1JZOA

Dsbc c101s
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN DSBC
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal Structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 67
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzoA02
1J9BA 1E2YA 2H6ZA 4KX4A 4MLYA 1ZOFA 1DE1A 2CT6A 4TKYA 1A8LA 4JZQA 3UOMA 1A0FA 3DIEA 1W4VA 5KN0A 2BMXA 4HJ2A 1URMA 1SKSB 5DBQA 1K0CA 5JWRB 1WRYA 5CP1A 1PKWA 1VGLA 3WT1A 3CRTA 9GSSA 4LMWA 3GKXA 3TKSC 3EMPA 4ECBA 2GSRA 3WT2A 2K8SA 4JEDA 3UARA 1NM3A 4NV2A 2WRTA 1XW6A 2G0FA 4DVCA 3HZ8A 3LG6A 1YF1A 3DRNA 3FK8A 4HQZA 5IMVA 1EV4A 5ECHB 3KTBA 1SL1B 22GSA 3C73A 2X8CA 4TXVA 1IYIA 5JWOB 1B48A 5HR3A 1GTAA 1VRSD 3A2WA 2GQKA 1EEJA 2B1KA 2C3QA 5HFKA 2TRXA 1OC9A 3WD6A 4IP1A 3KH9A 1XWGA 1XWKA 4AJ8A 2C0FA 3TKSA 3L9UA 2LNSA 4WXTA 3M0FA 5ECPB 5ECQB 5FWGA 4TR3A 4YAVA 2IMDA 4IBPA 5DJMA 3TB2A 4FYBA 5G1KA 2WGRA 1WP0A 2LTKA 1PQNA 5CO3A 5E4WA 3HJMA 5D96A 3OR5A 3ZIJA 3QMXA 1XVWA 5ECMB 5J41A 3I6AA 3F4SA 2L6DA 5HFIA 2ON5A 2MBSA 3KXOA 4TXOB 1QGVA 3ZIVA 2B5EA 1NSWA 2IWTA 5FT3A 4MP4A 1EGOA 5A5KA 3UBLA 3J7Yk 1GSQA 4HU9A 4RQXA 2P31A 4MF6A 5ECNB 4IP6A 1C72A 4NHZA 1WE0A 1GNEA 5IMCA 3HA9A 4HZ2A 2Z9SA 2HE3A 2LKUA 3LSZA 2V32A 4HDEA 4ISDA 1YKCA 4I2TA 2H73A 1K3YA 2IIYA 4HU7A 3ZFLA 4YQMA 4OFTA 3VI5A 3ZMLA 1HD2A 5DQYA 1F3BA 2GLRA 4OMVA 1WJKA 4KSMA 7GSSA 3AY8A 4GSTA 1EEMA 3I43A 4ILFA 2R2JA 5KN1A 4MZBA 2WULA 4Q5RA 4J57E 4BL7A 3RHBA 1N2AA 3TKQA 3FZ5A 2MZCA 4I5QA 5ELGA 1GSYA 4G9HA 3A5WA 3MDKA 3C71A 3HVVA 1FVKA 4OWYA 4I97A 3IAM2 1ZL9A 4NV5A 2H1BA 5JCGA 5CNWA 2HI7A 3U6VA 3EWLA 2IY2A 2E7PA 4Q5FA 1JZOA 1SJIA 1T4YA 5EVOA 3DEXA 1M9BA 2PVQA 4J2FA 2OA7A 2O8VB 2LEGA 1ERVA 2B5XA 2VLTA 1TJDA 2PUKC 1ML6A 2WB9A 3FR9A 4F0BA 4ZL9A 4KDUA 3US3A 4X0XA 5IPGA 1ST9A 2OJLA 1GTUA 4HQSA 2LRTA 4XRDA 4TR4A 5ECLB 1SKWB 3GX8A 2LJKA 1TTZA 1O7UA 3CTFA 3KCMA 4F03A 4K1FA 5ID2B 3W8SA 2YWIA 2HNLA 2GSQA 2DJ1A 5GSTA 4BWQA 4D73B 1PKZA 2B6MA 3LJRA 1DE2A 2K18A 2CX3A 1R26A 1V9WA 3ISOA 2RIIA 2NDOA 1IYHA 1KTEA 1USBA 3F3RA 1X9SB 2A2SA 2HSHA 3JCML 1SENA 1DUGA 1YEPA 3LWAA 3DXBA 2CX4A 2IMEA 3ZITA 3U5RE 1AAZA 4HJMA 5IOWA 5COHA 1AIUA 2I3YA 2VLVA 2AUVA 2OKAA 5AIVA 4TXOA 1A8YA 4BPYA 3UVHA 4N11A 2NBSA 3FW2A 4KGIA 3K8NA 4ZBAA 2DMMA 4G19A 1K0NA 1AQXA 1ACVA 2V6KA 1M0UA 1SJ6A 4NXIA 2I81A 2GVPA 5IQYA 1GSFA 1JLVA 4EXJA 3F4TA 2V41A 1BQ7A 2LNTA 1OYJA 2YZHA 1SD9A 3CSJA 3O3TA 1H4OA 3HJOA 2OE1A 3KMNA 2AJQB 3MSZA 1OKDA 2P5QA 4XCSA 5C00A 2OBIA 1PD21 2NVLA 2O7KA 2VOCA 4MA9A 6GSVA 2X64A 4NPBA 3DKSA 2M80A 4Q5QA 4GSSA 3ME8A 5ABRA 1WOUA 4H86A 1AW9A 2YOIA 4GTUA 3GKNA 2ZUPA 1EZKA 2K6VA 2DJ2A 4ULXA 3GX0A 3F6DA 1UC7A 2PBJA 3UL3A 2DMLA 2CAQA 5CRDA 1HNCA 5D9VA 1GUHA 1WMJA 2OBKA 2PMTA 1OKTA 3VPQA 1TK5B 4MJCA 2E0QA 2ZNMA 2GT6A 1EP8A 4PGTA 4TOPA 1HQOA 4ZBDA 2FWEA 4ML1A 4POBA 1B9XC 3DVWA 3FR3A 1VF1A 4JR4A 1WIKA 4WR5A 1TRVA 4EO3A 1Z7RA 2LS5A 2JZTA 1SJZA 2LUSA 1R5AA 1U6TA 1M2AA 2P0GA 3CSIA 4WEYA 1O8WA 4GXZA 4GQFA 1X5CA 1XW5A 2VCVA 3IA1A 3GH6A 1U3IA 2KUCA 3IBHA 4XS4B 1TKDB 2R5GA 3CBUA 1T8EB 2BJXA 3IRAA 3O6TA 3ZRDA 2PPTA 5DDLA 3KIJA 2VUPA 5CRHA 2L4CA 2FWGA 3GIXA 3SWLA 5GSSA 4OO5A 5DCGA 3Q18A 3C1RA 3LQ7A 2ON7A 4F82A 6GSTA 4KCAA 2PU9C 2K8VA 3LXZA 2YPMA 1O6JA 4DSQA 2DLXA 2H01A 2H0GA 3L0HA 4WBRD 3VLNA 11GSA 2RLIA 3CYNA 4WF5A 1H75A 4MZWA 1K0AA 2AV4A 1A24A 3ME7A 5IO2A 2GTUA 3UIWA 1XBSA 4NAXA 4MABA 2H66A 4POKA 4E8EA 1FO5A 1O8XA 4G2EA 3UMAA 2IL3A 2TRCP 2WZ9A 3J7Yb 2H76A 5GAPD 1HNAA 5IMFA 4MMMA 2B7JA 2YWOA 5J4UA 2H8LA 4L0UA 3NIVA 4N0VA 3EVIA 2CVBA 4GLTA 1GLPA 3QFBC 5HR0A 1T7PB 1O73A 5DALA 1EP7A 2HXKA 2PN8A 1BAYA 4L0WA 3KGKA 4EUYA 1QUWA 2A2RA 3W8JA 1SL2B 1FB0A 4WR4A 3CMIA 3BBYA 3VWVA 3C1SA 2PERA 3A3TA 3TRPA 1OAZA 3H1NA 2JSZA 2AAWA 5JCUA 1AQWA 3GKKA 1U3AA 4EC0A 3N9JA 2KHPA 1TU7A 2DJ3A 5D9WA 2CVDA 3GFKA 5DAKA 2XHFA 2DJJA 2LRCA 3F63A 2YJ7A 1M2BA 2IFQB 3IR4A 2JACA 3D22A 1FB6A 3ZFBA 4ACSA 3VWWA 2GDRA 4KH7A 4K6XA 2TIRA 4X1UA 1RK4A 4I2UA 4X43A 4KSOA 1ABAA 5CRGA 1MDKA 4L8EA 1R7HA 4EKZA 3GL3A 1V58A 5EL8A 3LEFA 2HT9A 1S3DA 2M72A 3KMOA 2FY6A 1EV9A 5A4UA 5KEJA 4Q5NA 3TKRA 2CZ3A 2MMOA 1ZMAA 1AC1A 5H5QA 2YANA 2PVOC 3TJKA 1GLQA 2C0GA 1TRSA 1PL1A 5HR2A 4TR1B 2F8FA 3HXSA 5LD0A 4MH2A 2JSYA 3QD9A 4BWSA 3A2XA 5L71A 2CVKA 2FWFA 2GS3A 2DC5A 5EPFA 1XIYA 1A2MA 4XRAA 1DBYA 3GURA 4DSSA 2JZRA 1VF4A 2KP1A 5F07A 2VIMA 2AB6A 1S3CA 1Z6NA 1OVNA 2KP2A 3LYKA 3QAWA 3G7IA 5ECSA 4JRRA 4V1Ap 4BA7A 1OE8A 3L78A 3IAS2 2LRNA 1GTIA 3IK7A 2IYJA 1M7TA 5CRWA 5ELAA 1QFNA 4AJ6A 3TJBA 2L6CA 2VD0A 4O32A 1NHOA 2CQ9A 3LXTA 2IN3A 3NOFA 4FIWA 4TRXA 2K9FA 2JZSA 3VWUA 1W89A 4XIHA 2N5AA 5GAND 4J56E 2H30A 3HVSA 3ZYWA 4QQ7A 1UA5A 3CSHA 3E0UA 6GSYA 3D5JA 3RDWA 4LL4B 1MDIA 3APQA 2LQOA 3HVXA 2IMFA 1ZZYA 5F0GA 1B4PA 3HKRA 5CAXA 4WKWA 2XPDA 4K9ZA 4IW9A 2FD3A 4MK3A 2H0HA 5IPHA 1ILOA 1PX7A 5IMZA 3UAPA 2L57A 2GZPA 1VF3A 3KZQA 2I1UA 1SU9A 2F51A 1JLWA 5D73A 3VPTA 8GSSA 2GZYA 4ZB6A 4O92A 1K0OA 3O76A 4JBBA 1J08A 1GSEA 2DSAA 4KE3A 4BVXA 5AISA 3WGEA 4LLRA 3WYWA 1B9YC 1JFUA 2JU5A 3HDCA 5DCHA 2GZZA 1EGRA 3DMLA 1XWCA 1A2LA 5ECKB 3EU3A 4HOJA 4WF4A 2GSTA 2HRNA 4IGJA 1Z7PA 2M46A 1KEBA 1G7OA 2C4JA 4QL9A 2H1DA 1JZWA 2QKEA 3E9JB 5EY6A 2OE3A 1UN2A 3QAVA 1JHBA 1LJRA 4MF7A 2L59A 5HFGA 1TW9A 1GTBA 3LYPA 2E2GA 3C8EA 4JU5A 1YJ6A 1TK0B 5B6MA 3L4NA 1DSBA 2HZEB 3ERWA 3QAGA 5H5RA 3F6FA 2L5LA 5INYA 3KTLA 2FNOA 5IO0A 3RHCA 1SYRA 1TRUA 3ZTLA 3I9V2 13GSA 1GUKA 1JZDA 4V2MA 3UBKA 2JL4A 3D21A 4RI6A 1XCCA 2B7KA 1BX9A 5J9CA 4K7OA 5D9XA 1LU4A 5IIZA 3APSA 3F4RA 1I5GA 4YAPA 1VF2A 2FCHA 5D9TA 3E3EA 5JCWA 2X99A 3FY7A 3M9JA 1B4QA 1YZXA 4IJ3A 2DJ0A 3R2QA 4PQHA 2C3TA 3FEUA 1F9MA 4L5OA 4RQRA 2EIOA 1M9AA 3DVXA 1ZGNA 2EIRA 2YZUA 1SKRB 1Y25A 1O81A 1B8XA 2C3NA 2H6YA 2R37A 3GRXA 1V40A 3GTUB 1FW1A 4OO4A 4IJIA 1U88A 20GSA 3ZREA 1X0RA 2RUFA 3LORA 2J23A 2GGTA 4ZB8A 4IN0A 3IOSA 3HYPA 4XS6A 4MPFA 3ED3A 3V1WA 5ECRB 4ZL8A 5IOXA 4PXOA 3GSSA 2YP6A 4O5RA 2VCXA 4EDZA 5B7CA 1MTCA 3GH9A 5ID2A 2H75A 2LJRA 1XFLA 2DIZA 1OC9B 2RM6A 4D73A 2O85A 1WWJA 3TJFA 3UJ1A 2FA8A 5C04A 2OADA 1GL8A 3TOUA 3S9FA 3M1GA 1BYEA 5H5SA 2LSTA 1XZOA 3I69A 2EIQA 4P3YB 4FO5A 4K0GA 4RUVA 2KLXA 2KOKA 5IM9A 3IK9A 2PGTA 3GKMA 1MD4A 4ECIA 1SYXA 5HQPA 3FR6A 2F8AA 5A4VA 4AGSA 3H4KA 3DWVA 3HJPA 10GSA 4KW6A 3G9BA 2MMZA 4YH2A 3EINA 3TJGA 1XW9A 3KD0A 4OFMA 1LBKA 1PL2A 1Z6MA 1N8JA 1V2AA 3L9SA 2H1AA 5E59A 1GRXA 2GSSA 2CAIA 4WBJA 1SD8A 2A4VA 4LMVA 1FHEA 2VCTA 1K3OA 2GQMA 3VURA 2H72A 2QGVA 2H6XA 1PGTA 2CV4A 2WCIA 3BD2A 4GQCA 1XOAA 1GSSA 1GH2A 2VD1A 4I8BA 1Z3EA 3DD3A 4ZBBA 3M9KA 3KP8A 3APOA 4HI7A 3FRCA 1ERUA 1T3BA 1G6YA 1T4ZA 3HZ4A 3UVTA 3WGXA 1AQVA 4MZCA 2FHEA 3BCKA 3TJJA 2DIYA 2G2QA 4NWYA 2HZFA 2HYXA 3HY2A 4KB3A 3H79A 2YV7A 4Z7XA 3D4MA 1TI3A 4IQ1A 4DSRA 1G7EA 1V98A 3BOAA 4GSNA 4MJBA 4HUAA 1QXHA 2YWMA 3FYGA 2VM1A 1GULA 1R5PA 3F0IA 5J9BA 2FGXA 1CQHA 3WGDA 2IMKA 4K7NA 2LJAA 4MPGA 5J5NA 2YCDA 3IPZA 5DVBA 1X9MB 3GTUA 3ERGA 3KJYA 4MF5A 4OCFA 3RBTA 4G10A 4MCUA 1Z5YE 3D6IA 4PURA 4ECCA 5A4WA 4WETA 3GYKA 2LV3A 4NHWA 1ZCPA 2NTOA 1O85A 2I4AA 1X5EA 2WFCA 5IMDA 3IE3A 2VAFA 4NMUA 3CTGA 2B1LA 1QMVA 1KNGA 2N5BA 2LQQA 4KDYA 4PX1A 6GSWA 1GNWA 2I9HA 3TKPA 4HS1A 4GCIA 1PMTA 3GV1A 2EC4A 2C8UA 2X8GA 3EYTA 1SK2A 4KUNA 4YQUA 1SK1A 5CYYA 1NHYA 4XS4A 3QCPA 6GSXA 4POMA 2B5YA 3KEBA 1G6WA 4L5LA 3ZMKA 4TW5A 4IS0A 4KCEA 2XBIA 3EC3A 2F9SA 3H8QA 4K0NA 5AGYA 4V1Ag 12GSA 5B8BA 4LL1B 4PNGA 2IPAA 4PQIA 4EVMA 5G5FA 4KDXA 3M8NA 3Q74A 3QDNA 5IMAA 1HNBA 5DJLA 3CXGA 4OFNA 1GUMA 1YQ1A 4BVYA 2C1YA 3G7YA 1BG5A 3GL5A 3VWXA 3ZL5A 5D93A 2VCQA 2H74A 5B8AA 4EE0A 1GSDA 3A2VA 1M2DA 1NW2A 4MH3A 3D4TA 1OC3A 4KNDA 2REMA 1UVZA 1F2EA 1S3AA 1GSUA 2B3SA 5LCZA 4ID0A 2CZ2A 2H70A 3P90A 4POLA 5KN2A 1Q4JA 1AXDA 2DJKA 1YY7A 3KP9A 1OE7A 2VLUA 3IDVA 1WPIA 3EMXA 1A23A 3QPMA 5ENUA 1E6BA 2MBTA 5G1LA 3LFLA 2O89A 5D8IA 3M3MA 3HHVA 4PUAA 1K3LA 1TOFA 1FG4A 3H93A 5AIXA 3FKFA 5G31A 4ZIJA 2P5RA 6GSSA 1TK8B 5G2ZA 2QC7A 2CA8A 2MMAA 3VI7A 3ERFA 2ZCTA 3F3QA 5J3RA 5LNKe 3GN3A 16GSA 3GHAA 1QQ2A 4OD7A 1PA3A 1MEKA 1Y6EA 4TN8A 3BCIA 3F8UA 4KAEA 4RI7A 1THOA 2OACA 2E2MA 3FZ9A 3TKSE 1PX6A 4EF0A 1QK8A 3NZNA 2RM5A 3TCOA 3RPPA 6GSUA 2J9HA 4YQVA 4XTSA 3FZ4A 2IFQA 2C0DA 5G30A 3TUEA 1SK0A 1F37A 1U87A 3D0ZA 1TP9A 1J0FA 2HFDA 3GNJA 1XWBA 1EOHA 3DGQA 5F05A 5B6NA 3RPNA 1R4WA 3RAZA 4ML6A 3ZVJA 4TR0A 1EWXA 2IMIA 3G7JA 2L4QA 4IVFA 2OE0A 3GSTA 2PWJA 3TRXA 4LA1A 1V57A 1F3AA 3GA4A 3IC4A 5AN1A 4IQAA 1GWCA 2QSIA 1X9WB 2WS2A 3LGCA 4GWRA 1KBNA 4MDCA 3GMFA 4EDYA 4F9ZA 5KN3A 3IV4A 1A2JA 3C7MA 4IKHA 1HYUA 1FAAA 4TR1A 2IJYA 1F6MC 1FVJA 4PUFC 4DEJA 1ZYQB 3TGZA 4F0CA 4JE1A 1K0DA 4GF0A 2VO4A 1GP1A 3KM6A 3Q6OA 3P8WA 2YV9A 1T00A 1YF0A 1I9DA 3QFAC 4K7IA 4ZILA 4XHMA 3P7XA 1Q98A 2VL2C 1THXA 4AF2A 4V2LA 2ALBA 3UEMA 3FZAA 4FH8A 2V6OA 2DBCA 2R4VA 3QOUA 2YNXA 3CRUA 1YKAA 4FYUA 4OCEA 3EU4A 3MNGA 2YN1A 1BJXA 2F3MA 19GSA 3ZZXA 5F8BA 2X8HA 3P2AA 2XPEA 1BEDA 4IELA 4JR6A 4CW9A 4XS1A 18GSA 2YWNA 2H0IA 3PGTA 4PQ1A 5GZZB 3ZVJD 3EE2A 5DALB 2VL2A 1OC8A 2FUG2 2HRFA 2XC2A 1TXXA 4ZL7A 1PRXA 3TRQA 1MD3A 4CHSA 3L9VA 2MYGA 4N0ZA 4HEA2 1G0TA 2HSYA 5ECOB 17GSA 3IHQA 2AYTA 3F9UA 1XXUA 1X5DA 4N10A 2VCWA 1K0BA 1TRWA 1TI1A 4I6XA 1FOVA 3ZLPA 4EL1A 3BJ5A 4AJ7A 5DAKB 1M99A 3HD5A 3DYRA 2JADA 4HZ4A 4K2DA 4ZXGA 1K0MA 2XBQA 1RQMA 4MJAA 2FA4A 1TU8A 2RUEA 5F06A 4K8MA 2GQLA 4KA0A 4CDOA 3TOTA 3EURA 1YDKA 2VL3A 1TDIA 5JWQB 2V2GA 1SL0B 2V1MA 2C80A 1A0RP 2FWHA 4MJEA 4F2IA 2H71A 5FHIA 2N5FA 2R3XA 1XWAA 1MDJA 2VM2A 4PNFA 2FLSA 2MMNA 3Q19A 2BTOT 3KH7A 4TVEA 4N30A 2H1GA 4V2NA 2GT5A 3IXRA 3W6GA 2VL9A 4IHUA 2NPBA 1ERWA 1AUCA 3GUSA 4FYCA 2VCZA 5ECIB 1T1VA 1XPVA 1RW1A 2R6KA 1PSQA 3VFIA 1ERTA 1PN9A 2L5OA 3MAKA 1XOBA 1Z9HA 3HCZA 1JZRA 2HZEA 2WJUA 4O7HA 4E8HA 3FHKA 5DQSA 2HLSA 5CREA 3TDGA 4GRFA 3PR8A 1YEXA 1XVQA 3MWHA 1ON4A 2H19A 4ECJA 2ES7A 3PH9A 1EOGA 2AHEA 5G5EA 2O87A 2D2ZA 1CQGA 1ZYEA 3N5OA 3PINA 2YJHA 4DSSB 4ZB9A 2WDUA 14GSA 3VK9A 5HR1A 3SBCA 2C0EA 3QR6A 4QL7A
chains in the Genus database with same CATH superfamily
3ROBA 4HM2B 1J9BA 1E2YA 2H6ZA 5IEOA 4KX4A 4MLYA 1ZOFA 1DE1A 2V1LA 2CT6A 3EJVA 5A0OB 4TKYA 4HOHA 1A8LA 4JZQA 3UOMA 1A0FA 1SIIA 3DIEA 1O7NB 3GSPA 1W4VA 2IA7A 5KN0A 2BMXA 4HJ2A 1URMA 1SKSB 5DBQA 1B2ZA 1K0CA 5JWRB 4NREA 1WRYA 5CP1A 1PKWA 1VGLA 3WT1A 1CYUA 3CRTA 9GSSA 4LMWA 3GKXA 3TKSC 3EMPA 4ECBA 2E2VA 2GSRA 3WT2A 1CEWI 1G96A 1JBSA 2K8SA 4JEDA 3UARA 1W6YA 1NM3A 4NV2A 1V74A 2WRTA 1XW6A 2X49A 2G0FA 1FUSA 1PN0A 4DVCA 1TIJA 1SJWA 3HZ8A 3LG6A 1YF1A 4MEIA 5D83A 3DRNA 2CHCA 1RRLA 3FK8A 4J8TA 4K1VA 3PPUA 4HQZA 5IMVA 1EV4A 5ECHB 3KTBA 1YIJ3 1SL1B 22GSA 3C73A 4BL2A 3BU4A 2X8CA 4TXVA 1IYIA 1IVVA 1GOVA 2YX9A 1KC84 5JWOB 1B48A 5HR3A 1GTAA 1Z1SA 4FCJA 1VRSD 3CCL3 3A2WA 2GQKA 1EEJA 3ER7A 2B1KA 1PFOA 2C3QA 2TRXA 5HFKA 1W01A 4BL3A 1OC9A 1CQSA 1E3VA 3WD6A 4IP1A 3KH9A 1XWGA 1XWKA 3U1WA 1ROAA 1QJGA 4AJ8A 2C0FA 3TKSA 3L9UA 2LNSA 4KF9A 8CHOA 4EW5A 1RN4A 4WXTA 3M0FA 5ECPB 5ECQB 5AIFA 5FWGA 3PXMA 4TR3A 4BVXB 2F86B 4YAVA 1X1UA 3HI7A 4EXRA 2XFSA 2LQVA 2OWPA 2IMDA 4IBPA 5DJMA 4ICYA 3LTCA 4HKVB 4FYBA 2P0MA 5G1KA 3TB2A 2WGRA 3LTBA 1WP0A 2CW9A 2LTKA 1PQNA 5CO3A 1A67A 5E4WA 1RGAA 1DVCA 1BSAA 3LZAA 3HJMA 5D96A 4KFDA 3OR5A 3ZIJA 3QMXA 1XVWA 5ECMB 3CCM3 5J41A 3I6AA 1OGZA 1RNBA 3F4SA 2L6DA 2IUJA 5HFIA 2ON5A 2MBSA 3KXOA 4TXOB 1QGVA 3ZIVA 2B5EA 1NSWA 2IWTA 1BRHA 1STDA 5FT3A 3G0KA 3CQFA 1RGGA 4WP5A 4MP4A 1EGOA 3X3XA 5A5KA 3UBLA 3J7Yk 1GSQA 1IT8A 2IUKA 4HU9A 4RQXA 1RGHA 2P31A 4MF6A 5ECNB 4IP6A 1IVUA 1C72A 4NHZA 1NWWA 1WE0A 1GNEA 5IMCA 3HA9A 4HZ2A 1QMAA 2Z9SA 2HE3A 1D6ZA 3G8ZA 3I553 8RNTA 4GHOA 2LKUA 3LSZA 4XM4A 2V32A 2QIYA 1ZYNA 2HMLB 4GB5A 4HDEA 4ISDA 1RDSA 1YKCA 4I2TA 2H73A 1K3YA 2IIYA 1Y4KA 4HU7A 3ZFLA 2XR8B 1GD3A 3UL6A 1UGHI 4U13A 4YQMA 1OACA 1AVLA 4OFTA 3VI5A 3ZMLA 3NX0A 1HD2A 5DQYA 1F3BA 2GLRA 3CCV3 1RTUA 4OMVA 3CCE3 1WJKA 4KSMA 7GSSA 3AY8A 5M18A 4GSTA 1EEMA 2RSXA 3I43A 4ILFA 1DMMA 4WFOA 2R2JA 4MZBA 5KN1A 4HM7B 2WULA 5IG0A 4Q5RA 4J57E 4BL7A 3RHBA 3PS8A 1N2AA 3TKQA 3FZ5A 2MZCA 4I5QA 3KZTA 5ELGA 4Z2UA 4HAAA 1GSYA 4G9HA 3A5WA 3MDKA 2R0GA 3F8HA 3C71A 3HVVA 1FVKA 4OWYA 4I97A 3IAM2 1ZL9A 3LH4A 3FG1A 4NV5A 2H1BA 5JCGA 1BNJA 3S28A 5CNWA 1JKGB 2HI7A 3U6VA 3EWLA 1IV7A 2IY2A 2E7PA 1BGSA 1TFOA 3LTAA 1JZOA 4Q5FA 1SJIA 1T4YA 4X4JA 1AQZA 1LOYA 5EVOA 3DEXA 1M9BA 1BUJA 1IYYA 1UCJA 2PVQA 4J2FA 4R1KA 2OA7A 2O8VB 2LEGA 1ERVA 2CH9A 2B5XA 4ORLA 1TJDA 3AHWA 3IMAB 2VLTA 2PUKC 1ML6A 5D81A 1O7WB 1R4CA 1T5YA 2UGIA 2WB9A 3FR9A 4F0BA 4ZL9A 4KDUA 1W7CA 3US3A 1LQGC 4X0XA 5IPGA 1ST9A 2HSMA 2OJLA 3N9HA 1IT7A 1GTUA 4HQSA 2LRTA 4XRDA 4TR4A 3CC73 5ECLB 4XB5A 1SKWB 3GX8A 1BSDA 2LJKA 1TTZA 5IERA 4LSOA 1O7UA 1PYLA 3B8LA 2W6JH 3DGNA 2RCDA 3CTFA 2C11A 4RNTA 1OHPA 2XGLA 3KCMA 4F03A 1BRNL 4K1FA 5ID2B 3W8SA 2YWIA 2W9QA 5EQLA 2HNLA 2GSQA 2DJ1A 3S29A 3DGMA 2ZDJA 5GSTA 4BWQA 1ASKA 4D73B 1W4NA 4MNNA 1PKZA 2B6MA 4R9LA 4IT7A 5AYRB 3LJRA 1DE2A 2K18A 1WMNA 2CX3A 1R26A 1V9WA 5IENA 2RIIA 3ISOA 2NDOA 1K41A 3X3YA 1IYHA 1KTEA 1XG8A 4N6MA 1USBA 3F3RA 1BRJA 1X9SB 2A2SA 3CPOA 2HSHA 3JCML 1SENA 1DUGA 1YEPA 3LWAA 2XF3A 3DXBA 1LRAA 2CX4A 2IMEA 3ZITA 4IIAA 3U5RE 3LT8A 1AAZA 4HJMA 1TRPA 5IOWA 1GY5A 2A2PA 5COHA 1AIUA 2I3YA 2VLVA 2AUVA 2OKAA 1RGLA 1LOVA 5AIVA 3KN4A 4TXOA 3NHXA 1A8YA 4BPYA 3UVHA 3BNCA 4N11A 2NBSA 3FW2A 4KGIA 2QA43 3K8NA 4ZBAA 1VQQA 3K5TA 2DMMA 5ELJA 3QRDA 4LMIA 4G19A 1K0NA 1AQXA 1ACVA 3MWZA 5IF6A 1W00A 2V6KA 1OHOA 1M0UA 3K0ZA 1SJ6A 2K0MA 4NXIA 2I81A 1NB5I 2GVPA 1JB4A 1GSFA 5IQYA 1JLVA 4EXJA 3F4TA 3NBRA 2MC8A 3B4PA 2V41A 1BQ7A 2LNTA 1MGRA 1OYJA 2YZHA 1SD9A 2ZL8A 3CSJA 3BNBA 3Q1CA 4RBNA 3O3TA 1O7MB 1H4OA 3HJOA 2OE1A 3KMNA 7STDA 2AJQB 1VQ53 3MSZA 1OKDA 2P5QA 4XCSA 1UCIA 5C00A 2CX1A 2OBIA 1PD21 3EB8A 2NVLA 4LEHA 2QEX3 2O7KA 2VOCA 2Z7AA 4MA9A 6GSVA 2CC3A 1SPUA 2X64A 5AEWB 4NPBA 3CXC2 3DKSA 2M80A 1UUWB 4Q5QA 4GSSA 3ME8A 1KQS2 5ABRA 1WOUA 4H86A 1ZO2A 1A2VA 1X1XA 3CCQ3 1AW9A 1BRSA 2IMJA 2YOIA 3GAXA 4GTUA 3GKNA 4EV2A 2ZUPA 1EZKA 1TP6A 2K6VA 3AMOA 2DJ2A 4ULXA 3GX0A 3F6DA 1UC7A 2XSOB 1JKGA 2PBJA 3UL3A 2DMLA 1OF5B 1QAKA 2CAQA 5CRDA 1HNCA 1J2BA 1BRGA 3F9SA 2DKIA 5D9VA 2GBXB 4O3VA 4N6UA 1GUHA 1S3RA 1EQKA 1WMJA 2OBKA 4FMAA 2PMTA 1OKTA 3VPQA 2JDIH 1TK5B 4MJCA 2Y74A 2E0QA 3AGNA 1Q7HA 2ZNMA 2GT6A 1EP8A 4PGTA 4TOPA 1HQOA 1IV9A 4HM6B 4ZBDA 2FWEA 4ML1A 4POBA 1B9XC 1VQ73 3DVWA 1RCKA 1NNVA 3FR3A 1VF1A 4EV5A 5KP3A 4JR4A 4YKFA 1WIKA 2XEPA 1STFI 2O9UX 4WR5A 1TRVA 4EO3A 1Z7RA 2LS5A 3LTDA 2JZTA 3MG3A 1N5PA 4L7KA 1GY7A 1SJZA 1E97A 2LUSA 1R5AA 3OWYA 1U6TA 1M2AA 1YVBI 2P0GA 3CSIA 2YFJB 5BXQA 1DETA 4WEYA 1O8WA 1GSPA 4GXZA 4GQFA 2K3DA 5IG3A 3D4AA 3NM2A 1RJOA 2R0CA 1X5CA 4YKGA 5KOXA 4HVNA 1JRQA 1XW5A 2VCVA 1ZS7A 3IA1A 1DE3A 3GH6A 1U3IA 2KUCA 3IBHA 1B2MA 4XS4B 3EQQB 1ZYPA 3SYUA 1TKDB 2R5GA 3CBUA 3CCU3 1T8EB 2BJXA 3IRAA 3O6TA 2AAEA 1U8CB 3ZRDA 3JUNA 2CFDA 3GZXB 4IPBA 1PY3A 4O5QA 2PPTA 3F8XA 4N6V0 5DDLA 2QA1A 3KIJA 2VUPA 4Q53A 5CRHA 2L4CA 2FWGA 1I2FA 3GIXA 3SWLA 3X41A 5GSSA 4OO5A 5DCGA 3Q18A 3C1RA 5JPUA 3LQ7A 2ON7A 1B21A 4F82A 3LT9A 6GSTA 4HBRA 4KCAA 2PU9C 2K8VA 3LXZA 2YPMA 1O6JA 4DSQA 1FGRA 5RNTA 2DLXA 3WOFB 5GSPA 3T8UA 4XDWA 2H01A 1BRKA 2H0GA 3L0HA 4K5SA 4WBRD 3VLNA 11GSA 1JBTA 4BVYB 2RLIA 3UNLA 3KE7A 3CYNA 4WF5A 1DVDA 1RGCA 1H75A 4MZWA 1K0AA 2AV4A 4HM5B 1A24A 3ME7A 3S67A 1FUTA 5IO2A 3FSDA 2QGUA 2GTUA 3UIWA 1XBSA 3FZWA 1E3RA 4NAXA 4MABA 3MG2A 2H66A 4POKA 4E8EA 1FO5A 1O8XA 1VQ43 4G2EA 3UMAA 2IL3A 2TRCP 2WZ9A 3J7Yb 2H76A 5GAPD 1HNAA 5IMFA 4MMMA 2B7JA 4HZBB 2YWOA 1K8A4 5J4UA 2BIRA 2H8LA 4L0UA 3NIVA 4N0VA 3EVIA 2CVBA 4GLTA 1GLPA 3UJMA 3QFBC 5HR0A 1T7PB 1BRIA 1O73A 2HRAA 5DALA 1EP7A 2HXKA 4WWUC 2PN8A 1BAYA 4L0WA 3KGKA 1BNIA 2W04A 4EUYA 4O02B 1QUWA 2A2RA 3W8JA 1SL2B 4CJNA 4CY8A 3V99A 2W56B 4RNYA 1FB0A 3CC43 4WR4A 2GEYA 3CMIA 3BBYA 3G4S3 3JUMA 3VWVA 3C1SA 2PERA 3A3TA 3TRPA 2GU1A 1OAZA 3H1NA 1M1XB 2X4AA 2JSZA 2AAWA 4XDVA 5JCUA 4J5GA 2KXGA 3MYDA 4J5KA 1QAFA 1AQWA 2WO0A 3GKKA 5AIGA 1U3AA 3CCS3 4EC0A 3N9JA 2KHPA 3Q90A 1TU7A 3IJEB 1BNSA 2CFLA 5KP4A 2DJ3A 5D9WA 2CVDA 1CH0A 3EHCA 3GFKA 3EN1B 1VQ83 5DAKA 4WYKB 4EIPA 2XHFA 2DJJA 2LRCA 2F5MA 2Z76A 5LC7A 3F63A 2KF5A 2YJ7A 5STDA 1M2BA 2IFQB 2O3OA 2W2CA 1I2GA 3CD63 4GSPA 3IR4A 2JACA 1FZUA 3D22A 3AGOA 1FB6A 3ZFBA 4ACSA 3NV0A 3BNEA 3VWWA 2CFGA 3S27A 2GDRA 4KH7A 1IVWA 2HMOB 4MMYB 4H3UA 4K6XA 2TIRA 1OH0A 4X1UA 1RK4A 3QK9A 1BIRA 4I2UA 1ULJB 4X43A 4KSOA 1ABAA 5CRGA 1RN1A 1MDKA 4L8EA 3DH2A 1K9M4 1R7HA 4EKZA 3GL3A 3NBBA 1LOWA 4HM4B 1V58A 1I0XA 5EL8A 1EUIC 3LEFA 2W9PA 2HT9A 3WOEB 1S3DA 2M72A 3KMOA 2FY6A 1EV9A 5A4UA 2HMMB 5KEJA 4Q5NA 3TKRA 1AV4A 1ROVA 3GZBA 4J9AA 2CZ3A 2D1WA 1QVG2 2MMOA 3MKIA 1ZMAA 1AC1A 5H5QA 2YANA 2PVOC 3TJKA 1GLQA 3CCR3 2C0GA 1TRSA 4O2HA 1AY7A 3NUVA 1PL1A 5HR2A 4CCVA 4TR1B 2F8FA 1SIHA 3CME3 1B27A 1JJ22 3HXSA 5LD0A 4MH2A 2JSYA 1IDPA 3EN8A 1C7HA 1BOXA 2WGQA 1D6UA 2E2UA 3QD9A 4BWSA 1C54A 3A2XA 5L71A 2CVKA 2FWFA 1JNQA 2YFLB 3RDEA 4BTYA 2GS3A 3A5IA 2DC5A 2B24B 1A2KA 3ZFZA 3VSYA 5EPFA 1XIYA 1A2MA 4XRAA 1DBYA 3GURA 2CKFB 4USSA 4DSSA 2JZRA 1VF4A 2R0PA 1VQK3 2KP1A 5F07A 2VIMA 2AB6A 4OK0A 1VQL3 1YGEA 3B7CA 3VF1A 1S3CA 4K2XA 3HIIA 1Z6NA 1OVNA 2KP2A 3LYKA 3QAWA 3G7IA 5ECSA 2PNCA 2FGTA 1BSEA 4JRRA 2STDA 4V1Ap 3WDGB 4BA7A 1B3SA 1OE8A 3L78A 1WMPA 3IAS2 2LRNA 1GTIA 3IK7A 1NDOB 2CX0A 2IYJA 1KSIA 1M7TA 1RGEA 2Q07A 5CRWA 5ELAA 2CIUA 1QFNA 4AJ6A 3TJBA 4X2HA 2L6CA 4BTXA 2VD0A 1NB3I 4O32A 4LGQA 1NHOA 2CQ9A 3LXTA 2IN3A 3D5IA 2BHMA 3HOHA 3NOFA 3CMA3 4FIWA 1FGOA 1O7PB 3FMWA 4TRXA 2K9FA 2JZSA 1Q864 2W0QA 5BIRA 3VWUA 1W89A 4XIHA 5AIHA 2N5AA 3OXAA 5GAND 4J56E 2H30A 1HKXA 1IQXA 3HVSA 3ZYWA 4QQ7A 1PU4A 1UA5A 3CSHA 1QALA 3E0UA 6GSYA 3J7Yd 3F40A 5CK6A 3D5JA 1HZ1A 1MWSA 4LL4B 1MDIA 3RDWA 3APQA 2LQOA 3HVXA 2IMFA 2F56A 1ZZYA 5F0GA 3SLUA 1FA3A 1WQLB 1B4PA 3HKRA 2KF3A 5CAXA 1UI8A 2DKHA 2XPDA 4WKWA 3NM7A 4K9ZA 4IW9A 1BU4A 3M8CA 1N9JA 3DXOA 2FD3A 4MK3A 2H0HA 5IPHA 1ILOA 1PX7A 2KAAA 5IMZA 2KF4A 3NBJA 3DZLA 3UAPA 2L57A 2GZPA 1VF3A 3KZQA 2I1UA 1SU9A 2F51A 1JLWA 5D73A 1FGMA 1OUNA 4L8PA 3VPTA 4STDA 8GSSA 2GZYA 4ZB6A 1GOYA 4O92A 1K0OA 3O76A 4JBBA 4N6NB 1YNVX 4KVHA 1YI23 1J08A 1GSEA 2DSAA 4KE3A 4BVXA 5AISA 3WGEA 4AEQA 4LLRA 3WYWA 3KIIA 1B9YC 1JFUA 2JU5A 4FMCA 3HDCA 4FMDA 2F99A 2GSPA 5DCHA 2C10A 3I0YA 2GZZA 1EGRA 3DUKA 3DMLA 1XWCA 3LOYA 1A2LA 1JN5B 1W5ZA 4TX4A 5ECKB 2LYXA 3EU3A 4HOJA 5D82A 4WF4A 2GSTA 2HRNA 4IGJA 1Z7PA 2M46A 1KEBA 1G7OA 2C4JA 1BNFA 3ECFA 4QL9A 2H1DA 1M3JA 1JZWA 2QKEA 1TFKA 3U97A 2UUGC 3OW22 3E9JB 5EY6A 3ZG0A 2OE3A 3WODG 3PCRA 2MF7A 3HZPA 4GL6A 1EA2A 1UN2A 3QAVA 1YGWA 1JHBA 3DGLA 1LJRA 4MF7A 3K9MC 2L59A 5HFGA 4R9KA 1TW9A 2F98A 1GTBA 2HRKA 3LYPA 2HOHA 2E2GA 3C8EA 4JU5A 1YJ6A 1TK0B 5B6MA 3L4NA 2C4BA 3RGAA 1DSBA 2HZEB 3ERWA 3QAGA 5H5RA 3EBYA 1NO3A 1M1K4 3F6FA 2K54A 2L5LA 5INYA 3KTLA 1FOHA 1B2SA 2FNOA 5IO0A 3RHCA 1SYRA 1TRUA 3ZTLA 3I9V2 13GSA 1GUKA 1JZDA 2BNGA 3GRDA 4V2MA 1KWIA 3N8BA 3UBKA 2JL4A 3D21A 4RI6A 1XCCA 4O8SA 2CWTA 2B7KA 1BX9A 5J9CA 3PGBA 4K7OA 5D9XA 1LU4A 5IIZA 3APSA 3F4RA 1I5GA 5M19A 4CY6A 4YAPA 1VF2A 4FQUA 2FCHA 5D9TA 3E3EA 5JCWA 1JV2B 1Q40B 2X99A 3FY7A 3M9JA 1B4QA 1YZXA 4IJ3A 2DJ0A 3R2QA 4PQHA 3KCHA 2OOVC 7GSPA 2C3TA 3FEUA 1F9MA 4L5OA 1DMNA 1T2IA 4RQRA 2EIOA 1T2HA 4N6TA 1M9AA 3DVXA 1ZGNA 2EIRA 2YZUA 1SKRB 1GYBA 1K734 1Y25A 1BNRA 1O81A 1B8XA 2C3NA 3BLZA 3NQYA 1NU3A 2M7OA 2H6YA 1TU5A 2R37A 3GRXA 3CNXA 1W2ZA 1V40A 5FGOA 3E99A 1GS3A 3D79A 3G6E3 4FR9A 3GTUB 1FW1A 2OTJ3 4OO4A 4IJIA 1U88A 20GSA 3ZREA 1X0RA 2RUFA 3LORA 2J23A 2GGTA 4HM8B 4ZB8A 4IN0A 3IOSA 3OWSA 1ZX2A 5TGNA 3HYPA 4XS6A 4MPFA 3ED3A 3V1WA 5ECRB 4ZL8A 5IOXA 1RGKA 1DMQA 2YP6A 3JVCA 3GSSA 4PXOA 4EIQA 4O5RA 1SQWA 2VCXA 4EDZA 1GD4A 3I563 2OOVA 5B7CA 1MTCA 3B4OA 9RNTA 2P09A 3GH9A 5ID2A 1BSBA 2H75A 2LJRA 2WOFA 1XFLA 2DIZA 1I3FA 1OC9B 3K63A 2RM6A 1W6CA 4D73A 1IQ8A 2O85A 1WWJA 1RRHA 3TJFA 3UJ1A 2FA8A 3HIGA 5C04A 2OADA 4FCMA 3DM8A 2A15A 4LZIA 1GL8A 3TOUA 3S9FA 3M1GA 1BYEA 4XBYA 5H5SA 2LSTA 1HYFA 3S5CA 1XZOA 3I69A 1JB2A 2EIQA 4P3YB 2FNQA 4WHAA 1LXEA 1ISKA 4FO5A 4K0GA 4RUVA 1GMQA 2KLXA 2KOKA 5IM9A 3V98A 5BU4A 5KOWA 2QA2A 3IK9A 2PGTA 3GKMA 1MD4A 4ECIA 1SYXA 5HQPA 3FR6A 2F8AA 5A4VA 4AGSA 3Q3FA 3KKGA 3H4KA 3DWVA 2RGQA 3HJPA 4QWTA 10GSA 4KW6A 3MYTA 3G9BA 1IU7A 2MMZA 4YH2A 1LNHA 3EINA 3TJGA 1XW9A 3KD0A 4OFMA 1LBKA 4EYCA 1EG9B 1PL2A 3HVNA 1Z6MA 4R80A 1N8JA 1V2AA 3L9SA 5FW5A 2H1AA 1FGTA 5E59A 2SARA 3FG3A 1GRXA 2GSSA 2CAIA 2FXTA 4WBJA 3STDA 1SD8A 2UX0A 3MIXA 3BIRA 4G1MB 2A4VA 1OGXA 1JBRA 4LMVA 1EKMA 1FHEA 4KT3B 2VCTA 1K3OA 3BB9A 3MSOA 2GQMA 3VURA 3PCSA 1YJN3 2GEXA 1NJI4 2H72A 2QGVA 4HM0B 1GMRA 2L1SA 2H6XA 1PGTA 1WNHA 2CV4A 3CC23 2WCIA 3BD2A 4GQCA 3WA3A 2BMOB 1XOAA 1GSSA 2XRXB 3CU3A 4N6LA 1A2PA 1GH2A 2VD1A 4I8BA 1RGFA 2Z6BA 1OCVA 1Z3EA 1B2XA 3DD3A 4ZBBA 3M9KA 3KP8A 3APOA 4HI7A 3FRCA 2CG0A 1ERUA 1RNTA 2SBLA 1T3BA 1G6YA 1T4ZA 3HZ4A 3UVTA 1OHSA 1AQVA 3WGXA 4MZCA 1Q9EA 2FHEA 2A4HA 3BCKA 1Q40A 3TJJA 2DIYA 3PYJA 3H51A 1LNIA 2G2QA 4NWYA 2GBWB 2HZFA 2HYXA 1I0VA 3HY2A 4KB3A 1JB5A 3H79A 2YV7A 4KZ1A 1CYVA 4Z7XA 2YFIB 1W2B2 3D4MA 1TI3A 4BL7B 4IQ1A 4DSRA 3X42A 1G7EA 4AKYA 1V98A 3BOAA 3OX9A 4GSNA 3MG1A 4MJBA 4HUAA 1QXHA 1YVSA 2YWMA 3FYGA 2VM1A 1GULA 1M9GA 1R5PA 3F0IA 1RHLA 3UB1A 5J9BA 2FGXA 3JUQA 1OF5A 1CQHA 3WGDA 2CG1A 5AYSC 2IMKA 4K7NA 4PEJA 2LJAA 4X2OA 4MPGA 5J5NA 2YCDA 3IPZA 5DVBA 1X9MB 1S723 3GTUA 3ERGA 3KJYA 1KD14 4G0KA 4MF5A 4OCFA 3RBTA 3ZG5A 5HGRA 4G10A 4MCUA 1Z5YE 3FLJA 3D6IA 4PURA 5KP1A 4ECCA 5A4WA 3SOYA 4WETA 3GYKA 1F8NA 2LV3A 4XBTA 4NHWA 6GSPA 1M3IA 2OCTA 1ZCPA 2NTOA 1O85A 5DRVA 2I4AA 1X5EA 2WFCA 3SOAA 5IMDA 3IE3A 2VAFA 4NMUA 4JRFA 3CTGA 2B1LA 1YJ93 1QMVA 6RNTA 1KNGA 2N5BA 2LQQA 2WGOA 4KDYA 4PX1A 1FGQA 5IG5A 2I9WA 6GSWA 4EC6A 4L8OA 3GZRA 4BIRA 1GNWA 3UL5A 2I9HA 3TKPA 4FMBA 4HS1A 5CF2A 2B1XB 4GCIA 1PMTA 3GV1A 5DREA 3FH1A 3F7XA 2EC4A 2C8UA 1I2EA 1L5GB 2X8GA 5BVBA 1Q7Y4 5EEOA 3EYTA 4NHFA 1SK2A 2XSHB 3DMCA 1U5OA 3PZWA 4KUNA 4YQUA 1GOUA 1SK1A 5CYYA 1NHYA 4XS4A 3GZYB 3QCPA 6GSXA 4POMA 2B5YA 4MJDA 3KEBA 1G6WA 4L5LA 4AKZA 3ZMKA 3LW9A 4TW5A 2F5WA 4IS0A 1Q814 3IPTA 3FKAA 4K61A 4KCEA 2XBIA 3EC3A 2F9SA 3H8QA 4K0NA 5AGYA 4V1Ag 3VGNA 2KRTA 4G0LA 3OWUA 1TUHA 12GSA 5B8BA 5JBSA 4LL1B 4PNGA 2IPAA 4PQIA 4EVMA 5G5FA 2INXA 4KDXA 1S5AA 3M8NA 3DY5A 2HMJB 3Q74A 3QDNA 5IMAA 1HNBA 5DJLA 1UCKA 1RN7A 3CXGA 4K1UA 2ZHXB 4OFNA 1GUMA 5ELUA 1YQ1A 4BVYA 2C1YA 3G7YA 1BG5A 3GL5A 3VWXA 3WMDA 3ZL5A 5D93A 2VCQA 2H74A 5B8AA 4EE0A 3NXJA 3V92A 2BT3A 1UCLA 1GSDA 3GWRA 3A2VA 1M2DA 1NW2A 4K5RA 4MH3A 1GY6A 3BNDA 3D4TA 1OC3A 1FYSA 4KNDA 4Z2TA 3FCSB 2REMA 1UVZA 1F2EA 1IVXA 1I3IA 1S3AA 1GSUA 2B3SA 3LXUX 5LCZA 4ID0A 2CZ2A 2H70A 3P90A 4POLA 5KN2A 1Q4JA 1AXDA 2DJKA 3EF8A 1YY7A 3KP9A 1OE7A 2VLUA 2R41A 3IDVA 1WPIA 3EMXA 1I70A 3LYGA 1A23A 3QPMA 5ENUA 1E6BA 2MBTA 4Z2RA 1WTHA 5G1LA 4BTWA 5CLKA 3LFLA 1I8VA 3DGYA 4JF8A 2O89A 5BRTA 3SEDA 5D8IA 3K7CA 3M3MA 1HU9A 5AI1A 1Q42A 3HHVA 4FCZA 4PUAA 1K3LA 1TOFA 1G02A 1FG4A 4CDLA 3H93A 5AIXA 3FKFA 1VQP3 1YJW3 5G31A 2PZVA 4ZIJA 2CK3H 1IQYA 5CXOA 2P5RA 3IC8A 3LMLA 1W02A 6GSSA 3T0UA 1TK8B 3D3LA 5G2ZA 2QC7A 2CA8A 2MMAA 3VI7A 2W56A 3ERFA 3MHEA 2ZCTA 3F3QA 1UGIA 5J3RA 5LNKe 1FUWA 2RNTA 3GN3A 16GSA 5AIIA 3GHAA 1QQ2A 3AMOB 3KSED 4OD7A 1D6YA 3H3HA 1PA3A 1MEKA 1Y6EA 4TN8A 1DYUA 3BCIA 3F8UA 4KAEA 3WHOA 4RI7A 1THOA 2OACA 2E2MA 2UZ8A 3FZ9A 3OV4A 3CPW2 1MOLA 1MWUA 4WYKA 1PX6A 3TKSE 4EF0A 3JUPA 1QK8A 3NZNA 5IW9A 2RM5A 3TCOA 3RPPA 6GSUA 2GU3A 2J9HA 4YQVA 4XTSA 3FZ4A 2IFQA 2C0DA 5G30A 3AHSA 3FG4A 3TUEA 3O8YA 1SK0A 1UW1A 1QVF2 1F37A 1MWRA 1U87A 3D0ZA 2F4YA 1TP9A 2Y73A 1J0FA 3EC9A 2HFDA 2J8XB 3EPTA 2XH9A 3GNJA 1XWBA 1GMPA 1EOHA 1VQ63 3DGQA 5F05A 3KFQC 3RPNA 1R4WA 5B6NA 3RAZA 2P38A 4ML6A 1LOXA 3ZVJA 4TR0A 1EWXA 3FF0A 2IMIA 3G16A 4ZM8A 3G7JA 1N8R4 2L4QA 5EVHA 2CWVA 4IVFA 3JUOA 2OE0A 3GSTA 2PWJA 3TRXA 4OVMA 4LA1A 1V57A 5IEPA 1F3AA 3GA4A 3IC4A 2ML6A 1LVNA 4HM3B 5AN1A 4N3VA 4IQAA 1GWCA 2QSIA 1X9WB 3F7SA 4KFFA 2WS2A 3LGCA 4GWRA 1SARA 3X3ZA 1R4YA 1KBNA 4MDCA 3WA2X 3GMFA 4EDYA 4F9ZA 5KN3A 3T8NA 3IV4A 1A2JA 4I4KA 3C7MA 1HYUA 4IKHA 1FAAA 4TR1A 2IJYA 1F6MC 1FVJA 4PUFC 4DEJA 1MNLA 1ZYQB 3A5EA 4G0IA 3TGZA 4F0CA 3IHGA 1IK3A 3CNMA 4JE1A 2CFKA 4HYZA 2WOHA 1K0DA 4GF0A 2VO4A 3FGYA 4BU4A 1GP1A 3KM6A 3Q6OA 3P8WA 2YV9A 1TRQA 1AVKA 1T00A 1YF0A 2XFTA 3CCJ3 2ML5A 1I9DA 3QFAC 1ZGXA 4K7IA 4ZILA 4OUQA 4XHMA 4RNZA 3P7XA 4RZMA 1Q98A 2CWUA 3SVAA 2VL2C 1THXA 4AF2A 2P0XA 2BO9B 4V2LA 2ZA4A 2ALBA 1N9EA 3UEMA 3FZAA 4FH8A 2RFRA 2V6OA 1ULIB 1RSNA 2DBCA 2BMRB 2R4VA 1UI7A 3QOUA 2YNXA 5M1AA 1RLSA 5HOHA 2HMKB 4HJLB 3HX8A 3CRUA 1YKAA 4FYUA 4OCEA 1YIT3 3EU4A 2XGNA 3NQZA 5JPPA 3MNGA 2YN1A 3MPHA 4H61A 1VQ93 1OPYA 1BJXA 3SXXA 1US1A 2F3MA 19GSA 3ZZXA 5LC6A 5F8BA 3FF2A 4MMZB 2X8HA 3P2AA 2OQEC 1BEDA 2XPEA 4IELA 4BIKA 1WMOA 4KFEA 3EE1A 1BVIA 4JR6A 4CW9A 5CF1A 4XS1A 18GSA 3KSPA 2YWNA 2H0IA 3PGTA 4PQ1A 1RCLA 4K90B 1MGWA 1B2UA 5GZZB 3ZVJD 1UDII 2GXFA 2D42A 1BANA 1VQM3 3EE2A 5DALB 3EBTA 2KCDA 2VL2A 3SX1A 5G2GA 1OC8A 2FUG2 2HRFA 2XC2A 1TXXA 4ZL7A 1PRXA 1X1YA 3HK4A 3TRQA 2Z77A 1BAOA 1MD3A 1VQO3 4CHSA 3EX9A 3L9VA 2MYGA 4N0ZA 4HEA2 1G0TA 2HSYA 5ECOB 1K28A 2L4VA 17GSA 3IHQA 5BMUA 2P05A 1YHQ3 2AYTA 3F9UA 1XXUA 1X5DA 4N10A 2VCWA 1UUGB 1K0BA 1TRWA 1TI1A 4I6XA 1FOVA 3DGOA 4HZ9B 3ZLPA 4EBGA 1LQMB 4EL1A 7RNTA 1FW7A 2OQEA 3BJ5A 2BU4A 4AJ7A 1BUQA 1M99A 3DYRA 2JADA 2JQ5A 3HD5A 4HZ4A 4K2DA 1K0MA 5DAKB 4ZXGA 2XBQA 1O7HB 1TTOA 1MWTA 1RMSA 1RQMA 4MJAA 2FA4A 4DKIA 3D9RA 1TU8A 2RUEA 4CPKA 4O5UA 5F06A 2R4IA 4K8MA 2GQLA 1X1WA 4KA0A 4CDOA 4N6OB 3EURA 3TOTA 3WR2A 2RBIA 1YDKA 2VL3A 1TDIA 5JWQB 5AEUB 3NV0B 2V2GA 1BNEA 1SL0B 2V1MA 1RKYA 2C80A 2CFWA 1A0RP 2FWHA 4MJEA 2AADA 1JN5A 4F2IA 2H71A 3N54B 5FHIA 2N5FA 1N5HA 2R3XA 2KF6A 1Q824 1BNGA 1XWAA 1MDJA 2VM2A 4PNFA 2FLSA 2MMNA 3Q19A 2BTOT 3RNTA 3KH7A 4TVEA 2OTL3 1UUVB 3A76A 4N30A 2H1GA 4V2NA 5I97A 2GT5A 3IXRA 3W6GA 2VL9A 6STDA 2NPBA 1AUCA 4LYLB 1ERWA 4IHUA 3GUSA 3L0RA 4FYCA 3G713 2VCZA 3X40A 5ECIB 5IG4A 1T1VA 1VQN3 1XPVA 3F14A 3D5GA 1B20A 1RW1A 2R6KA 1PSQA 3VFIA 1ERTA 1PN9A 4HM1B 2L5OA 3MAKA 1XOBA 1Z9HA 3HCZA 1JZRA 4PTSA 2HZEA 2WJUA 4O7HA 1N8QA 4MMXB 3FHKA 1AR0A 5DQSA 4E8HA 2W03A 2HLSA 5CREA 4A5PA 3TDGA 4GRFA 3PR8A 1O7GB 1YEXA 1XVQA 3MWHA 1ON4A 2H19A 2HMNB 3Q2PA 3R3EA 4ECJA 1VZZA 2ES7A 1PFPA 3PH9A 1EOGA 4R4KA 2AHEA 5G5EA 3RGRA 3ALAA 2O87A 4HSCX 1W6GA 2D2ZA 1CQGA 1ZYEA 3N5OA 3PINA 4XBXA 1BSCA 2YJHA 4DSSB 3URPA 4ZB9A 2WDUA 1M904 1A90A 14GSA 2BMQB 2E2TA 5HR1A 3VK9A 3SBCA 2C0EA 3QR6A 4QL7A
chains in the Genus database with same CATH topology
1J9BA 1E2YA 2H6ZA 4KX4A 4MLYA 1ZOFA 1DE1A 2CT6A 4TKYA 1A8LA 4JZQA 3UOMA 1A0FA 3DIEA 1W4VA 5KN0A 2BMXA 4HJ2A 1URMA 1SKSB 5DBQA 1K0CA 5JWRB 1WRYA 5CP1A 1PKWA 1VGLA 3WT1A 3CRTA 9GSSA 4LMWA 3GKXA 3TKSC 3EMPA 4ECBA 2GSRA 3WT2A 2K8SA 4JEDA 3UARA 1NM3A 4NV2A 2WRTA 1XW6A 2X49A 2G0FA 1PN0A 4DVCA 3HZ8A 3LG6A 1YF1A 3DRNA 3FK8A 4HQZA 3PPUA 5IMVA 1EV4A 5ECHB 3KTBA 1SL1B 22GSA 3C73A 2X8CA 4TXVA 1IYIA 5JWOB 1B48A 5HR3A 1GTAA 1VRSD 3A2WA 2GQKA 1EEJA 2B1KA 2C3QA 5HFKA 2TRXA 1OC9A 3WD6A 4IP1A 3KH9A 1XWGA 1XWKA 4AJ8A 2C0FA 3TKSA 3L9UA 2LNSA 4KF9A 4WXTA 3M0FA 5ECPB 5ECQB 5FWGA 4TR3A 4BVXB 4YAVA 2IMDA 4IBPA 5DJMA 4ICYA 3TB2A 4FYBA 5G1KA 2WGRA 1WP0A 2LTKA 1PQNA 5CO3A 5E4WA 3HJMA 5D96A 3OR5A 3ZIJA 3QMXA 1XVWA 5ECMB 5J41A 3I6AA 3F4SA 2L6DA 5HFIA 2ON5A 2MBSA 3KXOA 4TXOB 1QGVA 3ZIVA 2B5EA 1NSWA 2IWTA 5FT3A 4MP4A 1EGOA 5A5KA 3UBLA 3J7Yk 1GSQA 4HU9A 4RQXA 2P31A 4MF6A 5ECNB 4IP6A 1C72A 4NHZA 1WE0A 1GNEA 5IMCA 3HA9A 4HZ2A 2Z9SA 2HE3A 2LKUA 3LSZA 2V32A 1ZYNA 4HDEA 4ISDA 1YKCA 4I2TA 2H73A 1K3YA 2IIYA 4HU7A 3ZFLA 4YQMA 4OFTA 3VI5A 3ZMLA 1HD2A 5DQYA 1F3BA 2GLRA 4OMVA 1WJKA 4KSMA 7GSSA 3AY8A 4GSTA 1EEMA 3I43A 4ILFA 2R2JA 5KN1A 4MZBA 2WULA 4Q5RA 4J57E 4BL7A 3RHBA 1N2AA 3TKQA 3FZ5A 2MZCA 4I5QA 5ELGA 4Z2UA 1GSYA 4G9HA 3A5WA 3MDKA 2R0GA 3C71A 3HVVA 1FVKA 4OWYA 4I97A 3IAM2 1ZL9A 4NV5A 2H1BA 5JCGA 5CNWA 2HI7A 3U6VA 3EWLA 2IY2A 2E7PA 4Q5FA 1JZOA 1SJIA 1T4YA 4X4JA 5EVOA 3DEXA 1M9BA 2PVQA 4J2FA 2OA7A 2O8VB 2LEGA 1ERVA 2B5XA 2VLTA 1TJDA 2PUKC 1ML6A 2WB9A 3FR9A 4F0BA 4ZL9A 4KDUA 3US3A 4X0XA 5IPGA 1ST9A 2HSMA 2OJLA 1GTUA 4HQSA 2LRTA 4XRDA 4TR4A 5ECLB 1SKWB 3GX8A 2LJKA 1TTZA 1O7UA 3CTFA 3KCMA 4F03A 4K1FA 5ID2B 3W8SA 2YWIA 2HNLA 2GSQA 2DJ1A 5GSTA 4BWQA 4D73B 4MNNA 1PKZA 2B6MA 3LJRA 1DE2A 2K18A 2CX3A 1R26A 1V9WA 3ISOA 2RIIA 2NDOA 1IYHA 1KTEA 1USBA 3F3RA 1X9SB 2A2SA 2HSHA 3JCML 1SENA 1DUGA 1YEPA 3LWAA 3DXBA 2CX4A 2IMEA 3ZITA 3U5RE 1AAZA 4HJMA 5IOWA 2A2PA 5COHA 1AIUA 2I3YA 2VLVA 2AUVA 2OKAA 5AIVA 4TXOA 1A8YA 4BPYA 3UVHA 4N11A 2NBSA 3FW2A 4KGIA 3K8NA 4ZBAA 2DMMA 4G19A 1K0NA 1AQXA 1ACVA 2V6KA 1M0UA 1SJ6A 4NXIA 2I81A 2GVPA 5IQYA 1GSFA 1JLVA 4EXJA 3F4TA 2V41A 1BQ7A 2LNTA 1OYJA 2YZHA 1SD9A 3CSJA 3O3TA 1H4OA 3HJOA 2OE1A 3KMNA 2AJQB 3MSZA 1OKDA 2P5QA 4XCSA 5C00A 2OBIA 1PD21 2NVLA 2O7KA 2VOCA 4MA9A 6GSVA 2X64A 4NPBA 3DKSA 2M80A 4Q5QA 4GSSA 3ME8A 5ABRA 1WOUA 4H86A 1AW9A 2YOIA 4GTUA 3GKNA 2ZUPA 1EZKA 2K6VA 2DJ2A 4ULXA 3GX0A 3F6DA 1UC7A 2PBJA 3UL3A 2DMLA 2CAQA 5CRDA 1HNCA 2DKIA 5D9VA 1GUHA 1WMJA 2OBKA 2PMTA 1OKTA 3VPQA 1TK5B 4MJCA 2E0QA 2ZNMA 2GT6A 1EP8A 4PGTA 4TOPA 1HQOA 4ZBDA 2FWEA 4ML1A 4POBA 1B9XC 3DVWA 3FR3A 1VF1A 4YKFA 4JR4A 1WIKA 4WR5A 1TRVA 4EO3A 1Z7RA 2LS5A 2JZTA 1SJZA 2LUSA 1R5AA 1U6TA 1M2AA 2P0GA 3CSIA 4WEYA 1O8WA 4GXZA 4GQFA 2R0CA 1X5CA 4YKGA 5KOXA 1XW5A 2VCVA 3IA1A 3GH6A 1U3IA 2KUCA 3IBHA 4XS4B 1ZYPA 1TKDB 2R5GA 3CBUA 1T8EB 2BJXA 3IRAA 3O6TA 3ZRDA 4O5QA 2PPTA 5DDLA 2QA1A 3KIJA 2VUPA 5CRHA 2L4CA 2FWGA 3GIXA 3SWLA 5GSSA 4OO5A 5DCGA 3Q18A 3C1RA 3LQ7A 2ON7A 4F82A 6GSTA 4KCAA 2PU9C 2K8VA 3LXZA 2YPMA 1O6JA 4DSQA 2DLXA 2H01A 2H0GA 3L0HA 4K5SA 4WBRD 3VLNA 11GSA 4BVYB 2RLIA 3CYNA 4WF5A 1H75A 4MZWA 1K0AA 2AV4A 1A24A 3ME7A 5IO2A 2GTUA 3UIWA 1XBSA 4NAXA 4MABA 2H66A 4POKA 4E8EA 1FO5A 1O8XA 4G2EA 3UMAA 2IL3A 2TRCP 2WZ9A 3J7Yb 2H76A 5GAPD 1HNAA 5IMFA 4MMMA 2B7JA 2YWOA 5J4UA 2H8LA 4L0UA 3NIVA 4N0VA 3EVIA 2CVBA 4GLTA 1GLPA 3QFBC 5HR0A 1T7PB 1O73A 2HRAA 5DALA 1EP7A 2HXKA 2PN8A 1BAYA 4L0WA 3KGKA 4EUYA 1QUWA 2A2RA 3W8JA 1SL2B 4CY8A 1FB0A 4WR4A 3CMIA 3BBYA 3VWVA 3C1SA 2PERA 3A3TA 3TRPA 1OAZA 3H1NA 2X4AA 2JSZA 2AAWA 5JCUA 3MYDA 1AQWA 3GKKA 1U3AA 4EC0A 3N9JA 2KHPA 1TU7A 2DJ3A 5D9WA 2CVDA 3GFKA 5DAKA 4EIPA 2XHFA 2DJJA 2LRCA 3F63A 2YJ7A 1M2BA 2IFQB 3IR4A 2JACA 3D22A 1FB6A 3ZFBA 4ACSA 3VWWA 2GDRA 4KH7A 4K6XA 2TIRA 4X1UA 1RK4A 4I2UA 4X43A 4KSOA 1ABAA 5CRGA 1MDKA 4L8EA 1R7HA 4EKZA 3GL3A 1V58A 5EL8A 3LEFA 2HT9A 1S3DA 2M72A 3KMOA 2FY6A 1EV9A 5A4UA 5KEJA 4Q5NA 3TKRA 2CZ3A 2MMOA 1ZMAA 1AC1A 5H5QA 2YANA 2PVOC 3TJKA 1GLQA 2C0GA 1TRSA 1PL1A 5HR2A 4TR1B 2F8FA 3HXSA 5LD0A 4MH2A 2JSYA 3QD9A 4BWSA 3A2XA 5L71A 2CVKA 2FWFA 2GS3A 3A5IA 2DC5A 5EPFA 1XIYA 1A2MA 4XRAA 1DBYA 3GURA 4USSA 4DSSA 2JZRA 1VF4A 2R0PA 2KP1A 5F07A 2VIMA 2AB6A 1S3CA 4K2XA 1Z6NA 1OVNA 2KP2A 3LYKA 3QAWA 3G7IA 5ECSA 4JRRA 4V1Ap 4BA7A 1OE8A 3L78A 3IAS2 2LRNA 1GTIA 3IK7A 2IYJA 1M7TA 5CRWA 5ELAA 1QFNA 4AJ6A 3TJBA 2L6CA 2VD0A 4O32A 1NHOA 2CQ9A 3LXTA 2IN3A 3NOFA 4FIWA 3FMWA 4TRXA 2K9FA 2JZSA 3VWUA 1W89A 4XIHA 2N5AA 5GAND 4J56E 2H30A 3HVSA 3ZYWA 4QQ7A 1UA5A 3CSHA 3E0UA 6GSYA 3D5JA 3RDWA 4LL4B 1MDIA 3APQA 2LQOA 3HVXA 2IMFA 1ZZYA 5F0GA 1B4PA 3HKRA 5CAXA 2DKHA 2XPDA 4WKWA 4K9ZA 4IW9A 2FD3A 4MK3A 2H0HA 5IPHA 1ILOA 1PX7A 5IMZA 3UAPA 2L57A 2GZPA 1VF3A 3KZQA 2I1UA 1SU9A 2F51A 1JLWA 5D73A 3VPTA 8GSSA 2GZYA 4ZB6A 4O92A 1K0OA 3O76A 4JBBA 1J08A 1GSEA 2DSAA 4KE3A 4BVXA 5AISA 3WGEA 4LLRA 3WYWA 1B9YC 1JFUA 2JU5A 3HDCA 5DCHA 2GZZA 1EGRA 3DMLA 1XWCA 1A2LA 5ECKB 3EU3A 4HOJA 4WF4A 2GSTA 2HRNA 4IGJA 1Z7PA 2M46A 1KEBA 1G7OA 2C4JA 4QL9A 2H1DA 1JZWA 2QKEA 3E9JB 5EY6A 2OE3A 1UN2A 3QAVA 1JHBA 1LJRA 4MF7A 2L59A 5HFGA 1TW9A 1GTBA 2HRKA 3LYPA 2E2GA 3C8EA 4JU5A 1YJ6A 1TK0B 5B6MA 3L4NA 1DSBA 2HZEB 3ERWA 3QAGA 5H5RA 3F6FA 2L5LA 5INYA 3KTLA 1FOHA 2FNOA 5IO0A 3RHCA 1SYRA 1TRUA 3ZTLA 3I9V2 13GSA 1GUKA 1JZDA 4V2MA 3UBKA 2JL4A 3D21A 4RI6A 1XCCA 2B7KA 1BX9A 5J9CA 4K7OA 5D9XA 1LU4A 5IIZA 3APSA 3F4RA 1I5GA 4CY6A 4YAPA 1VF2A 4FQUA 2FCHA 5D9TA 3E3EA 5JCWA 2X99A 3FY7A 3M9JA 1B4QA 1YZXA 4IJ3A 2DJ0A 3R2QA 4PQHA 2C3TA 3FEUA 1F9MA 4L5OA 4RQRA 2EIOA 1M9AA 3DVXA 1ZGNA 2EIRA 2YZUA 1SKRB 1Y25A 1O81A 1B8XA 2C3NA 2H6YA 2R37A 3GRXA 1V40A 3GTUB 1FW1A 4OO4A 4IJIA 1U88A 20GSA 3ZREA 1X0RA 2RUFA 3LORA 2J23A 2GGTA 4ZB8A 4IN0A 3IOSA 3HYPA 4XS6A 4MPFA 3ED3A 3V1WA 5ECRB 4ZL8A 5IOXA 4PXOA 3GSSA 2YP6A 4EIQA 4O5RA 2VCXA 4EDZA 5B7CA 1MTCA 3GH9A 5ID2A 2H75A 2LJRA 1XFLA 2DIZA 1OC9B 2RM6A 4D73A 2O85A 1WWJA 3TJFA 3UJ1A 2FA8A 5C04A 2OADA 1GL8A 3TOUA 3S9FA 3M1GA 1BYEA 5H5SA 2LSTA 1XZOA 3I69A 2EIQA 4P3YB 4FO5A 4K0GA 4RUVA 2KLXA 2KOKA 5IM9A 5KOWA 2QA2A 3IK9A 2PGTA 3GKMA 1MD4A 4ECIA 1SYXA 5HQPA 3FR6A 2F8AA 5A4VA 4AGSA 3H4KA 3DWVA 3HJPA 10GSA 4KW6A 3G9BA 2MMZA 4YH2A 3EINA 3TJGA 1XW9A 3KD0A 4OFMA 1LBKA 1PL2A 1Z6MA 1N8JA 1V2AA 3L9SA 2H1AA 5E59A 1GRXA 2GSSA 2CAIA 4WBJA 1SD8A 3MIXA 2A4VA 4LMVA 1FHEA 2VCTA 1K3OA 2GQMA 3VURA 2H72A 2QGVA 2H6XA 1PGTA 2CV4A 2WCIA 3BD2A 4GQCA 1XOAA 1GSSA 1GH2A 2VD1A 4I8BA 1Z3EA 3DD3A 4ZBBA 3M9KA 3KP8A 3APOA 4HI7A 3FRCA 1ERUA 1T3BA 1G6YA 1T4ZA 3HZ4A 3UVTA 3WGXA 1AQVA 4MZCA 2FHEA 2A4HA 3BCKA 3TJJA 2DIYA 2G2QA 4NWYA 2HZFA 2HYXA 3HY2A 4KB3A 3H79A 2YV7A 4Z7XA 3D4MA 1TI3A 4BL7B 4IQ1A 4DSRA 1G7EA 1V98A 3BOAA 4GSNA 4MJBA 4HUAA 1QXHA 2YWMA 3FYGA 2VM1A 1GULA 1R5PA 3F0IA 5J9BA 2FGXA 1CQHA 3WGDA 2IMKA 4K7NA 2LJAA 4MPGA 5J5NA 2YCDA 3IPZA 5DVBA 1X9MB 3GTUA 3ERGA 3KJYA 4G0KA 4MF5A 4OCFA 3RBTA 4G10A 4MCUA 1Z5YE 3D6IA 4PURA 4ECCA 5A4WA 4WETA 3GYKA 2LV3A 4NHWA 1ZCPA 2NTOA 1O85A 2I4AA 1X5EA 2WFCA 5IMDA 3IE3A 2VAFA 4NMUA 3CTGA 2B1LA 1QMVA 1KNGA 2N5BA 2LQQA 4KDYA 4PX1A 6GSWA 1GNWA 2I9HA 3TKPA 4HS1A 4GCIA 1PMTA 3GV1A 2EC4A 2C8UA 2X8GA 3EYTA 1SK2A 4KUNA 4YQUA 1SK1A 5CYYA 1NHYA 4XS4A 3QCPA 6GSXA 4POMA 2B5YA 3KEBA 1G6WA 4L5LA 3ZMKA 3LW9A 4TW5A 4IS0A 4KCEA 2XBIA 3EC3A 2F9SA 3H8QA 4K0NA 5AGYA 4V1Ag 4G0LA 12GSA 5B8BA 4LL1B 4PNGA 2IPAA 4PQIA 4EVMA 5G5FA 4KDXA 3M8NA 3Q74A 3QDNA 5IMAA 1HNBA 5DJLA 3CXGA 4OFNA 1GUMA 1YQ1A 4BVYA 2C1YA 3G7YA 1BG5A 3GL5A 3VWXA 3ZL5A 5D93A 2VCQA 2H74A 5B8AA 4EE0A 1GSDA 3A2VA 1M2DA 1NW2A 4MH3A 4K5RA 3D4TA 1OC3A 4KNDA 4Z2TA 2REMA 1UVZA 1F2EA 1S3AA 1GSUA 2B3SA 5LCZA 4ID0A 2CZ2A 2H70A 3P90A 4POLA 5KN2A 1Q4JA 1AXDA 2DJKA 1YY7A 3KP9A 1OE7A 2VLUA 3IDVA 1WPIA 3EMXA 1A23A 3QPMA 5ENUA 1E6BA 2MBTA 4Z2RA 5G1LA 3LFLA 2O89A 5BRTA 5D8IA 3M3MA 3HHVA 4PUAA 1K3LA 1TOFA 1FG4A 3H93A 5AIXA 3FKFA 5G31A 4ZIJA 2P5RA 3IC8A 6GSSA 1TK8B 5G2ZA 2QC7A 2CA8A 2MMAA 3VI7A 3ERFA 2ZCTA 3F3QA 5J3RA 5LNKe 3GN3A 16GSA 3GHAA 1QQ2A 4OD7A 1PA3A 1MEKA 1Y6EA 4TN8A 3BCIA 3F8UA 4KAEA 4RI7A 1THOA 2OACA 2E2MA 2UZ8A 3FZ9A 3TKSE 1PX6A 4EF0A 1QK8A 3NZNA 2RM5A 3TCOA 3RPPA 6GSUA 2J9HA 4YQVA 4XTSA 3FZ4A 2IFQA 2C0DA 5G30A 3TUEA 1SK0A 1F37A 1U87A 3D0ZA 1TP9A 1J0FA 2HFDA 3EPTA 3GNJA 1XWBA 1EOHA 3DGQA 5F05A 5B6NA 3RPNA 1R4WA 3RAZA 4ML6A 3ZVJA 4TR0A 1EWXA 2IMIA 3G7JA 2L4QA 4IVFA 2OE0A 3GSTA 2PWJA 3TRXA 4LA1A 1V57A 1F3AA 3GA4A 3IC4A 5AN1A 4IQAA 1GWCA 2QSIA 1X9WB 2WS2A 3LGCA 4GWRA 1KBNA 4MDCA 3GMFA 4EDYA 4F9ZA 5KN3A 3IV4A 1A2JA 3C7MA 4IKHA 1HYUA 1FAAA 4TR1A 2IJYA 1F6MC 1FVJA 4PUFC 4DEJA 1ZYQB 4G0IA 3TGZA 4F0CA 3IHGA 4JE1A 1K0DA 4GF0A 2VO4A 1GP1A 3KM6A 3Q6OA 3P8WA 2YV9A 1T00A 1YF0A 1I9DA 3QFAC 4K7IA 4ZILA 4XHMA 3P7XA 1Q98A 2VL2C 1THXA 4AF2A 4V2LA 2ALBA 3UEMA 3FZAA 4FH8A 2V6OA 2DBCA 2R4VA 3QOUA 2YNXA 3CRUA 1YKAA 4FYUA 4OCEA 3EU4A 3MNGA 2YN1A 1BJXA 2F3MA 19GSA 3ZZXA 5F8BA 2X8HA 3P2AA 2XPEA 1BEDA 4IELA 4JR6A 4CW9A 4XS1A 18GSA 2YWNA 2H0IA 3PGTA 4PQ1A 5GZZB 3ZVJD 3EE2A 5DALB 2VL2A 1OC8A 2FUG2 2HRFA 2XC2A 1TXXA 4ZL7A 1PRXA 3TRQA 1MD3A 4CHSA 3L9VA 2MYGA 4N0ZA 4HEA2 1G0TA 2HSYA 5ECOB 17GSA 3IHQA 5BMUA 2AYTA 3F9UA 1XXUA 1X5DA 4N10A 2VCWA 1K0BA 1TRWA 1TI1A 4I6XA 1FOVA 3ZLPA 4EL1A 3BJ5A 4AJ7A 1M99A 3HD5A 3DYRA 2JADA 4K2DA 4HZ4A 5DAKB 4ZXGA 1K0MA 2XBQA 1RQMA 4MJAA 2FA4A 1TU8A 2RUEA 4O5UA 5F06A 4K8MA 2GQLA 4KA0A 4CDOA 3TOTA 3EURA 1YDKA 2VL3A 1TDIA 5JWQB 2V2GA 1SL0B 2V1MA 2C80A 1A0RP 2FWHA 4MJEA 4F2IA 2H71A 5FHIA 2N5FA 2R3XA 1XWAA 1MDJA 2VM2A 4PNFA 2FLSA 2MMNA 3Q19A 2BTOT 3KH7A 4TVEA 4N30A 2H1GA 4V2NA 2GT5A 3IXRA 3W6GA 2VL9A 4IHUA 2NPBA 1ERWA 1AUCA 3GUSA 4FYCA 2VCZA 5ECIB 1T1VA 1XPVA 1RW1A 2R6KA 1PSQA 3VFIA 1ERTA 1PN9A 2L5OA 3MAKA 1XOBA 1Z9HA 3HCZA 1JZRA 4PTSA 2HZEA 2WJUA 4O7HA 4E8HA 3FHKA 5DQSA 2HLSA 5CREA 4A5PA 3TDGA 4GRFA 3PR8A 1YEXA 1XVQA 3MWHA 1ON4A 2H19A 4ECJA 3R3EA 2ES7A 3PH9A 1EOGA 2AHEA 5G5EA 2O87A 2D2ZA 1CQGA 1ZYEA 3N5OA 3PINA 2YJHA 4DSSB 4ZB9A 2WDUA 14GSA 3VK9A 5HR1A 3SBCA 2C0EA 3QR6A 4QL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9B A;  1E2Y A;  2H6Z A;  4KX4 A;  4MLY A;  1ZOF A;  1DE1 A;  2CT6 A;  4TKY A;  1A8L A;  4JZQ A;  3UOM A;  1A0F A;  3DIE A;  1W4V A;  5KN0 A;  2BMX A;  4HJ2 A;  1URM A;  1SKS B;  5DBQ A;  1K0C A;  5JWR B;  1WRY A;  5CP1 A;  1PKW A;  1VGL A;  3WT1 A;  3CRT A;  9GSS A;  4LMW A;  3GKX A;  3TKS C;  3EMP A;  4ECB A;  2GSR A;  3WT2 A;  2K8S A;  4JED A;  3UAR A;  1NM3 A;  4NV2 A;  2WRT A;  1XW6 A;  2G0F A;  4DVC A;  3HZ8 A;  3LG6 A;  1YF1 A;  3DRN A;  3FK8 A;  4HQZ A;  5IMV A;  1EV4 A;  5ECH B;  3KTB A;  1SL1 B;  22GS A;  3C73 A;  2X8C A;  4TXV A;  1IYI A;  5JWO B;  1B48 A;  5HR3 A;  1GTA A;  1VRS D;  3A2W A;  2GQK A;  1EEJ A;  2B1K A;  2C3Q A;  5HFK A;  2TRX A;  1OC9 A;  3WD6 A;  4IP1 A;  3KH9 A;  1XWG A;  1XWK A;  4AJ8 A;  2C0F A;  3TKS A;  3L9U A;  2LNS A;  4WXT A;  3M0F A;  5ECP B;  5ECQ B;  5FWG A;  4TR3 A;  4YAV A;  2IMD A;  4IBP A;  5DJM A;  3TB2 A;  4FYB A;  5G1K A;  2WGR A;  1WP0 A;  2LTK A;  1PQN A;  5CO3 A;  5E4W A;  3HJM A;  5D96 A;  3OR5 A;  3ZIJ A;  3QMX A;  1XVW A;  5ECM B;  5J41 A;  3I6A A;  3F4S A;  2L6D A;  5HFI A;  2ON5 A;  2MBS A;  3KXO A;  4TXO B;  1QGV A;  3ZIV A;  2B5E A;  1NSW A;  2IWT A;  5FT3 A;  4MP4 A;  1EGO A;  5A5K A;  3UBL A;  3J7Y k;  1GSQ A;  4HU9 A;  4RQX A;  2P31 A;  4MF6 A;  5ECN B;  4IP6 A;  1C72 A;  4NHZ A;  1WE0 A;  1GNE A;  5IMC A;  3HA9 A;  4HZ2 A;  2Z9S A;  2HE3 A;  2LKU A;  3LSZ A;  2V32 A;  4HDE A;  4ISD A;  1YKC A;  4I2T A;  2H73 A;  1K3Y A;  2IIY A;  4HU7 A;  3ZFL A;  4YQM A;  4OFT A;  3VI5 A;  3ZML A;  1HD2 A;  5DQY A;  1F3B A;  2GLR A;  4OMV A;  1WJK A;  4KSM A;  7GSS A;  3AY8 A;  4GST A;  1EEM A;  3I43 A;  4ILF A;  2R2J A;  5KN1 A;  4MZB A;  2WUL A;  4Q5R A;  4J57 E;  4BL7 A;  3RHB A;  1N2A A;  3TKQ A;  3FZ5 A;  2MZC A;  4I5Q A;  5ELG A;  1GSY A;  4G9H A;  3A5W A;  3MDK A;  3C71 A;  3HVV A;  1FVK A;  4OWY A;  4I97 A;  3IAM 2;  1ZL9 A;  4NV5 A;  2H1B A;  5JCG A;  5CNW A;  2HI7 A;  3U6V A;  3EWL A;  2IY2 A;  2E7P A;  4Q5F A;  1JZO A;  1SJI A;  1T4Y A;  5EVO A;  3DEX A;  1M9B A;  2PVQ A;  4J2F A;  2OA7 A;  2O8V B;  2LEG A;  1ERV A;  2B5X A;  2VLT A;  1TJD A;  2PUK C;  1ML6 A;  2WB9 A;  3FR9 A;  4F0B A;  4ZL9 A;  4KDU A;  3US3 A;  4X0X A;  5IPG A;  1ST9 A;  2OJL A;  1GTU A;  4HQS A;  2LRT A;  4XRD A;  4TR4 A;  5ECL B;  1SKW B;  3GX8 A;  2LJK A;  1TTZ A;  1O7U A;  3CTF A;  3KCM A;  4F03 A;  4K1F A;  5ID2 B;  3W8S A;  2YWI A;  2HNL A;  2GSQ A;  2DJ1 A;  5GST A;  4BWQ A;  4D73 B;  1PKZ A;  2B6M A;  3LJR A;  1DE2 A;  2K18 A;  2CX3 A;  1R26 A;  1V9W A;  3ISO A;  2RII A;  2NDO A;  1IYH A;  1KTE A;  1USB A;  3F3R A;  1X9S B;  2A2S A;  2HSH A;  3JCM L;  1SEN A;  1DUG A;  1YEP A;  3LWA A;  3DXB A;  2CX4 A;  2IME A;  3ZIT A;  3U5R E;  1AAZ A;  4HJM A;  5IOW A;  5COH A;  1AIU A;  2I3Y A;  2VLV A;  2AUV A;  2OKA A;  5AIV A;  4TXO A;  1A8Y A;  4BPY A;  3UVH A;  4N11 A;  2NBS A;  3FW2 A;  4KGI A;  3K8N A;  4ZBA A;  2DMM A;  4G19 A;  1K0N A;  1AQX A;  1ACV A;  2V6K A;  1M0U A;  1SJ6 A;  4NXI A;  2I81 A;  2GVP A;  5IQY A;  1GSF A;  1JLV A;  4EXJ A;  3F4T A;  2V41 A;  1BQ7 A;  2LNT A;  1OYJ A;  2YZH A;  1SD9 A;  3CSJ A;  3O3T A;  1H4O A;  3HJO A;  2OE1 A;  3KMN A;  2AJQ B;  3MSZ A;  1OKD A;  2P5Q A;  4XCS A;  5C00 A;  2OBI A;  1PD2 1;  2NVL A;  2O7K A;  2VOC A;  4MA9 A;  6GSV A;  2X64 A;  4NPB A;  3DKS A;  2M80 A;  4Q5Q A;  4GSS A;  3ME8 A;  5ABR A;  1WOU A;  4H86 A;  1AW9 A;  2YOI A;  4GTU A;  3GKN A;  2ZUP A;  1EZK A;  2K6V A;  2DJ2 A;  4ULX A;  3GX0 A;  3F6D A;  1UC7 A;  2PBJ A;  3UL3 A;  2DML A;  2CAQ A;  5CRD A;  1HNC A;  5D9V A;  1GUH A;  1WMJ A;  2OBK A;  2PMT A;  1OKT A;  3VPQ A;  1TK5 B;  4MJC A;  2E0Q A;  2ZNM A;  2GT6 A;  1EP8 A;  4PGT A;  4TOP A;  1HQO A;  4ZBD A;  2FWE A;  4ML1 A;  4POB A;  1B9X C;  3DVW A;  3FR3 A;  1VF1 A;  4JR4 A;  1WIK A;  4WR5 A;  1TRV A;  4EO3 A;  1Z7R A;  2LS5 A;  2JZT A;  1SJZ A;  2LUS A;  1R5A A;  1U6T A;  1M2A A;  2P0G A;  3CSI A;  4WEY A;  1O8W A;  4GXZ A;  4GQF A;  1X5C A;  1XW5 A;  2VCV A;  3IA1 A;  3GH6 A;  1U3I A;  2KUC A;  3IBH A;  4XS4 B;  1TKD B;  2R5G A;  3CBU A;  1T8E B;  2BJX A;  3IRA A;  3O6T A;  3ZRD A;  2PPT A;  5DDL A;  3KIJ A;  2VUP A;  5CRH A;  2L4C A;  2FWG A;  3GIX A;  3SWL A;  5GSS A;  4OO5 A;  5DCG A;  3Q18 A;  3C1R A;  3LQ7 A;  2ON7 A;  4F82 A;  6GST A;  4KCA A;  2PU9 C;  2K8V A;  3LXZ A;  2YPM A;  1O6J A;  4DSQ A;  2DLX A;  2H01 A;  2H0G A;  3L0H A;  4WBR D;  3VLN A;  11GS A;  2RLI A;  3CYN A;  4WF5 A;  1H75 A;  4MZW A;  1K0A A;  2AV4 A;  1A24 A;  3ME7 A;  5IO2 A;  2GTU A;  3UIW A;  1XBS A;  4NAX A;  4MAB A;  2H66 A;  4POK A;  4E8E A;  1FO5 A;  1O8X A;  4G2E A;  3UMA A;  2IL3 A;  2TRC P;  2WZ9 A;  3J7Y b;  2H76 A;  5GAP D;  1HNA A;  5IMF A;  4MMM A;  2B7J A;  2YWO A;  5J4U A;  2H8L A;  4L0U A;  3NIV A;  4N0V A;  3EVI A;  2CVB A;  4GLT A;  1GLP A;  3QFB C;  5HR0 A;  1T7P B;  1O73 A;  5DAL A;  1EP7 A;  2HXK A;  2PN8 A;  1BAY A;  4L0W A;  3KGK A;  4EUY A;  1QUW A;  2A2R A;  3W8J A;  1SL2 B;  1FB0 A;  4WR4 A;  3CMI A;  3BBY A;  3VWV A;  3C1S A;  2PER A;  3A3T A;  3TRP A;  1OAZ A;  3H1N A;  2JSZ A;  2AAW A;  5JCU A;  1AQW A;  3GKK A;  1U3A A;  4EC0 A;  3N9J A;  2KHP A;  1TU7 A;  2DJ3 A;  5D9W A;  2CVD A;  3GFK A;  5DAK A;  2XHF A;  2DJJ A;  2LRC A;  3F63 A;  2YJ7 A;  1M2B A;  2IFQ B;  3IR4 A;  2JAC A;  3D22 A;  1FB6 A;  3ZFB A;  4ACS A;  3VWW A;  2GDR A;  4KH7 A;  4K6X A;  2TIR A;  4X1U A;  1RK4 A;  4I2U A;  4X43 A;  4KSO A;  1ABA A;  5CRG A;  1MDK A;  4L8E A;  1R7H A;  4EKZ A;  3GL3 A;  1V58 A;  5EL8 A;  3LEF A;  2HT9 A;  1S3D A;  2M72 A;  3KMO A;  2FY6 A;  1EV9 A;  5A4U A;  5KEJ A;  4Q5N A;  3TKR A;  2CZ3 A;  2MMO A;  1ZMA A;  1AC1 A;  5H5Q A;  2YAN A;  2PVO C;  3TJK A;  1GLQ A;  2C0G A;  1TRS A;  1PL1 A;  5HR2 A;  4TR1 B;  2F8F A;  3HXS A;  5LD0 A;  4MH2 A;  2JSY A;  3QD9 A;  4BWS A;  3A2X A;  5L71 A;  2CVK A;  2FWF A;  2GS3 A;  2DC5 A;  5EPF A;  1XIY A;  1A2M A;  4XRA A;  1DBY A;  3GUR A;  4DSS A;  2JZR A;  1VF4 A;  2KP1 A;  5F07 A;  2VIM A;  2AB6 A;  1S3C A;  1Z6N A;  1OVN A;  2KP2 A;  3LYK A;  3QAW A;  3G7I A;  5ECS A;  4JRR A;  4V1A p;  4BA7 A;  1OE8 A;  3L78 A;  3IAS 2;  2LRN A;  1GTI A;  3IK7 A;  2IYJ A;  1M7T A;  5CRW A;  5ELA A;  1QFN A;  4AJ6 A;  3TJB A;  2L6C A;  2VD0 A;  4O32 A;  1NHO A;  2CQ9 A;  3LXT A;  2IN3 A;  3NOF A;  4FIW A;  4TRX A;  2K9F A;  2JZS A;  3VWU A;  1W89 A;  4XIH A;  2N5A A;  5GAN D;  4J56 E;  2H30 A;  3HVS A;  3ZYW A;  4QQ7 A;  1UA5 A;  3CSH A;  3E0U A;  6GSY A;  3D5J A;  3RDW A;  4LL4 B;  1MDI A;  3APQ A;  2LQO A;  3HVX A;  2IMF A;  1ZZY A;  5F0G A;  1B4P A;  3HKR A;  5CAX A;  4WKW A;  2XPD A;  4K9Z A;  4IW9 A;  2FD3 A;  4MK3 A;  2H0H A;  5IPH A;  1ILO A;  1PX7 A;  5IMZ A;  3UAP A;  2L57 A;  2GZP A;  1VF3 A;  3KZQ A;  2I1U A;  1SU9 A;  2F51 A;  1JLW A;  5D73 A;  3VPT A;  8GSS A;  2GZY A;  4ZB6 A;  4O92 A;  1K0O A;  3O76 A;  4JBB A;  1J08 A;  1GSE A;  2DSA A;  4KE3 A;  4BVX A;  5AIS A;  3WGE A;  4LLR A;  3WYW A;  1B9Y C;  1JFU A;  2JU5 A;  3HDC A;  5DCH A;  2GZZ A;  1EGR A;  3DML A;  1XWC A;  1A2L A;  5ECK B;  3EU3 A;  4HOJ A;  4WF4 A;  2GST A;  2HRN A;  4IGJ A;  1Z7P A;  2M46 A;  1KEB A;  1G7O A;  2C4J A;  4QL9 A;  2H1D A;  1JZW A;  2QKE A;  3E9J B;  5EY6 A;  2OE3 A;  1UN2 A;  3QAV A;  1JHB A;  1LJR A;  4MF7 A;  2L59 A;  5HFG A;  1TW9 A;  1GTB A;  3LYP A;  2E2G A;  3C8E A;  4JU5 A;  1YJ6 A;  1TK0 B;  5B6M A;  3L4N A;  1DSB A;  2HZE B;  3ERW A;  3QAG A;  5H5R A;  3F6F A;  2L5L A;  5INY A;  3KTL A;  2FNO A;  5IO0 A;  3RHC A;  1SYR A;  1TRU A;  3ZTL A;  3I9V 2;  13GS A;  1GUK A;  1JZD A;  4V2M A;  3UBK A;  2JL4 A;  3D21 A;  4RI6 A;  1XCC A;  2B7K A;  1BX9 A;  5J9C A;  4K7O A;  5D9X A;  1LU4 A;  5IIZ A;  3APS A;  3F4R A;  1I5G A;  4YAP A;  1VF2 A;  2FCH A;  5D9T A;  3E3E A;  5JCW A;  2X99 A;  3FY7 A;  3M9J A;  1B4Q A;  1YZX A;  4IJ3 A;  2DJ0 A;  3R2Q A;  4PQH A;  2C3T A;  3FEU A;  1F9M A;  4L5O A;  4RQR A;  2EIO A;  1M9A A;  3DVX A;  1ZGN A;  2EIR A;  2YZU A;  1SKR B;  1Y25 A;  1O81 A;  1B8X A;  2C3N A;  2H6Y A;  2R37 A;  3GRX A;  1V40 A;  3GTU B;  1FW1 A;  4OO4 A;  4IJI A;  1U88 A;  20GS A;  3ZRE A;  1X0R A;  2RUF A;  3LOR A;  2J23 A;  2GGT A;  4ZB8 A;  4IN0 A;  3IOS A;  3HYP A;  4XS6 A;  4MPF A;  3ED3 A;  3V1W A;  5ECR B;  4ZL8 A;  5IOX A;  4PXO A;  3GSS A;  2YP6 A;  4O5R A;  2VCX A;  4EDZ A;  5B7C A;  1MTC A;  3GH9 A;  5ID2 A;  2H75 A;  2LJR A;  1XFL A;  2DIZ A;  1OC9 B;  2RM6 A;  4D73 A;  2O85 A;  1WWJ A;  3TJF A;  3UJ1 A;  2FA8 A;  5C04 A;  2OAD A;  1GL8 A;  3TOU A;  3S9F A;  3M1G A;  1BYE A;  5H5S A;  2LST A;  1XZO A;  3I69 A;  2EIQ A;  4P3Y B;  4FO5 A;  4K0G A;  4RUV A;  2KLX A;  2KOK A;  5IM9 A;  3IK9 A;  2PGT A;  3GKM A;  1MD4 A;  4ECI A;  1SYX A;  5HQP A;  3FR6 A;  2F8A A;  5A4V A;  4AGS A;  3H4K A;  3DWV A;  3HJP A;  10GS A;  4KW6 A;  3G9B A;  2MMZ A;  4YH2 A;  3EIN A;  3TJG A;  1XW9 A;  3KD0 A;  4OFM A;  1LBK A;  1PL2 A;  1Z6M A;  1N8J A;  1V2A A;  3L9S A;  2H1A A;  5E59 A;  1GRX A;  2GSS A;  2CAI A;  4WBJ A;  1SD8 A;  2A4V A;  4LMV A;  1FHE A;  2VCT A;  1K3O A;  2GQM A;  3VUR A;  2H72 A;  2QGV A;  2H6X A;  1PGT A;  2CV4 A;  2WCI A;  3BD2 A;  4GQC A;  1XOA A;  1GSS A;  1GH2 A;  2VD1 A;  4I8B A;  1Z3E A;  3DD3 A;  4ZBB A;  3M9K A;  3KP8 A;  3APO A;  4HI7 A;  3FRC A;  1ERU A;  1T3B A;  1G6Y A;  1T4Z A;  3HZ4 A;  3UVT A;  3WGX A;  1AQV A;  4MZC A;  2FHE A;  3BCK A;  3TJJ A;  2DIY A;  2G2Q A;  4NWY A;  2HZF A;  2HYX A;  3HY2 A;  4KB3 A;  3H79 A;  2YV7 A;  4Z7X A;  3D4M A;  1TI3 A;  4IQ1 A;  4DSR A;  1G7E A;  1V98 A;  3BOA A;  4GSN A;  4MJB A;  4HUA A;  1QXH A;  2YWM A;  3FYG A;  2VM1 A;  1GUL A;  1R5P A;  3F0I A;  5J9B A;  2FGX A;  1CQH A;  3WGD A;  2IMK A;  4K7N A;  2LJA A;  4MPG A;  5J5N A;  2YCD A;  3IPZ A;  5DVB A;  1X9M B;  3GTU A;  3ERG A;  3KJY A;  4MF5 A;  4OCF A;  3RBT A;  4G10 A;  4MCU A;  1Z5Y E;  3D6I A;  4PUR A;  4ECC A;  5A4W A;  4WET A;  3GYK A;  2LV3 A;  4NHW A;  1ZCP A;  2NTO A;  1O85 A;  2I4A A;  1X5E A;  2WFC A;  5IMD A;  3IE3 A;  2VAF A;  4NMU A;  3CTG A;  2B1L A;  1QMV A;  1KNG A;  2N5B A;  2LQQ A;  4KDY A;  4PX1 A;  6GSW A;  1GNW A;  2I9H A;  3TKP A;  4HS1 A;  4GCI A;  1PMT A;  3GV1 A;  2EC4 A;  2C8U A;  2X8G A;  3EYT A;  1SK2 A;  4KUN A;  4YQU A;  1SK1 A;  5CYY A;  1NHY A;  4XS4 A;  3QCP A;  6GSX A;  4POM A;  2B5Y A;  3KEB A;  1G6W A;  4L5L A;  3ZMK A;  4TW5 A;  4IS0 A;  4KCE A;  2XBI A;  3EC3 A;  2F9S A;  3H8Q A;  4K0N A;  5AGY A;  4V1A g;  12GS A;  5B8B A;  4LL1 B;  4PNG A;  2IPA A;  4PQI A;  4EVM A;  5G5F A;  4KDX A;  3M8N A;  3Q74 A;  3QDN A;  5IMA A;  1HNB A;  5DJL A;  3CXG A;  4OFN A;  1GUM A;  1YQ1 A;  4BVY A;  2C1Y A;  3G7Y A;  1BG5 A;  3GL5 A;  3VWX A;  3ZL5 A;  5D93 A;  2VCQ A;  2H74 A;  5B8A A;  4EE0 A;  1GSD A;  3A2V A;  1M2D A;  1NW2 A;  4MH3 A;  3D4T A;  1OC3 A;  4KND A;  2REM A;  1UVZ A;  1F2E A;  1S3A A;  1GSU A;  2B3S A;  5LCZ A;  4ID0 A;  2CZ2 A;  2H70 A;  3P90 A;  4POL A;  5KN2 A;  1Q4J A;  1AXD A;  2DJK A;  1YY7 A;  3KP9 A;  1OE7 A;  2VLU A;  3IDV A;  1WPI A;  3EMX A;  1A23 A;  3QPM A;  5ENU A;  1E6B A;  2MBT A;  5G1L A;  3LFL A;  2O89 A;  5D8I A;  3M3M A;  3HHV A;  4PUA A;  1K3L A;  1TOF A;  1FG4 A;  3H93 A;  5AIX A;  3FKF A;  5G31 A;  4ZIJ A;  2P5R A;  6GSS A;  1TK8 B;  5G2Z A;  2QC7 A;  2CA8 A;  2MMA A;  3VI7 A;  3ERF A;  2ZCT A;  3F3Q A;  5J3R A;  5LNK e;  3GN3 A;  16GS A;  3GHA A;  1QQ2 A;  4OD7 A;  1PA3 A;  1MEK A;  1Y6E A;  4TN8 A;  3BCI A;  3F8U A;  4KAE A;  4RI7 A;  1THO A;  2OAC A;  2E2M A;  3FZ9 A;  3TKS E;  1PX6 A;  4EF0 A;  1QK8 A;  3NZN A;  2RM5 A;  3TCO A;  3RPP A;  6GSU A;  2J9H A;  4YQV A;  4XTS A;  3FZ4 A;  2IFQ A;  2C0D A;  5G30 A;  3TUE A;  1SK0 A;  1F37 A;  1U87 A;  3D0Z A;  1TP9 A;  1J0F A;  2HFD A;  3GNJ A;  1XWB A;  1EOH A;  3DGQ A;  5F05 A;  5B6N A;  3RPN A;  1R4W A;  3RAZ A;  4ML6 A;  3ZVJ A;  4TR0 A;  1EWX A;  2IMI A;  3G7J A;  2L4Q A;  4IVF A;  2OE0 A;  3GST A;  2PWJ A;  3TRX A;  4LA1 A;  1V57 A;  1F3A A;  3GA4 A;  3IC4 A;  5AN1 A;  4IQA A;  1GWC A;  2QSI A;  1X9W B;  2WS2 A;  3LGC A;  4GWR A;  1KBN A;  4MDC A;  3GMF A;  4EDY A;  4F9Z A;  5KN3 A;  3IV4 A;  1A2J A;  3C7M A;  4IKH A;  1HYU A;  1FAA A;  4TR1 A;  2IJY A;  1F6M C;  1FVJ A;  4PUF C;  4DEJ A;  1ZYQ B;  3TGZ A;  4F0C A;  4JE1 A;  1K0D A;  4GF0 A;  2VO4 A;  1GP1 A;  3KM6 A;  3Q6O A;  3P8W A;  2YV9 A;  1T00 A;  1YF0 A;  1I9D A;  3QFA C;  4K7I A;  4ZIL A;  4XHM A;  3P7X A;  1Q98 A;  2VL2 C;  1THX A;  4AF2 A;  4V2L A;  2ALB A;  3UEM A;  3FZA A;  4FH8 A;  2V6O A;  2DBC A;  2R4V A;  3QOU A;  2YNX A;  3CRU A;  1YKA A;  4FYU A;  4OCE A;  3EU4 A;  3MNG A;  2YN1 A;  1BJX A;  2F3M A;  19GS A;  3ZZX A;  5F8B A;  2X8H A;  3P2A A;  2XPE A;  1BED A;  4IEL A;  4JR6 A;  4CW9 A;  4XS1 A;  18GS A;  2YWN A;  2H0I A;  3PGT A;  4PQ1 A;  5GZZ B;  3ZVJ D;  3EE2 A;  5DAL B;  2VL2 A;  1OC8 A;  2FUG 2;  2HRF A;  2XC2 A;  1TXX A;  4ZL7 A;  1PRX A;  3TRQ A;  1MD3 A;  4CHS A;  3L9V A;  2MYG A;  4N0Z A;  4HEA 2;  1G0T A;  2HSY A;  5ECO B;  17GS A;  3IHQ A;  2AYT A;  3F9U A;  1XXU A;  1X5D A;  4N10 A;  2VCW A;  1K0B A;  1TRW A;  1TI1 A;  4I6X A;  1FOV A;  3ZLP A;  4EL1 A;  3BJ5 A;  4AJ7 A;  5DAK B;  1M99 A;  3HD5 A;  3DYR A;  2JAD A;  4HZ4 A;  4K2D A;  4ZXG A;  1K0M A;  2XBQ A;  1RQM A;  4MJA A;  2FA4 A;  1TU8 A;  2RUE A;  5F06 A;  4K8M A;  2GQL A;  4KA0 A;  4CDO A;  3TOT A;  3EUR A;  1YDK A;  2VL3 A;  1TDI A;  5JWQ B;  2V2G A;  1SL0 B;  2V1M A;  2C80 A;  1A0R P;  2FWH A;  4MJE A;  4F2I A;  2H71 A;  5FHI A;  2N5F A;  2R3X A;  1XWA A;  1MDJ A;  2VM2 A;  4PNF A;  2FLS A;  2MMN A;  3Q19 A;  2BTO T;  3KH7 A;  4TVE A;  4N30 A;  2H1G A;  4V2N A;  2GT5 A;  3IXR A;  3W6G A;  2VL9 A;  4IHU A;  2NPB A;  1ERW A;  1AUC A;  3GUS A;  4FYC A;  2VCZ A;  5ECI B;  1T1V A;  1XPV A;  1RW1 A;  2R6K A;  1PSQ A;  3VFI A;  1ERT A;  1PN9 A;  2L5O A;  3MAK A;  1XOB A;  1Z9H A;  3HCZ A;  1JZR A;  2HZE A;  2WJU A;  4O7H A;  4E8H A;  3FHK A;  5DQS A;  2HLS A;  5CRE A;  3TDG A;  4GRF A;  3PR8 A;  1YEX A;  1XVQ A;  3MWH A;  1ON4 A;  2H19 A;  4ECJ A;  2ES7 A;  3PH9 A;  1EOG A;  2AHE A;  5G5E A;  2O87 A;  2D2Z A;  1CQG A;  1ZYE A;  3N5O A;  3PIN A;  2YJH A;  4DSS B;  4ZB9 A;  2WDU A;  14GS A;  3VK9 A;  5HR1 A;  3SBC A;  2C0E A;  3QR6 A;  4QL7 A; 
#chains in the Genus database with same CATH topology
 3ROB A;  4HM2 B;  1J9B A;  1E2Y A;  2H6Z A;  5IEO A;  4KX4 A;  4MLY A;  1ZOF A;  1DE1 A;  2V1L A;  2CT6 A;  3EJV A;  5A0O B;  4TKY A;  4HOH A;  1A8L A;  4JZQ A;  3UOM A;  1A0F A;  1SII A;  3DIE A;  1O7N B;  3GSP A;  1W4V A;  2IA7 A;  5KN0 A;  2BMX A;  4HJ2 A;  1URM A;  1SKS B;  5DBQ A;  1B2Z A;  1K0C A;  5JWR B;  4NRE A;  1WRY A;  5CP1 A;  1PKW A;  1VGL A;  3WT1 A;  1CYU A;  3CRT A;  9GSS A;  4LMW A;  3GKX A;  3TKS C;  3EMP A;  4ECB A;  2E2V A;  2GSR A;  3WT2 A;  1CEW I;  1G96 A;  1JBS A;  2K8S A;  4JED A;  3UAR A;  1W6Y A;  1NM3 A;  4NV2 A;  1V74 A;  2WRT A;  1XW6 A;  2X49 A;  2G0F A;  1FUS A;  1PN0 A;  4DVC A;  1TIJ A;  1SJW A;  3HZ8 A;  3LG6 A;  1YF1 A;  4MEI A;  5D83 A;  3DRN A;  2CHC A;  1RRL A;  3FK8 A;  4J8T A;  4K1V A;  3PPU A;  4HQZ A;  5IMV A;  1EV4 A;  5ECH B;  3KTB A;  1YIJ 3;  1SL1 B;  22GS A;  3C73 A;  4BL2 A;  3BU4 A;  2X8C A;  4TXV A;  1IYI A;  1IVV A;  1GOV A;  2YX9 A;  1KC8 4;  5JWO B;  1B48 A;  5HR3 A;  1GTA A;  1Z1S A;  4FCJ A;  1VRS D;  3CCL 3;  3A2W A;  2GQK A;  1EEJ A;  3ER7 A;  2B1K A;  1PFO A;  2C3Q A;  2TRX A;  5HFK A;  1W01 A;  4BL3 A;  1OC9 A;  1CQS A;  1E3V A;  3WD6 A;  4IP1 A;  3KH9 A;  1XWG A;  1XWK A;  3U1W A;  1ROA A;  1QJG A;  4AJ8 A;  2C0F A;  3TKS A;  3L9U A;  2LNS A;  4KF9 A;  8CHO A;  4EW5 A;  1RN4 A;  4WXT A;  3M0F A;  5ECP B;  5ECQ B;  5AIF A;  5FWG A;  3PXM A;  4TR3 A;  4BVX B;  2F86 B;  4YAV A;  1X1U A;  3HI7 A;  4EXR A;  2XFS A;  2LQV A;  2OWP A;  2IMD A;  4IBP A;  5DJM A;  4ICY A;  3LTC A;  4HKV B;  4FYB A;  2P0M A;  5G1K A;  3TB2 A;  2WGR A;  3LTB A;  1WP0 A;  2CW9 A;  2LTK A;  1PQN A;  5CO3 A;  1A67 A;  5E4W A;  1RGA A;  1DVC A;  1BSA A;  3LZA A;  3HJM A;  5D96 A;  4KFD A;  3OR5 A;  3ZIJ A;  3QMX A;  1XVW A;  5ECM B;  3CCM 3;  5J41 A;  3I6A A;  1OGZ A;  1RNB A;  3F4S A;  2L6D A;  2IUJ A;  5HFI A;  2ON5 A;  2MBS A;  3KXO A;  4TXO B;  1QGV A;  3ZIV A;  2B5E A;  1NSW A;  2IWT A;  1BRH A;  1STD A;  5FT3 A;  3G0K A;  3CQF A;  1RGG A;  4WP5 A;  4MP4 A;  1EGO A;  3X3X A;  5A5K A;  3UBL A;  3J7Y k;  1GSQ A;  1IT8 A;  2IUK A;  4HU9 A;  4RQX A;  1RGH A;  2P31 A;  4MF6 A;  5ECN B;  4IP6 A;  1IVU A;  1C72 A;  4NHZ A;  1NWW A;  1WE0 A;  1GNE A;  5IMC A;  3HA9 A;  4HZ2 A;  1QMA A;  2Z9S A;  2HE3 A;  1D6Z A;  3G8Z A;  3I55 3;  8RNT A;  4GHO A;  2LKU A;  3LSZ A;  4XM4 A;  2V32 A;  2QIY A;  1ZYN A;  2HML B;  4GB5 A;  4HDE A;  4ISD A;  1RDS A;  1YKC A;  4I2T A;  2H73 A;  1K3Y A;  2IIY A;  1Y4K A;  4HU7 A;  3ZFL A;  2XR8 B;  1GD3 A;  3UL6 A;  1UGH I;  4U13 A;  4YQM A;  1OAC A;  1AVL A;  4OFT A;  3VI5 A;  3ZML A;  3NX0 A;  1HD2 A;  5DQY A;  1F3B A;  2GLR A;  3CCV 3;  1RTU A;  4OMV A;  3CCE 3;  1WJK A;  4KSM A;  7GSS A;  3AY8 A;  5M18 A;  4GST A;  1EEM A;  2RSX A;  3I43 A;  4ILF A;  1DMM A;  4WFO A;  2R2J A;  4MZB A;  5KN1 A;  4HM7 B;  2WUL A;  5IG0 A;  4Q5R A;  4J57 E;  4BL7 A;  3RHB A;  3PS8 A;  1N2A A;  3TKQ A;  3FZ5 A;  2MZC A;  4I5Q A;  3KZT A;  5ELG A;  4Z2U A;  4HAA A;  1GSY A;  4G9H A;  3A5W A;  3MDK A;  2R0G A;  3F8H A;  3C71 A;  3HVV A;  1FVK A;  4OWY A;  4I97 A;  3IAM 2;  1ZL9 A;  3LH4 A;  3FG1 A;  4NV5 A;  2H1B A;  5JCG A;  1BNJ A;  3S28 A;  5CNW A;  1JKG B;  2HI7 A;  3U6V A;  3EWL A;  1IV7 A;  2IY2 A;  2E7P A;  1BGS A;  1TFO A;  3LTA A;  1JZO A;  4Q5F A;  1SJI A;  1T4Y A;  4X4J A;  1AQZ A;  1LOY A;  5EVO A;  3DEX A;  1M9B A;  1BUJ A;  1IYY A;  1UCJ A;  2PVQ A;  4J2F A;  4R1K A;  2OA7 A;  2O8V B;  2LEG A;  1ERV A;  2CH9 A;  2B5X A;  4ORL A;  1TJD A;  3AHW A;  3IMA B;  2VLT A;  2PUK C;  1ML6 A;  5D81 A;  1O7W B;  1R4C A;  1T5Y A;  2UGI A;  2WB9 A;  3FR9 A;  4F0B A;  4ZL9 A;  4KDU A;  1W7C A;  3US3 A;  1LQG C;  4X0X A;  5IPG A;  1ST9 A;  2HSM A;  2OJL A;  3N9H A;  1IT7 A;  1GTU A;  4HQS A;  2LRT A;  4XRD A;  4TR4 A;  3CC7 3;  5ECL B;  4XB5 A;  1SKW B;  3GX8 A;  1BSD A;  2LJK A;  1TTZ A;  5IER A;  4LSO A;  1O7U A;  1PYL A;  3B8L A;  2W6J H;  3DGN A;  2RCD A;  3CTF A;  2C11 A;  4RNT A;  1OHP A;  2XGL A;  3KCM A;  4F03 A;  1BRN L;  4K1F A;  5ID2 B;  3W8S A;  2YWI A;  2W9Q A;  5EQL A;  2HNL A;  2GSQ A;  2DJ1 A;  3S29 A;  3DGM A;  2ZDJ A;  5GST A;  4BWQ A;  1ASK A;  4D73 B;  1W4N A;  4MNN A;  1PKZ A;  2B6M A;  4R9L A;  4IT7 A;  5AYR B;  3LJR A;  1DE2 A;  2K18 A;  1WMN A;  2CX3 A;  1R26 A;  1V9W A;  5IEN A;  2RII A;  3ISO A;  2NDO A;  1K41 A;  3X3Y A;  1IYH A;  1KTE A;  1XG8 A;  4N6M A;  1USB A;  3F3R A;  1BRJ A;  1X9S B;  2A2S A;  3CPO A;  2HSH A;  3JCM L;  1SEN A;  1DUG A;  1YEP A;  3LWA A;  2XF3 A;  3DXB A;  1LRA A;  2CX4 A;  2IME A;  3ZIT A;  4IIA A;  3U5R E;  3LT8 A;  1AAZ A;  4HJM A;  1TRP A;  5IOW A;  1GY5 A;  2A2P A;  5COH A;  1AIU A;  2I3Y A;  2VLV A;  2AUV A;  2OKA A;  1RGL A;  1LOV A;  5AIV A;  3KN4 A;  4TXO A;  3NHX A;  1A8Y A;  4BPY A;  3UVH A;  3BNC A;  4N11 A;  2NBS A;  3FW2 A;  4KGI A;  2QA4 3;  3K8N A;  4ZBA A;  1VQQ A;  3K5T A;  2DMM A;  5ELJ A;  3QRD A;  4LMI A;  4G19 A;  1K0N A;  1AQX A;  1ACV A;  3MWZ A;  5IF6 A;  1W00 A;  2V6K A;  1OHO A;  1M0U A;  3K0Z A;  1SJ6 A;  2K0M A;  4NXI A;  2I81 A;  1NB5 I;  2GVP A;  1JB4 A;  1GSF A;  5IQY A;  1JLV A;  4EXJ A;  3F4T A;  3NBR A;  2MC8 A;  3B4P A;  2V41 A;  1BQ7 A;  2LNT A;  1MGR A;  1OYJ A;  2YZH A;  1SD9 A;  2ZL8 A;  3CSJ A;  3BNB A;  3Q1C A;  4RBN A;  3O3T A;  1O7M B;  1H4O A;  3HJO A;  2OE1 A;  3KMN A;  7STD A;  2AJQ B;  1VQ5 3;  3MSZ A;  1OKD A;  2P5Q A;  4XCS A;  1UCI A;  5C00 A;  2CX1 A;  2OBI A;  1PD2 1;  3EB8 A;  2NVL A;  4LEH A;  2QEX 3;  2O7K A;  2VOC A;  2Z7A A;  4MA9 A;  6GSV A;  2CC3 A;  1SPU A;  2X64 A;  5AEW B;  4NPB A;  3CXC 2;  3DKS A;  2M80 A;  1UUW B;  4Q5Q A;  4GSS A;  3ME8 A;  1KQS 2;  5ABR A;  1WOU A;  4H86 A;  1ZO2 A;  1A2V A;  1X1X A;  3CCQ 3;  1AW9 A;  1BRS A;  2IMJ A;  2YOI A;  3GAX A;  4GTU A;  3GKN A;  4EV2 A;  2ZUP A;  1EZK A;  1TP6 A;  2K6V A;  3AMO A;  2DJ2 A;  4ULX A;  3GX0 A;  3F6D A;  1UC7 A;  2XSO B;  1JKG A;  2PBJ A;  3UL3 A;  2DML A;  1OF5 B;  1QAK A;  2CAQ A;  5CRD A;  1HNC A;  1J2B A;  1BRG A;  3F9S A;  2DKI A;  5D9V A;  2GBX B;  4O3V A;  4N6U A;  1GUH A;  1S3R A;  1EQK A;  1WMJ A;  2OBK A;  4FMA A;  2PMT A;  1OKT A;  3VPQ A;  2JDI H;  1TK5 B;  4MJC A;  2Y74 A;  2E0Q A;  3AGN A;  1Q7H A;  2ZNM A;  2GT6 A;  1EP8 A;  4PGT A;  4TOP A;  1HQO A;  1IV9 A;  4HM6 B;  4ZBD A;  2FWE A;  4ML1 A;  4POB A;  1B9X C;  1VQ7 3;  3DVW A;  1RCK A;  1NNV A;  3FR3 A;  1VF1 A;  4EV5 A;  5KP3 A;  4JR4 A;  4YKF A;  1WIK A;  2XEP A;  1STF I;  2O9U X;  4WR5 A;  1TRV A;  4EO3 A;  1Z7R A;  2LS5 A;  3LTD A;  2JZT A;  3MG3 A;  1N5P A;  4L7K A;  1GY7 A;  1SJZ A;  1E97 A;  2LUS A;  1R5A A;  3OWY A;  1U6T A;  1M2A A;  1YVB I;  2P0G A;  3CSI A;  2YFJ B;  5BXQ A;  1DET A;  4WEY A;  1O8W A;  1GSP A;  4GXZ A;  4GQF A;  2K3D A;  5IG3 A;  3D4A A;  3NM2 A;  1RJO A;  2R0C A;  1X5C A;  4YKG A;  5KOX A;  4HVN A;  1JRQ A;  1XW5 A;  2VCV A;  1ZS7 A;  3IA1 A;  1DE3 A;  3GH6 A;  1U3I A;  2KUC A;  3IBH A;  1B2M A;  4XS4 B;  3EQQ B;  1ZYP A;  3SYU A;  1TKD B;  2R5G A;  3CBU A;  3CCU 3;  1T8E B;  2BJX A;  3IRA A;  3O6T A;  2AAE A;  1U8C B;  3ZRD A;  3JUN A;  2CFD A;  3GZX B;  4IPB A;  1PY3 A;  4O5Q A;  2PPT A;  3F8X A;  4N6V 0;  5DDL A;  2QA1 A;  3KIJ A;  2VUP A;  4Q53 A;  5CRH A;  2L4C A;  2FWG A;  1I2F A;  3GIX A;  3SWL A;  3X41 A;  5GSS A;  4OO5 A;  5DCG A;  3Q18 A;  3C1R A;  5JPU A;  3LQ7 A;  2ON7 A;  1B21 A;  4F82 A;  3LT9 A;  6GST A;  4HBR A;  4KCA A;  2PU9 C;  2K8V A;  3LXZ A;  2YPM A;  1O6J A;  4DSQ A;  1FGR A;  5RNT A;  2DLX A;  3WOF B;  5GSP A;  3T8U A;  4XDW A;  2H01 A;  1BRK A;  2H0G A;  3L0H A;  4K5S A;  4WBR D;  3VLN A;  11GS A;  1JBT A;  4BVY B;  2RLI A;  3UNL A;  3KE7 A;  3CYN A;  4WF5 A;  1DVD A;  1RGC A;  1H75 A;  4MZW A;  1K0A A;  2AV4 A;  4HM5 B;  1A24 A;  3ME7 A;  3S67 A;  1FUT A;  5IO2 A;  3FSD A;  2QGU A;  2GTU A;  3UIW A;  1XBS A;  3FZW A;  1E3R A;  4NAX A;  4MAB A;  3MG2 A;  2H66 A;  4POK A;  4E8E A;  1FO5 A;  1O8X A;  1VQ4 3;  4G2E A;  3UMA A;  2IL3 A;  2TRC P;  2WZ9 A;  3J7Y b;  2H76 A;  5GAP D;  1HNA A;  5IMF A;  4MMM A;  2B7J A;  4HZB B;  2YWO A;  1K8A 4;  5J4U A;  2BIR A;  2H8L A;  4L0U A;  3NIV A;  4N0V A;  3EVI A;  2CVB A;  4GLT A;  1GLP A;  3UJM A;  3QFB C;  5HR0 A;  1T7P B;  1BRI A;  1O73 A;  2HRA A;  5DAL A;  1EP7 A;  2HXK A;  4WWU C;  2PN8 A;  1BAY A;  4L0W A;  3KGK A;  1BNI A;  2W04 A;  4EUY A;  4O02 B;  1QUW A;  2A2R A;  3W8J A;  1SL2 B;  4CJN A;  4CY8 A;  3V99 A;  2W56 B;  4RNY A;  1FB0 A;  3CC4 3;  4WR4 A;  2GEY A;  3CMI A;  3BBY A;  3G4S 3;  3JUM A;  3VWV A;  3C1S A;  2PER A;  3A3T A;  3TRP A;  2GU1 A;  1OAZ A;  3H1N A;  1M1X B;  2X4A A;  2JSZ A;  2AAW A;  4XDV A;  5JCU A;  4J5G A;  2KXG A;  3MYD A;  4J5K A;  1QAF A;  1AQW A;  2WO0 A;  3GKK A;  5AIG A;  1U3A A;  3CCS 3;  4EC0 A;  3N9J A;  2KHP A;  3Q90 A;  1TU7 A;  3IJE B;  1BNS A;  2CFL A;  5KP4 A;  2DJ3 A;  5D9W A;  2CVD A;  1CH0 A;  3EHC A;  3GFK A;  3EN1 B;  1VQ8 3;  5DAK A;  4WYK B;  4EIP A;  2XHF A;  2DJJ A;  2LRC A;  2F5M A;  2Z76 A;  5LC7 A;  3F63 A;  2KF5 A;  2YJ7 A;  5STD A;  1M2B A;  2IFQ B;  2O3O A;  2W2C A;  1I2G A;  3CD6 3;  4GSP A;  3IR4 A;  2JAC A;  1FZU A;  3D22 A;  3AGO A;  1FB6 A;  3ZFB A;  4ACS A;  3NV0 A;  3BNE A;  3VWW A;  2CFG A;  3S27 A;  2GDR A;  4KH7 A;  1IVW A;  2HMO B;  4MMY B;  4H3U A;  4K6X A;  2TIR A;  1OH0 A;  4X1U A;  1RK4 A;  3QK9 A;  1BIR A;  4I2U A;  1ULJ B;  4X43 A;  4KSO A;  1ABA A;  5CRG A;  1RN1 A;  1MDK A;  4L8E A;  3DH2 A;  1K9M 4;  1R7H A;  4EKZ A;  3GL3 A;  3NBB A;  1LOW A;  4HM4 B;  1V58 A;  1I0X A;  5EL8 A;  1EUI C;  3LEF A;  2W9P A;  2HT9 A;  3WOE B;  1S3D A;  2M72 A;  3KMO A;  2FY6 A;  1EV9 A;  5A4U A;  2HMM B;  5KEJ A;  4Q5N A;  3TKR A;  1AV4 A;  1ROV A;  3GZB A;  4J9A A;  2CZ3 A;  2D1W A;  1QVG 2;  2MMO A;  3MKI A;  1ZMA A;  1AC1 A;  5H5Q A;  2YAN A;  2PVO C;  3TJK A;  1GLQ A;  3CCR 3;  2C0G A;  1TRS A;  4O2H A;  1AY7 A;  3NUV A;  1PL1 A;  5HR2 A;  4CCV A;  4TR1 B;  2F8F A;  1SIH A;  3CME 3;  1B27 A;  1JJ2 2;  3HXS A;  5LD0 A;  4MH2 A;  2JSY A;  1IDP A;  3EN8 A;  1C7H A;  1BOX A;  2WGQ A;  1D6U A;  2E2U A;  3QD9 A;  4BWS A;  1C54 A;  3A2X A;  5L71 A;  2CVK A;  2FWF A;  1JNQ A;  2YFL B;  3RDE A;  4BTY A;  2GS3 A;  3A5I A;  2DC5 A;  2B24 B;  1A2K A;  3ZFZ A;  3VSY A;  5EPF A;  1XIY A;  1A2M A;  4XRA A;  1DBY A;  3GUR A;  2CKF B;  4USS A;  4DSS A;  2JZR A;  1VF4 A;  2R0P A;  1VQK 3;  2KP1 A;  5F07 A;  2VIM A;  2AB6 A;  4OK0 A;  1VQL 3;  1YGE A;  3B7C A;  3VF1 A;  1S3C A;  4K2X A;  3HII A;  1Z6N A;  1OVN A;  2KP2 A;  3LYK A;  3QAW A;  3G7I A;  5ECS A;  2PNC A;  2FGT A;  1BSE A;  4JRR A;  2STD A;  4V1A p;  3WDG B;  4BA7 A;  1B3S A;  1OE8 A;  3L78 A;  1WMP A;  3IAS 2;  2LRN A;  1GTI A;  3IK7 A;  1NDO B;  2CX0 A;  2IYJ A;  1KSI A;  1M7T A;  1RGE A;  2Q07 A;  5CRW A;  5ELA A;  2CIU A;  1QFN A;  4AJ6 A;  3TJB A;  4X2H A;  2L6C A;  4BTX A;  2VD0 A;  1NB3 I;  4O32 A;  4LGQ A;  1NHO A;  2CQ9 A;  3LXT A;  2IN3 A;  3D5I A;  2BHM A;  3HOH A;  3NOF A;  3CMA 3;  4FIW A;  1FGO A;  1O7P B;  3FMW A;  4TRX A;  2K9F A;  2JZS A;  1Q86 4;  2W0Q A;  5BIR A;  3VWU A;  1W89 A;  4XIH A;  5AIH A;  2N5A A;  3OXA A;  5GAN D;  4J56 E;  2H30 A;  1HKX A;  1IQX A;  3HVS A;  3ZYW A;  4QQ7 A;  1PU4 A;  1UA5 A;  3CSH A;  1QAL A;  3E0U A;  6GSY A;  3J7Y d;  3F40 A;  5CK6 A;  3D5J A;  1HZ1 A;  1MWS A;  4LL4 B;  1MDI A;  3RDW A;  3APQ A;  2LQO A;  3HVX A;  2IMF A;  2F56 A;  1ZZY A;  5F0G A;  3SLU A;  1FA3 A;  1WQL B;  1B4P A;  3HKR A;  2KF3 A;  5CAX A;  1UI8 A;  2DKH A;  2XPD A;  4WKW A;  3NM7 A;  4K9Z A;  4IW9 A;  1BU4 A;  3M8C A;  1N9J A;  3DXO A;  2FD3 A;  4MK3 A;  2H0H A;  5IPH A;  1ILO A;  1PX7 A;  2KAA A;  5IMZ A;  2KF4 A;  3NBJ A;  3DZL A;  3UAP A;  2L57 A;  2GZP A;  1VF3 A;  3KZQ A;  2I1U A;  1SU9 A;  2F51 A;  1JLW A;  5D73 A;  1FGM A;  1OUN A;  4L8P A;  3VPT A;  4STD A;  8GSS A;  2GZY A;  4ZB6 A;  1GOY A;  4O92 A;  1K0O A;  3O76 A;  4JBB A;  4N6N B;  1YNV X;  4KVH A;  1YI2 3;  1J08 A;  1GSE A;  2DSA A;  4KE3 A;  4BVX A;  5AIS A;  3WGE A;  4AEQ A;  4LLR A;  3WYW A;  3KII A;  1B9Y C;  1JFU A;  2JU5 A;  4FMC A;  3HDC A;  4FMD A;  2F99 A;  2GSP A;  5DCH A;  2C10 A;  3I0Y A;  2GZZ A;  1EGR A;  3DUK A;  3DML A;  1XWC A;  3LOY A;  1A2L A;  1JN5 B;  1W5Z A;  4TX4 A;  5ECK B;  2LYX A;  3EU3 A;  4HOJ A;  5D82 A;  4WF4 A;  2GST A;  2HRN A;  4IGJ A;  1Z7P A;  2M46 A;  1KEB A;  1G7O A;  2C4J A;  1BNF A;  3ECF A;  4QL9 A;  2H1D A;  1M3J A;  1JZW A;  2QKE A;  1TFK A;  3U97 A;  2UUG C;  3OW2 2;  3E9J B;  5EY6 A;  3ZG0 A;  2OE3 A;  3WOD G;  3PCR A;  2MF7 A;  3HZP A;  4GL6 A;  1EA2 A;  1UN2 A;  3QAV A;  1YGW A;  1JHB A;  3DGL A;  1LJR A;  4MF7 A;  3K9M C;  2L59 A;  5HFG A;  4R9K A;  1TW9 A;  2F98 A;  1GTB A;  2HRK A;  3LYP A;  2HOH A;  2E2G A;  3C8E A;  4JU5 A;  1YJ6 A;  1TK0 B;  5B6M A;  3L4N A;  2C4B A;  3RGA A;  1DSB A;  2HZE B;  3ERW A;  3QAG A;  5H5R A;  3EBY A;  1NO3 A;  1M1K 4;  3F6F A;  2K54 A;  2L5L A;  5INY A;  3KTL A;  1FOH A;  1B2S A;  2FNO A;  5IO0 A;  3RHC A;  1SYR A;  1TRU A;  3ZTL A;  3I9V 2;  13GS A;  1GUK A;  1JZD A;  2BNG A;  3GRD A;  4V2M A;  1KWI A;  3N8B A;  3UBK A;  2JL4 A;  3D21 A;  4RI6 A;  1XCC A;  4O8S A;  2CWT A;  2B7K A;  1BX9 A;  5J9C A;  3PGB A;  4K7O A;  5D9X A;  1LU4 A;  5IIZ A;  3APS A;  3F4R A;  1I5G A;  5M19 A;  4CY6 A;  4YAP A;  1VF2 A;  4FQU A;  2FCH A;  5D9T A;  3E3E A;  5JCW A;  1JV2 B;  1Q40 B;  2X99 A;  3FY7 A;  3M9J A;  1B4Q A;  1YZX A;  4IJ3 A;  2DJ0 A;  3R2Q A;  4PQH A;  3KCH A;  2OOV C;  7GSP A;  2C3T A;  3FEU A;  1F9M A;  4L5O A;  1DMN A;  1T2I A;  4RQR A;  2EIO A;  1T2H A;  4N6T A;  1M9A A;  3DVX A;  1ZGN A;  2EIR A;  2YZU A;  1SKR B;  1GYB A;  1K73 4;  1Y25 A;  1BNR A;  1O81 A;  1B8X A;  2C3N A;  3BLZ A;  3NQY A;  1NU3 A;  2M7O A;  2H6Y A;  1TU5 A;  2R37 A;  3GRX A;  3CNX A;  1W2Z A;  1V40 A;  5FGO A;  3E99 A;  1GS3 A;  3D79 A;  3G6E 3;  4FR9 A;  3GTU B;  1FW1 A;  2OTJ 3;  4OO4 A;  4IJI A;  1U88 A;  20GS A;  3ZRE A;  1X0R A;  2RUF A;  3LOR A;  2J23 A;  2GGT A;  4HM8 B;  4ZB8 A;  4IN0 A;  3IOS A;  3OWS A;  1ZX2 A;  5TGN A;  3HYP A;  4XS6 A;  4MPF A;  3ED3 A;  3V1W A;  5ECR B;  4ZL8 A;  5IOX A;  1RGK A;  1DMQ A;  2YP6 A;  3JVC A;  3GSS A;  4PXO A;  4EIQ A;  4O5R A;  1SQW A;  2VCX A;  4EDZ A;  1GD4 A;  3I56 3;  2OOV A;  5B7C A;  1MTC A;  3B4O A;  9RNT A;  2P09 A;  3GH9 A;  5ID2 A;  1BSB A;  2H75 A;  2LJR A;  2WOF A;  1XFL A;  2DIZ A;  1I3F A;  1OC9 B;  3K63 A;  2RM6 A;  1W6C A;  4D73 A;  1IQ8 A;  2O85 A;  1WWJ A;  1RRH A;  3TJF A;  3UJ1 A;  2FA8 A;  3HIG A;  5C04 A;  2OAD A;  4FCM A;  3DM8 A;  2A15 A;  4LZI A;  1GL8 A;  3TOU A;  3S9F A;  3M1G A;  1BYE A;  4XBY A;  5H5S A;  2LST A;  1HYF A;  3S5C A;  1XZO A;  3I69 A;  1JB2 A;  2EIQ A;  4P3Y B;  2FNQ A;  4WHA A;  1LXE A;  1ISK A;  4FO5 A;  4K0G A;  4RUV A;  1GMQ A;  2KLX A;  2KOK A;  5IM9 A;  3V98 A;  5BU4 A;  5KOW A;  2QA2 A;  3IK9 A;  2PGT A;  3GKM A;  1MD4 A;  4ECI A;  1SYX A;  5HQP A;  3FR6 A;  2F8A A;  5A4V A;  4AGS A;  3Q3F A;  3KKG A;  3H4K A;  3DWV A;  2RGQ A;  3HJP A;  4QWT A;  10GS A;  4KW6 A;  3MYT A;  3G9B A;  1IU7 A;  2MMZ A;  4YH2 A;  1LNH A;  3EIN A;  3TJG A;  1XW9 A;  3KD0 A;  4OFM A;  1LBK A;  4EYC A;  1EG9 B;  1PL2 A;  3HVN A;  1Z6M A;  4R80 A;  1N8J A;  1V2A A;  3L9S A;  5FW5 A;  2H1A A;  1FGT A;  5E59 A;  2SAR A;  3FG3 A;  1GRX A;  2GSS A;  2CAI A;  2FXT A;  4WBJ A;  3STD A;  1SD8 A;  2UX0 A;  3MIX A;  3BIR A;  4G1M B;  2A4V A;  1OGX A;  1JBR A;  4LMV A;  1EKM A;  1FHE A;  4KT3 B;  2VCT A;  1K3O A;  3BB9 A;  3MSO A;  2GQM A;  3VUR A;  3PCS A;  1YJN 3;  2GEX A;  1NJI 4;  2H72 A;  2QGV A;  4HM0 B;  1GMR A;  2L1S A;  2H6X A;  1PGT A;  1WNH A;  2CV4 A;  3CC2 3;  2WCI A;  3BD2 A;  4GQC A;  3WA3 A;  2BMO B;  1XOA A;  1GSS A;  2XRX B;  3CU3 A;  4N6L A;  1A2P A;  1GH2 A;  2VD1 A;  4I8B A;  1RGF A;  2Z6B A;  1OCV A;  1Z3E A;  1B2X A;  3DD3 A;  4ZBB A;  3M9K A;  3KP8 A;  3APO A;  4HI7 A;  3FRC A;  2CG0 A;  1ERU A;  1RNT A;  2SBL A;  1T3B A;  1G6Y A;  1T4Z A;  3HZ4 A;  3UVT A;  1OHS A;  1AQV A;  3WGX A;  4MZC A;  1Q9E A;  2FHE A;  2A4H A;  3BCK A;  1Q40 A;  3TJJ A;  2DIY A;  3PYJ A;  3H51 A;  1LNI A;  2G2Q A;  4NWY A;  2GBW B;  2HZF A;  2HYX A;  1I0V A;  3HY2 A;  4KB3 A;  1JB5 A;  3H79 A;  2YV7 A;  4KZ1 A;  1CYV A;  4Z7X A;  2YFI B;  1W2B 2;  3D4M A;  1TI3 A;  4BL7 B;  4IQ1 A;  4DSR A;  3X42 A;  1G7E A;  4AKY A;  1V98 A;  3BOA A;  3OX9 A;  4GSN A;  3MG1 A;  4MJB A;  4HUA A;  1QXH A;  1YVS A;  2YWM A;  3FYG A;  2VM1 A;  1GUL A;  1M9G A;  1R5P A;  3F0I A;  1RHL A;  3UB1 A;  5J9B A;  2FGX A;  3JUQ A;  1OF5 A;  1CQH A;  3WGD A;  2CG1 A;  5AYS C;  2IMK A;  4K7N A;  4PEJ A;  2LJA A;  4X2O A;  4MPG A;  5J5N A;  2YCD A;  3IPZ A;  5DVB A;  1X9M B;  1S72 3;  3GTU A;  3ERG A;  3KJY A;  1KD1 4;  4G0K A;  4MF5 A;  4OCF A;  3RBT A;  3ZG5 A;  5HGR A;  4G10 A;  4MCU A;  1Z5Y E;  3FLJ A;  3D6I A;  4PUR A;  5KP1 A;  4ECC A;  5A4W A;  3SOY A;  4WET A;  3GYK A;  1F8N A;  2LV3 A;  4XBT A;  4NHW A;  6GSP A;  1M3I A;  2OCT A;  1ZCP A;  2NTO A;  1O85 A;  5DRV A;  2I4A A;  1X5E A;  2WFC A;  3SOA A;  5IMD A;  3IE3 A;  2VAF A;  4NMU A;  4JRF A;  3CTG A;  2B1L A;  1YJ9 3;  1QMV A;  6RNT A;  1KNG A;  2N5B A;  2LQQ A;  2WGO A;  4KDY A;  4PX1 A;  1FGQ A;  5IG5 A;  2I9W A;  6GSW A;  4EC6 A;  4L8O A;  3GZR A;  4BIR A;  1GNW A;  3UL5 A;  2I9H A;  3TKP A;  4FMB A;  4HS1 A;  5CF2 A;  2B1X B;  4GCI A;  1PMT A;  3GV1 A;  5DRE A;  3FH1 A;  3F7X A;  2EC4 A;  2C8U A;  1I2E A;  1L5G B;  2X8G A;  5BVB A;  1Q7Y 4;  5EEO A;  3EYT A;  4NHF A;  1SK2 A;  2XSH B;  3DMC A;  1U5O A;  3PZW A;  4KUN A;  4YQU A;  1GOU A;  1SK1 A;  5CYY A;  1NHY A;  4XS4 A;  3GZY B;  3QCP A;  6GSX A;  4POM A;  2B5Y A;  4MJD A;  3KEB A;  1G6W A;  4L5L A;  4AKZ A;  3ZMK A;  3LW9 A;  4TW5 A;  2F5W A;  4IS0 A;  1Q81 4;  3IPT A;  3FKA A;  4K61 A;  4KCE A;  2XBI A;  3EC3 A;  2F9S A;  3H8Q A;  4K0N A;  5AGY A;  4V1A g;  3VGN A;  2KRT A;  4G0L A;  3OWU A;  1TUH A;  12GS A;  5B8B A;  5JBS A;  4LL1 B;  4PNG A;  2IPA A;  4PQI A;  4EVM A;  5G5F A;  2INX A;  4KDX A;  1S5A A;  3M8N A;  3DY5 A;  2HMJ B;  3Q74 A;  3QDN A;  5IMA A;  1HNB A;  5DJL A;  1UCK A;  1RN7 A;  3CXG A;  4K1U A;  2ZHX B;  4OFN A;  1GUM A;  5ELU A;  1YQ1 A;  4BVY A;  2C1Y A;  3G7Y A;  1BG5 A;  3GL5 A;  3VWX A;  3WMD A;  3ZL5 A;  5D93 A;  2VCQ A;  2H74 A;  5B8A A;  4EE0 A;  3NXJ A;  3V92 A;  2BT3 A;  1UCL A;  1GSD A;  3GWR A;  3A2V A;  1M2D A;  1NW2 A;  4K5R A;  4MH3 A;  1GY6 A;  3BND A;  3D4T A;  1OC3 A;  1FYS A;  4KND A;  4Z2T A;  3FCS B;  2REM A;  1UVZ A;  1F2E A;  1IVX A;  1I3I A;  1S3A A;  1GSU A;  2B3S A;  3LXU X;  5LCZ A;  4ID0 A;  2CZ2 A;  2H70 A;  3P90 A;  4POL A;  5KN2 A;  1Q4J A;  1AXD A;  2DJK A;  3EF8 A;  1YY7 A;  3KP9 A;  1OE7 A;  2VLU A;  2R41 A;  3IDV A;  1WPI A;  3EMX A;  1I70 A;  3LYG A;  1A23 A;  3QPM A;  5ENU A;  1E6B A;  2MBT A;  4Z2R A;  1WTH A;  5G1L A;  4BTW A;  5CLK A;  3LFL A;  1I8V A;  3DGY A;  4JF8 A;  2O89 A;  5BRT A;  3SED A;  5D8I A;  3K7C A;  3M3M A;  1HU9 A;  5AI1 A;  1Q42 A;  3HHV A;  4FCZ A;  4PUA A;  1K3L A;  1TOF A;  1G02 A;  1FG4 A;  4CDL A;  3H93 A;  5AIX A;  3FKF A;  1VQP 3;  1YJW 3;  5G31 A;  2PZV A;  4ZIJ A;  2CK3 H;  1IQY A;  5CXO A;  2P5R A;  3IC8 A;  3LML A;  1W02 A;  6GSS A;  3T0U A;  1TK8 B;  3D3L A;  5G2Z A;  2QC7 A;  2CA8 A;  2MMA A;  3VI7 A;  2W56 A;  3ERF A;  3MHE A;  2ZCT A;  3F3Q A;  1UGI A;  5J3R A;  5LNK e;  1FUW A;  2RNT A;  3GN3 A;  16GS A;  5AII A;  3GHA A;  1QQ2 A;  3AMO B;  3KSE D;  4OD7 A;  1D6Y A;  3H3H A;  1PA3 A;  1MEK A;  1Y6E A;  4TN8 A;  1DYU A;  3BCI A;  3F8U A;  4KAE A;  3WHO A;  4RI7 A;  1THO A;  2OAC A;  2E2M A;  2UZ8 A;  3FZ9 A;  3OV4 A;  3CPW 2;  1MOL A;  1MWU A;  4WYK A;  1PX6 A;  3TKS E;  4EF0 A;  3JUP A;  1QK8 A;  3NZN A;  5IW9 A;  2RM5 A;  3TCO A;  3RPP A;  6GSU A;  2GU3 A;  2J9H A;  4YQV A;  4XTS A;  3FZ4 A;  2IFQ A;  2C0D A;  5G30 A;  3AHS A;  3FG4 A;  3TUE A;  3O8Y A;  1SK0 A;  1UW1 A;  1QVF 2;  1F37 A;  1MWR A;  1U87 A;  3D0Z A;  2F4Y A;  1TP9 A;  2Y73 A;  1J0F A;  3EC9 A;  2HFD A;  2J8X B;  3EPT A;  2XH9 A;  3GNJ A;  1XWB A;  1GMP A;  1EOH A;  1VQ6 3;  3DGQ A;  5F05 A;  3KFQ C;  3RPN A;  1R4W A;  5B6N A;  3RAZ A;  2P38 A;  4ML6 A;  1LOX A;  3ZVJ A;  4TR0 A;  1EWX A;  3FF0 A;  2IMI A;  3G16 A;  4ZM8 A;  3G7J A;  1N8R 4;  2L4Q A;  5EVH A;  2CWV A;  4IVF A;  3JUO A;  2OE0 A;  3GST A;  2PWJ A;  3TRX A;  4OVM A;  4LA1 A;  1V57 A;  5IEP A;  1F3A A;  3GA4 A;  3IC4 A;  2ML6 A;  1LVN A;  4HM3 B;  5AN1 A;  4N3V A;  4IQA A;  1GWC A;  2QSI A;  1X9W B;  3F7S A;  4KFF A;  2WS2 A;  3LGC A;  4GWR A;  1SAR A;  3X3Z A;  1R4Y A;  1KBN A;  4MDC A;  3WA2 X;  3GMF A;  4EDY A;  4F9Z A;  5KN3 A;  3T8N A;  3IV4 A;  1A2J A;  4I4K A;  3C7M A;  1HYU A;  4IKH A;  1FAA A;  4TR1 A;  2IJY A;  1F6M C;  1FVJ A;  4PUF C;  4DEJ A;  1MNL A;  1ZYQ B;  3A5E A;  4G0I A;  3TGZ A;  4F0C A;  3IHG A;  1IK3 A;  3CNM A;  4JE1 A;  2CFK A;  4HYZ A;  2WOH A;  1K0D A;  4GF0 A;  2VO4 A;  3FGY A;  4BU4 A;  1GP1 A;  3KM6 A;  3Q6O A;  3P8W A;  2YV9 A;  1TRQ A;  1AVK A;  1T00 A;  1YF0 A;  2XFT A;  3CCJ 3;  2ML5 A;  1I9D A;  3QFA C;  1ZGX A;  4K7I A;  4ZIL A;  4OUQ A;  4XHM A;  4RNZ A;  3P7X A;  4RZM A;  1Q98 A;  2CWU A;  3SVA A;  2VL2 C;  1THX A;  4AF2 A;  2P0X A;  2BO9 B;  4V2L A;  2ZA4 A;  2ALB A;  1N9E A;  3UEM A;  3FZA A;  4FH8 A;  2RFR A;  2V6O A;  1ULI B;  1RSN A;  2DBC A;  2BMR B;  2R4V A;  1UI7 A;  3QOU A;  2YNX A;  5M1A A;  1RLS A;  5HOH A;  2HMK B;  4HJL B;  3HX8 A;  3CRU A;  1YKA A;  4FYU A;  4OCE A;  1YIT 3;  3EU4 A;  2XGN A;  3NQZ A;  5JPP A;  3MNG A;  2YN1 A;  3MPH A;  4H61 A;  1VQ9 3;  1OPY A;  1BJX A;  3SXX A;  1US1 A;  2F3M A;  19GS A;  3ZZX A;  5LC6 A;  5F8B A;  3FF2 A;  4MMZ B;  2X8H A;  3P2A A;  2OQE C;  1BED A;  2XPE A;  4IEL A;  4BIK A;  1WMO A;  4KFE A;  3EE1 A;  1BVI A;  4JR6 A;  4CW9 A;  5CF1 A;  4XS1 A;  18GS A;  3KSP A;  2YWN A;  2H0I A;  3PGT A;  4PQ1 A;  1RCL A;  4K90 B;  1MGW A;  1B2U A;  5GZZ B;  3ZVJ D;  1UDI I;  2GXF A;  2D42 A;  1BAN A;  1VQM 3;  3EE2 A;  5DAL B;  3EBT A;  2KCD A;  2VL2 A;  3SX1 A;  5G2G A;  1OC8 A;  2FUG 2;  2HRF A;  2XC2 A;  1TXX A;  4ZL7 A;  1PRX A;  1X1Y A;  3HK4 A;  3TRQ A;  2Z77 A;  1BAO A;  1MD3 A;  1VQO 3;  4CHS A;  3EX9 A;  3L9V A;  2MYG A;  4N0Z A;  4HEA 2;  1G0T A;  2HSY A;  5ECO B;  1K28 A;  2L4V A;  17GS A;  3IHQ A;  5BMU A;  2P05 A;  1YHQ 3;  2AYT A;  3F9U A;  1XXU A;  1X5D A;  4N10 A;  2VCW A;  1UUG B;  1K0B A;  1TRW A;  1TI1 A;  4I6X A;  1FOV A;  3DGO A;  4HZ9 B;  3ZLP A;  4EBG A;  1LQM B;  4EL1 A;  7RNT A;  1FW7 A;  2OQE A;  3BJ5 A;  2BU4 A;  4AJ7 A;  1BUQ A;  1M99 A;  3DYR A;  2JAD A;  2JQ5 A;  3HD5 A;  4HZ4 A;  4K2D A;  1K0M A;  5DAK B;  4ZXG A;  2XBQ A;  1O7H B;  1TTO A;  1MWT A;  1RMS A;  1RQM A;  4MJA A;  2FA4 A;  4DKI A;  3D9R A;  1TU8 A;  2RUE A;  4CPK A;  4O5U A;  5F06 A;  2R4I A;  4K8M A;  2GQL A;  1X1W A;  4KA0 A;  4CDO A;  4N6O B;  3EUR A;  3TOT A;  3WR2 A;  2RBI A;  1YDK A;  2VL3 A;  1TDI A;  5JWQ B;  5AEU B;  3NV0 B;  2V2G A;  1BNE A;  1SL0 B;  2V1M A;  1RKY A;  2C80 A;  2CFW A;  1A0R P;  2FWH A;  4MJE A;  2AAD A;  1JN5 A;  4F2I A;  2H71 A;  3N54 B;  5FHI A;  2N5F A;  1N5H A;  2R3X A;  2KF6 A;  1Q82 4;  1BNG A;  1XWA A;  1MDJ A;  2VM2 A;  4PNF A;  2FLS A;  2MMN A;  3Q19 A;  2BTO T;  3RNT A;  3KH7 A;  4TVE A;  2OTL 3;  1UUV B;  3A76 A;  4N30 A;  2H1G A;  4V2N A;  5I97 A;  2GT5 A;  3IXR A;  3W6G A;  2VL9 A;  6STD A;  2NPB A;  1AUC A;  4LYL B;  1ERW A;  4IHU A;  3GUS A;  3L0R A;  4FYC A;  3G71 3;  2VCZ A;  3X40 A;  5ECI B;  5IG4 A;  1T1V A;  1VQN 3;  1XPV A;  3F14 A;  3D5G A;  1B20 A;  1RW1 A;  2R6K A;  1PSQ A;  3VFI A;  1ERT A;  1PN9 A;  4HM1 B;  2L5O A;  3MAK A;  1XOB A;  1Z9H A;  3HCZ A;  1JZR A;  4PTS A;  2HZE A;  2WJU A;  4O7H A;  1N8Q A;  4MMX B;  3FHK A;  1AR0 A;  5DQS A;  4E8H A;  2W03 A;  2HLS A;  5CRE A;  4A5P A;  3TDG A;  4GRF A;  3PR8 A;  1O7G B;  1YEX A;  1XVQ A;  3MWH A;  1ON4 A;  2H19 A;  2HMN B;  3Q2P A;  3R3E A;  4ECJ A;  1VZZ A;  2ES7 A;  1PFP A;  3PH9 A;  1EOG A;  4R4K A;  2AHE A;  5G5E A;  3RGR A;  3ALA A;  2O87 A;  4HSC X;  1W6G A;  2D2Z A;  1CQG A;  1ZYE A;  3N5O A;  3PIN A;  4XBX A;  1BSC A;  2YJH A;  4DSS B;  3URP A;  4ZB9 A;  2WDU A;  1M90 4;  1A90 A;  14GS A;  2BMQ B;  2E2T A;  5HR1 A;  3VK9 A;  3SBC A;  2C0E A;  3QR6 A;  4QL7 A; 
#chains in the Genus database with same CATH homology
 1J9B A;  1E2Y A;  2H6Z A;  4KX4 A;  4MLY A;  1ZOF A;  1DE1 A;  2CT6 A;  4TKY A;  1A8L A;  4JZQ A;  3UOM A;  1A0F A;  3DIE A;  1W4V A;  5KN0 A;  2BMX A;  4HJ2 A;  1URM A;  1SKS B;  5DBQ A;  1K0C A;  5JWR B;  1WRY A;  5CP1 A;  1PKW A;  1VGL A;  3WT1 A;  3CRT A;  9GSS A;  4LMW A;  3GKX A;  3TKS C;  3EMP A;  4ECB A;  2GSR A;  3WT2 A;  2K8S A;  4JED A;  3UAR A;  1NM3 A;  4NV2 A;  2WRT A;  1XW6 A;  2X49 A;  2G0F A;  1PN0 A;  4DVC A;  3HZ8 A;  3LG6 A;  1YF1 A;  3DRN A;  3FK8 A;  4HQZ A;  3PPU A;  5IMV A;  1EV4 A;  5ECH B;  3KTB A;  1SL1 B;  22GS A;  3C73 A;  2X8C A;  4TXV A;  1IYI A;  5JWO B;  1B48 A;  5HR3 A;  1GTA A;  1VRS D;  3A2W A;  2GQK A;  1EEJ A;  2B1K A;  2C3Q A;  5HFK A;  2TRX A;  1OC9 A;  3WD6 A;  4IP1 A;  3KH9 A;  1XWG A;  1XWK A;  4AJ8 A;  2C0F A;  3TKS A;  3L9U A;  2LNS A;  4KF9 A;  4WXT A;  3M0F A;  5ECP B;  5ECQ B;  5FWG A;  4TR3 A;  4BVX B;  4YAV A;  2IMD A;  4IBP A;  5DJM A;  4ICY A;  3TB2 A;  4FYB A;  5G1K A;  2WGR A;  1WP0 A;  2LTK A;  1PQN A;  5CO3 A;  5E4W A;  3HJM A;  5D96 A;  3OR5 A;  3ZIJ A;  3QMX A;  1XVW A;  5ECM B;  5J41 A;  3I6A A;  3F4S A;  2L6D A;  5HFI A;  2ON5 A;  2MBS A;  3KXO A;  4TXO B;  1QGV A;  3ZIV A;  2B5E A;  1NSW A;  2IWT A;  5FT3 A;  4MP4 A;  1EGO A;  5A5K A;  3UBL A;  3J7Y k;  1GSQ A;  4HU9 A;  4RQX A;  2P31 A;  4MF6 A;  5ECN B;  4IP6 A;  1C72 A;  4NHZ A;  1WE0 A;  1GNE A;  5IMC A;  3HA9 A;  4HZ2 A;  2Z9S A;  2HE3 A;  2LKU A;  3LSZ A;  2V32 A;  1ZYN A;  4HDE A;  4ISD A;  1YKC A;  4I2T A;  2H73 A;  1K3Y A;  2IIY A;  4HU7 A;  3ZFL A;  4YQM A;  4OFT A;  3VI5 A;  3ZML A;  1HD2 A;  5DQY A;  1F3B A;  2GLR A;  4OMV A;  1WJK A;  4KSM A;  7GSS A;  3AY8 A;  4GST A;  1EEM A;  3I43 A;  4ILF A;  2R2J A;  5KN1 A;  4MZB A;  2WUL A;  4Q5R A;  4J57 E;  4BL7 A;  3RHB A;  1N2A A;  3TKQ A;  3FZ5 A;  2MZC A;  4I5Q A;  5ELG A;  4Z2U A;  1GSY A;  4G9H A;  3A5W A;  3MDK A;  2R0G A;  3C71 A;  3HVV A;  1FVK A;  4OWY A;  4I97 A;  3IAM 2;  1ZL9 A;  4NV5 A;  2H1B A;  5JCG A;  5CNW A;  2HI7 A;  3U6V A;  3EWL A;  2IY2 A;  2E7P A;  4Q5F A;  1JZO A;  1SJI A;  1T4Y A;  4X4J A;  5EVO A;  3DEX A;  1M9B A;  2PVQ A;  4J2F A;  2OA7 A;  2O8V B;  2LEG A;  1ERV A;  2B5X A;  2VLT A;  1TJD A;  2PUK C;  1ML6 A;  2WB9 A;  3FR9 A;  4F0B A;  4ZL9 A;  4KDU A;  3US3 A;  4X0X A;  5IPG A;  1ST9 A;  2HSM A;  2OJL A;  1GTU A;  4HQS A;  2LRT A;  4XRD A;  4TR4 A;  5ECL B;  1SKW B;  3GX8 A;  2LJK A;  1TTZ A;  1O7U A;  3CTF A;  3KCM A;  4F03 A;  4K1F A;  5ID2 B;  3W8S A;  2YWI A;  2HNL A;  2GSQ A;  2DJ1 A;  5GST A;  4BWQ A;  4D73 B;  4MNN A;  1PKZ A;  2B6M A;  3LJR A;  1DE2 A;  2K18 A;  2CX3 A;  1R26 A;  1V9W A;  3ISO A;  2RII A;  2NDO A;  1IYH A;  1KTE A;  1USB A;  3F3R A;  1X9S B;  2A2S A;  2HSH A;  3JCM L;  1SEN A;  1DUG A;  1YEP A;  3LWA A;  3DXB A;  2CX4 A;  2IME A;  3ZIT A;  3U5R E;  1AAZ A;  4HJM A;  5IOW A;  2A2P A;  5COH A;  1AIU A;  2I3Y A;  2VLV A;  2AUV A;  2OKA A;  5AIV A;  4TXO A;  1A8Y A;  4BPY A;  3UVH A;  4N11 A;  2NBS A;  3FW2 A;  4KGI A;  3K8N A;  4ZBA A;  2DMM A;  4G19 A;  1K0N A;  1AQX A;  1ACV A;  2V6K A;  1M0U A;  1SJ6 A;  4NXI A;  2I81 A;  2GVP A;  5IQY A;  1GSF A;  1JLV A;  4EXJ A;  3F4T A;  2V41 A;  1BQ7 A;  2LNT A;  1OYJ A;  2YZH A;  1SD9 A;  3CSJ A;  3O3T A;  1H4O A;  3HJO A;  2OE1 A;  3KMN A;  2AJQ B;  3MSZ A;  1OKD A;  2P5Q A;  4XCS A;  5C00 A;  2OBI A;  1PD2 1;  2NVL A;  2O7K A;  2VOC A;  4MA9 A;  6GSV A;  2X64 A;  4NPB A;  3DKS A;  2M80 A;  4Q5Q A;  4GSS A;  3ME8 A;  5ABR A;  1WOU A;  4H86 A;  1AW9 A;  2YOI A;  4GTU A;  3GKN A;  2ZUP A;  1EZK A;  2K6V A;  2DJ2 A;  4ULX A;  3GX0 A;  3F6D A;  1UC7 A;  2PBJ A;  3UL3 A;  2DML A;  2CAQ A;  5CRD A;  1HNC A;  2DKI A;  5D9V A;  1GUH A;  1WMJ A;  2OBK A;  2PMT A;  1OKT A;  3VPQ A;  1TK5 B;  4MJC A;  2E0Q A;  2ZNM A;  2GT6 A;  1EP8 A;  4PGT A;  4TOP A;  1HQO A;  4ZBD A;  2FWE A;  4ML1 A;  4POB A;  1B9X C;  3DVW A;  3FR3 A;  1VF1 A;  4YKF A;  4JR4 A;  1WIK A;  4WR5 A;  1TRV A;  4EO3 A;  1Z7R A;  2LS5 A;  2JZT A;  1SJZ A;  2LUS A;  1R5A A;  1U6T A;  1M2A A;  2P0G A;  3CSI A;  4WEY A;  1O8W A;  4GXZ A;  4GQF A;  2R0C A;  1X5C A;  4YKG A;  5KOX A;  1XW5 A;  2VCV A;  3IA1 A;  3GH6 A;  1U3I A;  2KUC A;  3IBH A;  4XS4 B;  1ZYP A;  1TKD B;  2R5G A;  3CBU A;  1T8E B;  2BJX A;  3IRA A;  3O6T A;  3ZRD A;  4O5Q A;  2PPT A;  5DDL A;  2QA1 A;  3KIJ A;  2VUP A;  5CRH A;  2L4C A;  2FWG A;  3GIX A;  3SWL A;  5GSS A;  4OO5 A;  5DCG A;  3Q18 A;  3C1R A;  3LQ7 A;  2ON7 A;  4F82 A;  6GST A;  4KCA A;  2PU9 C;  2K8V A;  3LXZ A;  2YPM A;  1O6J A;  4DSQ A;  2DLX A;  2H01 A;  2H0G A;  3L0H A;  4K5S A;  4WBR D;  3VLN A;  11GS A;  4BVY B;  2RLI A;  3CYN A;  4WF5 A;  1H75 A;  4MZW A;  1K0A A;  2AV4 A;  1A24 A;  3ME7 A;  5IO2 A;  2GTU A;  3UIW A;  1XBS A;  4NAX A;  4MAB A;  2H66 A;  4POK A;  4E8E A;  1FO5 A;  1O8X A;  4G2E A;  3UMA A;  2IL3 A;  2TRC P;  2WZ9 A;  3J7Y b;  2H76 A;  5GAP D;  1HNA A;  5IMF A;  4MMM A;  2B7J A;  2YWO A;  5J4U A;  2H8L A;  4L0U A;  3NIV A;  4N0V A;  3EVI A;  2CVB A;  4GLT A;  1GLP A;  3QFB C;  5HR0 A;  1T7P B;  1O73 A;  2HRA A;  5DAL A;  1EP7 A;  2HXK A;  2PN8 A;  1BAY A;  4L0W A;  3KGK A;  4EUY A;  1QUW A;  2A2R A;  3W8J A;  1SL2 B;  4CY8 A;  1FB0 A;  4WR4 A;  3CMI A;  3BBY A;  3VWV A;  3C1S A;  2PER A;  3A3T A;  3TRP A;  1OAZ A;  3H1N A;  2X4A A;  2JSZ A;  2AAW A;  5JCU A;  3MYD A;  1AQW A;  3GKK A;  1U3A A;  4EC0 A;  3N9J A;  2KHP A;  1TU7 A;  2DJ3 A;  5D9W A;  2CVD A;  3GFK A;  5DAK A;  4EIP A;  2XHF A;  2DJJ A;  2LRC A;  3F63 A;  2YJ7 A;  1M2B A;  2IFQ B;  3IR4 A;  2JAC A;  3D22 A;  1FB6 A;  3ZFB A;  4ACS A;  3VWW A;  2GDR A;  4KH7 A;  4K6X A;  2TIR A;  4X1U A;  1RK4 A;  4I2U A;  4X43 A;  4KSO A;  1ABA A;  5CRG A;  1MDK A;  4L8E A;  1R7H A;  4EKZ A;  3GL3 A;  1V58 A;  5EL8 A;  3LEF A;  2HT9 A;  1S3D A;  2M72 A;  3KMO A;  2FY6 A;  1EV9 A;  5A4U A;  5KEJ A;  4Q5N A;  3TKR A;  2CZ3 A;  2MMO A;  1ZMA A;  1AC1 A;  5H5Q A;  2YAN A;  2PVO C;  3TJK A;  1GLQ A;  2C0G A;  1TRS A;  1PL1 A;  5HR2 A;  4TR1 B;  2F8F A;  3HXS A;  5LD0 A;  4MH2 A;  2JSY A;  3QD9 A;  4BWS A;  3A2X A;  5L71 A;  2CVK A;  2FWF A;  2GS3 A;  3A5I A;  2DC5 A;  5EPF A;  1XIY A;  1A2M A;  4XRA A;  1DBY A;  3GUR A;  4USS A;  4DSS A;  2JZR A;  1VF4 A;  2R0P A;  2KP1 A;  5F07 A;  2VIM A;  2AB6 A;  1S3C A;  4K2X A;  1Z6N A;  1OVN A;  2KP2 A;  3LYK A;  3QAW A;  3G7I A;  5ECS A;  4JRR A;  4V1A p;  4BA7 A;  1OE8 A;  3L78 A;  3IAS 2;  2LRN A;  1GTI A;  3IK7 A;  2IYJ A;  1M7T A;  5CRW A;  5ELA A;  1QFN A;  4AJ6 A;  3TJB A;  2L6C A;  2VD0 A;  4O32 A;  1NHO A;  2CQ9 A;  3LXT A;  2IN3 A;  3NOF A;  4FIW A;  3FMW A;  4TRX A;  2K9F A;  2JZS A;  3VWU A;  1W89 A;  4XIH A;  2N5A A;  5GAN D;  4J56 E;  2H30 A;  3HVS A;  3ZYW A;  4QQ7 A;  1UA5 A;  3CSH A;  3E0U A;  6GSY A;  3D5J A;  3RDW A;  4LL4 B;  1MDI A;  3APQ A;  2LQO A;  3HVX A;  2IMF A;  1ZZY A;  5F0G A;  1B4P A;  3HKR A;  5CAX A;  2DKH A;  2XPD A;  4WKW A;  4K9Z A;  4IW9 A;  2FD3 A;  4MK3 A;  2H0H A;  5IPH A;  1ILO A;  1PX7 A;  5IMZ A;  3UAP A;  2L57 A;  2GZP A;  1VF3 A;  3KZQ A;  2I1U A;  1SU9 A;  2F51 A;  1JLW A;  5D73 A;  3VPT A;  8GSS A;  2GZY A;  4ZB6 A;  4O92 A;  1K0O A;  3O76 A;  4JBB A;  1J08 A;  1GSE A;  2DSA A;  4KE3 A;  4BVX A;  5AIS A;  3WGE A;  4LLR A;  3WYW A;  1B9Y C;  1JFU A;  2JU5 A;  3HDC A;  5DCH A;  2GZZ A;  1EGR A;  3DML A;  1XWC A;  1A2L A;  5ECK B;  3EU3 A;  4HOJ A;  4WF4 A;  2GST A;  2HRN A;  4IGJ A;  1Z7P A;  2M46 A;  1KEB A;  1G7O A;  2C4J A;  4QL9 A;  2H1D A;  1JZW A;  2QKE A;  3E9J B;  5EY6 A;  2OE3 A;  1UN2 A;  3QAV A;  1JHB A;  1LJR A;  4MF7 A;  2L59 A;  5HFG A;  1TW9 A;  1GTB A;  2HRK A;  3LYP A;  2E2G A;  3C8E A;  4JU5 A;  1YJ6 A;  1TK0 B;  5B6M A;  3L4N A;  1DSB A;  2HZE B;  3ERW A;  3QAG A;  5H5R A;  3F6F A;  2L5L A;  5INY A;  3KTL A;  1FOH A;  2FNO A;  5IO0 A;  3RHC A;  1SYR A;  1TRU A;  3ZTL A;  3I9V 2;  13GS A;  1GUK A;  1JZD A;  4V2M A;  3UBK A;  2JL4 A;  3D21 A;  4RI6 A;  1XCC A;  2B7K A;  1BX9 A;  5J9C A;  4K7O A;  5D9X A;  1LU4 A;  5IIZ A;  3APS A;  3F4R A;  1I5G A;  4CY6 A;  4YAP A;  1VF2 A;  4FQU A;  2FCH A;  5D9T A;  3E3E A;  5JCW A;  2X99 A;  3FY7 A;  3M9J A;  1B4Q A;  1YZX A;  4IJ3 A;  2DJ0 A;  3R2Q A;  4PQH A;  2C3T A;  3FEU A;  1F9M A;  4L5O A;  4RQR A;  2EIO A;  1M9A A;  3DVX A;  1ZGN A;  2EIR A;  2YZU A;  1SKR B;  1Y25 A;  1O81 A;  1B8X A;  2C3N A;  2H6Y A;  2R37 A;  3GRX A;  1V40 A;  3GTU B;  1FW1 A;  4OO4 A;  4IJI A;  1U88 A;  20GS A;  3ZRE A;  1X0R A;  2RUF A;  3LOR A;  2J23 A;  2GGT A;  4ZB8 A;  4IN0 A;  3IOS A;  3HYP A;  4XS6 A;  4MPF A;  3ED3 A;  3V1W A;  5ECR B;  4ZL8 A;  5IOX A;  4PXO A;  3GSS A;  2YP6 A;  4EIQ A;  4O5R A;  2VCX A;  4EDZ A;  5B7C A;  1MTC A;  3GH9 A;  5ID2 A;  2H75 A;  2LJR A;  1XFL A;  2DIZ A;  1OC9 B;  2RM6 A;  4D73 A;  2O85 A;  1WWJ A;  3TJF A;  3UJ1 A;  2FA8 A;  5C04 A;  2OAD A;  1GL8 A;  3TOU A;  3S9F A;  3M1G A;  1BYE A;  5H5S A;  2LST A;  1XZO A;  3I69 A;  2EIQ A;  4P3Y B;  4FO5 A;  4K0G A;  4RUV A;  2KLX A;  2KOK A;  5IM9 A;  5KOW A;  2QA2 A;  3IK9 A;  2PGT A;  3GKM A;  1MD4 A;  4ECI A;  1SYX A;  5HQP A;  3FR6 A;  2F8A A;  5A4V A;  4AGS A;  3H4K A;  3DWV A;  3HJP A;  10GS A;  4KW6 A;  3G9B A;  2MMZ A;  4YH2 A;  3EIN A;  3TJG A;  1XW9 A;  3KD0 A;  4OFM A;  1LBK A;  1PL2 A;  1Z6M A;  1N8J A;  1V2A A;  3L9S A;  2H1A A;  5E59 A;  1GRX A;  2GSS A;  2CAI A;  4WBJ A;  1SD8 A;  3MIX A;  2A4V A;  4LMV A;  1FHE A;  2VCT A;  1K3O A;  2GQM A;  3VUR A;  2H72 A;  2QGV A;  2H6X A;  1PGT A;  2CV4 A;  2WCI A;  3BD2 A;  4GQC A;  1XOA A;  1GSS A;  1GH2 A;  2VD1 A;  4I8B A;  1Z3E A;  3DD3 A;  4ZBB A;  3M9K A;  3KP8 A;  3APO A;  4HI7 A;  3FRC A;  1ERU A;  1T3B A;  1G6Y A;  1T4Z A;  3HZ4 A;  3UVT A;  3WGX A;  1AQV A;  4MZC A;  2FHE A;  2A4H A;  3BCK A;  3TJJ A;  2DIY A;  2G2Q A;  4NWY A;  2HZF A;  2HYX A;  3HY2 A;  4KB3 A;  3H79 A;  2YV7 A;  4Z7X A;  3D4M A;  1TI3 A;  4BL7 B;  4IQ1 A;  4DSR A;  1G7E A;  1V98 A;  3BOA A;  4GSN A;  4MJB A;  4HUA A;  1QXH A;  2YWM A;  3FYG A;  2VM1 A;  1GUL A;  1R5P A;  3F0I A;  5J9B A;  2FGX A;  1CQH A;  3WGD A;  2IMK A;  4K7N A;  2LJA A;  4MPG A;  5J5N A;  2YCD A;  3IPZ A;  5DVB A;  1X9M B;  3GTU A;  3ERG A;  3KJY A;  4G0K A;  4MF5 A;  4OCF A;  3RBT A;  4G10 A;  4MCU A;  1Z5Y E;  3D6I A;  4PUR A;  4ECC A;  5A4W A;  4WET A;  3GYK A;  2LV3 A;  4NHW A;  1ZCP A;  2NTO A;  1O85 A;  2I4A A;  1X5E A;  2WFC A;  5IMD A;  3IE3 A;  2VAF A;  4NMU A;  3CTG A;  2B1L A;  1QMV A;  1KNG A;  2N5B A;  2LQQ A;  4KDY A;  4PX1 A;  6GSW A;  1GNW A;  2I9H A;  3TKP A;  4HS1 A;  4GCI A;  1PMT A;  3GV1 A;  2EC4 A;  2C8U A;  2X8G A;  3EYT A;  1SK2 A;  4KUN A;  4YQU A;  1SK1 A;  5CYY A;  1NHY A;  4XS4 A;  3QCP A;  6GSX A;  4POM A;  2B5Y A;  3KEB A;  1G6W A;  4L5L A;  3ZMK A;  3LW9 A;  4TW5 A;  4IS0 A;  4KCE A;  2XBI A;  3EC3 A;  2F9S A;  3H8Q A;  4K0N A;  5AGY A;  4V1A g;  4G0L A;  12GS A;  5B8B A;  4LL1 B;  4PNG A;  2IPA A;  4PQI A;  4EVM A;  5G5F A;  4KDX A;  3M8N A;  3Q74 A;  3QDN A;  5IMA A;  1HNB A;  5DJL A;  3CXG A;  4OFN A;  1GUM A;  1YQ1 A;  4BVY A;  2C1Y A;  3G7Y A;  1BG5 A;  3GL5 A;  3VWX A;  3ZL5 A;  5D93 A;  2VCQ A;  2H74 A;  5B8A A;  4EE0 A;  1GSD A;  3A2V A;  1M2D A;  1NW2 A;  4MH3 A;  4K5R A;  3D4T A;  1OC3 A;  4KND A;  4Z2T A;  2REM A;  1UVZ A;  1F2E A;  1S3A A;  1GSU A;  2B3S A;  5LCZ A;  4ID0 A;  2CZ2 A;  2H70 A;  3P90 A;  4POL A;  5KN2 A;  1Q4J A;  1AXD A;  2DJK A;  1YY7 A;  3KP9 A;  1OE7 A;  2VLU A;  3IDV A;  1WPI A;  3EMX A;  1A23 A;  3QPM A;  5ENU A;  1E6B A;  2MBT A;  4Z2R A;  5G1L A;  3LFL A;  2O89 A;  5BRT A;  5D8I A;  3M3M A;  3HHV A;  4PUA A;  1K3L A;  1TOF A;  1FG4 A;  3H93 A;  5AIX A;  3FKF A;  5G31 A;  4ZIJ A;  2P5R A;  3IC8 A;  6GSS A;  1TK8 B;  5G2Z A;  2QC7 A;  2CA8 A;  2MMA A;  3VI7 A;  3ERF A;  2ZCT A;  3F3Q A;  5J3R A;  5LNK e;  3GN3 A;  16GS A;  3GHA A;  1QQ2 A;  4OD7 A;  1PA3 A;  1MEK A;  1Y6E A;  4TN8 A;  3BCI A;  3F8U A;  4KAE A;  4RI7 A;  1THO A;  2OAC A;  2E2M A;  2UZ8 A;  3FZ9 A;  3TKS E;  1PX6 A;  4EF0 A;  1QK8 A;  3NZN A;  2RM5 A;  3TCO A;  3RPP A;  6GSU A;  2J9H A;  4YQV A;  4XTS A;  3FZ4 A;  2IFQ A;  2C0D A;  5G30 A;  3TUE A;  1SK0 A;  1F37 A;  1U87 A;  3D0Z A;  1TP9 A;  1J0F A;  2HFD A;  3EPT A;  3GNJ A;  1XWB A;  1EOH A;  3DGQ A;  5F05 A;  5B6N A;  3RPN A;  1R4W A;  3RAZ A;  4ML6 A;  3ZVJ A;  4TR0 A;  1EWX A;  2IMI A;  3G7J A;  2L4Q A;  4IVF A;  2OE0 A;  3GST A;  2PWJ A;  3TRX A;  4LA1 A;  1V57 A;  1F3A A;  3GA4 A;  3IC4 A;  5AN1 A;  4IQA A;  1GWC A;  2QSI A;  1X9W B;  2WS2 A;  3LGC A;  4GWR A;  1KBN A;  4MDC A;  3GMF A;  4EDY A;  4F9Z A;  5KN3 A;  3IV4 A;  1A2J A;  3C7M A;  4IKH A;  1HYU A;  1FAA A;  4TR1 A;  2IJY A;  1F6M C;  1FVJ A;  4PUF C;  4DEJ A;  1ZYQ B;  4G0I A;  3TGZ A;  4F0C A;  3IHG A;  4JE1 A;  1K0D A;  4GF0 A;  2VO4 A;  1GP1 A;  3KM6 A;  3Q6O A;  3P8W A;  2YV9 A;  1T00 A;  1YF0 A;  1I9D A;  3QFA C;  4K7I A;  4ZIL A;  4XHM A;  3P7X A;  1Q98 A;  2VL2 C;  1THX A;  4AF2 A;  4V2L A;  2ALB A;  3UEM A;  3FZA A;  4FH8 A;  2V6O A;  2DBC A;  2R4V A;  3QOU A;  2YNX A;  3CRU A;  1YKA A;  4FYU A;  4OCE A;  3EU4 A;  3MNG A;  2YN1 A;  1BJX A;  2F3M A;  19GS A;  3ZZX A;  5F8B A;  2X8H A;  3P2A A;  2XPE A;  1BED A;  4IEL A;  4JR6 A;  4CW9 A;  4XS1 A;  18GS A;  2YWN A;  2H0I A;  3PGT A;  4PQ1 A;  5GZZ B;  3ZVJ D;  3EE2 A;  5DAL B;  2VL2 A;  1OC8 A;  2FUG 2;  2HRF A;  2XC2 A;  1TXX A;  4ZL7 A;  1PRX A;  3TRQ A;  1MD3 A;  4CHS A;  3L9V A;  2MYG A;  4N0Z A;  4HEA 2;  1G0T A;  2HSY A;  5ECO B;  17GS A;  3IHQ A;  5BMU A;  2AYT A;  3F9U A;  1XXU A;  1X5D A;  4N10 A;  2VCW A;  1K0B A;  1TRW A;  1TI1 A;  4I6X A;  1FOV A;  3ZLP A;  4EL1 A;  3BJ5 A;  4AJ7 A;  1M99 A;  3HD5 A;  3DYR A;  2JAD A;  4K2D A;  4HZ4 A;  5DAK B;  4ZXG A;  1K0M A;  2XBQ A;  1RQM A;  4MJA A;  2FA4 A;  1TU8 A;  2RUE A;  4O5U A;  5F06 A;  4K8M A;  2GQL A;  4KA0 A;  4CDO A;  3TOT A;  3EUR A;  1YDK A;  2VL3 A;  1TDI A;  5JWQ B;  2V2G A;  1SL0 B;  2V1M A;  2C80 A;  1A0R P;  2FWH A;  4MJE A;  4F2I A;  2H71 A;  5FHI A;  2N5F A;  2R3X A;  1XWA A;  1MDJ A;  2VM2 A;  4PNF A;  2FLS A;  2MMN A;  3Q19 A;  2BTO T;  3KH7 A;  4TVE A;  4N30 A;  2H1G A;  4V2N A;  2GT5 A;  3IXR A;  3W6G A;  2VL9 A;  4IHU A;  2NPB A;  1ERW A;  1AUC A;  3GUS A;  4FYC A;  2VCZ A;  5ECI B;  1T1V A;  1XPV A;  1RW1 A;  2R6K A;  1PSQ A;  3VFI A;  1ERT A;  1PN9 A;  2L5O A;  3MAK A;  1XOB A;  1Z9H A;  3HCZ A;  1JZR A;  4PTS A;  2HZE A;  2WJU A;  4O7H A;  4E8H A;  3FHK A;  5DQS A;  2HLS A;  5CRE A;  4A5P A;  3TDG A;  4GRF A;  3PR8 A;  1YEX A;  1XVQ A;  3MWH A;  1ON4 A;  2H19 A;  4ECJ A;  3R3E A;  2ES7 A;  3PH9 A;  1EOG A;  2AHE A;  5G5E A;  2O87 A;  2D2Z A;  1CQG A;  1ZYE A;  3N5O A;  3PIN A;  2YJH A;  4DSS B;  4ZB9 A;  2WDU A;  14GS A;  3VK9 A;  5HR1 A;  3SBC A;  2C0E A;  3QR6 A;  4QL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...