A;  2CX3 A;  5HFG A;  1HNA A;  2XPD A;  5COH A;  5EY6 A;  3DRN A;  2E2M A;  1XXU A;  2ZCT A;  8GSS A;  4MZC A;  4QL9 A;  4PUR A;  3RHB A;  4O7H A;  5ECO B;  3TUE A;  3W8S A;  2PMT A;  2O8V B;  2REM A;  5J4U A;  4EKZ A;  3F4R A;  3HVV A;  4HDE A;  2VL9 A;  3LQ7 A;  4G9H A;  2F9S A;  5B6M A;  1GNE A;  3Q6O A;  2G2Q A;  1TRV A;  3PR8 A;  1KBN A;  5D9T A;  3KM6 A;  3CSH A;  3J7Y k;  4BVY A;  4NV2 A; 
#chains in the Genus database with same CATH topology
 5TGN A;  1GSU A;  3GFK A;  3VK9 A;  3N54 B;  1J2B A;  3ME8 A;  1A0R P;  3D5I A;  1TOF A;  1GD3 A;  1YHQ 3;  4ML6 A;  4IEL A;  4KH7 A;  2L4Q A;  3Q74 A;  2A15 A;  2X8C A;  1NJI 4;  1BRS A;  4HM3 B;  1GTI A;  3VI7 A;  4IQA A;  3ZFB A;  1JHB A;  3DML A;  1M7T A;  3BNE A;  5IEO A;  1QAL A;  2KF5 A;  4FCM A;  2DBC A;  4L0W A;  1G0T A;  2E2T A;  1Z1S A;  4FQU A;  1RRL A;  2BMQ B;  5AII A;  3G6E 3;  3ALA A;  1SJI A;  20GS A;  2IFQ B;  2UZ8 A;  2CZ3 A;  4K90 B;  5BXQ A;  2M46 A;  1XW9 A;  1S3C A;  3F0I A;  3MSZ A;  3SED A;  1PX7 A;  4IJI A;  2INX A;  1LU4 A;  1R4W A;  1KC8 4;  3A2W A;  2K0M A;  3MHE A;  4HM2 B;  4GF0 A;  3MG2 A;  2H30 A;  4QQ7 A;  2RM6 A;  4BTY A;  2IMK A;  3IBH A;  2P38 A;  1J08 A;  4DVC A;  2AAE A;  3I43 A;  1UN2 A;  2CAI A;  1ERV A;  5M1A A;  3HJM A;  5G5F A;  2A2P A;  2CZ2 A;  3KN4 A;  1RSN A;  1I2E A;  3GUS A;  2VOC A;  1X1X A;  2LUS A;  3TKR A;  3NIV A;  3WD6 A;  3FZW A;  4DKI A;  1BAY A;  2D1W A;  4MJA A;  1Y4K A;  3WGX A;  3OWS A;  3A2X A;  5DVB A;  1TDI A;  2D42 A;  3C71 A;  1E6B A;  3KII A;  2CAQ A;  2FD3 A;  2KP2 A;  4KW6 A;  4PXO A;  2P0M A;  1B4Q A;  4IN0 A;  3KTB A;  3ZML A;  4JE1 A;  4TR3 A;  1U87 A;  1R26 A;  1I70 A;  2WCI A;  1MWU A;  5JWQ B;  4TR0 A;  5F0G A;  3KMN A;  5AIH A;  3L9V A;  1RGG A;  1JBR A;  2FWG A;  1YZX A;  4WP5 A;  1GSY A;  4KCA A;  4OCE A;  4RNY A;  5F06 A;  3LT9 A;  1DE1 A;  5DCH A;  1ZYN A;  4MJB A;  3KP9 A;  3W8J A;  3KD0 A;  2B3S A;  1S5A A;  2HLS A;  3WA3 A;  3O3T A;  1YIJ 3;  3UNL A;  1WNH A;  3GZR A;  1RGC A;  1PRX A;  4J9A A;  3GSP A;  4HZ2 A;  2O87 A;  5IW9 A;  3SLU A;  1XVW A;  4HJ2 A;  1EG9 B;  4Z7X A;  4EUY A;  1V40 A;  1FG4 A;  2MMA A;  3BNB A;  3L0H A;  3DIE A;  5JPU A;  3TCO A;  4XBX A;  1K0M A;  4BL3 A;  1OAZ A;  1SD9 A;  4MCU A;  5AIF A;  1KTE A;  1YF0 A;  1OE8 A;  3ZYW A;  1VQ7 3;  3MSO A;  2IFQ A;  4MEI A;  2FWE A;  4O92 A;  2F51 A;  4OFN A;  1NO3 A;  2C80 A;  1QMA A;  2AB6 A;  3QDN A;  4LMW A;  5CNW A;  2FNO A;  1K8A 4;  4LMV A;  2ZDJ A;  1N5P A;  2PWJ A;  4K7N A;  2JSY A;  5AEW B;  1I0X A;  3IRA A;  2X8H A;  2PU9 C;  3D5J A;  3GX8 A;  1CYU A;  3ERG A;  2XFT A;  3EN8 A;  3ZRE A;  3NBJ A;  4EV2 A;  2TRC P;  3GST A;  1LRA A;  3IHG A;  5H5S A;  4FIW A;  1D6Z A;  4FMB A;  1QQ2 A;  3KJY A;  2IY2 A;  1VQL 3;  1WRY A;  5ECR B;  5KP3 A;  5HR1 A;  1R4C A;  2RUE A;  1FHE A;  4BL2 A;  1YQ1 A;  2WB9 A;  4P3Y B;  4USS A;  3I9V 2;  2DKI A;  1N2A A;  2RSX A;  3KEB A;  1XOA A;  2R0G A;  1YJN 3;  1NHY A;  3HVN A;  2VO4 A;  1GYB A;  3TKS E;  2CW9 A;  4ZBD A;  3TRX A;  2CX4 A;  2X99 A;  4L0U A;  1O7P B;  2Z9S A;  1JB5 A;  3CCE 3;  1QUW A;  1IVV A;  4FYC A;  5AIS A;  1YNV X;  3MG1 A;  5CK6 A;  2BTO T;  2CQ9 A;  2O7K A;  4TRX A;  4AGS A;  2B7J A;  1XIY A;  5LD0 A;  3CMA 3;  1TIJ A;  1K3O A;  4L5O A;  1TKD B;  1W2B 2;  1FVJ A;  4EE0 A;  2H74 A;  1K0D A;  2NDO A;  4JU5 A;  3IDV A;  2F98 A;  3X3X A;  2LJR A;  2VL3 A;  1Z9H A;  2OE3 A;  2WOF A;  1RGE A;  2JAD A;  1S72 3;  3FR6 A;  1K0N A;  4HM7 B;  3CCR 3;  1EOH A;  2JAC A;  4WR5 A;  12GS A;  2NVL A;  4N6U A;  4POK A;  1SYR A;  1PN9 A;  3QCP A;  1BVI A;  1YY7 A;  3MG3 A;  3HOH A;  4AJ6 A;  4G0I A;  2E0Q A;  4KSO A;  2J8X B;  1BAO A;  2JZR A;  5GSS A;  1YVS A;  1M99 A;  1M2B A;  1M3I A;  2XGL A;  4K6X A;  2L1S A;  2IMI A;  4QWT A;  1XWC A;  1YGE A;  1B3S A;  2OOV C;  3F6F A;  3GA4 A;  3GRD A;  3H79 A;  1QK8 A;  2M7O A;  1G6W A;  4K0G A;  5KP1 A;  1PFO A;  5FT3 A;  3KZQ A;  3WOD G;  5HR2 A;  2F8A A;  3APO A;  2VUP A;  5G1K A;  3B7C A;  9RNT A;  2GTU A;  2P31 A;  3DVW A;  3FGY A;  1B8X A;  2BMR B;  1G7E A;  4LMI A;  3U6V A;  2HYX A;  3ZTL A;  1BRG A;  1HYU A;  2BHM A;  5EL8 A;  2WS2 A;  2JSZ A;  1LNH A;  1OC9 A;  4XBY A;  3MWZ A;  2Z77 A;  1BRJ A;  1X9S B;  1W01 A;  4K2X A;  3F40 A;  3NQZ A;  3FZA A;  1GMR A;  1TFK A;  2B1L A;  3ZL5 A;  3HII A;  3E99 A;  1XZO A;  2B5X A;  1GY5 A;  3AMO B;  3FK8 A;  5DJL A;  4FH8 A;  3C7M A;  1W4V A;  1FUS A;  1D6U A;  1ZL9 A;  2PNC A;  3KMO A;  3DY5 A;  3NV0 A;  3CRU A;  2IIY A;  3GYK A;  4GRF A;  3IV4 A;  4JZQ A;  1BNE A;  2W0Q A;  2GDR A;  2PPT A;  3FW2 A;  4TR1 B;  2H19 A;  3HK4 A;  3EN1 B;  1NHO A;  1X5E A;  5D83 A;  8CHO A;  1ROA A;  2E7P A;  3ME7 A;  1YKA A;  1XWA A;  1ZYP A;  2PN8 A;  2VM2 A;  5ECK B;  1VQ5 3;  5IMV A;  2HE3 A;  3DGN A;  2QIY A;  2YN1 A;  4CJN A;  1FB0 A;  1K3L A;  4KND A;  2C3Q A;  5EPF A;  1A2J A;  3FHK A;  4BIK A;  5AIV A;  1SL2 B;  3T0U A;  3CCS 3;  2W2C A;  2VIM A;  1SL1 B;  1IYY A;  3EVI A;  4GXZ A;  1RGK A;  1UCJ A;  2YNX A;  4XIH A;  1GLP A;  3A5W A;  2WRT A;  5KEJ A;  2H66 A;  1PQN A;  1T5Y A;  1TFO A;  3X42 A;  2VD0 A;  2YV7 A;  2YJH A;  5ID2 A;  3JUP A;  3IK7 A;  1MNL A;  2FLS A;  2R5G A;  4IKH A;  3APS A;  3BU4 A;  2NPB A;  1MTC A;  1EEJ A;  1O73 A;  2OOV A;  3KTL A;  3ZFL A;  1V58 A;  1VQ6 3;  1W89 A;  1XW5 A;  1PGT A;  4I8B A;  3GTU A;  2GZP A;  2MF7 A;  3M0F A;  2QKE A;  3E3E A;  3DVX A;  5IMF A;  1O85 A;  1SEN A;  5B7C A;  2A4H A;  1RLS A;  2IMF A;  2JZS A;  2N5F A;  3QAG A;  1J9B A;  3CRT A;  4V2M A;  4TX4 A;  2KF6 A;  3NQY A;  1OC3 A;  1CQG A;  2W9P A;  3URP A;  2MC8 A;  3A5I A;  4N6N B;  3FR9 A;  3BOA A;  4ZL7 A;  2LJK A;  5E4W A;  3J7Y d;  3EIN A;  1HKX A;  4DSS B;  3AHS A;  1FOH A;  2HMJ B;  2ZL8 A;  4K1F A;  1NU3 A;  5ENU A;  1O7W B;  2L6D A;  3IOS A;  1FA3 A;  3N9J A;  4I2T A;  1SK0 A;  4KZ1 A;  4O32 A;  4V1A p;  2DJ3 A;  3TJG A;  1IV7 A;  4KX4 A;  1YVB I;  3GZX B;  4ZIL A;  2L59 A;  2MMO A;  4D73 A;  2WFC A;  1N8J A;  4X2H A;  4WHA A;  4I2U A;  2XRX B;  2VCZ A;  1WMP A;  1GUK A;  1JZW A;  4GSS A;  3IMA B;  1SKR B;  1UDI I;  1PU4 A;  3MYT A;  1Q86 4;  3TB2 A;  1JNQ A;  2EIQ A;  4BU4 A;  1AXD A;  4N10 A;  4HZ9 B;  4V2L A;  5INY A;  1JZO A;  2F99 A;  3ERW A;  1ULJ B;  3G16 A;  4CDL A;  4EBG A;  1HNC A;  2CFD A;  1BSC A;  1JLV A;  3R2Q A;  2LQQ A;  2K3D A;  2IA7 A;  1EZK A;  4R80 A;  1VF4 A;  7STD A;  2IYJ A;  4HZ4 A;  3MDK A;  4PX1 A;  4N6M A;  4IBP A;  2YWN A;  2IUK A;  1MWS A;  3D21 A;  2W6J H;  5F07 A;  2FA4 A;  2OWP A;  5IG5 A;  4GWR A;  1JRQ A;  3B4P A;  3G8Z A;  2GXF A;  1VQN 3;  3UEM A;  3HJP A;  4HAA A;  3GKM A;  4BL7 A;  5ELJ A;  2YWO A;  3WA2 X;  4IIA A;  4JRR A;  1NB3 I;  2VAF A;  4ID0 A;  3LG6 A;  2CFL A;  4IP6 A;  4G2E A;  3ZVJ A;  1K0C A;  4PUF C;  1RKY A;  3S29 A;  2C0G A;  4BIR A;  5H5R A;  2PVQ A;  2MYG A;  3F8H A;  3EU4 A;  1WMN A;  2I4A A;  3IE3 A;  4KVH A;  5HQP A;  1JZD A;  3EU3 A;  4MK3 A;  2GSR A;  4KFE A;  2BIR A;  4LEH A;  1LOW A;  2CWT A;  3H3H A;  3SVA A;  3H1N A;  3PYJ A;  4JR4 A;  3VPT A;  3NZN A;  2TIR A;  1PL1 A;  1QMV A;  2MMZ A;  4EYC A;  1IV9 A;  1SIH A;  2FA8 A;  2H1B A;  4WR4 A;  5CRW A;  3O76 A;  4GQF A;  3G71 3;  3FCS B;  4TVE A;  3K5T A;  4KUN A;  4ZL8 A;  2XGN A;  3NXJ A;  1TI3 A;  3H8Q A;  1ACV A;  4GSN A;  2GSP A;  2CFG A;  3CC2 3;  1UA5 A;  3APQ A;  3LOR A;  4X1U A;  3SWL A;  1Q42 A;  3EE1 A;  2KOK A;  2H8L A;  3P90 A;  2XF3 A;  4HBR A;  5IEP A;  1VQO 3;  4HOH A;  2OCT A;  1YF1 A;  2E2G A;  2BMX A;  1OKT A;  3ZRD A;  2YX9 A;  1A2V A;  3QRD A;  17GS A;  3PH9 A;  3L0R A;  3VFI A;  1A8Y A;  1FZU A;  1RW1 A;  3CME 3;  3LOY A;  2RM5 A;  2GU1 A;  3BNC A;  3QFA C;  11GS A;  2KP1 A;  2V41 A;  1BX9 A;  3C8E A;  3UIW A;  1DE2 A;  5G30 A;  4AJ7 A;  5HGR A;  3ECF A;  2R0C A;  3DGO A;  3I55 3;  4K5S A;  2C8U A;  1A2M A;  4E8E A;  2DIY A;  2B5Y A;  1UVZ A;  3GKN A;  3HHV A;  3TKQ A;  2H71 A;  10GS A;  1T1V A;  2L6C A;  1FUT A;  1G6Y A;  1B21 A;  1DYU A;  5IQY A;  1V57 A;  2BU4 A;  2GSQ A;  1A24 A;  4XB5 A;  3TOT A;  1MEK A;  4TXO B;  4F9Z A;  1OHP A;  1LOX A;  3ROB A;  2YFI B;  1Q40 B;  2YOI A;  3TJB A;  1RGH A;  4RNT A;  3SOA A;  1XVQ A;  5D96 A;  3VWX A;  4CY6 A;  2DJ2 A;  1EP7 A;  1E3R A;  2HMM B;  1NB5 I;  2WOH A;  4GTU A;  4MJC A;  5IMC A;  2CG1 A;  3EB8 A;  5IMD A;  2IME A;  5KOW A;  4HM6 B;  1I0V A;  3F4T A;  2CFW A;  1EA2 A;  2WJU A;  3WR2 A;  4F82 A;  5D93 A;  3LXU X;  2R2J A;  1RHL A;  3EUR A;  4TR4 A;  4PTS A;  3G0K A;  4IQ1 A;  3KSE D;  2ML6 A;  3CPW 2;  4MZW A;  4Q5N A;  4KA0 A;  3K7C A;  1HYF A;  3GAX A;  4GSP A;  2LNT A;  4XM4 A;  4GQC A;  1JLW A;  4H3U A;  4YKG A;  1CYV A;  1BUJ A;  3F3R A;  3D3L A;  4J57 E;  1YEP A;  4KCE A;  3VLN A;  1BED A;  3BND A;  2YWM A;  4J5G A;  4RUV A;  3AY8 A;  1GUL A;  1FVK A;  4MH2 A;  1DMM A;  5IPH A;  1BSD A;  3WHO A;  2HMK B;  4WF5 A;  1O81 A;  3J7Y b;  1O7N B;  1TRQ A;  4Z2T A;  1PKW A;  3CCL 3;  1NM3 A;  1O7U A;  2F3M A;  3OX9 A;  4RNZ A;  2FGX A;  1PKZ A;  2XFS A;  2YPM A;  5DRE A;  2CVK A;  3UJ1 A;  4NMU A;  3FZ4 A;  1TU8 A;  3C1R A;  3UL3 A;  2VD1 A;  4PNF A;  4HU7 A;  1GOY A;  3K8N A;  4NRE A;  5DQY A;  1U6T A;  3KCH A;  3V98 A;  2H75 A;  2KHP A;  1T8E B;  2X49 A;  3WGD A;  3K0Z A;  2LST A;  3GZY B;  1BNS A;  1LQM B;  1GTB A;  1BSA A;  5CAX A;  1LXE A;  1Z7P A;  5AN1 A;  3D79 A;  2YV9 A;  1VQK 3;  3D5G A;  1O6J A;  1G02 A;  3F63 A;  1BGS A;  3CMI A;  3BIR A;  2HI7 A;  4TXO A;  4IHU A;  2KRT A;  1OKD A;  3CU3 A;  2QA4 3;  2K9F A;  4POL A;  1Q40 A;  2KCD A;  3PGB A;  1VQ8 3;  3DH2 A;  5IPG A;  5JWO B;  1A2K A;  1EOG A;  2MBT A;  3L4N A;  3FZ5 A;  3KFQ C;  3U5R E;  9GSS A;  1DVD A;  2RFR A;  2NBS A;  5ECL B;  5HFK A;  3VSY A;  1WIK A;  1QAF A;  2RBI A;  5HR3 A;  2E2U A;  4FO5 A;  3CSI A;  3DKS A;  2DJK A;  3KH9 A;  1S3A A;  3NUV A;  19GS A;  3O6T A;  5A4U A;  1IYI A;  1U3A A;  4G1M B;  3UB1 A;  4FR9 A;  3QOU A;  4XCS A;  2B6M A;  1OHO A;  1GP1 A;  3EQQ B;  3NOF A;  5D9X A;  2O85 A;  1M1X B;  1RTU A;  3ER7 A;  2I3Y A;  1FO5 A;  4K7I A;  3ERF A;  4LL1 B;  1FW1 A;  2N5B A;  2ZA4 A;  3I69 A;  2MZC A;  2KAA A;  2GQK A;  3F7S A;  3P8W A;  1Z5Y E;  4N30 A;  3RDE A;  3HZP A;  4ZB6 A;  4V2N A;  1TRW A;  3D4A A;  1Q7H A;  1ROV A;  3KZT A;  5B8B A;  4IS0 A;  1GUM A;  3US3 A;  2LYX A;  5LC7 A;  1EUI C;  5BMU A;  2R37 A;  1ZOF A;  3WYW A;  1B2Z A;  4NXI A;  2V1M A;  2CFK A;  3ZMK A;  1JN5 A;  4OK0 A;  1GSS A;  2OKA A;  1M9B A;  2P5Q A;  2AJQ B;  1STD A;  4BTX A;  2OA7 A;  1OC9 B;  1H4O A;  7RNT A;  4HYZ A;  4CHS A;  4IPB A;  3HJO A;  4U13 A;  3DGM A;  4MF5 A;  3HXS A;  2GS3 A;  3LEF A;  4K9Z A;  4FCJ A;  3GHA A;  1U5O A;  1AVK A;  4BA7 A;  1GH2 A;  3EC3 A;  4LL4 B;  4KDU A;  2IJY A;  2VL2 C;  1W6C A;  1W6Y A;  3PPU A;  3NV0 B;  4L8O A;  3HDC A;  1RDS A;  5IG0 A;  4RI6 A;  1JB2 A;  3RGR A;  5C04 A;  4BVX A;  2GU3 A;  4LZI A;  2GQL A;  4TOP A;  3Q3F A;  3HZ4 A;  4WKW A;  3UOM A;  1QXH A;  3MNG A;  2F4Y A;  3EHC A;  4RQR A;  4YQV A;  2ALB A;  4GST A;  5CP1 A;  4XS4 A;  3QAW A;  2DML A;  3X40 A;  1BRK A;  3BCK A;  5IF6 A;  1TRP A;  5BIR A;  1JKG A;  18GS A;  4Q53 A;  3F8U A;  3FF2 A;  1MWR A;  3OXA A;  2A2S A;  2IWT A;  4I5Q A;  1M90 4;  1R7H A;  4HM4 B;  4A5P A;  1N9J A;  1FW7 A;  1WJK A;  4YQM A;  3FMW A;  5AYR B;  1RRH A;  2V32 A;  1TK8 B;  2CC3 A;  5ID2 B;  4NHZ A;  1TP6 A;  4NPB A;  2XHF A;  4I97 A;  1ML6 A;  2J9H A;  1M0U A;  3VWU A;  1X1W A;  1ZZY A;  1XWK A;  5IM9 A;  1GSF A;  5F05 A;  4WEY A;  1TI1 A;  5J9B A;  6STD A;  4HEA 2;  1T7P B;  2YCD A;  1XW6 A;  2LRC A;  4WBR D;  1IQ8 A;  1KEB A;  3DGY A;  1ERU A;  3JUO A;  1AQV A;  3GTU B;  5KOX A;  1VQ4 3;  2DJ1 A;  1LBK A;  1K0A A;  1UW1 A;  3IHQ A;  3KGK A;  2HZE B;  3NHX A;  3IC4 A;  2OTL 3;  1IQX A;  4HVN A;  1F37 A;  4MP4 A;  1W02 A;  4PQH A;  2XBI A;  5DAK B;  1OGX A;  4K5R A;  4QL7 A;  1Q98 A;  5D8I A;  14GS A;  1GOU A;  3U1W A;  2STD A;  3WMD A;  2CH9 A;  16GS A;  2HOH A;  4L7K A;  5DRV A;  1W00 A;  2QSI A;  4HM5 B;  1IVU A;  5CRG A;  4POB A;  1AV4 A;  1BOX A;  4OFM A;  3Q1C A;  3EPT A;  4PUA A;  4ZM8 A;  2H1A A;  1XG8 A;  5FGO A;  2CX1 A;  3N9H A;  5D82 A;  2I9H A;  4ZIJ A;  2E2V A;  1TTZ A;  4FYB A;  5IEN A;  1IDP A;  2K18 A;  1BQ7 A;  1GTU A;  2X64 A;  5KN1 A;  2DLX A;  2JZT A;  4D73 B;  2XSH B;  1QFN A;  1JJ2 2;  2PZV A;  2XR8 B;  4ZB8 A;  4K0N A;  2DJ0 A;  3M8C A;  3QK9 A;  1I3F A;  3GMF A;  3PCS A;  2K6V A;  1Z6N A;  1DVC A;  1B2M A;  2QA1 A;  5CLK A;  3KCM A;  1TU7 A;  4EIP A;  1Q81 4;  1RMS A;  1GY6 A;  5FHI A;  3RPN A;  2AAD A;  2HXK A;  1NDO B;  2O3O A;  1F8N A;  1OF5 A;  2TRX A;  3S28 A;  3RDW A;  2CKF B;  1M3J A;  1ERW A;  1F9M A;  5IIZ A;  2H76 A;  3EYT A;  1MD3 A;  3FEU A;  3N5O A;  3GNJ A;  5LNK e;  1LOV A;  2WUL A;  6GSY A;  2IMJ A;  4CCV A;  1BNR A;  1IT7 A;  4MF6 A;  1J0F A;  4AJ8 A;  1K3Y A;  4JR6 A;  3DD3 A;  2DIZ A;  6GSS A;  4NAX A;  4XS1 A;  5JCW A;  2W03 A;  4Q5Q A;  4BL7 B;  4DSQ A;  1PY3 A;  2CK3 H;  2CT6 A;  1VQM 3;  4WET A;  3I56 3;  2W9Q A;  5JWR B;  4IT7 A;  5AEU B;  1EV4 A;  1MOL A;  3FH1 A;  1A2P A;  1MGR A;  4GB5 A;  5ECI B;  3Q18 A;  4XS6 A;  3JUM A;  4KFF A;  4KAE A;  4HQZ A;  4Q5F A;  1DBY A;  3TDG A;  4LGQ A;  3LYP A;  2P0G A;  3HCZ A;  2OQE C;  1PYL A;  4F2I A;  1RQM A;  1GTA A;  3NM7 A;  5IOX A;  3FR3 A;  1B27 A;  2H70 A;  1A67 A;  2HZE A;  5E59 A;  5RNT A;  2P09 A;  1W2Z A;  1A8L A;  1DE3 A;  2HSH A;  1UUV B;  1LVN A;  5DAK A;  1KQS 2;  4FMC A;  4YQU A;  4KSM A;  1BUQ A;  1HQO A;  5IER A;  1FGQ A;  2LQV A;  1BRN L;  1GLQ A;  3GRX A;  1HU9 A;  2XH9 A;  4GL6 A;  2CA8 A;  4ULX A;  1N8Q A;  5GSP A;  4LA1 A;  1PMT A;  2OAD A;  4N6T A;  1B9Y C;  1VF3 A;  3LW9 A;  4N11 A;  3ZVJ D;  1ASK A;  3GSS A;  4EXR A;  5D9V A;  4CPK A;  4PNG A;  5KN2 A;  1EV9 A;  1R5P A;  2B1K A;  4PQI A;  1KNG A;  3F9U A;  1G7O A;  2GBW B;  2UX0 A;  4EO3 A;  2GVP A;  1JZR A;  4Q5R A;  1B2U A;  2QA2 A;  3E9J B;  2H6X A;  2KUC A;  3MIX A;  3ZZX A;  1OPY A;  4MJD A;  4ZL9 A;  2GZZ A;  3L78 A;  1Q9E A;  3ZIV A;  2PER A;  4F0B A;  1LOY A;  1GOV A;  2L4C A;  5ELG A;  1N5H A;  1WOU A;  5CRE A;  1NWW A;  2P5R A;  1HD2 A;  4MH3 A;  5KN3 A;  1XBS A;  5L71 A;  1GMP A;  1Q4J A;  3GL3 A;  1AQZ A;  3OWU A;  2YAN A;  5BRT A;  1Q7Y 4;  2QEX 3;  1RN7 A;  2QGU A;  3PCR A;  3WOE B;  3G7Y A;  3IJE B;  2ZHX B;  1X5C A;  2XSO B;  3GKK A;  5CRD A;  2RCD A;  6GSW A;  1FAA A;  4PQ1 A;  1A23 A;  1JFU A;  4OUQ A;  2LRN A;  4WFO A;  2WGQ A;  1O8X A;  5IO2 A;  1RCK A;  4JED A;  1BRH A;  3B4O A;  2H73 A;  1I9D A;  2GT6 A;  3CXG A;  4HQS A;  3WT1 A;  1G96 A;  2F5M A;  1FUW A;  5ELA A;  1OCV A;  1BSE A;  3LTC A;  2K8V A;  2J23 A;  4KFD A;  1IQY A;  1AAZ A;  2OQE A;  2YFJ B;  1H75 A;  3EF8 A;  4K61 A;  4G19 A;  3S27 A;  4OWY A;  5KN0 A;  6RNT A;  1E3V A;  3GKX A;  1SAR A;  3IK9 A;  3Q2P A;  3HYP A;  1I3I A;  4FMA A;  3OR5 A;  2OBK A;  3UBL A;  22GS A;  2YWI A;  4BTW A;  3H93 A;  5I97 A;  1SJW A;  4EC0 A;  1TTO A;  2C0E A;  1M2A A;  3C1S A;  1GSD A;  2EC4 A;  1W6G A;  2CG0 A;  1A2L A;  4HU9 A;  3CPO A;  3G4S 3;  1TXX A;  3TRQ A;  1MWT A;  2IMD A;  3JVC A;  1F2E A;  1K9M 4;  3B8L A;  3EJV A;  1JV2 B;  4JBB A;  5C00 A;  1ZYQ B;  3ZIT A;  5ECH B;  4J56 E;  3HVX A;  3ZG0 A;  3GL5 A;  1SQW A;  1AIU A;  5BVB A;  4AKY A;  2X8G A;  1B2S A;  1K28 A;  4OO5 A;  5CF1 A;  3LJR A;  1TK5 B;  1STF I;  4WBJ A;  2RII A;  3G9B A;  1V9W A;  3K63 A;  1GWC A;  5A4W A;  1VQP 3;  3CCQ 3;  2AAW A;  1W4N A;  1U3I A;  3QPM A;  4TW5 A;  3UBK A;  4J5K A;  2V6K A;  1XOB A;  3LTA A;  4O3V A;  1TRU A;  1NNV A;  2XPE A;  4HM0 B;  1W5Z A;  1A0F A;  2FWF A;  1VF2 A;  3CC7 3;  4RZM A;  3EC9 A;  3LYK A;  4KDY A;  1SII A;  2RNT A;  2GQM A;  4RBN A;  4IVF A;  1X5D A;  1Z6M A;  1YGW A;  3MYD A;  3CD6 3;  2KF3 A;  3SOY A;  1IVW A;  1TU5 A;  3SBC A;  3CCU 3;  1ZCP A;  4BWS A;  1US1 A;  2RUF A;  4TKY A;  4XDV A;  2DMM A;  3A3T A;  5B8A A;  3DYR A;  1GSP A;  3RNT A;  2ES7 A;  1RN1 A;  3DMC A;  3ZFZ A;  2PVO C;  2C0F A;  4O8S A;  3HZ8 A;  4ML1 A;  3SYU A;  2AUV A;  2C3N A;  3KH7 A;  4N0V A;  3H4K A;  4L5L A;  2LEG A;  3M1G A;  4K1V A;  4K7O A;  5ECP B;  3VGN A;  1WMO A;  1MD4 A;  2I81 A;  3TOU A;  3UL6 A;  1O7H B;  5HOH A;  4EC6 A;  1JBT A;  3HA9 A;  3N8B A;  2CIU A;  3CCV 3;  3FLJ A;  2FXT A;  3LH4 A;  2EIO A;  1EEM A;  1F3A A;  5DAL A;  6GSX A;  4N6O B;  3GV1 A;  4ECJ A;  3DXO A;  2WZ9 A;  4HM1 B;  4ZBB A;  2BMO B;  2BO9 B;  1LQG C;  3QD9 A;  2OBI A;  4CY8 A;  4Z2R A;  5JCG A;  3CSJ A;  4FYU A;  2CWU A;  2HMN B;  4N6V 0;  4YAV A;  1F3B A;  1CQS A;  2CHC A;  2WGR A;  1YJW 3;  5M18 A;  1BNJ A;  3LML A;  2VCX A;  4KB3 A;  1AUC A;  1USB A;  3OV4 A;  3STD A;  2FHE A;  1B20 A;  3CCJ 3;  4MMY B;  1TP9 A;  1C7H A;  5A5K A;  3FZ9 A;  2GST A;  2OE0 A;  3CQF A;  4RQX A;  4F0C A;  2XC2 A;  3PGT A;  4GHO A;  1PD2 1;  2OTJ 3;  1UGI A;  3GN3 A;  3FYG A;  3ISO A;  5G1L A;  2GLR A;  4MAB A;  5ECN B;  2Q07 A;  3G7I A;  1YDK A;  4G0K A;  2K8S A;  3LZA A;  1L5G B;  2GEX A;  4O02 B;  2L5L A;  1E97 A;  1UI8 A;  1WP0 A;  3FKF A;  1IYH A;  1QGV A;  2ZNM A;  3CBU A;  3DEX A;  3LGC A;  2Z7A A;  5CF2 A;  3RBT A;  1JN5 B;  5FWG A;  1SU9 A;  5EEO A;  1SJ6 A;  4N6L A;  4ZBA A;  3UVH A;  2IPA A;  3OW2 2;  1TW9 A;  3LSZ A;  5IG3 A;  2SBL A;  2FCH A;  3TJF A;  2R4I A;  1T2H A;  3MAK A;  3GUR A;  2HRF A;  5EQL A;  2LS5 A;  2D2Z A;  4MDC A;  2HMO B;  1URM A;  2Z6B A;  3BJ5 A;  1E2Y A;  5STD A;  4OCF A;  2RGQ A;  5HFI A;  2B5E A;  3GZB A;  2R4V A;  1EGO A;  5M19 A;  1VF1 A;  4K8M A;  5KP4 A;  2HRN A;  4KE3 A;  2VLU A;  3CNX A;  3MKI A;  3UVT A;  2H6Z A;  2P05 A;  3IR4 A;  4ECB A;  4BVX B;  5CRH A;  4WYK A;  2HT9 A;  7GSP A;  1YEX A;  4XHM A;  1RGL A;  4RI7 A;  2OAC A;  3BB9 A;  2MBS A;  2CX0 A;  5G31 A;  2W56 A;  3LXZ A;  4YH2 A;  1W7C A;  4XS4 B;  5EVO A;  2FY6 A;  4X0X A;  1YJ6 A;  1WTH A;  2IN3 A;  1JKG B;  1ULI B;  1M2D A;  3BCI A;  1OC8 A;  1B2X A;  2JU5 A;  3TKS C;  1RJO A;  1FGO A;  5LCZ A;  3HD5 A;  4MPF A;  4NV5 A;  2AV4 A;  3CCM 3;  2ML5 A;  1Q82 4;  4CDO A;  3KE7 A;  2R0P A;  4ECC A;  3LWA A;  4AEQ A;  3LYG A;  1CEW I;  1YJ9 3;  1N8R 4;  3L9S A;  1K41 A;  5G5E A;  4FCZ A;  3D4M A;  2K54 A;  1CH0 A;  1R4Y A;  4ORL A;  1OHS A;  1VRS D;  2ON7 A;  4JRF A;  2YZH A;  5ELU A;  3FG4 A;  3NM2 A;  3H51 A;  1GSE A;  5DCG A;  5GST A;  6GSU A;  3NX0 A;  2QGV A;  4HJM A;  4ECI A;  1UGH I;  1X9M B;  2VCW A;  1XCC A;  5AYS C;  3DGL A;  2Y74 A;  3EBY A;  3S67 A;  2Z76 A;  3NBB A;  1V98 A;  1BSB A;  4AF2 A;  1PFP A;  4STD A;  3S5C A;  1EGR A;  1BNI A;  4Z2U A;  3QAV A;  2HNL A;  2VLT A;  3P7X A;  3F9S A;  3DM8 A;  1HNB A;  1OYJ A;  3T8N A;  4WF4 A;  4H86 A;  4X43 A;  2B1X B;  2VCQ A;  3D0Z A;  2H01 A;  2HSY A;  2X4A A;  1ABA A;  4X4J A;  3EMP A;  5IOW A;  1T00 A;  1SJZ A;  3V92 A;  4ZXG A;  3EWL A;  3FRC A;  1N9E A;  1AW9 A;  1AVL A;  2H1G A;  4KF9 A;  3M9J A;  3HX8 A;  2FWH A;  3UAP A;  1GNW A;  3D22 A;  4I6X A;  4G0L A;  4N3V A;  2OJL A;  2FUG 2;  1JBS A;  2WDU A;  1QVF 2;  4ICY A;  4JF8 A;  5AIG A;  4LYL B;  1SYX A;  1Z3E A;  3V1W A;  1GD4 A;  2VM1 A;  1T2I A;  5BU4 A;  2NTO A;  2GT5 A;  1OVN A;  5ECQ B;  1PN0 A;  3FG1 A;  1GSQ A;  1ZS7 A;  3D6I A;  4LSO A;  4MLY A;  1OF5 B;  1IK3 A;  3TKS A;  1I2F A;  3D4T A;  2FNQ A;  5A4V A;  3PZW A;  3ED3 A;  3EE2 A;  1T4Z A;  3DGQ A;  1S3R A;  3QR6 A;  2LRT A;  1EP8 A;  2XBQ A;  4EIQ A;  1ZYE A;  2VCV A;  1Z7R A;  3M3M A;  2VLV A;  5DJM A;  4XTS A;  1UUG B;  4V1A g;  4MMM A;  1ZO2 A;  3F7X A;  1X9W B;  2ZUP A;  2LQO A;  1FYS A;  1SD8 A;  1LNI A;  4N0Z A;  2AYT A;  1WQL B;  1OUN A;  2O89 A;  3VUR A;  1VZZ A;  3E0U A;  8RNT A;  5J41 A;  1I2G A;  2L57 A;  3KXO A;  4G10 A;  2UUG C;  1RCL A;  5DQS A;  3W6G A;  5CO3 A;  5IO0 A;  1AQX A;  2CVB A;  3WGE A;  3M9K A;  5F8B A;  1TRS A;  1D6Y A;  1LJR A;  4MPG A;  4TXV A;  1ILO A;  4KT3 B;  3JUQ A;  4K1U A;  1RK4 A;  2P0X A;  1M9A A;  3HIG A;  3VWV A;  3KP8 A;  3CYN A;  5HR0 A;  4IJ3 A;  2V6O A;  3U97 A;  3PXM A;  5GAN D;  4YAP A;  2O9U X;  1V74 A;  3QFB C;  1UCL A;  3HY2 A;  4XRD A;  2I9W A;  4EDZ A;  2R3X A;  2RLI A;  5ECM B;  1JB4 A;  4OVM A;  3JCM L;  1BJX A;  1BG5 A;  4MF7 A;  2H0G A;  2C10 A;  3GH6 A;  2C11 A;  1FB6 A;  4TN8 A;  2VL2 A;  1HZ1 A;  4HM8 B;  4OD7 A;  2A4V A;  4LLR A;  4GCI A;  3X3Y A;  1THO A;  1SKW B;  3X3Z A;  2UGI A;  2F8F A;  1XWB A;  2CVD A;  1O8W A;  5D9W A;  3AGN A;  1DMN A;  2HFD A;  4J2F A;  3Q19 A;  2KXG A;  1THX A;  3CC4 3;  1DUG A;  1XFL A;  3RHC A;  2H6Y A;  3PIN A;  1BNG A;  3A5E A;  3AHW A;  1K0B A;  5IMA A;  3GIX A;  5D73 A;  1MDJ A;  4EDY A;  5DDL A;  3TJJ A;  5G2Z A;  1UC7 A;  3I6A A;  3R3E A;  4EXJ A;  6GST A;  3DZL A;  3DUK A;  3KIJ A;  3FF0 A;  1EKM A;  4MNN A;  3LTD A;  3WT2 A;  3VI5 A;  5G2G A;  1DMQ A;  1O7M B;  3SXX A;  5J3R A;  1GS3 A;  1I8V A;  2JL4 A;  4NHW A;  3ZG5 A;  1AC1 A;  6GSV A;  3CTF A;  2DSA A;  4KGI A;  2H0I A;  2C4J A;  2B7K A;  3F14 A;  1IT8 A;  2IUJ A;  4IW9 A;  3MPH A;  1QAK A;  1K73 4;  3F8X A;  2G0F A;  1ST9 A;  2R41 A;  4OMV A;  1WWJ A;  3IXR A;  2KLX A;  1YI2 3;  2WGO A;  4R4K A;  3ZLP A;  5J9C A;  3VWW A;  1GL8 A;  1BU4 A;  4ILF A;  4XRA A;  2A2R A;  2MMN A;  4HOJ A;  3UAR A;  1O7G B;  5JCU A;  1TK0 B;  1AY7 A;  2I1U A;  1DSB A;  1EWX A;  1S3D A;  4CW9 A;  2YFL B;  5GZZ B;  3A2V A;  5H5Q A;  1MGW A;  1OH0 A;  3G7J A;  4O5U A;  1VQQ A;  3BD2 A;  3CNM A;  2L5O A;  1MDK A;  3WOF B;  2OE1 A;  3KSP A;  1WMJ A;  3UJM A;  3GWR A;  4ZB9 A;  1FOV A;  1OGZ A;  3L9U A;  3PS8 A;  1X0R A;  2YJ7 A;  2AHE A;  5JBS A;  1AQW A;  3X41 A;  2CWV A;  2V2G A;  2GGT A;  4J8T A;  5ECS A;  5ABR A;  1I5G A;  1VQ9 3;  4HS1 A;  1OE7 A;  2GEY A;  4HSC X;  4YKF A;  1DET A;  2WO0 A;  2LKU A;  2Y73 A;  4K2D A;  4R9K A;  3LXT A;  1B48 A;  3D9R A;  1C54 A;  1FGM A;  1M1K 4;  3HI7 A;  4BWQ A;  2LJA A;  2PGT A;  3UL5 A;  1KSI A;  1CQH A;  2GZY A;  2YP6 A;  3JUN A;  2C0D A;  1GRX A;  2B24 B;  3OWY A;  1SL0 B;  5CYY A;  1BAN A;  3EMX A;  1UUW B;  3RAZ A;  3S9F A;  1PX6 A;  2EIR A;  5AGY A;  2H1D A;  4DEJ A;  4FMD A;  2DJJ A;  4POM A;  1T4Y A;  2L4V A;  1ON4 A;  4AKZ A;  5J5N A;  3AMO A;  1F6M C;  3I0Y A;  4BPY A;  4HI7 A;  1ZX2 A;  5AIX A;  3BLZ A;  3HKR A;  2BNG A;  4GLT A;  4H61 A;  3EX9 A;  1V2A A;  1PL2 A;  2BJX A;  1ZGN A;  13GS A;  3GX0 A;  1KD1 4;  5AI1 A;  4TR1 A;  1RN4 A;  1Y6E A;  2H0H A;  1Y25 A;  2HML B;  1GY7 A;  3HVS A;  1GUH A;  5FW5 A;  5B6N A;  3A76 A;  4I4K A;  3NBR A;  2KF4 A;  1A90 A;  3IAS 2;  3ZIJ A;  1B4P A;  4KDX A;  3IAM 2;  4DSR A;  3M8N A;  2C1Y A;  2PBJ A;  3IA1 A;  2N5A A;  3DXB A;  2V1L A;  1TUH A;  4HKV B;  1NSW A;  1YKC A;  3BBY A;  3P2A A;  1FGT A;  3VPQ A;  4OFT A;  2HZF A;  2W04 A;  1BIR A;  4EVM A;  2F56 A;  1SPU A;  4XDW A;  3VF1 A;  3IPT A;  4EW5 A;  2CV4 A;  1WE0 A;  2IL3 A;  1IVX A;  1UCI A;  4F03 A;  4WXT A;  5LC6 A;  1OAC A;  3F3Q A;  3O8Y A;  1C72 A;  1WPI A;  4EL1 A;  5DAL B;  7GSS A;  2SAR A;  4NWY A;  4L8E A;  1NW2 A;  4MJE A;  5GAP D;  1RGA A;  3WDG B;  2LTK A;  2XEP A;  1SK2 A;  2LV3 A;  3FKA A;  3CTG A;  3TJK A;  4MZB A;  1SKS B;  2F86 B;  2C3T A;  3MWH A;  3EBT A;  1K0O A;  1BNF A;  1ZMA A;  1B9X C;  1T3B A;  3TRP A;  3AGO A;  3LFL A;  2H72 A;  1ERT A;  1QJG A;  4E8H A;  3F6D A;  4ACS A;  1QVG 2;  3QMX A;  4BVY B;  2ON5 A;  3Q90 A;  4EV5 A;  3C73 A;  3TGZ A;  4IGJ A;  1X1U A;  1BYE A;  1TJD A;  5A0O B;  2DC5 A;  2HRA A;  2PUK C;  1ZGX A;  1MDI A;  2LNS A;  2M72 A;  3RGA A;  1EQK A;  1VGL A;  1PA3 A;  3TKP A;  1SK1 A;  2F5W A;  4DSS A;  1UI7 A;  4O5R A;  2GBX B;  5IMZ A;  2R6K A;  1XPV A;  1BRI A;  2JDI H;  3V99 A;  4L8P A;  2VCT A;  3SX1 A;  2YZU A;  4O5Q A;  1R5A A;  3F4S A;  2FGT A;  1GMQ A;  4IP1 A;  1X1Y A;  5DBQ A;  4HUA A;  4MA9 A;  4EF0 A;  1ISK A;  4MMX B;  3FY7 A;  2M80 A;  3LTB A;  3IPZ A;  1YIT 3;  3UMA A;  1IU7 A;  1RGF A;  1U88 A;  3DWV A;  3FSD A;  2HRK A;  5JPP A;  1M9G A;  2QC7 A;  4PGT A;  3RPP A;  5IG4 A;  4WWU C;  3GH9 A;  4MMZ B;  4R9L A;  2GSS A;  4OO4 A;  1PSQ A;  3CXC 2;  4ISD A;  1FGR A;  1XWG A;  2CX3 A;  5HFG A;  4R1K A;  3KKG A;  1HNA A;  2XPD A;  5COH A;  5EY6 A;  3DRN A;  4XBT A;  4X2O A;  2E2M A;  5D81 A;  1XXU A;  2ZCT A;  8GSS A;  2HSM A;  4O2H A;  2BT3 A;  2C4B A;  4HZB B;  1AR0 A;  1RNT A;  2JQ5 A;  3IC8 A;  4MZC A;  5EVH A;  4QL9 A;  4PUR A;  3RHB A;  4O7H A;  5ECO B;  3TUE A;  1U8C B;  3W8S A;  2PMT A;  2O8V B;  2REM A;  5J4U A;  4WYK B;  1UCK A;  4EKZ A;  1RNB A;  3FG3 A;  3F4R A;  3HVV A;  4HDE A;  2VL9 A;  2W56 B;  3LQ7 A;  4G9H A;  2F9S A;  4PEJ A;  5B6M A;  4NHF A;  3K9M C;  1GNE A;  3Q6O A;  2G2Q A;  1TRV A;  1KWI A;  3PR8 A;  2DKH A;  1KBN A;  5D9T A;  3KM6 A;  5CXO A;  3CSH A;  4HJL B;  3J7Y k;  6GSP A;  3T8U A;  4BVY A;  3LT8 A;  4NV2 A; 
#chains in the Genus database with same CATH homology
 1GSU A;  3GFK A;  3VK9 A;  3ME8 A;  1A0R P;  1TOF A;  4ML6 A;  4IEL A;  4KH7 A;  2L4Q A;  3Q74 A;  2X8C A;  1GTI A;  3VI7 A;  4IQA A;  3ZFB A;  1JHB A;  3DML A;  1M7T A;  2DBC A;  4L0W A;  1G0T A;  4FQU A;  1SJI A;  2UZ8 A;  2IFQ B;  20GS A;  2CZ3 A;  2M46 A;  1XW9 A;  1S3C A;  3F0I A;  3MSZ A;  1PX7 A;  4IJI A;  1LU4 A;  1R4W A;  3A2W A;  4GF0 A;  2H30 A;  4QQ7 A;  2RM6 A;  2IMK A;  3IBH A;  1J08 A;  4DVC A;  3I43 A;  1UN2 A;  2CAI A;  1ERV A;  3HJM A;  5G5F A;  2A2P A;  2CZ2 A;  3GUS A;  2VOC A;  2LUS A;  3TKR A;  3NIV A;  3WD6 A;  1BAY A;  4MJA A;  3WGX A;  3A2X A;  5DVB A;  1TDI A;  3C71 A;  1E6B A;  2CAQ A;  2FD3 A;  2KP2 A;  4KW6 A;  4PXO A;  1B4Q A;  4IN0 A;  3KTB A;  3ZML A;  4JE1 A;  4TR3 A;  1U87 A;  1R26 A;  2WCI A;  5JWQ B;  4TR0 A;  5F0G A;  3KMN A;  3L9V A;  2FWG A;  1YZX A;  1GSY A;  4KCA A;  4OCE A;  5F06 A;  1DE1 A;  5DCH A;  1ZYN A;  4MJB A;  3KP9 A;  3W8J A;  3KD0 A;  2B3S A;  2HLS A;  3O3T A;  1PRX A;  4HZ2 A;  2O87 A;  1XVW A;  4HJ2 A;  4Z7X A;  4EUY A;  1V40 A;  1FG4 A;  2MMA A;  3L0H A;  3DIE A;  3TCO A;  1K0M A;  1OAZ A;  1SD9 A;  4MCU A;  1KTE A;  1YF0 A;  1OE8 A;  3ZYW A;  2IFQ A;  2FWE A;  4O92 A;  2F51 A;  4OFN A;  2C80 A;  2AB6 A;  3QDN A;  4LMW A;  5CNW A;  2FNO A;  4LMV A;  2PWJ A;  4K7N A;  2JSY A;  3IRA A;  2X8H A;  2PU9 C;  3D5J A;  3GX8 A;  3ERG A;  3ZRE A;  2TRC P;  3GST A;  3IHG A;  5H5S A;  4FIW A;  3KJY A;  1QQ2 A;  2IY2 A;  1WRY A;  5ECR B;  5HR1 A;  2RUE A;  1FHE A;  1YQ1 A;  4P3Y B;  2WB9 A;  4USS A;  3I9V 2;  2DKI A;  1N2A A;  3KEB A;  1XOA A;  2R0G A;  1NHY A;  2VO4 A;  3TKS E;  4ZBD A;  3TRX A;  2CX4 A;  2X99 A;  4L0U A;  2Z9S A;  1QUW A;  4FYC A;  5AIS A;  2BTO T;  2CQ9 A;  2O7K A;  4TRX A;  4AGS A;  2B7J A;  1XIY A;  5LD0 A;  1K3O A;  4L5O A;  1TKD B;  1FVJ A;  4EE0 A;  2H74 A;  1K0D A;  2NDO A;  4JU5 A;  3IDV A;  2LJR A;  2VL3 A;  1Z9H A;  2OE3 A;  2JAD A;  3FR6 A;  1K0N A;  1EOH A;  2JAC A;  4WR5 A;  12GS A;  2NVL A;  4POK A;  1SYR A;  1PN9 A;  3QCP A;  1YY7 A;  4AJ6 A;  4G0I A;  2E0Q A;  4KSO A;  2JZR A;  5GSS A;  1M99 A;  1M2B A;  4K6X A;  2IMI A;  1XWC A;  3F6F A;  3H79 A;  3GA4 A;  1QK8 A;  4K0G A;  1G6W A;  5FT3 A;  3KZQ A;  5HR2 A;  2F8A A;  3APO A;  2VUP A;  5G1K A;  2GTU A;  2P31 A;  3DVW A;  1B8X A;  1G7E A;  3U6V A;  2HYX A;  3ZTL A;  1HYU A;  5EL8 A;  2WS2 A;  2JSZ A;  1OC9 A;  1X9S B;  4K2X A;  3FZA A;  2B1L A;  3ZL5 A;  2B5X A;  1XZO A;  3FK8 A;  5DJL A;  4FH8 A;  3C7M A;  1W4V A;  1ZL9 A;  3KMO A;  3CRU A;  2IIY A;  3GYK A;  4GRF A;  3IV4 A;  4JZQ A;  2GDR A;  2PPT A;  3FW2 A;  4TR1 B;  2H19 A;  1NHO A;  1X5E A;  2E7P A;  3ME7 A;  1YKA A;  1XWA A;  1ZYP A;  2PN8 A;  2VM2 A;  5ECK B;  5IMV A;  2HE3 A;  2YN1 A;  1FB0 A;  1K3L A;  4KND A;  2C3Q A;  5EPF A;  1A2J A;  3FHK A;  5AIV A;  1SL2 B;  2VIM A;  1SL1 B;  3EVI A;  4GXZ A;  4XIH A;  2YNX A;  1GLP A;  3A5W A;  2WRT A;  5KEJ A;  2H66 A;  1PQN A;  2VD0 A;  2YV7 A;  2YJH A;  5ID2 A;  3IK7 A;  2FLS A;  2R5G A;  4IKH A;  3APS A;  2NPB A;  1MTC A;  1EEJ A;  1O73 A;  3KTL A;  3ZFL A;  1V58 A;  1W89 A;  1XW5 A;  1PGT A;  4I8B A;  3GTU A;  2GZP A;  3M0F A;  2QKE A;  3E3E A;  3DVX A;  5IMF A;  1O85 A;  1SEN A;  5B7C A;  2A4H A;  2IMF A;  2JZS A;  2N5F A;  3QAG A;  1J9B A;  3CRT A;  4V2M A;  1OC3 A;  1CQG A;  3A5I A;  3FR9 A;  3BOA A;  4ZL7 A;  2LJK A;  5E4W A;  3EIN A;  4DSS B;  1FOH A;  4K1F A;  5ENU A;  2L6D A;  3IOS A;  3N9J A;  4I2T A;  1SK0 A;  4O32 A;  4V1A p;  2DJ3 A;  3TJG A;  4KX4 A;  4ZIL A;  2L59 A;  2MMO A;  4D73 A;  2WFC A;  1N8J A;  4I2U A;  2VCZ A;  1GUK A;  1JZW A;  4GSS A;  1SKR B;  3TB2 A;  2EIQ A;  1AXD A;  4N10 A;  4V2L A;  5INY A;  1JZO A;  3ERW A;  1HNC A;  1JLV A;  3R2Q A;  2LQQ A;  1EZK A;  1VF4 A;  2IYJ A;  4HZ4 A;  3MDK A;  4PX1 A;  4IBP A;  2YWN A;  3D21 A;  5F07 A;  2FA4 A;  4GWR A;  3UEM A;  3HJP A;  3GKM A;  4BL7 A;  2YWO A;  4JRR A;  2VAF A;  4ID0 A;  3LG6 A;  4IP6 A;  4G2E A;  3ZVJ A;  1K0C A;  4PUF C;  2C0G A;  5H5R A;  2PVQ A;  2MYG A;  3EU4 A;  2I4A A;  3IE3 A;  5HQP A;  1JZD A;  3EU3 A;  4MK3 A;  2GSR A;  3H1N A;  4JR4 A;  3VPT A;  3NZN A;  2TIR A;  1PL1 A;  1QMV A;  2MMZ A;  2FA8 A;  2H1B A;  4WR4 A;  5CRW A;  3O76 A;  4GQF A;  4TVE A;  4KUN A;  4ZL8 A;  1TI3 A;  3H8Q A;  1ACV A;  4GSN A;  1UA5 A;  3APQ A;  3LOR A;  4X1U A;  3SWL A;  2KOK A;  2H8L A;  3P90 A;  1YF1 A;  2E2G A;  2BMX A;  1OKT A;  3ZRD A;  17GS A;  3PH9 A;  3VFI A;  1A8Y A;  1RW1 A;  2RM5 A;  3QFA C;  11GS A;  2KP1 A;  2V41 A;  1BX9 A;  3C8E A;  3UIW A;  1DE2 A;  5G30 A;  4AJ7 A;  2R0C A;  4K5S A;  2C8U A;  1A2M A;  4E8E A;  2DIY A;  2B5Y A;  1UVZ A;  3GKN A;  3HHV A;  3TKQ A;  2H71 A;  10GS A;  1T1V A;  2L6C A;  1G6Y A;  5IQY A;  1V57 A;  2GSQ A;  1A24 A;  3TOT A;  1MEK A;  4TXO B;  4F9Z A;  2YOI A;  3TJB A;  1XVQ A;  5D96 A;  3VWX A;  4CY6 A;  2DJ2 A;  1EP7 A;  4GTU A;  4MJC A;  5IMC A;  5IMD A;  2IME A;  5KOW A;  3F4T A;  2WJU A;  4F82 A;  5D93 A;  2R2J A;  3EUR A;  4TR4 A;  4PTS A;  4IQ1 A;  4MZW A;  4Q5N A;  4KA0 A;  2LNT A;  4GQC A;  1JLW A;  4YKG A;  3F3R A;  4KCE A;  4J57 E;  1YEP A;  3VLN A;  1BED A;  2YWM A;  4RUV A;  3AY8 A;  1GUL A;  1FVK A;  4MH2 A;  5IPH A;  4WF5 A;  1O81 A;  3J7Y b;  4Z2T A;  1PKW A;  1NM3 A;  1O7U A;  2F3M A;  2FGX A;  1PKZ A;  2YPM A;  3UJ1 A;  2CVK A;  4NMU A;  3FZ4 A;  1TU8 A;  3C1R A;  3UL3 A;  2VD1 A;  4PNF A;  4HU7 A;  3K8N A;  5DQY A;  1U6T A;  2H75 A;  2KHP A;  1T8E B;  2X49 A;  3WGD A;  2LST A;  1GTB A;  5CAX A;  1Z7P A;  5AN1 A;  2YV9 A;  1O6J A;  3F63 A;  3CMI A;  2HI7 A;  4TXO A;  4IHU A;  1OKD A;  2K9F A;  4POL A;  5IPG A;  5JWO B;  1EOG A;  3L4N A;  2MBT A;  3FZ5 A;  3U5R E;  9GSS A;  5ECL B;  2NBS A;  5HFK A;  1WIK A;  5HR3 A;  4FO5 A;  3CSI A;  3DKS A;  2DJK A;  3KH9 A;  1S3A A;  19GS A;  3O6T A;  5A4U A;  1IYI A;  1U3A A;  3QOU A;  4XCS A;  2B6M A;  1GP1 A;  3NOF A;  5D9X A;  2O85 A;  2I3Y A;  1FO5 A;  4K7I A;  3ERF A;  4LL1 B;  1FW1 A;  2N5B A;  3I69 A;  2MZC A;  2GQK A;  3P8W A;  1Z5Y E;  4N30 A;  4ZB6 A;  4V2N A;  1TRW A;  5B8B A;  4IS0 A;  1GUM A;  3US3 A;  5BMU A;  2R37 A;  1ZOF A;  3WYW A;  4NXI A;  2V1M A;  3ZMK A;  1GSS A;  2OKA A;  1M9B A;  2P5Q A;  2AJQ B;  2OA7 A;  1OC9 B;  1H4O A;  4CHS A;  3HJO A;  4MF5 A;  3HXS A;  2GS3 A;  3LEF A;  4K9Z A;  3GHA A;  4BA7 A;  1GH2 A;  3EC3 A;  4LL4 B;  4KDU A;  2IJY A;  2VL2 C;  3PPU A;  3HDC A;  4RI6 A;  5C04 A;  4BVX A;  2GQL A;  4TOP A;  3HZ4 A;  4WKW A;  3UOM A;  1QXH A;  3MNG A;  4RQR A;  4YQV A;  2ALB A;  4GST A;  5CP1 A;  4XS4 A;  3QAW A;  2DML A;  3BCK A;  18GS A;  3F8U A;  2A2S A;  2IWT A;  4I5Q A;  1R7H A;  4A5P A;  1WJK A;  4YQM A;  3FMW A;  2V32 A;  1TK8 B;  5ID2 B;  4NHZ A;  2XHF A;  4NPB A;  4I97 A;  1ML6 A;  2J9H A;  1M0U A;  3VWU A;  5IM9 A;  1ZZY A;  1XWK A;  1GSF A;  5F05 A;  4WEY A;  1TI1 A;  5J9B A;  4HEA 2;  1T7P B;  2YCD A;  1XW6 A;  2LRC A;  4WBR D;  1KEB A;  1ERU A;  1AQV A;  3GTU B;  5KOX A;  2DJ1 A;  1LBK A;  1K0A A;  3IHQ A;  3KGK A;  2HZE B;  3IC4 A;  1F37 A;  4MP4 A;  4PQH A;  2XBI A;  5DAK B;  4K5R A;  4QL7 A;  1Q98 A;  5D8I A;  14GS A;  16GS A;  2QSI A;  5CRG A;  4POB A;  4OFM A;  3EPT A;  4PUA A;  2H1A A;  2I9H A;  4ZIJ A;  1TTZ A;  4FYB A;  2K18 A;  1BQ7 A;  1GTU A;  2X64 A;  5KN1 A;  2JZT A;  2DLX A;  4D73 B;  1QFN A;  4ZB8 A;  4K0N A;  2DJ0 A;  3GMF A;  2K6V A;  1Z6N A;  2QA1 A;  3KCM A;  1TU7 A;  4EIP A;  5FHI A;  3RPN A;  2HXK A;  2TRX A;  3RDW A;  1ERW A;  1F9M A;  5IIZ A;  2H76 A;  3EYT A;  1MD3 A;  3FEU A;  3N5O A;  3GNJ A;  5LNK e;  2WUL A;  6GSY A;  4MF6 A;  1J0F A;  4AJ8 A;  1K3Y A;  4JR6 A;  3DD3 A;  2DIZ A;  6GSS A;  4NAX A;  4XS1 A;  5JCW A;  4Q5Q A;  4BL7 B;  4DSQ A;  2CT6 A;  4WET A;  5JWR B;  1EV4 A;  5ECI B;  3Q18 A;  4XS6 A;  4KAE A;  4HQZ A;  4Q5F A;  1DBY A;  3TDG A;  3LYP A;  2P0G A;  3HCZ A;  4F2I A;  1RQM A;  1GTA A;  5IOX A;  3FR3 A;  2HZE A;  2H70 A;  5E59 A;  1A8L A;  2HSH A;  5DAK A;  4YQU A;  4KSM A;  1HQO A;  1GLQ A;  3GRX A;  2CA8 A;  4ULX A;  4LA1 A;  1PMT A;  2OAD A;  1B9Y C;  1VF3 A;  3LW9 A;  4N11 A;  3ZVJ D;  3GSS A;  5D9V A;  4PNG A;  5KN2 A;  1EV9 A;  1R5P A;  2B1K A;  4PQI A;  1KNG A;  3F9U A;  1G7O A;  4EO3 A;  2GVP A;  4Q5R A;  1JZR A;  2QA2 A;  3E9J B;  2H6X A;  2KUC A;  3MIX A;  3ZZX A;  4ZL9 A;  2GZZ A;  3L78 A;  3ZIV A;  2PER A;  4F0B A;  2L4C A;  5ELG A;  1WOU A;  5CRE A;  2P5R A;  1HD2 A;  4MH3 A;  5KN3 A;  1XBS A;  5L71 A;  1Q4J A;  3GL3 A;  2YAN A;  5BRT A;  3G7Y A;  1X5C A;  3GKK A;  5CRD A;  6GSW A;  1FAA A;  4PQ1 A;  1A23 A;  1JFU A;  2LRN A;  1O8X A;  5IO2 A;  4JED A;  2H73 A;  1I9D A;  2GT6 A;  3CXG A;  4HQS A;  3WT1 A;  5ELA A;  2K8V A;  2J23 A;  1AAZ A;  1H75 A;  4G19 A;  4OWY A;  5KN0 A;  3GKX A;  3IK9 A;  3HYP A;  3OR5 A;  2OBK A;  3UBL A;  22GS A;  2YWI A;  3H93 A;  4EC0 A;  2C0E A;  1M2A A;  3C1S A;  1GSD A;  2EC4 A;  1A2L A;  4HU9 A;  1TXX A;  3TRQ A;  2IMD A;  1F2E A;  4JBB A;  1ZYQ B;  5C00 A;  3ZIT A;  5ECH B;  4J56 E;  3HVX A;  3GL5 A;  1AIU A;  2X8G A;  4OO5 A;  3LJR A;  1TK5 B;  4WBJ A;  2RII A;  3G9B A;  1V9W A;  1GWC A;  5A4W A;  2AAW A;  1U3I A;  3QPM A;  4TW5 A;  3UBK A;  2V6K A;  1XOB A;  1TRU A;  2XPE A;  1A0F A;  2FWF A;  1VF2 A;  3LYK A;  4KDY A;  2GQM A;  4IVF A;  1X5D A;  1Z6M A;  3MYD A;  3SBC A;  1ZCP A;  4BWS A;  2RUF A;  4TKY A;  2DMM A;  3A3T A;  5B8A A;  3DYR A;  2ES7 A;  2PVO C;  2C0F A;  3HZ8 A;  4ML1 A;  2C3N A;  2AUV A;  3KH7 A;  4N0V A;  3H4K A;  4L5L A;  2LEG A;  3M1G A;  4K7O A;  5ECP B;  1MD4 A;  2I81 A;  3TOU A;  3HA9 A;  2EIO A;  6GSX A;  1EEM A;  1F3A A;  5DAL A;  3GV1 A;  4ECJ A;  2WZ9 A;  4ZBB A;  3QD9 A;  2OBI A;  4CY8 A;  4Z2R A;  5JCG A;  3CSJ A;  4FYU A;  4YAV A;  1F3B A;  2WGR A;  2VCX A;  4KB3 A;  1AUC A;  1USB A;  2FHE A;  1TP9 A;  5A5K A;  3FZ9 A;  2GST A;  2OE0 A;  4RQX A;  4F0C A;  2XC2 A;  3PGT A;  1PD2 1;  3GN3 A;  3FYG A;  3ISO A;  5G1L A;  2GLR A;  4MAB A;  5ECN B;  3G7I A;  1YDK A;  4G0K A;  2K8S A;  2L5L A;  3FKF A;  1WP0 A;  1IYH A;  1QGV A;  2ZNM A;  3CBU A;  3DEX A;  3LGC A;  3RBT A;  5FWG A;  1SU9 A;  1SJ6 A;  4ZBA A;  3UVH A;  2IPA A;  1TW9 A;  3LSZ A;  2FCH A;  3TJF A;  3MAK A;  3GUR A;  2HRF A;  2LS5 A;  2D2Z A;  4MDC A;  1URM A;  3BJ5 A;  1E2Y A;  4OCF A;  5HFI A;  2B5E A;  2R4V A;  1EGO A;  1VF1 A;  4K8M A;  2HRN A;  4KE3 A;  2VLU A;  3UVT A;  2H6Z A;  3IR4 A;  4ECB A;  4BVX B;  5CRH A;  2HT9 A;  1YEX A;  4XHM A;  4RI7 A;  2OAC A;  2MBS A;  5G31 A;  3LXZ A;  4YH2 A;  4XS4 B;  5EVO A;  2FY6 A;  4X0X A;  1YJ6 A;  2IN3 A;  1M2D A;  3BCI A;  1OC8 A;  2JU5 A;  3TKS C;  5LCZ A;  3HD5 A;  4MPF A;  4NV5 A;  2AV4 A;  4CDO A;  2R0P A;  4ECC A;  3LWA A;  3L9S A;  5G5E A;  3D4M A;  1VRS D;  2ON7 A;  2YZH A;  1GSE A;  5DCG A;  6GSU A;  5GST A;  2QGV A;  4HJM A;  4ECI A;  1X9M B;  2VCW A;  1XCC A;  1V98 A;  4AF2 A;  1EGR A;  4Z2U A;  3QAV A;  2HNL A;  2VLT A;  3P7X A;  1HNB A;  1OYJ A;  4WF4 A;  4H86 A;  4X43 A;  2VCQ A;  3D0Z A;  2H01 A;  2HSY A;  2X4A A;  1ABA A;  4X4J A;  3EMP A;  5IOW A;  1T00 A;  1SJZ A;  4ZXG A;  3EWL A;  3FRC A;  1AW9 A;  2H1G A;  4KF9 A;  3M9J A;  2FWH A;  3UAP A;  1GNW A;  3D22 A;  4I6X A;  4G0L A;  2OJL A;  2FUG 2;  2WDU A;  4ICY A;  3V1W A;  1SYX A;  1Z3E A;  2VM1 A;  2NTO A;  2GT5 A;  1OVN A;  5ECQ B;  1PN0 A;  1GSQ A;  3D6I A;  4MLY A;  3TKS A;  3D4T A;  5A4V A;  3ED3 A;  3EE2 A;  1T4Z A;  3DGQ A;  3QR6 A;  2LRT A;  1EP8 A;  2XBQ A;  4EIQ A;  1ZYE A;  2VCV A;  1Z7R A;  3M3M A;  2VLV A;  5DJM A;  4XTS A;  4V1A g;  4MMM A;  1X9W B;  2ZUP A;  2LQO A;  1SD8 A;  4N0Z A;  2AYT A;  2O89 A;  3VUR A;  3E0U A;  5J41 A;  3KXO A;  2L57 A;  4G10 A;  5DQS A;  3W6G A;  5CO3 A;  5IO0 A;  1AQX A;  2CVB A;  3WGE A;  3M9K A;  5F8B A;  1TRS A;  1LJR A;  4MPG A;  4TXV A;  1ILO A;  1RK4 A;  1M9A A;  3VWV A;  3KP8 A;  3CYN A;  5HR0 A;  4IJ3 A;  2V6O A;  5GAN D;  4YAP A;  3QFB C;  3HY2 A;  4EDZ A;  4XRD A;  2R3X A;  2RLI A;  5ECM B;  3JCM L;  1BJX A;  1BG5 A;  4MF7 A;  2H0G A;  3GH6 A;  1FB6 A;  4TN8 A;  2VL2 A;  4OD7 A;  2A4V A;  4LLR A;  4GCI A;  1THO A;  1SKW B;  2F8F A;  1XWB A;  2CVD A;  1O8W A;  5D9W A;  2HFD A;  4J2F A;  3Q19 A;  1THX A;  1DUG A;  1XFL A;  3RHC A;  2H6Y A;  3PIN A;  1K0B A;  5IMA A;  3GIX A;  5D73 A;  1MDJ A;  4EDY A;  5DDL A;  3TJJ A;  5G2Z A;  1UC7 A;  3I6A A;  3R3E A;  4EXJ A;  6GST A;  3KIJ A;  4MNN A;  3WT2 A;  3VI5 A;  5J3R A;  2JL4 A;  4NHW A;  1AC1 A;  6GSV A;  3CTF A;  2DSA A;  4KGI A;  2H0I A;  2C4J A;  2B7K A;  4IW9 A;  2G0F A;  1ST9 A;  4OMV A;  1WWJ A;  3IXR A;  2KLX A;  3ZLP A;  5J9C A;  3VWW A;  1GL8 A;  4ILF A;  4XRA A;  2A2R A;  2MMN A;  4HOJ A;  3UAR A;  5JCU A;  1TK0 B;  2I1U A;  1DSB A;  1EWX A;  1S3D A;  4CW9 A;  5GZZ B;  3A2V A;  5H5Q A;  3G7J A;  4O5U A;  3BD2 A;  2L5O A;  1MDK A;  2OE1 A;  1WMJ A;  4ZB9 A;  1FOV A;  3L9U A;  1X0R A;  2YJ7 A;  2AHE A;  1AQW A;  2V2G A;  2GGT A;  5ECS A;  5ABR A;  1I5G A;  4HS1 A;  1OE7 A;  4YKF A;  2LKU A;  4K2D A;  3LXT A;  1B48 A;  4BWQ A;  2LJA A;  2PGT A;  1CQH A;  2GZY A;  2YP6 A;  2C0D A;  1GRX A;  1SL0 B;  5CYY A;  3EMX A;  3RAZ A;  3S9F A;  1PX6 A;  2EIR A;  5AGY A;  2H1D A;  4DEJ A;  2DJJ A;  4POM A;  1T4Y A;  1ON4 A;  5J5N A;  1F6M C;  4BPY A;  4HI7 A;  5AIX A;  3HKR A;  4GLT A;  1V2A A;  1PL2 A;  2BJX A;  1ZGN A;  13GS A;  3GX0 A;  4TR1 A;  1Y6E A;  2H0H A;  1Y25 A;  3HVS A;  1GUH A;  5B6N A;  3IAS 2;  3ZIJ A;  1B4P A;  4KDX A;  3IAM 2;  4DSR A;  3M8N A;  2C1Y A;  2PBJ A;  3IA1 A;  2N5A A;  3DXB A;  1NSW A;  3P2A A;  3BBY A;  1YKC A;  3VPQ A;  4OFT A;  2HZF A;  4EVM A;  2CV4 A;  1WE0 A;  2IL3 A;  4F03 A;  4WXT A;  3F3Q A;  1C72 A;  1WPI A;  4EL1 A;  5DAL B;  7GSS A;  4NWY A;  4L8E A;  1NW2 A;  4MJE A;  5GAP D;  2LTK A;  1SK2 A;  2LV3 A;  3CTG A;  3TJK A;  4MZB A;  1SKS B;  2C3T A;  3MWH A;  1K0O A;  1ZMA A;  1B9X C;  1T3B A;  3TRP A;  3LFL A;  2H72 A;  1ERT A;  4E8H A;  3F6D A;  4ACS A;  3QMX A;  4BVY B;  2ON5 A;  3C73 A;  3TGZ A;  4IGJ A;  1BYE A;  1TJD A;  2DC5 A;  2HRA A;  2PUK C;  1MDI A;  2LNS A;  2M72 A;  1VGL A;  1PA3 A;  3TKP A;  1SK1 A;  4DSS A;  4O5R A;  5IMZ A;  2R6K A;  1XPV A;  4O5Q A;  2VCT A;  2YZU A;  1R5A A;  3F4S A;  4IP1 A;  5DBQ A;  4HUA A;  4MA9 A;  4EF0 A;  3FY7 A;  2M80 A;  3IPZ A;  3UMA A;  1U88 A;  3DWV A;  2HRK A;  2QC7 A;  4PGT A;  3RPP A;  3GH9 A;  2GSS A;  4OO4 A;  1PSQ A;  4ISD A;  1XWG A;  2CX3 A;  5HFG A;  1HNA A;  2XPD A;  5COH A;  5EY6 A;  3DRN A;  2E2M A;  1XXU A;  2ZCT A;  8GSS A;  2HSM A;  3IC8 A;  4MZC A;  4QL9 A;  4PUR A;  3RHB A;  4O7H A;  5ECO B;  3TUE A;  3W8S A;  2PMT A;  2O8V B;  2REM A;  5J4U A;  4EKZ A;  3F4R A;  3HVV A;  4HDE A;  2VL9 A;  3LQ7 A;  4G9H A;  2F9S A;  5B6M A;  1GNE A;  3Q6O A;  2G2Q A;  1TRV A;  3PR8 A;  2DKH A;  1KBN A;  5D9T A;  3KM6 A;  3CSH A;  3J7Y k;  4BVY A;  4NV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...