1JZOA

Dsbc c101s
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
215
structure length
215
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal Structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN DSBC
total genus 67
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzoA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzoA02
4NMUA 2DJJA 2CAIA 3FKFA 1ZL9A 4GXZA 1M99A 1XPVA 2MBSA 6GSUA 4EL1A 4ZB8A 2LV3A 3ZFLA 2NBSA 2N5AA 1SKRB 2CVDA 3C1RA 3D22A 2P31A 2H76A 3O76A 1F6MC 4PQIA 3Q19A 1JZWA 3F8UA 4HJMA 4TRXA 3L9UA 1T1VA 2V2GA 2JZRA 1OC3A 5DALA 4ACSA 1TRSA 3HJMA 1XZOA 4IJIA 5G30A 1K0NA 2VLTA 1Z9HA 3CRTA 4MJBA 2WZ9A 1LBKA 3CMIA 2L5OA 4MF7A 4N0ZA 5D9XA 2VCWA 4AJ8A 3N9JA 1DE1A 1RW1A 5IM9A 4F03A 5J3RA 5KEJA 2H8LA 2VLUA 5A4VA 1K0CA 4XTSA 1ZCPA 2LRNA 2O87A 3FR9A 4YAPA 2EC4A 4J56E 1U88A 4TR3A 3RPPA 1WE0A 1ILOA 4MLYA 5EVOA 5A4UA 2G0FA 2IFQA 1A8LA 4PURA 4LL1B 1OC9A 3H8QA 3Q18A 5IMFA 4OO5A 4IP1A 1V9WA 3HVVA 1UVZA 2WDUA 4HU7A 1GSQA 1K3OA 1M2DA 3WYWA 2VL2C 4EF0A 4MP4A 2L6CA 3KEBA 4WF4A 5GAND 1A0RP 5FHIA 2I9HA 1AC1A 2H73A 2AAWA 2CZ3A 1J08A 4ZBDA 4JRRA 5DVBA 3HD5A 5JWRB 4PNGA 3E0UA 4MF6A 2LQQA 2XPDA 2VD0A 5E4WA 4KUNA 1UN2A 4GF0A 2IMDA 5JCGA 1WWJA 3IRAA 2LSTA 3P7XA 5CRDA 1X9SB 4EDZA 3V1WA 3KM6A 5D96A 4ILFA 2H72A 2RLIA 3KMOA 2FCHA 2IY2A 4IBPA 1EP8A 4ML6A 4XS4B 1Z7PA 2O89A 3MNGA 3LFLA 1HNAA 3GH6A 4YH2A 2R3XA 5ECHB 4HU9A 4MPGA 1RK4A 5F07A 1Z6MA 1PKZA 3TJBA 4MH3A 2ES7A 3F3RA 3EINA 5D73A 3US3A 2P5QA 4I97A 4TXVA 2FY6A 2K8VA 2VM2A 2HNLA 2H0GA 1XXUA 2E0QA 2GQKA 4NAXA 2B3SA 2VUPA 4WBRD 4IQAA 2GT6A 2VAFA 3D21A 4ZBBA 4N0VA 3LXZA 22GSA 3D5JA 4HJ2A 3S9FA 5DJMA 1G7OA 5ECPB 3WD6A 3C7MA 3EURA 4V1Ap 1TKDB 4QL7A 1O6JA 4I6XA 2HLSA 2E2GA 2H66A 1V98A 2VL3A 2X8HA 11GSA 3MDKA 1FW1A 4D73B 5DAKA 5IPHA 3ZYWA 2OE1A 3EVIA 3F63A 1HYUA 3PGTA 2YZHA 1GH2A 2AYTA 1X9WB 3TRPA 4IHUA 4XS4A 4O92A 1GTUA 3TJGA 4E8EA 4HZ2A 3MSZA 2I4AA 4RQRA 3GL5A 1M2AA 3ZTLA 1XVQA 4ZL7A 3UJ1A 4POLA 2X8CA 1K0OA 2MZCA 3HXSA 3HZ8A 4AGSA 1Z6NA 3DRNA 2PVOC 4MZBA 4ZXGA 5ECIB 5IMAA 2ALBA 5D9TA 2BTOT 3FRCA 1ZGNA 4MCUA 1X9MB 1W4VA 4ECJA 3OR5A 1TK8B 2H19A 1GLQA 2CT6A 1GNWA 1SKWB 4POKA 3TJKA 3UVTA 17GSA 1PX7A 4N10A 1PX6A 4NPBA 4Q5QA 3D0ZA 3KIJA 1T7PB 3APQA 4RQXA 3KXOA 2OJLA 4XIHA 3QMXA 2V1MA 1WJKA 5AISA 4LMVA 4NWYA 4NHZA 1AW9A 1OKDA 1B4QA 1EZKA 3KH7A 3H93A 1AIUA 3QAGA 1M0UA 5ECKB 5AIXA 1ZMAA 1UA5A 2C80A 12GSA 3UBLA 2WS2A 3KTBA 4ECIA 2B6MA 1F2EA 2VOCA 1FO5A 5E59A 4GSTA 2H75A 3FZ5A 3IDVA 4JR4A 3LEFA 1F37A 1KEBA 3HZ4A 4OFNA 3CTFA 4EUYA 5DALB 1B48A 3IV4A 4HEA2 3F0IA 4HDEA 5J4UA 1VF3A 4JE1A 2MMNA 1NW2A 3WGDA 5DDLA 3GV1A 3UEMA 2OBKA 1TI3A 4TR1B 1N8JA 5DQYA 3VK9A 3P90A 2KHPA 1SL2B 3ME7A 1MDJA 1SYRA 2TRCP 1U87A 2DJ2A 5ECSA 4BA7A 5DAKB 1S3AA 1XBSA 2F51A 4YQVA 2VCTA 1M9AA 5HR1A 2LEGA 1X5DA 4LL4B 1YDKA 1AUCA 5G2ZA 3A2VA 1SKSB 2FNOA 3ZZXA 4GQFA 4KAEA 4RUVA 1M7TA 3VURA 1R5AA 4KW6A 3TOUA 3LGCA 1USBA 2DJ3A 3IK9A 5IOXA 5J41A 1PMTA 3APOA 4MDCA 3J7Yb 4BWSA 4I2UA 3KD0A 2YANA 3HY2A 2JU5A 3QPMA 1SL0B 1R4WA 3LYPA 1FOVA 2J9HA 2IPAA 3LJRA 1X0RA 1EOGA 2JSZA 2YJHA 5DBQA 1TXXA 3L78A 1EOHA 6GSXA 5EL8A 3LWAA 6GSSA 2FWGA 1ERUA 5ECMB 3D4TA 3F4SA 5KN1A 1RQMA 1O7UA 2BJXA 2IMKA 5H5QA 1ACVA 2ZUPA 2R5GA 3IXRA 2LQOA 3O3TA 5GZZB 4NXIA 3C8EA 4DSSA 2YWMA 5LCZA 5IIZA 1EEMA 4O5RA 2L59A 3PH9A 3IOSA 4HUAA 3M9JA 2GSTA 3DD3A 1YKAA 4MJEA 1WMJA 3P8WA 3GKNA 3GIXA 1EV9A 3HA9A 3W8SA 1F9MA 3TRXA 1H75A 1A24A 1HNBA 2GZZA 4GRFA 2DJKA 5HFIA 4D73A 2NDOA 4POBA 3ED3A 3E9JB 3LORA 4TN8A 4N11A 2WB9A 2JADA 2LJRA 1T8EB 2ZCTA 1VF2A 2KLXA 3KP8A 4NHWA 5C04A 1HD2A 1UC7A 3QFAC 4IJ3A 1GTIA 4HZ4A 3NZNA 4PX1A 4ML1A 2LJAA 3GL3A 4X0XA 1GUKA 3WGXA 1URMA 1VGLA 1B9XC 4POMA 5KN3A 4E8HA 2L57A 4EC0A 4K9ZA 4TXOB 4TW5A 1J0FA 2VCXA 3H79A 2FGXA 3GTUA 1ST9A 1R26A 3F3QA 3LG6A 4KDYA 1IYHA 3IBHA 3E3EA 4G10A 5AN1A 4ISDA 2RM6A 1XWAA 5JCUA 4NV5A 5ELAA 5G1LA 4DSSB 4JBBA 4MA9A 3I6AA 1LU4A 4MZCA 5AGYA 1U3AA 3ERFA 1YZXA 4IW9A 5ELGA 2LTKA 2QC7A 1ERVA 3DMLA 3TKSE 2H6XA 4FH8A 3CYNA 3G7IA 2VL9A 3LXTA 2VO4A 3ERGA 3TGZA 2VCVA 2M46A 1Q4JA 4Z7XA 3GH9A 3KZQA 3HYPA 3ZFBA 1BX9A 5H5SA 1SK1A 3GNJA 1I9DA 3P2AA 2YNXA 4ZL8A 2VM1A 3HVSA 5CO3A 4WBJA 2I81A 2DMLA 5GAPD 3BBYA 5ID2A 3FR6A 3VLNA 1M2BA 5HR3A 1TK5B 3GSTA 4G19A 4AF2A 3UIWA 5F06A 3IHQA 4GQCA 1WOUA 2GDRA 3DWVA 5HFGA 4IN0A 4EVMA 3ERWA 3F4RA 3QOUA 2IYJA 3O6TA 3EWLA 1F3AA 2GGTA 1T00A 4MJAA 3HVXA 3GTUB 5GSSA 1GRXA 2GTUA 2JSYA 2JACA 3C1SA 4HOJA 4L5LA 5B6MA 2V32A 4OFMA 1MDKA 1OC9B 2I1UA 9GSSA 1JZDA 2VL2A 3DVWA 3GRXA 3EU3A 1NHOA 3FEUA 2WRTA 3GX0A 3H1NA 1JLVA 2DJ0A 4WF5A 5IO2A 4KCAA 1XW9A 2C0FA 2LS5A 5B6NA 3ZRDA 2BMXA 1DSBA 2GZYA 2L5LA 1SJ6A 2RM5A 3TKSC 5IO0A 1FB0A 2C0DA 4F82A 3C73A 4OWYA 2FA8A 4OCFA 3BCIA 1K0BA 4WETA 1PRXA 4XRDA 3LYKA 2IN3A 1XWBA 3AY8A 1GNEA 1JLWA 4HS1A 1SENA 3EC3A 2K18A 4IKHA 5HR2A 4GLTA 3Q74A 1AQWA 2PWJA 2A2SA 2C8UA 1NHYA 2VIMA 4JR6A 1ERWA 4FYCA 1X5CA 1BEDA 2VD1A 3KCMA 3M0FA 1H4OA 5ENUA 3VFIA 2H74A 3NOFA 2KUCA 1WIKA 1TDIA 2DIZA 4GSSA 1GSYA 2H0IA 1GP1A 4BVXA 2H1DA 4BL7A 1MTCA 1YKCA 4EE0A 3TKPA 4ECBA 1F3BA 3VI5A 4KX4A 1SJZA 2CX3A 4F0CA 4GTUA 1TRUA 1PA3A 2YWNA 3H4KA 2YV7A 2GLRA 3IE3A 1DBYA 1A23A 2KOKA 3M9KA 2TRXA 3IA1A 1GULA 4DVCA 3GUSA 3EE2A 2LJKA 1XFLA 4MJCA 4TR1A 3U6VA 4L0UA 1A0FA 4TR4A 3VPQA 2LRTA 1G0TA 2M80A 5CYYA 2C3QA 3M1GA 1A2JA 2PERA 3GHAA 2GQLA 4GSNA 1V40A 2WULA 3NIVA 3ME8A 5G1KA 3WT2A 1S3DA 2YCDA 4BVYA 2C0GA 3A2XA 1Y6EA 2H0HA 3FZAA 4YQMA 2DC5A 4LLRA 1GTAA 3KP9A 4YAVA 4CW9A 1U6TA 1YEXA 3RPNA 7GSSA 4EKZA 3ZVJA 2MMZA 1GUHA 5IQYA 2R4VA 1WP0A 3G9BA 3U5RE 3M8NA 3UOMA 2PMTA 1XWCA 4O32A 1SK0A 3TRQA 1R5PA 8GSSA 1A8YA 3I43A 1OE7A 3DYRA 3TJFA 1S3CA 1TTZA 1JZRA 4OCEA 2XBIA 1XVWA 1OC8A 2HSHA 3A3TA 3GKKA 2ZNMA 3M3MA 4V1Ag 1YF1A 3VPTA 1EGOA 2LUSA 1NSWA 3TKQA 1BYEA 2RUFA 2B5EA 1XWKA 2P0GA 2YWOA 2LRCA 1SK2A 1MD4A 1YEPA 2KP1A 1JZOA 1Y25A 2GZPA 4EO3A 2R2JA 3VI7A 4IQ1A 2K6VA 1VF4A 5HR0A 5KN2A 4MPFA 1WRYA 2GQMA 5J9BA 5ECOB 5CRHA 1VRSD 1QMVA 2I3YA 3KMNA 4K6XA 3TCOA 2ON5A 2L4QA 3RBTA 1GSDA 1ON4A 1DUGA 1ZOFA 6GSTA 4BWQA 4KNDA 2CQ9A 3IAM2 5G31A 3DVXA 5ECQB 1CQHA 1GSSA 3DGQA 5CNWA 1GSFA 4X43A 1Z3EA 2JZSA 2MYGA 4ECCA 4XCSA 3FYGA 1X5EA 4ID0A 3A5WA 5F8BA 2FA4A 2F8AA 3J7Yk 3UVHA 4H86A 5IMCA 2HXKA 4KA0A 2MMAA 2HSYA 4K7NA 2HFDA 2PUKC 4PQ1A 3UAPA 5FWGA 3WGEA 4PNFA 3MAKA 5DQSA 1PKWA 5IOWA 4ZB6A 1B4PA 4HQSA 4JZQA 3TJJA 2B5XA 5ECLB 3VWVA 1TJDA 2A2RA 3KH9A 1W89A 2EIOA 1G6WA 3G7YA 1BG5A 2FWFA 1SJIA 1V57A 4OMVA 5JWOB 5G5EA 1GLPA 3GFKA 1QFNA 1O8WA 4F9ZA 5CP1A 4EDYA 1OYJA 2GSQA 2L4CA 2HRNA 3ZL5A 1NM3A 3TOTA 3RHBA 4IS0A 2PGTA 2FHEA 4XRAA 1FHEA 3IAS2 5D9VA 2B7KA 3F4TA 3GX8A 3HHVA 5CRWA 3QD9A 4K7IA 1K0AA 3DKSA 1ABAA 4OO4A 1YY7A 2N5FA 3R2QA 4TXOA 1T4ZA 3ZVJD 1TW9A 2FWEA 1PL1A 5ABRA 4WR4A 1SD9A 3HDCA 2H1GA 2FD3A 3HCZA 4XS1A 2LKUA 1PGTA 2WCIA 3F6FA 2WJUA 1OVNA 2IMFA 1HQOA 1AQXA 2CVKA 3BOAA 3L4NA 2HZFA 2IL3A 1XIYA 5F0GA 2YP6A 3I9V2 2HE3A 2WFCA 1XCCA 3IPZA 5EY6A 4FYUA 3A2WA 1AXDA 1PSQA 3QAWA 1WPIA 3PR8A 4IGJA 1G6YA 4KH7A 4J2FA 1O8XA 2CV4A 1K3YA 4PXOA 2C1YA 3F6DA 2HYXA 4PUAA 1JHBA 3CXGA 6GSWA 2LNTA 20GSA 2NTOA 3ZLPA 3IK7A 4AJ6A 3VWXA 2QKEA 1ZYEA 2MMOA 3Q6OA 3MWHA 1TRVA 1U3IA 4Q5NA 4WEYA 4FYBA 3PINA 5CRGA 1M9BA 4FO5A 1THOA 1A2MA 3W6GA 2FUG2 2H1BA 2M72A 3RDWA 1J9BA 2AUVA 2R37A 3D4MA 3QCPA 4MH2A 1QGVA 2PU9C 4KDUA 4L0WA 5LD0A 2XBQA 6GSVA 1JFUA 1XWGA 3QFBC 3RHCA 10GSA 3UMAA 4OFTA 5JCWA 4ZILA 4KGIA 3G7JA 4ULXA 5D9WA 1SD8A 4X1UA 2O85A 1KBNA 3ISOA 3K8NA 2PVQA 4MF5A 1O85A 2EIRA 4DSQA 4LMWA 4HQZA 4IELA 4V2NA 1SYXA 1ERTA 5HFKA 5IMDA 5KN0A 1K0DA 2OE3A 1O73A 3FR3A 4RI6A 4WR5A 4I8BA 4CHSA 1EEJA 1Z5YE 5H5RA 3HJOA 5ID2B 4O7HA 3LSZA 3KTLA 4RI7A 1BJXA 1PN9A 4G9HA 3VWWA 2GT5A 1EV4A 4Q5RA 3QAVA 1ZYQB 1XW5A 5IPGA 2IMEA 3WT1A 1EP7A 1SU9A 1GUMA 2PBJA 3BCKA 2HI7A 4MABA 2DLXA 3UARA 5AIVA 2PPTA 2HRFA 3FZ9A 2IMIA 5CAXA 1QQ2A 4I5QA 1I5GA 3L0HA 2YJ7A 3UL3A 2H70A 2D2ZA 3SBCA 4TKYA 4AJ7A 1K3LA 4ZB9A 4EXJA 1TRWA 2OKAA 2AHEA 2NVLA 3IC4A 5G5FA 4LA1A 5HQPA 1OAZA 2CA8A 2CX4A 1ML6A 2B7JA 2H30A 1BAYA 2RUEA 2TIRA 5D93A 2IIYA 2E7PA 2G2QA 5DJLA 1OE8A 2DMMA 3HJPA 2GSRA 1PL2A 4XHMA 4K7OA 3CBUA 3TKRA 1FG4A 2O7KA 2IJYA 3GYKA 5DCGA 1SL1B 3I69A 3BJ5A 3ZMKA 4F2IA 2H71A 3FHKA 5ECNB 2GS3A 2B5YA 4FIWA 3CSJA 4L5OA 14GSA 3TB2A 2IWTA 4WXTA 2HT9A 4DEJA 3GN3A 5B7CA 3DEXA 4MZWA 5L71A 2OBIA 3ZIVA 3ZMLA 1ZZYA 2O8VB 1HNCA 3UBKA 1V58A 1QK8A 5D8IA 2E2MA 3N5OA 3QDNA 2R6KA 3FY7A 2REMA 3TKSA 4XS6A 1Q98A 1TP9A 2H6ZA 1YJ6A 3EMXA 1R7HA 5J9CA 1IYIA 2RIIA 2F8FA 3JCML 2WGRA 19GSA 2DIYA 4K1FA 3TDGA 1GWCA 2J23A 4OD7A 1MD3A 1YF0A 2B1KA 2AJQB 2V6OA 2OADA 1XOBA 5GSTA 1FVKA 2YN1A 1TK0B 13GSA 2LNSA 1MDIA 5JWQB 3CTGA 1AAZA 5INYA 1GSEA 2C3TA 4KSOA 4J57E 3TUEA 3EMPA 4QQ7A 2P5RA 2DJ1A 2DSAA 2N5BA 5IMVA 2YPMA 1FB6A 4PUFC 1O81A 2YZUA 2XPEA 3KGKA 2IFQB 4K0GA 2C3NA 4KE3A 2VLVA 1LJRA 3KJYA 4ZL9A 3LQ7A 1TOFA 1FAAA 3APSA 5A4WA 4YQUA 1E6BA 1BQ7A 3SWLA 2FWHA 1VF1A 1PD21 1YQ1A 4TVEA 4TOPA 2H6YA 4V2MA 2ON7A 3EYTA 2K9FA 2YV9A 4HI7A 2H1AA 4ZIJA 4IP6A 5ECRB 4K0NA 3CRUA 3FW2A 2JZTA 2OA7A 1T4YA 1V2AA 2XHFA 3W8JA 1E2YA 4MMMA 5DCHA 2HZEB 2FLSA 2JL4A 4PQHA 4K8MA 1B9YC 5J5NA 1Z7RA 3QR6A 3GA4A 4QL9A 1A2LA 3VWUA 2DBCA 2MBTA 4PGTA 4IVFA 2CZ2A 4KDXA 2VCQA 5B8AA 2OE0A 2Z9SA 4I2TA 3RAZA 2CVBA 1G7EA 3GKXA 1K0MA 2V41A 3CSIA 3CSHA 4KB3A 1AQVA 4BPYA 4KSMA 2KP2A 3GKMA 2EIQA 3GMFA 4KCEA 1T3BA 5B8BA 2YOIA 6GSYA 2AV4A 2GVPA 4TR0A 4JU5A 1XOAA 3FZ4A 5EPFA 3ZREA 2CAQA 5C00A 3C71A 4N30A 3F9UA 18GSA 1EWXA 4JEDA 4P3YB 1FVJA 2X8GA 2PN8A 16GSA 4F0BA 3GSSA 4V2LA 1CQGA 4K2DA 1QUWA 3HKRA 4GWRA 2K8SA 5FT3A 2C0EA 5F05A 3L9VA 4WKWA 2QGVA 5IMZA 2OACA 4Q5FA 2F9SA 4CDOA 5A5KA 1GTBA 2QSIA 1XW6A 2B1LA 2X64A 1N2AA 2A4VA 3ZITA 2GSSA 2F3MA 3DIEA 1PQNA 1OKTA 3ZIJA 4DSRA 2HZEA 3DXBA 3IR4A 1TI1A 1KTEA 3EU4A 1B8XA 2AB6A 1GL8A 1MEKA 2C4JA 3BD2A 2VCZA 4ZBAA 1TU8A 4GCIA 2V6KA 2YWIA 2XC2A 2H01A 1C72A 4G2EA 4MK3A 1THXA 3L9SA 1GSUA 3GURA 2NPBA 3D6IA 1DE2A 2L6DA 1KNGA 3FK8A 5LNKe 4NV2A 2X99A 5COHA 1EGRA 1TU7A 1QXHA 5CREA 4L8EA
chains in the Genus database with same CATH superfamily
4NMUA 2DJJA 2CAIA 3FKFA 1ZL9A 3LTCA 2R0CA 4GXZA 3CCE3 1M99A 1XPVA 2MBSA 6GSUA 4EL1A 4HM4B 4ZB8A 2LV3A 2KAAA 3ZFLA 2NBSA 2MF7A 2N5AA 1SKRB 2CVDA 3C1RA 3D22A 2P31A 2H76A 2W6JH 1GD4A 1X1XA 1CH0A 3O76A 4K5RA 1F6MC 4PQIA 4G0KA 1YJ93 2YFIB 3Q19A 3H3HA 1JZWA 3BNEA 3D79A 3F8UA 4HJMA 4TRXA 3L9UA 1T1VA 2V2GA 1RTUA 2JZRA 1OC3A 5DALA 5CF1A 4ACSA 1AY7A 1TRSA 3HJMA 1XZOA 3OX9A 3IPTA 1QVG2 4IJIA 5G30A 1IYYA 1K0NA 2VLTA 1Z9HA 3CCS3 1JBRA 1W6YA 1RDSA 3CRTA 8RNTA 2BMQB 4MJBA 4HM7B 2WZ9A 1LBKA 3CPOA 4RNZA 2L5OA 3CMIA 1LOVA 4HKVB 4MF7A 1TFKA 4N0ZA 2VCWA 5D9XA 4AJ8A 1RLSA 1RN1A 3A76A 3EC9A 3N9JA 1DE1A 1RW1A 5IM9A 3NUVA 4F03A 5J3RA 4EV5A 4ZM8A 5EQLA 1SIIA 2H8LA 5KEJA 2VLUA 4RZMA 5A4VA 1K0CA 4XTSA 1ZCPA 3D5IA 2LRNA 2O87A 3FR9A 4YAPA 3HIGA 2EC4A 4J56E 3FGYA 1U88A 4TR3A 3CCL3 3RPPA 1WE0A 1ILOA 4MLYA 5EVOA 5A4UA 2G0FA 2IFQA 1A8LA 4PURA 4LL1B 1US1A 3F14A 1JBSA 1OC9A 3H8QA 3Q18A 5IMFA 4OO5A 4IP1A 1V9WA 4HM6B 3E99A 3HVVA 1UVZA 3SEDA 2WDUA 4HU7A 1LOWA 4J8TA 1OUNA 3PS8A 2HSMA 1GSQA 1K3OA 4K5SA 4DKIA 1M2DA 3GZXB 3WYWA 3CNXA 1IVVA 2VL2C 1DVDA 4EF0A 4MP4A 1BSBA 2L6CA 2JDIH 3KEBA 3JUMA 4BVYB 4WF4A 4N6UA 3LT9A 5GAND 3ZG0A 4MNNA 2Y74A 2FXTA 1A0RP 5FHIA 2I9HA 5CF2A 1AC1A 2H73A 3D9RA 5AIFA 1W00A 1IVXA 4XBXA 2AAWA 3FCSB 1J08A 2CZ3A 1X1WA 4ZBDA 4JRRA 5DVBA 3DH2A 3HD5A 5JWRB 4PNGA 1VQ63 3E0UA 2JQ5A 2XFSA 4HOHA 4XDVA 3CME3 4MF6A 7GSPA 2LQQA 2XPDA 2CG0A 2VD0A 5E4WA 4KUNA 1UN2A 4GF0A 1W2B2 1YJW3 4L7KA 2IMDA 5JCGA 2OOVC 1WWJA 2W2CA 3IRAA 1ISKA 2LSTA 3P7XA 4HM8B 1D6ZA 5CRDA 1X9SB 4EDZA 1N5PA 3V1WA 8CHOA 4LSOA 3KM6A 2CC3A 5D96A 1BNFA 4G0IA 4ILFA 2H72A 2RLIA 1VQP3 3KMOA 2FCHA 3G6E3 3WOEB 2YFJB 2IY2A 1STDA 4IBPA 1EP8A 4ML6A 4XS4B 2MC8A 2W56B 1Z7PA 2O89A 3MNGA 1UUGB 3LFLA 4MMYB 1HNAA 3GH6A 4YH2A 2R3XA 5ECHB 1DYUA 1A2PA 4HU9A 3RDEA 4MPGA 5IF6A 1NB5I 1RK4A 5F07A 1Z6MA 4LGQA 3CC73 1PKZA 3TJBA 4MH3A 2ES7A 2KF6A 3EINA 3F3RA 5D73A 2P5QA 4I97A 3US3A 1IQXA 4TXVA 1U8CB 2FY6A 2K8VA 2VM2A 2HNLA 1AV4A 1A2KA 2H0GA 3CMA3 1XXUA 5CXOA 2E0QA 2GQKA 4NAXA 2B3SA 1G96A 2VUPA 4WBRD 4IQAA 2GT6A 1UCJA 2VAFA 3D21A 4ZBBA 1W6CA 4N0VA 1BRGA 1BRIA 3LXZA 22GSA 3D5JA 1FGRA 4HJ2A 5DJMA 3S9FA 1G7OA 3OWYA 4Q53A 5ECPB 3WD6A 3C7MA 2P0XA 3EURA 4V1Ap 1TKDB 2OWPA 4IT7A 4QL7A 3CU3A 4K1UA 1O6JA 4I6XA 4AEQA 2HLSA 2KF4A 2E2GA 2H66A 1UDII 3S27A 4K2XA 1V98A 2VL3A 2RBIA 2X8HA 3MSOA 11GSA 3I563 3MDKA 1FW1A 1C7HA 4D73B 5DAKA 5IPHA 3ZYWA 2OE1A 4XBYA 3EVIA 3F63A 3CXC2 1HYUA 5KOXA 3PGTA 2YZHA 1GH2A 2AYTA 1X9WB 2IUKA 3TRPA 4IHUA 4XS4A 4O92A 2CWVA 1LNIA 1GTUA 3CC43 3TJGA 4E8EA 4HZ2A 3MSZA 1BSAA 2I4AA 4RQRA 3GL5A 1M2AA 1N8R4 3ZTLA 5HGRA 1XVQA 4ZL7A 3UJ1A 1ZGXA 4POLA 1CEWI 2X8CA 1K0OA 5CLKA 2MZCA 1OH0A 3HXSA 2R0GA 2E2UA 5D82A 1NWWA 3HZ8A 4AGSA 1Z6NA 3DRNA 2J8XB 5RNTA 2PVOC 4MZBA 4ZXGA 5ECIB 5IMAA 3RGAA 4STDA 2ALBA 5D9TA 2BTOT 3FRCA 1ZGNA 4MCUA 1X9MB 1W4VA 4ECJA 3OR5A 1TK8B 2H19A 1GLQA 2CFKA 2CT6A 2CKFB 1GNWA 1SKWB 2R41A 4POKA 3TJKA 3UVTA 17GSA 1Q40A 1T2IA 1PX7A 3LYGA 2DKHA 1PX6A 4N10A 1RGCA 4NPBA 4Q5QA 3WODG 3D0ZA 3KIJA 1T7PB 3FF2A 3APQA 4NREA 4RQXA 3KXOA 1Y4KA 2OJLA 4XIHA 3QMXA 3EB8A 4ORLA 2V1MA 3NQYA 5BXQA 1WJKA 1YVBI 5AISA 3OW22 4LMVA 3HI7A 2Z6BA 1BVIA 4NWYA 4NHZA 1AW9A 1BNGA 3HX8A 1OKDA 1B4QA 1EZKA 3DGMA 4N6OB 1B20A 3MPHA 5EVHA 1KWIA 1UI7A 4BL2A 1C54A 3KH7A 3H93A 4KFFA 1AIUA 4KZ1A 3QAGA 1M0UA 5ECKB 5AIXA 3SOAA 1ZMAA 2GBXB 1UA5A 2C80A 1GD3A 1BANA 12GSA 3UBLA 1JN5B 1RNBA 2WS2A 1N9JA 4TX4A 3KTBA 4ECIA 2B6MA 1F2EA 2HMOB 2VOCA 1IV9A 2QIYA 1FO5A 5E59A 4GSTA 3URPA 1O7HB 2H75A 4KT3B 3FZ5A 3IDVA 3LEFA 4JR4A 4H3UA 1F37A 1KEBA 3LT8A 1IDPA 1A90A 3HZ4A 4OFNA 3CTFA 4EUYA 3EF8A 5DALB 1B48A 3DUKA 2F86B 3IJEB 3IV4A 4HEA2 3F0IA 4HDEA 2ZL8A 5J4UA 1VF3A 4JE1A 2MMNA 1NW2A 3T8UA 3WGDA 5DDLA 1RGHA 3GV1A 4WYKB 3UEMA 1HKXA 2OBKA 3LW9A 4HBRA 4ICYA 1B2XA 1B2ZA 1TI3A 4TR1B 3CCU3 1N8JA 1QJGA 1KD14 5DQYA 3VK9A 3P90A 2RSXA 2WOHA 3FKAA 2KHPA 1SL2B 2XGNA 4JRFA 1QVF2 1DETA 1MDJA 3ME7A 1SYRA 2TRCP 1FUWA 1U87A 1RGEA 1OHSA 2DJ2A 5ECSA 4BA7A 5DAKB 3CQFA 1S3AA 2BHMA 1XBSA 3CD63 4K90B 2F51A 4YQVA 2VCTA 1RGFA 4LMIA 1M9AA 5HR1A 4R9KA 2LEGA 3K7CA 3OXAA 1UUVB 1RHLA 4FMDA 1X5DA 4LL4B 1YDKA 1AUCA 5G2ZA 3A2VA 2UZ8A 2CHCA 1SKSB 2B1XB 2FNOA 5G2GA 3ZZXA 4GQFA 4KAEA 4RUVA 1M7TA 3VURA 4CJNA 1R5AA 4KW6A 3TOUA 3PGBA 2HOHA 4RNYA 1USBA 3LGCA 2DJ3A 3F8HA 3IK9A 5IOXA 5J41A 5KP4A 1PMTA 1CYVA 3GRDA 3APOA 1UGIA 4MDCA 2ML5A 3J7Yb 3FZWA 4I2UA 4BWSA 3FG1A 3KD0A 2YANA 3HY2A 1R4YA 2JU5A 3QPMA 1SL0B 1R4WA 3LYPA 1FOVA 2J9HA 2IPAA 5AIGA 3LJRA 1X0RA 3EE1A 1I2EA 1EOGA 3QK9A 2JSZA 3JUPA 2YJHA 5DBQA 1TXXA 2W56A 2WGQA 3L78A 1EOHA 6GSXA 5EL8A 3LXUX 1BSEA 3LWAA 6GSSA 2FWGA 5ELUA 1ERUA 3WMDA 3MHEA 3D4TA 5ECMB 3F4SA 5KN1A 1RQMA 1O7UA 1E3RA 4FCMA 3KSED 2BJXA 1AQZA 2HRAA 1TRPA 2IMKA 5H5QA 1ACVA 2ZUPA 3DGOA 2R5GA 3IXRA 2FNQA 1B2UA 2LQOA 3O3TA 5GZZB 4NXIA 1LOYA 3C8EA 4DSSA 2YWMA 5LCZA 3PZWA 3EBTA 2AADA 5IIZA 4O5UA 1EEMA 4O5RA 2L59A 4WFOA 3IOSA 1K9M4 2CIUA 3PH9A 3M9JA 4HUAA 1AVLA 2GSTA 4HM1B 3JUNA 2C4BA 1B27A 3DD3A 2F4YA 1YKAA 4MJEA 1W5ZA 2QA43 1WMJA 3P8WA 3GKNA 3GIXA 1EV9A 3HA9A 3W8SA 1F9MA 3TRXA 1H75A 1A24A 1W2ZA 1HNBA 2GZZA 1BRSA 2GXFA 1KC84 4KF9A 4GRFA 3BNCA 4I4KA 2DJKA 4FMBA 5HFIA 4D73A 2NDOA 4EV2A 4POBA 5BMUA 3ED3A 3E9JB 3LORA 4TN8A 4N11A 2WB9A 2JADA 2LJRA 5A0OB 1T8EB 2ZCTA 1I0XA 2Z76A 1VF2A 3BB9A 2KLXA 3KP8A 3FLJA 1Q9EA 3PYJA 4NHWA 5C04A 1HD2A 1SQWA 1UC7A 3QFAC 3F8XA 4IJ3A 1GTIA 1RCLA 4HZ4A 1HYFA 3NZNA 4PX1A 4ML1A 2LJAA 4L8OA 3GL3A 3GZBA 4X0XA 2A15A 1GUKA 3WGXA 2P09A 1VGLA 1B9XC 1URMA 4POMA 5KN3A 1BRKA 1IVWA 4E8HA 2L57A 5AYSC 4EC0A 3CCQ3 4K9ZA 3FH1A 4HM5B 4TXOB 5KP1A 3DGLA 4TW5A 1J0FA 2KF5A 2VCXA 1IQ8A 4CPKA 4FCJA 1Q814 3H79A 2FGXA 3ROBA 2DKIA 3GTUA 1ST9A 3GAXA 1R26A 2FGTA 3F3QA 3LG6A 4KDYA 1IYHA 1VQ53 3E3EA 4WYKA 1OACA 3K63A 4G1MB 1YJN3 3IBHA 4G10A 5AN1A 4ISDA 5CK6A 2RM6A 1XWAA 5JCUA 4NV5A 5ELAA 1CQSA 5G1LA 4DSSB 4JBBA 4MA9A 3I6AA 1OF5A 1LU4A 4MZCA 5AGYA 1U3AA 3ERFA 4CY6A 1TU5A 1YZXA 1FYSA 4IW9A 3EPTA 5ELGA 2LTKA 3PCRA 2A2PA 2QC7A 1ERVA 3DMLA 3TKSE 2H6XA 4FH8A 1S723 3CYNA 4XB5A 3G7IA 3AMOA 3IHGA 1PFOA 4X4JA 2VL9A 3LXTA 2VO4A 3ERGA 3TGZA 1STFI 2VCVA 2BIRA 5BU4A 2M46A 1Q4JA 3U1WA 4Z7XA 2XSOB 3S5CA 3GH9A 3KZQA 4A5PA 3HYPA 3D3LA 3ZFBA 3NBJA 1BX9A 5H5SA 4WWUC 1O7MB 3NQZA 4OK0A 3GWRA 1SK1A 3D4AA 1W02A 3KKGA 1MWTA 4WP5A 2HMLB 2OOVA 3GNJA 1I9DA 3P2AA 1SJWA 2YNXA 4ZL8A 2VM1A 5JBSA 3HVSA 1GOYA 5CO3A 2HMJB 4WBJA 2I81A 1UUWB 2DMLA 1ROVA 5GAPD 3BBYA 4HSCX 4BIRA 5ID2A 3FR6A 3VLNA 1M2BA 4YKFA 5HR3A 2W9PA 1TK5B 2BMRB 4Z2TA 3LTAA 1Q864 1VQQA 2XSHB 3GSTA 4G19A 3KZTA 3B4PA 4AF2A 3UIWA 5F06A 3IHQA 1BSDA 4GQCA 1WOUA 2GDRA 2YFLB 3DWVA 3Q2PA 5HFGA 2XH9A 4IN0A 4EVMA 3ERWA 1BIRA 3F4RA 3QOUA 2LYXA 2IYJA 3O6TA 3EWLA 1F3AA 2GGTA 1T00A 2K54A 3PPUA 1HU9A 4MJAA 4BTYA 1B21A 1VQM3 3HVXA 3GTUB 5GSSA 1DMQA 1JB2A 1GRXA 2GTUA 2JSYA 2Y73A 2JACA 3C1SA 5KOWA 4HOJA 4L5LA 5B6MA 2V32A 4OFMA 1PFPA 1MDKA 1K28A 1OC9B 2Q07A 4FR9A 2I1UA 5AYRB 9GSSA 3T0UA 3ER7A 1JZDA 2VL2A 3DVWA 2PZVA 3GRXA 1LOXA 1M1K4 3EU3A 1NHOA 3FEUA 2WRTA 3GX0A 3X3ZA 3H1NA 1SIHA 2F56A 1JLVA 2DJ0A 4WF5A 5IO2A 3M8CA 4KCAA 1XW9A 2C0FA 2D1WA 1AR0A 2LS5A 5B6NA 5JPUA 3ZRDA 2BMXA 1DSBA 1PYLA 2GZYA 2L5LA 1SJ6A 3IC8A 4USSA 2RM5A 3TKSC 5IO0A 1FB0A 2C0DA 1ZYPA 3JUOA 1ULJB 4GHOA 4F82A 1X1YA 3CCR3 3C73A 4OWYA 2FA8A 2QGUA 4OCFA 3BCIA 3PXMA 1K0BA 1JKGB 4WETA 1PRXA 4XRDA 3LYKA 4HVNA 1XWBA 2IN3A 3AY8A 1GNEA 1DMNA 1JLWA 3ZG5A 4HS1A 1PY3A 1RRLA 3JUQA 3KFQC 1SENA 2K18A 4LEHA 3EC3A 4IKHA 5HR2A 4GLTA 4HYZA 1E97A 2KRTA 3Q74A 1AQWA 1I2GA 2PWJA 3BNDA 3EQQB 2A2SA 2C8UA 1NHYA 1R4CA 3K0ZA 2VIMA 4JR6A 1ERWA 4FYCA 4R4KA 1X5CA 1QAKA 1BUJA 2E2TA 1BEDA 2VD1A 3KCMA 4AKZA 3M0FA 1H4OA 3KCHA 5ENUA 3VFIA 2UUGC 5M19A 2H74A 1MGWA 3NOFA 2KUCA 2XR8B 3EJVA 1WIKA 1TDIA 2DIZA 4GSSA 5AI1A 1GSYA 4U13A 1B2MA 2H0IA 1GP1A 4BVXA 2H1DA 1I0VA 2M7OA 4BL7A 1MTCA 2B24B 1YKCA 4EE0A 3TKPA 1KQS2 4ECBA 2AAEA 1YVSA 1LXEA 1F3BA 3VI5A 2ZA4A 4OUQA 4KX4A 1SJZA 2CX3A 4EIQA 4F0CA 4GTUA 1TRUA 1PA3A 2YWNA 4H61A 3H4KA 4PTSA 2YV7A 3A5EA 2GLRA 3IE3A 1DBYA 2SBLA 5AEUB 1A23A 1DE3A 2OTL3 2KOKA 3M9KA 2TRXA 3IA1A 1GULA 4DVCA 3GUSA 3EE2A 2LJKA 2GSPA 1XFLA 3S29A 4MJCA 4TR1A 3U6VA 3NM7A 4L0UA 1Q7HA 1A0FA 4TR4A 3VPQA 3N9HA 2LRTA 3ECFA 5LC7A 1G0TA 2M80A 1PN0A 5CYYA 2C3QA 3M1GA 1EQKA 1A2JA 2PERA 3GHAA 2KCDA 2GQLA 2O9UX 4GSNA 1V40A 2WULA 3NIVA 3ME8A 7STDA 1N9EA 4FMAA 5JPPA 2HMKB 5G1KA 3UNLA 3WT2A 1BU4A 1S5AA 2OQEC 1ZYNA 1XG8A 1S3DA 2YCDA 4BVYA 2C0GA 1F8NA 5HOHA 3A2XA 1WMNA 2F98A 5GSPA 3T8NA 1Y6EA 3MYDA 4MMXB 3JVCA 2H0HA 1UI8A 3EN1B 3FZAA 4YQMA 2DC5A 4LLRA 4BL7B 3F7SA 1GTAA 4KFDA 3KP9A 1GOUA 4YAVA 4CW9A 1U6TA 1YEXA 2OCTA 3RPNA 7GSSA 4EKZA 4LYLB 3ZVJA 2MMZA 3I0YA 3A5IA 3GZYB 1GUHA 5IQYA 2RNTA 1A2VA 4J9AA 2KF3A 4BVXB 3FSDA 2R4VA 3N54B 1WP0A 2HRKA 2W04A 3NM2A 3G9BA 1FZUA 3U5RE 3M8NA 1OF5B 3X40A 4KFEA 1UW1A 4HZ9B 3UOMA 2PMTA 1XWCA 1IT8A 4O32A 1SK0A 3TRQA 1R5PA 1DMMA 8GSSA 1A8YA 3I43A 1OE7A 2K0MA 3DYRA 3TJFA 1S3CA 1TTZA 5BVBA 4XDWA 1JZRA 1ROAA 4OCEA 2CFDA 4FCZA 2XBIA 3CPW2 4GL6A 1XVWA 1GYBA 1OC8A 2HSHA 3A3TA 3GKKA 2CH9A 3AGNA 1WQLB 2ZNMA 3BLZA 3M3MA 4V1Ag 1MNLA 4AKYA 1YF1A 4FQUA 6STDA 1L5GB 3VPTA 3WDGB 1EGOA 3G0KA 1FGMA 1K734 3RGRA 4IIAA 2LUSA 1NSWA 3TKQA 1BYEA 4O3VA 2RUFA 2B5EA 5IEOA 1FGOA 3NXJA 1VQ83 1N8QA 4O2HA 1XWKA 3N8BA 2P0GA 2YWOA 1EA2A 1ZO2A 1TFOA 1WMPA 4RNTA 2LRCA 1SK2A 1MD4A 1BRNL 4R9LA 1YEPA 4HM0B 2KP1A 2W0QA 3VF1A 1JZOA 1Y25A 2GZPA 4EO3A 2R2JA 1OPYA 3VI7A 4IQ1A 2K6VA 1D6UA 1VF4A 5HR0A 1GS3A 5KN2A 2RFRA 3AGOA 4MPFA 1WRYA 2GQMA 3CCV3 5J9BA 5ECOB 3B8LA 5CRHA 1VRSD 2OTJ3 1QMVA 2I3YA 3KMNA 1RNTA 2X4AA 1W01A 1NDOB 4K6XA 3TCOA 2UGIA 2ON5A 2L4QA 3RBTA 2I9WA 2IUJA 1GSDA 1ON4A 4Z2RA 1G02A 5I97A 1RGGA 5EEOA 1RMSA 1DUGA 1ZOFA 6GSTA 2CX1A 4HM3B 4KNDA 4BWQA 1S3RA 2CQ9A 1I3IA 3DMCA 1JV2B 3IAM2 5G31A 3DVXA 5BIRA 1Q7Y4 1CQHA 5ECQB 1GSSA 3UB1A 3DGQA 5CNWA 5AEWB 1GSFA 4X43A 1IQYA 2CWUA 2CFWA 1Z3EA 2JZSA 2MYGA 4ECCA 4XCSA 3FYGA 1X5EA 2HMMB 1BNEA 4ID0A 3STDA 5AIHA 3A5WA 1VQO3 3HOHA 5F8BA 1SPUA 2FA4A 2F8AA 2ML6A 5IG5A 3J7Yk 3UVHA 3Q1CA 4H86A 5IMCA 2HXKA 4KA0A 1TUHA 2MMAA 1Q824 2HSYA 1M904 4K7NA 2HFDA 2PUKC 4PQ1A 4N3VA 2L4VA 3NHXA 3UAPA 5FWGA 3WGEA 4PNFA 3MAKA 5DQSA 1PKWA 5IOWA 4ZB6A 1GY5A 5IENA 1VZZA 1RGAA 1B4PA 4HQSA 2YX9A 4JZQA 3TJJA 1ZX2A 3FMWA 2B5XA 5ECLB 3VWVA 1TJDA 2A2RA 3KH9A 3FG4A 1WTHA 3WOFB 1W89A 3EBYA 5IERA 2EIOA 2W9QA 1G6WA 3G7YA 1BG5A 2FWFA 1KSIA 1RN4A 1SJIA 3V99A 1Q42A 1MWUA 1V57A 4OMVA 3X41A 4N6MA 5JWOB 1OHOA 5G5EA 1GLPA 3GFKA 1QFNA 2GU3A 1NNVA 4MJDA 1O8WA 1IVUA 4F9ZA 4Z2UA 2RGQA 2GU1A 5CP1A 4EDYA 5DREA 1OYJA 2GSQA 2L4CA 2HRNA 3ZL5A 1NM3A 3TOTA 3RHBA 1OGXA 1TIJA 5IG4A 5ELJA 1FGQA 4IS0A 2PGTA 2FHEA 4PEJA 4XRAA 1FHEA 3IAS2 1I8VA 1RCKA 5D9VA 3R3EA 2B7KA 3F4TA 3GX8A 3HHVA 5IG3A 5CRWA 3QD9A 4K7IA 1QMAA 1NB3I 3K5TA 1K0AA 3DKSA 1ABAA 2CW9A 3LTDA 4OO4A 1YY7A 1A67A 2N5FA 3R2QA 3VGNA 1JB5A 1GY6A 4TXOA 1T4ZA 3U97A 5M1AA 3ZVJD 3RNTA 1IT7A 4HAAA 1TW9A 2FWEA 1PL1A 5ABRA 4BTWA 1GMQA 4WR4A 1SD9A 3HDCA 3VSYA 2H1GA 2F5WA 1K8A4 1WNHA 2FD3A 3HCZA 4XS1A 2LKUA 1PGTA 2WCIA 2QA2A 3F6FA 3WA3A 3LMLA 2WJUA 4LZIA 1OVNA 2IMFA 1HQOA 1EKMA 1AQXA 2CVKA 1BUQA 3X42A 4HJLB 3MWZA 3BOAA 3L4NA 1TRQA 2OQEA 2HZFA 2IL3A 1XIYA 5F0GA 2YP6A 3I9V2 4G0LA 2HE3A 4JF8A 2WFCA 3G4S3 1XCCA 4N6NB 4WHAA 3IPZA 5EY6A 4BL3A 4FYUA 3A2WA 1AXDA 1BSCA 3OV4A 1PSQA 3QAWA 1WPIA 3PR8A 4IGJA 1G6YA 4KH7A 1M1XB 1TP6A 2IMJA 4J2FA 1O8XA 3NBBA 4CY8A 1EUIC 1DVCA 1HZ1A 4EBGA 2CV4A 4EYCA 1TTOA 1K3YA 4KVHA 2D42A 4PXOA 2C1YA 3F6DA 2HYXA 3OWUA 9RNTA 3WR2A 4PUAA 2IA7A 1JHBA 3MYTA 3CXGA 3GZRA 4J5KA 1O7WB 2LNTA 6GSWA 2CX0A 1UCKA 5STDA 3AHSA 20GSA 2NTOA 3G16A 3ZLPA 5KP3A 3IK7A 1Z1SA 5TGNA 4AJ6A 3VWXA 2XEPA 2QKEA 3OWSA 1ZYEA 2MMOA 3Q6OA 3HIIA 1YGEA 3MWHA 1TRVA 1VQL3 1U3IA 4Q5NA 3DM8A 4WEYA 4FMCA 4FYBA 3PINA 5CRGA 1M9BA 4FO5A 1THOA 2ZDJA 1A2MA 3W6GA 2FUG2 2H1BA 2M72A 3RDWA 1LNHA 1YGWA 1J9BA 2AUVA 1BOXA 2R37A 3D4MA 2BNGA 3QCPA 3EN8A 4MH2A 1BAOA 1QGVA 2PU9C 3MG1A 4KDUA 4L0WA 1VQ93 5LD0A 3SVAA 2XBQA 6GSVA 1JFUA 5IEPA 1XWGA 3QFBC 2A4HA 3DGYA 3RHCA 10GSA 3UMAA 1LQMB 4OFTA 1U5OA 5JCWA 1QALA 4ZILA 4KGIA 3G7JA 4ULXA 1VQ43 5D9WA 2ZHXB 1SD8A 4X1UA 2O85A 1KBNA 3ISOA 3NBRA 3UL5A 2PVQA 3K8NA 4MF5A 1O85A 2EIRA 4DSQA 4LMWA 4R80A 3MG3A 1M9GA 4HQZA 1YHQ3 4IELA 4V2NA 1SARA 1SYXA 1ERTA 5HFKA 5IMDA 5KN0A 1K0DA 3H51A 2OE3A 1O73A 3FR3A 1FOHA 3FG3A 4RI6A 4WR5A 4I8BA 4CHSA 1EEJA 1K41A 1Z5YE 5H5RA 3HJOA 5ID2B 3LTBA 2BMOB 4BTXA 2INXA 4O7HA 3LSZA 4RBNA 3KTLA 4RI7A 3DXOA 2WGOA 1BJXA 5IG0A 4HZBB 1PN9A 1WMOA 2F5MA 2K3DA 4G9HA 3CCJ3 3NX0A 3EX9A 1IV7A 1BNRA 3VWWA 2GT5A 2F99A 1EV4A 3DY5A 4Q5RA 3QAVA 1ZYQB 3SXXA 1XW5A 2V1LA 5IPGA 2P05A 2IMEA 3WT1A 1EP7A 4CDLA 1SU9A 1GUMA 2PBJA 1MWSA 1BGSA 3BCKA 4EIPA 3LH4A 2HI7A 4MABA 2DLXA 3UARA 2RCDA 2PPTA 5AIVA 2HRFA 3FZ9A 2IMIA 5CAXA 1QQ2A 4I5QA 1JRQA 1I5GA 2KXGA 3L0HA 2YJ7A 3UL3A 2H70A 2D2ZA 3SBCA 1LQGC 3V92A 4TKYA 4AJ7A 3WA2X 3FF0A 1K3LA 2P38A 4J5GA 4ZB9A 1I70A 1TRWA 2OKAA 1B2SA 2AHEA 4EXJA 2NVLA 4XBTA 3IC4A 2GBWB 5G5FA 3O8YA 4LA1A 5HQPA 2BO9B 1OAZA 2C11A 2CA8A 2CX4A 1AVKA 1ML6A 2B7JA 2H30A 1BAYA 2RUEA 2TIRA 5D93A 2IIYA 2E7PA 3LOYA 1MGRA 1FUSA 2G2QA 1B3SA 5DJLA 1N5HA 1OE8A 1RSNA 2DMMA 3HJPA 2GSRA 1PL2A 4XHMA 2R0PA 4K7OA 3CBUA 1QAFA 1BRJA 3NV0A 3TKRA 1MWRA 4N6V0 1FG4A 1ZS7A 3GSPA 4EXRA 2O7KA 2IJYA 3GYKA 5DCGA 1SL1B 3I69A 3BJ5A 3ZMKA 4F2IA 4HM2B 2H71A 1VQK3 1RRHA 1FGTA 2P0MA 2BU4A 3FHKA 5ECNB 2CFGA 4O5QA 5FGOA 3MKIA 1W7CA 1V74A 3D5GA 4IPBA 5D83A 2B5YA 3MG2A 2GS3A 1MOLA 2O3OA 4FIWA 3CSJA 4L5OA 4XM4A 14GSA 1YIJ3 3TB2A 1ULIB 2IWTA 4WXTA 3PCSA 1X1UA 2HT9A 4DEJA 3GN3A 3AMOB 1O7NB 2QEX3 2BT3A 3KE7A 1CYUA 6GSPA 5B7CA 3DEXA 4MZWA 5L71A 1EG9B 2OBIA 3ZIVA 1YNVX 3ZMLA 1VQ73 3F7XA 2X49A 3DGNA 1ZZYA 2O8VB 1JB4A 3ZFZA 1HNCA 3UBKA 1M3JA 1V58A 2XFTA 4GB5A 1QK8A 5D8IA 2E2MA 2GEYA 4K61A 3S28A 3N5OA 1OCVA 3QDNA 2GEXA 2R6KA 3FY7A 2UX0A 2REMA 3TKSA 4N6LA 4XS6A 1JNQA 1Q98A 1TP9A 3QRDA 1RKYA 2H6ZA 1YJ6A 3EMXA 1R7HA 4X2HA 5J9CA 1IYIA 2RIIA 1LRAA 2F8FA 3JCML 2WGRA 19GSA 2DIYA 4K1FA 3TDGA 1GWCA 2J23A 4OD7A 1MD3A 1YF0A 3UJMA 4R1KA 2B1KA 2AJQB 1IK3A 2V6OA 2OADA 1XOBA 3F40A 1UCIA 5GSTA 1D6YA 1LVNA 4EC6A 1FVKA 5LC6A 2YN1A 1TK0B 13GSA 2LNSA 1MDIA 2L1SA 5JWQB 5D81A 3CTGA 1AAZA 1BNSA 5INYA 5IW9A 2LQVA 1GSEA 2WOFA 5M18A 2CFLA 1J2BA 3ALAA 3SOYA 1M3IA 2C3TA 4KSOA 4J57E 3TUEA 3EMPA 4QQ7A 2P5RA 2DJ1A 2DSAA 2N5BA 5IMVA 3B4OA 2YPMA 1FB6A 4PUFC 3K9MC 1O81A 2YZUA 2XPEA 1RN7A 3KGKA 1OHPA 2IFQB 3F9SA 4K0GA 3DZLA 3AHWA 2C3NA 2W03A 2Z7AA 4KE3A 3CCM3 3V98A 2VLVA 1LJRA 3KJYA 4ZL9A 1I3FA 3LQ7A 1TOFA 1FUTA 1FAAA 4MEIA 3APSA 5A4WA 4YQUA 3CC23 1E6BA 1BQ7A 3SWLA 2FWHA 1VF1A 1PD21 1YQ1A 1RJOA 1BRHA 4TVEA 4TOPA 2H6YA 4V2MA 2ON7A 3EYTA 2K9FA 2YV9A 4HI7A 2H1AA 1NO3A 3SLUA 4IP6A 4ZIJA 5ECRB 4K0NA 1JBTA 1VQN3 3G8ZA 2WO0A 3CRUA 3FW2A 1JKGA 2JZTA 2OA7A 4QWTA 1T4YA 3KIIA 1I2FA 1V2AA 2PNCA 2XHFA 3W8JA 6RNTA 1E2YA 4MMMA 3S67A 5DCHA 2HZEB 1T2HA 2FLSA 1NJI4 2JL4A 4PQHA 4K8MA 1B9YC 4BU4A 5J5NA 2XF3A 1Z7RA 3QR6A 1FA3A 3GA4A 3BU4A 1A2LA 4QL9A 3VWUA 2DBCA 4YKGA 4L8PA 2MBTA 4PGTA 4IVFA 1GY7A 1E3VA 2CZ2A 2XGLA 2CG1A 1O7GB 4KDXA 3B7CA 2VCQA 3HK4A 5B8AA 2OE0A 2Z9SA 1FW7A 4I2TA 2CVBA 3RAZA 4K1VA 2R4IA 1G7EA 1JN5A 3GKXA 3EHCA 1GMRA 1K0MA 2CWTA 3X3XA 4CCVA 4L8EA 2V41A 3CSIA 3CSHA 3MIXA 4KB3A 1AQVA 4BPYA 4KSMA 2KP2A 3GKMA 2EIQA 3GMFA 4KCEA 1T3BA 5B8BA 2YOIA 5AIIA 6GSYA 3I553 3BNBA 2AV4A 2GVPA 4TR0A 4JU5A 2CK3H 1XOAA 3FZ4A 5EPFA 4GSPA 3ZREA 2E2VA 2CAQA 5C00A 1W6GA 1GSPA 3NV0B 3C71A 4N30A 3F9UA 3CNMA 18GSA 1EWXA 4JEDA 4P3YB 1FVJA 2X8GA 3L0RA 1T5YA 4N6TA 3HZPA 2PN8A 16GSA 1UCLA 4F0BA 3X3YA 3GSSA 3KN4A 4V2LA 1CQGA 4K2DA 1QUWA 1JJ22 3G713 1BNJA 3HKRA 4GWRA 2K8SA 5FT3A 3IMAB 2C0EA 3HVNA 1IU7A 5F05A 3L9VA 1GMPA 4WKWA 2QGVA 3WHOA 5IMZA 2OACA 2HMNB 1O7PB 1OGZA 2QA1A 4Q5FA 1UGHI 2F9SA 4CDOA 2STDA 5A5KA 1GTBA 1PU4A 2QSIA 1XW6A 1GOVA 1YIT3 1N2AA 2A4VA 2B1LA 2GSSA 2X64A 3ZITA 2F3MA 3DIEA 1PQNA 1OKTA 3ZIJA 4DSRA 4O8SA 4O02B 2HZEA 3DXBA 2C10A 3IR4A 1TI1A 2SARA 1KTEA 3EU4A 1B8XA 3SX1A 2AB6A 1GL8A 1Q40B 1MEKA 4MMZB 2C4JA 2VCZA 1ASKA 3BD2A 4NHFA 4ZBAA 1TU8A 4GCIA 5BRTA 3BIRA 1NU3A 2V6KA 2YWIA 3KSPA 2XC2A 4BIKA 3Q90A 1C72A 2H01A 4G2EA 4MK3A 3LZAA 1THXA 3L9SA 1W4NA 1YI23 1GSUA 3GURA 2NPBA 3UL6A 3D6IA 1DE2A 2L6DA 1BNIA 1KNGA 3FK8A 5LNKe 4NV2A 2X99A 2Z77A 4EW5A 5COHA 3J7Yd 5DRVA 7RNTA 1RGKA 4X2OA 1EGRA 2XRXB 3Q3FA 1TU7A 4OVMA 1QXHA 5CREA 3SYUA 1RGLA 5FW5A
chains in the Genus database with same CATH topology
4NMUA 2DJJA 2CAIA 3FKFA 1ZL9A 2R0CA 4GXZA 1M99A 1XPVA 2MBSA 6GSUA 4EL1A 4ZB8A 2LV3A 3ZFLA 2NBSA 2N5AA 1SKRB 2CVDA 3C1RA 3D22A 2P31A 2H76A 3O76A 4K5RA 1F6MC 4PQIA 4G0KA 3Q19A 1JZWA 3F8UA 4HJMA 4TRXA 3L9UA 1T1VA 2V2GA 2JZRA 1OC3A 5DALA 4ACSA 1TRSA 3HJMA 1XZOA 4IJIA 5G30A 1K0NA 2VLTA 1Z9HA 3CRTA 4MJBA 2WZ9A 1LBKA 3CMIA 2L5OA 4MF7A 4N0ZA 5D9XA 2VCWA 4AJ8A 3N9JA 1DE1A 1RW1A 5IM9A 4F03A 5J3RA 5KEJA 2H8LA 2VLUA 5A4VA 1K0CA 4XTSA 1ZCPA 2LRNA 2O87A 3FR9A 4YAPA 2EC4A 4J56E 1U88A 4TR3A 3RPPA 1WE0A 1ILOA 4MLYA 5EVOA 5A4UA 2G0FA 2IFQA 1A8LA 4PURA 4LL1B 1OC9A 3H8QA 3Q18A 5IMFA 4OO5A 4IP1A 1V9WA 3HVVA 1UVZA 2WDUA 4HU7A 2HSMA 1GSQA 1K3OA 4K5SA 1M2DA 3WYWA 2VL2C 4EF0A 4MP4A 2L6CA 3KEBA 4BVYB 4WF4A 5GAND 4MNNA 1A0RP 5FHIA 2I9HA 1AC1A 2H73A 2AAWA 2CZ3A 1J08A 4ZBDA 4JRRA 5DVBA 3HD5A 5JWRB 4PNGA 3E0UA 4MF6A 2LQQA 2XPDA 2VD0A 5E4WA 4KUNA 1UN2A 4GF0A 2IMDA 5JCGA 1WWJA 3IRAA 2LSTA 3P7XA 5CRDA 1X9SB 4EDZA 3V1WA 3KM6A 5D96A 4G0IA 4ILFA 2H72A 2RLIA 3KMOA 2FCHA 2IY2A 4IBPA 1EP8A 4ML6A 4XS4B 1Z7PA 2O89A 3MNGA 3LFLA 1HNAA 3GH6A 4YH2A 2R3XA 5ECHB 4HU9A 4MPGA 1RK4A 5F07A 1Z6MA 1PKZA 3TJBA 4MH3A 2ES7A 3F3RA 3EINA 5D73A 3US3A 2P5QA 4I97A 4TXVA 2FY6A 2K8VA 2VM2A 2HNLA 2H0GA 1XXUA 2E0QA 2GQKA 4NAXA 2B3SA 2VUPA 4WBRD 4IQAA 2GT6A 2VAFA 3D21A 4ZBBA 4N0VA 3LXZA 22GSA 3D5JA 4HJ2A 3S9FA 5DJMA 1G7OA 5ECPB 3WD6A 3C7MA 3EURA 4V1Ap 1TKDB 4QL7A 1O6JA 4I6XA 2HLSA 2E2GA 2H66A 4K2XA 1V98A 2VL3A 2X8HA 11GSA 3MDKA 1FW1A 4D73B 5DAKA 5IPHA 3ZYWA 2OE1A 3EVIA 3F63A 1HYUA 5KOXA 3PGTA 2YZHA 1GH2A 2AYTA 1X9WB 3TRPA 4IHUA 4XS4A 4O92A 1GTUA 3TJGA 4E8EA 4HZ2A 3MSZA 2I4AA 4RQRA 3GL5A 1M2AA 3ZTLA 1XVQA 4ZL7A 3UJ1A 4POLA 2X8CA 1K0OA 2MZCA 3HXSA 2R0GA 3HZ8A 4AGSA 1Z6NA 3DRNA 2PVOC 4MZBA 4ZXGA 5ECIB 5IMAA 2ALBA 5D9TA 2BTOT 3FRCA 1ZGNA 4MCUA 1X9MB 1W4VA 4ECJA 3OR5A 1TK8B 2H19A 1GLQA 2CT6A 1GNWA 1SKWB 4POKA 3TJKA 3UVTA 17GSA 1PX7A 2DKHA 1PX6A 4N10A 4NPBA 4Q5QA 3D0ZA 3KIJA 1T7PB 3APQA 4RQXA 3KXOA 4XIHA 2OJLA 3QMXA 2V1MA 1WJKA 5AISA 4LMVA 4NWYA 4NHZA 1AW9A 1OKDA 1B4QA 1EZKA 3KH7A 3H93A 1AIUA 3QAGA 1M0UA 5ECKB 5AIXA 1ZMAA 1UA5A 2C80A 12GSA 3UBLA 2WS2A 3KTBA 4ECIA 2B6MA 1F2EA 2VOCA 1FO5A 5E59A 4GSTA 2H75A 3FZ5A 3IDVA 4JR4A 3LEFA 1F37A 1KEBA 3HZ4A 4OFNA 3CTFA 4EUYA 5DALB 1B48A 3IV4A 4HEA2 3F0IA 4HDEA 5J4UA 1VF3A 4JE1A 2MMNA 1NW2A 3WGDA 5DDLA 3GV1A 3UEMA 2OBKA 3LW9A 4ICYA 1TI3A 4TR1B 1N8JA 5DQYA 3VK9A 3P90A 2KHPA 1SL2B 3ME7A 1MDJA 1SYRA 2TRCP 1U87A 2DJ2A 5ECSA 4BA7A 5DAKB 1S3AA 1XBSA 2F51A 4YQVA 2VCTA 1M9AA 5HR1A 2LEGA 1X5DA 4LL4B 1YDKA 1AUCA 5G2ZA 3A2VA 2UZ8A 1SKSB 2FNOA 3ZZXA 4GQFA 4KAEA 4RUVA 1M7TA 3VURA 1R5AA 4KW6A 3TOUA 3LGCA 1USBA 2DJ3A 3IK9A 5IOXA 5J41A 1PMTA 3APOA 4MDCA 3J7Yb 4BWSA 4I2UA 3KD0A 2YANA 3HY2A 2JU5A 3QPMA 1SL0B 1R4WA 3LYPA 1FOVA 2J9HA 2IPAA 3LJRA 1X0RA 1EOGA 2JSZA 2YJHA 5DBQA 1TXXA 3L78A 1EOHA 6GSXA 5EL8A 3LWAA 6GSSA 2FWGA 1ERUA 5ECMB 3D4TA 3F4SA 5KN1A 1RQMA 1O7UA 2BJXA 2HRAA 2IMKA 5H5QA 1ACVA 2ZUPA 2R5GA 3IXRA 2LQOA 3O3TA 5GZZB 4NXIA 3C8EA 4DSSA 2YWMA 5LCZA 5IIZA 4O5UA 1EEMA 4O5RA 2L59A 3PH9A 3IOSA 4HUAA 3M9JA 2GSTA 3DD3A 1YKAA 4MJEA 1WMJA 3P8WA 3GKNA 3GIXA 1EV9A 3HA9A 3W8SA 1F9MA 3TRXA 1H75A 1A24A 1HNBA 2GZZA 4KF9A 4GRFA 2DJKA 5HFIA 4D73A 2NDOA 4POBA 5BMUA 3ED3A 3E9JB 3LORA 4TN8A 4N11A 2WB9A 2JADA 2LJRA 1T8EB 2ZCTA 1VF2A 2KLXA 3KP8A 4NHWA 5C04A 1HD2A 1UC7A 3QFAC 4IJ3A 1GTIA 4HZ4A 3NZNA 4PX1A 4ML1A 2LJAA 3GL3A 4X0XA 1GUKA 3WGXA 1URMA 1VGLA 1B9XC 4POMA 5KN3A 4E8HA 2L57A 4EC0A 4K9ZA 4TXOB 4TW5A 1J0FA 2VCXA 3H79A 2FGXA 2DKIA 3GTUA 1ST9A 1R26A 3F3QA 3LG6A 4KDYA 1IYHA 3IBHA 3E3EA 4G10A 5AN1A 4ISDA 2RM6A 1XWAA 5JCUA 4NV5A 5ELAA 5G1LA 4DSSB 4JBBA 4MA9A 3I6AA 1LU4A 4MZCA 5AGYA 1U3AA 3ERFA 4CY6A 1YZXA 4IW9A 3EPTA 5ELGA 2LTKA 2A2PA 2QC7A 1ERVA 3DMLA 3TKSE 2H6XA 4FH8A 3CYNA 3G7IA 3IHGA 4X4JA 2VL9A 3LXTA 2VO4A 3ERGA 3TGZA 2VCVA 2M46A 1Q4JA 4Z7XA 3GH9A 3KZQA 4A5PA 3HYPA 3ZFBA 1BX9A 5H5SA 1SK1A 3GNJA 1I9DA 3P2AA 2YNXA 4ZL8A 2VM1A 3HVSA 5CO3A 4WBJA 2I81A 2DMLA 5GAPD 3BBYA 5ID2A 3FR6A 3VLNA 1M2BA 4YKFA 5HR3A 1TK5B 4Z2TA 3GSTA 4G19A 4AF2A 3UIWA 5F06A 3IHQA 4GQCA 1WOUA 2GDRA 3DWVA 5HFGA 4IN0A 4EVMA 3ERWA 3F4RA 3QOUA 2IYJA 3O6TA 3EWLA 1F3AA 2GGTA 1T00A 3PPUA 4MJAA 3HVXA 3GTUB 5GSSA 1GRXA 2GTUA 2JSYA 2JACA 3C1SA 5KOWA 4HOJA 4L5LA 5B6MA 2V32A 4OFMA 1MDKA 1OC9B 2I1UA 9GSSA 1JZDA 2VL2A 3DVWA 3GRXA 3EU3A 1NHOA 3FEUA 2WRTA 3GX0A 3H1NA 1JLVA 2DJ0A 4WF5A 5IO2A 4KCAA 1XW9A 2C0FA 2LS5A 5B6NA 3ZRDA 2BMXA 1DSBA 2GZYA 2L5LA 1SJ6A 3IC8A 4USSA 2RM5A 3TKSC 5IO0A 1FB0A 2C0DA 1ZYPA 4F82A 3C73A 4OWYA 2FA8A 4OCFA 3BCIA 1K0BA 4WETA 1PRXA 4XRDA 3LYKA 2IN3A 1XWBA 3AY8A 1GNEA 1JLWA 4HS1A 1SENA 3EC3A 2K18A 4IKHA 5HR2A 4GLTA 3Q74A 1AQWA 2PWJA 2A2SA 2C8UA 1NHYA 2VIMA 4JR6A 1ERWA 4FYCA 1X5CA 1BEDA 2VD1A 3KCMA 3M0FA 1H4OA 5ENUA 3VFIA 2H74A 3NOFA 2KUCA 1WIKA 1TDIA 2DIZA 4GSSA 1GSYA 2H0IA 1GP1A 4BVXA 2H1DA 4BL7A 1MTCA 1YKCA 4EE0A 3TKPA 4ECBA 1F3BA 3VI5A 4KX4A 1SJZA 2CX3A 4EIQA 4F0CA 4GTUA 1TRUA 1PA3A 2YWNA 3H4KA 4PTSA 2YV7A 2GLRA 3IE3A 1DBYA 1A23A 2KOKA 3M9KA 2TRXA 3IA1A 1GULA 4DVCA 3GUSA 3EE2A 2LJKA 1XFLA 4MJCA 4TR1A 3U6VA 4L0UA 1A0FA 4TR4A 3VPQA 2LRTA 1G0TA 2M80A 1PN0A 5CYYA 2C3QA 3M1GA 1A2JA 2PERA 3GHAA 2GQLA 4GSNA 1V40A 2WULA 3NIVA 3ME8A 5G1KA 3WT2A 1ZYNA 1S3DA 2YCDA 4BVYA 2C0GA 3A2XA 3MYDA 1Y6EA 2H0HA 3FZAA 4YQMA 2DC5A 4LLRA 4BL7B 1GTAA 3KP9A 4YAVA 4CW9A 1U6TA 1YEXA 3RPNA 7GSSA 4EKZA 3ZVJA 2MMZA 3A5IA 1GUHA 5IQYA 4BVXB 2R4VA 1WP0A 2HRKA 3G9BA 3U5RE 3M8NA 3UOMA 2PMTA 1XWCA 4O32A 1SK0A 3TRQA 1R5PA 8GSSA 1A8YA 3I43A 1OE7A 3DYRA 3TJFA 1S3CA 1TTZA 1JZRA 4OCEA 2XBIA 1XVWA 1OC8A 2HSHA 3A3TA 3GKKA 2ZNMA 3M3MA 4V1Ag 1YF1A 4FQUA 3VPTA 1EGOA 2LUSA 1NSWA 3TKQA 1BYEA 2RUFA 2B5EA 1XWKA 2P0GA 2YWOA 2LRCA 1SK2A 1MD4A 1YEPA 2KP1A 1JZOA 1Y25A 2GZPA 4EO3A 2R2JA 3VI7A 4IQ1A 2K6VA 1VF4A 5HR0A 5KN2A 4MPFA 1WRYA 2GQMA 5J9BA 5ECOB 5CRHA 1VRSD 1QMVA 2I3YA 3KMNA 2X4AA 4K6XA 3TCOA 2ON5A 2L4QA 3RBTA 1GSDA 1ON4A 4Z2RA 1DUGA 1ZOFA 6GSTA 4BWQA 4KNDA 2CQ9A 3IAM2 5G31A 3DVXA 5ECQB 1CQHA 1GSSA 3DGQA 5CNWA 1GSFA 4X43A 1Z3EA 2JZSA 2MYGA 4ECCA 4XCSA 3FYGA 1X5EA 4ID0A 3A5WA 5F8BA 2FA4A 2F8AA 3J7Yk 3UVHA 4H86A 5IMCA 2HXKA 4KA0A 2MMAA 2HSYA 4K7NA 2HFDA 2PUKC 4PQ1A 3UAPA 5FWGA 3WGEA 4PNFA 3MAKA 5DQSA 1PKWA 5IOWA 4ZB6A 1B4PA 4HQSA 4JZQA 3TJJA 3FMWA 2B5XA 5ECLB 3VWVA 1TJDA 2A2RA 3KH9A 1W89A 2EIOA 1G6WA 3G7YA 1BG5A 2FWFA 1SJIA 1V57A 4OMVA 5JWOB 5G5EA 1GLPA 3GFKA 1QFNA 1O8WA 4F9ZA 4Z2UA 5CP1A 4EDYA 1OYJA 2GSQA 2L4CA 2HRNA 3ZL5A 1NM3A 3TOTA 3RHBA 4IS0A 2PGTA 2FHEA 4XRAA 1FHEA 3IAS2 5D9VA 3R3EA 2B7KA 3F4TA 3GX8A 3HHVA 5CRWA 3QD9A 4K7IA 1K0AA 3DKSA 1ABAA 4OO4A 1YY7A 2N5FA 3R2QA 4TXOA 1T4ZA 3ZVJD 1TW9A 2FWEA 1PL1A 5ABRA 4WR4A 1SD9A 3HDCA 2H1GA 2FD3A 3HCZA 4XS1A 2LKUA 1PGTA 2WCIA 2QA2A 3F6FA 2WJUA 1OVNA 2IMFA 1HQOA 1AQXA 2CVKA 3BOAA 3L4NA 2HZFA 2IL3A 1XIYA 5F0GA 2YP6A 3I9V2 4G0LA 2HE3A 2WFCA 1XCCA 3IPZA 5EY6A 4FYUA 3A2WA 1AXDA 1PSQA 3QAWA 1WPIA 3PR8A 4IGJA 1G6YA 4KH7A 4J2FA 1O8XA 4CY8A 2CV4A 1K3YA 4PXOA 2C1YA 3F6DA 2HYXA 4PUAA 1JHBA 3CXGA 6GSWA 2LNTA 20GSA 2NTOA 3ZLPA 3IK7A 4AJ6A 3VWXA 2QKEA 1ZYEA 2MMOA 3Q6OA 3MWHA 1TRVA 1U3IA 4Q5NA 4WEYA 4FYBA 3PINA 5CRGA 1M9BA 4FO5A 1THOA 1A2MA 3W6GA 2FUG2 2H1BA 2M72A 3RDWA 1J9BA 2AUVA 2R37A 3D4MA 3QCPA 4MH2A 1QGVA 2PU9C 4KDUA 4L0WA 5LD0A 2XBQA 6GSVA 1JFUA 1XWGA 3QFBC 2A4HA 3RHCA 10GSA 3UMAA 4OFTA 5JCWA 4ZILA 4KGIA 3G7JA 4ULXA 5D9WA 1SD8A 4X1UA 2O85A 1KBNA 3ISOA 3K8NA 2PVQA 4MF5A 1O85A 2EIRA 4DSQA 4LMWA 4HQZA 4IELA 4V2NA 1SYXA 1ERTA 5HFKA 5IMDA 5KN0A 1K0DA 2OE3A 1O73A 3FR3A 1FOHA 4RI6A 4WR5A 4I8BA 4CHSA 1EEJA 1Z5YE 5H5RA 3HJOA 5ID2B 4O7HA 3LSZA 3KTLA 4RI7A 1BJXA 1PN9A 4G9HA 3VWWA 2GT5A 1EV4A 4Q5RA 3QAVA 1ZYQB 1XW5A 5IPGA 2IMEA 3WT1A 1EP7A 1SU9A 1GUMA 2PBJA 3BCKA 4EIPA 2HI7A 4MABA 2DLXA 3UARA 5AIVA 2PPTA 2HRFA 3FZ9A 2IMIA 5CAXA 1QQ2A 4I5QA 1I5GA 3L0HA 2YJ7A 3UL3A 2H70A 2D2ZA 3SBCA 4TKYA 4AJ7A 1K3LA 4ZB9A 4EXJA 1TRWA 2OKAA 2AHEA 2NVLA 3IC4A 5G5FA 4LA1A 5HQPA 1OAZA 2CA8A 2CX4A 1ML6A 2B7JA 2H30A 1BAYA 2RUEA 2TIRA 5D93A 2IIYA 2E7PA 2G2QA 5DJLA 1OE8A 2DMMA 3HJPA 2GSRA 1PL2A 4XHMA 2R0PA 4K7OA 3CBUA 3TKRA 1FG4A 2O7KA 2IJYA 3GYKA 5DCGA 1SL1B 3I69A 3BJ5A 3ZMKA 4F2IA 2H71A 3FHKA 5ECNB 4O5QA 2GS3A 2B5YA 4FIWA 3CSJA 4L5OA 14GSA 3TB2A 2IWTA 4WXTA 2HT9A 4DEJA 3GN3A 5B7CA 3DEXA 4MZWA 5L71A 2OBIA 3ZIVA 3ZMLA 2X49A 1ZZYA 2O8VB 1HNCA 3UBKA 1V58A 1QK8A 5D8IA 2E2MA 3N5OA 3QDNA 2R6KA 3FY7A 2REMA 3TKSA 4XS6A 1Q98A 1TP9A 2H6ZA 1YJ6A 3EMXA 1R7HA 5J9CA 1IYIA 2RIIA 2F8FA 3JCML 2WGRA 19GSA 2DIYA 4K1FA 3TDGA 1GWCA 2J23A 4OD7A 1MD3A 1YF0A 2B1KA 2AJQB 2V6OA 2OADA 1XOBA 5GSTA 1FVKA 2YN1A 1TK0B 13GSA 2LNSA 1MDIA 5JWQB 3CTGA 1AAZA 5INYA 1GSEA 2C3TA 4KSOA 4J57E 3TUEA 3EMPA 4QQ7A 2P5RA 2DJ1A 2DSAA 2N5BA 5IMVA 2YPMA 1FB6A 4PUFC 1O81A 2YZUA 2XPEA 3KGKA 2IFQB 4K0GA 2C3NA 4KE3A 2VLVA 1LJRA 3KJYA 4ZL9A 3LQ7A 1TOFA 1FAAA 3APSA 5A4WA 4YQUA 1E6BA 1BQ7A 3SWLA 2FWHA 1VF1A 1PD21 1YQ1A 4TVEA 4TOPA 2H6YA 4V2MA 2ON7A 3EYTA 2K9FA 2YV9A 4HI7A 2H1AA 4ZIJA 4IP6A 5ECRB 4K0NA 3CRUA 3FW2A 2JZTA 2OA7A 1T4YA 1V2AA 2XHFA 3W8JA 1E2YA 4MMMA 5DCHA 2HZEB 2FLSA 2JL4A 4PQHA 4K8MA 1B9YC 5J5NA 1Z7RA 3QR6A 3GA4A 4QL9A 1A2LA 3VWUA 2DBCA 4YKGA 2MBTA 4PGTA 4IVFA 2CZ2A 4KDXA 2VCQA 5B8AA 2OE0A 2Z9SA 4I2TA 3RAZA 2CVBA 1G7EA 3GKXA 1K0MA 2V41A 3CSIA 3CSHA 3MIXA 4KB3A 1AQVA 4BPYA 4KSMA 2KP2A 3GKMA 2EIQA 3GMFA 4KCEA 1T3BA 5B8BA 2YOIA 6GSYA 2AV4A 2GVPA 4TR0A 4JU5A 1XOAA 3FZ4A 5EPFA 3ZREA 2CAQA 5C00A 3C71A 4N30A 3F9UA 18GSA 1EWXA 4JEDA 4P3YB 1FVJA 2X8GA 2PN8A 16GSA 4F0BA 3GSSA 4V2LA 1CQGA 4K2DA 1QUWA 3HKRA 4GWRA 2K8SA 5FT3A 2C0EA 5F05A 3L9VA 4WKWA 2QGVA 5IMZA 2OACA 2QA1A 4Q5FA 2F9SA 4CDOA 5A5KA 1GTBA 2QSIA 1XW6A 2B1LA 2X64A 1N2AA 2A4VA 2GSSA 3ZITA 2F3MA 3DIEA 1PQNA 1OKTA 3ZIJA 4DSRA 2HZEA 3DXBA 3IR4A 1TI1A 1KTEA 3EU4A 1B8XA 2AB6A 1GL8A 1MEKA 2C4JA 3BD2A 2VCZA 4ZBAA 1TU8A 4GCIA 5BRTA 2V6KA 2YWIA 2XC2A 2H01A 1C72A 4G2EA 4MK3A 1THXA 3L9SA 1GSUA 3GURA 2NPBA 3D6IA 1DE2A 2L6DA 1KNGA 3FK8A 5LNKe 4NV2A 2X99A 5COHA 1EGRA 1TU7A 1QXHA 5CREA 4L8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMU A;  2DJJ A;  2CAI A;  3FKF A;  1ZL9 A;  4GXZ A;  1M99 A;  1XPV A;  2MBS A;  6GSU A;  4EL1 A;  4ZB8 A;  2LV3 A;  3ZFL A;  2NBS A;  2N5A A;  1SKR B;  2CVD A;  3C1R A;  3D22 A;  2P31 A;  2H76 A;  3O76 A;  1F6M C;  4PQI A;  3Q19 A;  1JZW A;  3F8U A;  4HJM A;  4TRX A;  3L9U A;  1T1V A;  2V2G A;  2JZR A;  1OC3 A;  5DAL A;  4ACS A;  1TRS A;  3HJM A;  1XZO A;  4IJI A;  5G30 A;  1K0N A;  2VLT A;  1Z9H A;  3CRT A;  4MJB A;  2WZ9 A;  1LBK A;  3CMI A;  2L5O A;  4MF7 A;  4N0Z A;  5D9X A;  2VCW A;  4AJ8 A;  3N9J A;  1DE1 A;  1RW1 A;  5IM9 A;  4F03 A;  5J3R A;  5KEJ A;  2H8L A;  2VLU A;  5A4V A;  1K0C A;  4XTS A;  1ZCP A;  2LRN A;  2O87 A;  3FR9 A;  4YAP A;  2EC4 A;  4J56 E;  1U88 A;  4TR3 A;  3RPP A;  1WE0 A;  1ILO A;  4MLY A;  5EVO A;  5A4U A;  2G0F A;  2IFQ A;  1A8L A;  4PUR A;  4LL1 B;  1OC9 A;  3H8Q A;  3Q18 A;  5IMF A;  4OO5 A;  4IP1 A;  1V9W A;  3HVV A;  1UVZ A;  2WDU A;  4HU7 A;  1GSQ A;  1K3O A;  1M2D A;  3WYW A;  2VL2 C;  4EF0 A;  4MP4 A;  2L6C A;  3KEB A;  4WF4 A;  5GAN D;  1A0R P;  5FHI A;  2I9H A;  1AC1 A;  2H73 A;  2AAW A;  2CZ3 A;  1J08 A;  4ZBD A;  4JRR A;  5DVB A;  3HD5 A;  5JWR B;  4PNG A;  3E0U A;  4MF6 A;  2LQQ A;  2XPD A;  2VD0 A;  5E4W A;  4KUN A;  1UN2 A;  4GF0 A;  2IMD A;  5JCG A;  1WWJ A;  3IRA A;  2LST A;  3P7X A;  5CRD A;  1X9S B;  4EDZ A;  3V1W A;  3KM6 A;  5D96 A;  4ILF A;  2H72 A;  2RLI A;  3KMO A;  2FCH A;  2IY2 A;  4IBP A;  1EP8 A;  4ML6 A;  4XS4 B;  1Z7P A;  2O89 A;  3MNG A;  3LFL A;  1HNA A;  3GH6 A;  4YH2 A;  2R3X A;  5ECH B;  4HU9 A;  4MPG A;  1RK4 A;  5F07 A;  1Z6M A;  1PKZ A;  3TJB A;  4MH3 A;  2ES7 A;  3F3R A;  3EIN A;  5D73 A;  3US3 A;  2P5Q A;  4I97 A;  4TXV A;  2FY6 A;  2K8V A;  2VM2 A;  2HNL A;  2H0G A;  1XXU A;  2E0Q A;  2GQK A;  4NAX A;  2B3S A;  2VUP A;  4WBR D;  4IQA A;  2GT6 A;  2VAF A;  3D21 A;  4ZBB A;  4N0V A;  3LXZ A;  22GS A;  3D5J A;  4HJ2 A;  3S9F A;  5DJM A;  1G7O A;  5ECP B;  3WD6 A;  3C7M A;  3EUR A;  4V1A p;  1TKD B;  4QL7 A;  1O6J A;  4I6X A;  2HLS A;  2E2G A;  2H66 A;  1V98 A;  2VL3 A;  2X8H A;  11GS A;  3MDK A;  1FW1 A;  4D73 B;  5DAK A;  5IPH A;  3ZYW A;  2OE1 A;  3EVI A;  3F63 A;  1HYU A;  3PGT A;  2YZH A;  1GH2 A;  2AYT A;  1X9W B;  3TRP A;  4IHU A;  4XS4 A;  4O92 A;  1GTU A;  3TJG A;  4E8E A;  4HZ2 A;  3MSZ A;  2I4A A;  4RQR A;  3GL5 A;  1M2A A;  3ZTL A;  1XVQ A;  4ZL7 A;  3UJ1 A;  4POL A;  2X8C A;  1K0O A;  2MZC A;  3HXS A;  3HZ8 A;  4AGS A;  1Z6N A;  3DRN A;  2PVO C;  4MZB A;  4ZXG A;  5ECI B;  5IMA A;  2ALB A;  5D9T A;  2BTO T;  3FRC A;  1ZGN A;  4MCU A;  1X9M B;  1W4V A;  4ECJ A;  3OR5 A;  1TK8 B;  2H19 A;  1GLQ A;  2CT6 A;  1GNW A;  1SKW B;  4POK A;  3TJK A;  3UVT A;  17GS A;  1PX7 A;  4N10 A;  1PX6 A;  4NPB A;  4Q5Q A;  3D0Z A;  3KIJ A;  1T7P B;  3APQ A;  4RQX A;  3KXO A;  2OJL A;  4XIH A;  3QMX A;  2V1M A;  1WJK A;  5AIS A;  4LMV A;  4NWY A;  4NHZ A;  1AW9 A;  1OKD A;  1B4Q A;  1EZK A;  3KH7 A;  3H93 A;  1AIU A;  3QAG A;  1M0U A;  5ECK B;  5AIX A;  1ZMA A;  1UA5 A;  2C80 A;  12GS A;  3UBL A;  2WS2 A;  3KTB A;  4ECI A;  2B6M A;  1F2E A;  2VOC A;  1FO5 A;  5E59 A;  4GST A;  2H75 A;  3FZ5 A;  3IDV A;  4JR4 A;  3LEF A;  1F37 A;  1KEB A;  3HZ4 A;  4OFN A;  3CTF A;  4EUY A;  5DAL B;  1B48 A;  3IV4 A;  4HEA 2;  3F0I A;  4HDE A;  5J4U A;  1VF3 A;  4JE1 A;  2MMN A;  1NW2 A;  3WGD A;  5DDL A;  3GV1 A;  3UEM A;  2OBK A;  1TI3 A;  4TR1 B;  1N8J A;  5DQY A;  3VK9 A;  3P90 A;  2KHP A;  1SL2 B;  3ME7 A;  1MDJ A;  1SYR A;  2TRC P;  1U87 A;  2DJ2 A;  5ECS A;  4BA7 A;  5DAK B;  1S3A A;  1XBS A;  2F51 A;  4YQV A;  2VCT A;  1M9A A;  5HR1 A;  2LEG A;  1X5D A;  4LL4 B;  1YDK A;  1AUC A;  5G2Z A;  3A2V A;  1SKS B;  2FNO A;  3ZZX A;  4GQF A;  4KAE A;  4RUV A;  1M7T A;  3VUR A;  1R5A A;  4KW6 A;  3TOU A;  3LGC A;  1USB A;  2DJ3 A;  3IK9 A;  5IOX A;  5J41 A;  1PMT A;  3APO A;  4MDC A;  3J7Y b;  4BWS A;  4I2U A;  3KD0 A;  2YAN A;  3HY2 A;  2JU5 A;  3QPM A;  1SL0 B;  1R4W A;  3LYP A;  1FOV A;  2J9H A;  2IPA A;  3LJR A;  1X0R A;  1EOG A;  2JSZ A;  2YJH A;  5DBQ A;  1TXX A;  3L78 A;  1EOH A;  6GSX A;  5EL8 A;  3LWA A;  6GSS A;  2FWG A;  1ERU A;  5ECM B;  3D4T A;  3F4S A;  5KN1 A;  1RQM A;  1O7U A;  2BJX A;  2IMK A;  5H5Q A;  1ACV A;  2ZUP A;  2R5G A;  3IXR A;  2LQO A;  3O3T A;  5GZZ B;  4NXI A;  3C8E A;  4DSS A;  2YWM A;  5LCZ A;  5IIZ A;  1EEM A;  4O5R A;  2L59 A;  3PH9 A;  3IOS A;  4HUA A;  3M9J A;  2GST A;  3DD3 A;  1YKA A;  4MJE A;  1WMJ A;  3P8W A;  3GKN A;  3GIX A;  1EV9 A;  3HA9 A;  3W8S A;  1F9M A;  3TRX A;  1H75 A;  1A24 A;  1HNB A;  2GZZ A;  4GRF A;  2DJK A;  5HFI A;  4D73 A;  2NDO A;  4POB A;  3ED3 A;  3E9J B;  3LOR A;  4TN8 A;  4N11 A;  2WB9 A;  2JAD A;  2LJR A;  1T8E B;  2ZCT A;  1VF2 A;  2KLX A;  3KP8 A;  4NHW A;  5C04 A;  1HD2 A;  1UC7 A;  3QFA C;  4IJ3 A;  1GTI A;  4HZ4 A;  3NZN A;  4PX1 A;  4ML1 A;  2LJA A;  3GL3 A;  4X0X A;  1GUK A;  3WGX A;  1URM A;  1VGL A;  1B9X C;  4POM A;  5KN3 A;  4E8H A;  2L57 A;  4EC0 A;  4K9Z A;  4TXO B;  4TW5 A;  1J0F A;  2VCX A;  3H79 A;  2FGX A;  3GTU A;  1ST9 A;  1R26 A;  3F3Q A;  3LG6 A;  4KDY A;  1IYH A;  3IBH A;  3E3E A;  4G10 A;  5AN1 A;  4ISD A;  2RM6 A;  1XWA A;  5JCU A;  4NV5 A;  5ELA A;  5G1L A;  4DSS B;  4JBB A;  4MA9 A;  3I6A A;  1LU4 A;  4MZC A;  5AGY A;  1U3A A;  3ERF A;  1YZX A;  4IW9 A;  5ELG A;  2LTK A;  2QC7 A;  1ERV A;  3DML A;  3TKS E;  2H6X A;  4FH8 A;  3CYN A;  3G7I A;  2VL9 A;  3LXT A;  2VO4 A;  3ERG A;  3TGZ A;  2VCV A;  2M46 A;  1Q4J A;  4Z7X A;  3GH9 A;  3KZQ A;  3HYP A;  3ZFB A;  1BX9 A;  5H5S A;  1SK1 A;  3GNJ A;  1I9D A;  3P2A A;  2YNX A;  4ZL8 A;  2VM1 A;  3HVS A;  5CO3 A;  4WBJ A;  2I81 A;  2DML A;  5GAP D;  3BBY A;  5ID2 A;  3FR6 A;  3VLN A;  1M2B A;  5HR3 A;  1TK5 B;  3GST A;  4G19 A;  4AF2 A;  3UIW A;  5F06 A;  3IHQ A;  4GQC A;  1WOU A;  2GDR A;  3DWV A;  5HFG A;  4IN0 A;  4EVM A;  3ERW A;  3F4R A;  3QOU A;  2IYJ A;  3O6T A;  3EWL A;  1F3A A;  2GGT A;  1T00 A;  4MJA A;  3HVX A;  3GTU B;  5GSS A;  1GRX A;  2GTU A;  2JSY A;  2JAC A;  3C1S A;  4HOJ A;  4L5L A;  5B6M A;  2V32 A;  4OFM A;  1MDK A;  1OC9 B;  2I1U A;  9GSS A;  1JZD A;  2VL2 A;  3DVW A;  3GRX A;  3EU3 A;  1NHO A;  3FEU A;  2WRT A;  3GX0 A;  3H1N A;  1JLV A;  2DJ0 A;  4WF5 A;  5IO2 A;  4KCA A;  1XW9 A;  2C0F A;  2LS5 A;  5B6N A;  3ZRD A;  2BMX A;  1DSB A;  2GZY A;  2L5L A;  1SJ6 A;  2RM5 A;  3TKS C;  5IO0 A;  1FB0 A;  2C0D A;  4F82 A;  3C73 A;  4OWY A;  2FA8 A;  4OCF A;  3BCI A;  1K0B A;  4WET A;  1PRX A;  4XRD A;  3LYK A;  2IN3 A;  1XWB A;  3AY8 A;  1GNE A;  1JLW A;  4HS1 A;  1SEN A;  3EC3 A;  2K18 A;  4IKH A;  5HR2 A;  4GLT A;  3Q74 A;  1AQW A;  2PWJ A;  2A2S A;  2C8U A;  1NHY A;  2VIM A;  4JR6 A;  1ERW A;  4FYC A;  1X5C A;  1BED A;  2VD1 A;  3KCM A;  3M0F A;  1H4O A;  5ENU A;  3VFI A;  2H74 A;  3NOF A;  2KUC A;  1WIK A;  1TDI A;  2DIZ A;  4GSS A;  1GSY A;  2H0I A;  1GP1 A;  4BVX A;  2H1D A;  4BL7 A;  1MTC A;  1YKC A;  4EE0 A;  3TKP A;  4ECB A;  1F3B A;  3VI5 A;  4KX4 A;  1SJZ A;  2CX3 A;  4F0C A;  4GTU A;  1TRU A;  1PA3 A;  2YWN A;  3H4K A;  2YV7 A;  2GLR A;  3IE3 A;  1DBY A;  1A23 A;  2KOK A;  3M9K A;  2TRX A;  3IA1 A;  1GUL A;  4DVC A;  3GUS A;  3EE2 A;  2LJK A;  1XFL A;  4MJC A;  4TR1 A;  3U6V A;  4L0U A;  1A0F A;  4TR4 A;  3VPQ A;  2LRT A;  1G0T A;  2M80 A;  5CYY A;  2C3Q A;  3M1G A;  1A2J A;  2PER A;  3GHA A;  2GQL A;  4GSN A;  1V40 A;  2WUL A;  3NIV A;  3ME8 A;  5G1K A;  3WT2 A;  1S3D A;  2YCD A;  4BVY A;  2C0G A;  3A2X A;  1Y6E A;  2H0H A;  3FZA A;  4YQM A;  2DC5 A;  4LLR A;  1GTA A;  3KP9 A;  4YAV A;  4CW9 A;  1U6T A;  1YEX A;  3RPN A;  7GSS A;  4EKZ A;  3ZVJ A;  2MMZ A;  1GUH A;  5IQY A;  2R4V A;  1WP0 A;  3G9B A;  3U5R E;  3M8N A;  3UOM A;  2PMT A;  1XWC A;  4O32 A;  1SK0 A;  3TRQ A;  1R5P A;  8GSS A;  1A8Y A;  3I43 A;  1OE7 A;  3DYR A;  3TJF A;  1S3C A;  1TTZ A;  1JZR A;  4OCE A;  2XBI A;  1XVW A;  1OC8 A;  2HSH A;  3A3T A;  3GKK A;  2ZNM A;  3M3M A;  4V1A g;  1YF1 A;  3VPT A;  1EGO A;  2LUS A;  1NSW A;  3TKQ A;  1BYE A;  2RUF A;  2B5E A;  1XWK A;  2P0G A;  2YWO A;  2LRC A;  1SK2 A;  1MD4 A;  1YEP A;  2KP1 A;  1JZO A;  1Y25 A;  2GZP A;  4EO3 A;  2R2J A;  3VI7 A;  4IQ1 A;  2K6V A;  1VF4 A;  5HR0 A;  5KN2 A;  4MPF A;  1WRY A;  2GQM A;  5J9B A;  5ECO B;  5CRH A;  1VRS D;  1QMV A;  2I3Y A;  3KMN A;  4K6X A;  3TCO A;  2ON5 A;  2L4Q A;  3RBT A;  1GSD A;  1ON4 A;  1DUG A;  1ZOF A;  6GST A;  4BWQ A;  4KND A;  2CQ9 A;  3IAM 2;  5G31 A;  3DVX A;  5ECQ B;  1CQH A;  1GSS A;  3DGQ A;  5CNW A;  1GSF A;  4X43 A;  1Z3E A;  2JZS A;  2MYG A;  4ECC A;  4XCS A;  3FYG A;  1X5E A;  4ID0 A;  3A5W A;  5F8B A;  2FA4 A;  2F8A A;  3J7Y k;  3UVH A;  4H86 A;  5IMC A;  2HXK A;  4KA0 A;  2MMA A;  2HSY A;  4K7N A;  2HFD A;  2PUK C;  4PQ1 A;  3UAP A;  5FWG A;  3WGE A;  4PNF A;  3MAK A;  5DQS A;  1PKW A;  5IOW A;  4ZB6 A;  1B4P A;  4HQS A;  4JZQ A;  3TJJ A;  2B5X A;  5ECL B;  3VWV A;  1TJD A;  2A2R A;  3KH9 A;  1W89 A;  2EIO A;  1G6W A;  3G7Y A;  1BG5 A;  2FWF A;  1SJI A;  1V57 A;  4OMV A;  5JWO B;  5G5E A;  1GLP A;  3GFK A;  1QFN A;  1O8W A;  4F9Z A;  5CP1 A;  4EDY A;  1OYJ A;  2GSQ A;  2L4C A;  2HRN A;  3ZL5 A;  1NM3 A;  3TOT A;  3RHB A;  4IS0 A;  2PGT A;  2FHE A;  4XRA A;  1FHE A;  3IAS 2;  5D9V A;  2B7K A;  3F4T A;  3GX8 A;  3HHV A;  5CRW A;  3QD9 A;  4K7I A;  1K0A A;  3DKS A;  1ABA A;  4OO4 A;  1YY7 A;  2N5F A;  3R2Q A;  4TXO A;  1T4Z A;  3ZVJ D;  1TW9 A;  2FWE A;  1PL1 A;  5ABR A;  4WR4 A;  1SD9 A;  3HDC A;  2H1G A;  2FD3 A;  3HCZ A;  4XS1 A;  2LKU A;  1PGT A;  2WCI A;  3F6F A;  2WJU A;  1OVN A;  2IMF A;  1HQO A;  1AQX A;  2CVK A;  3BOA A;  3L4N A;  2HZF A;  2IL3 A;  1XIY A;  5F0G A;  2YP6 A;  3I9V 2;  2HE3 A;  2WFC A;  1XCC A;  3IPZ A;  5EY6 A;  4FYU A;  3A2W A;  1AXD A;  1PSQ A;  3QAW A;  1WPI A;  3PR8 A;  4IGJ A;  1G6Y A;  4KH7 A;  4J2F A;  1O8X A;  2CV4 A;  1K3Y A;  4PXO A;  2C1Y A;  3F6D A;  2HYX A;  4PUA A;  1JHB A;  3CXG A;  6GSW A;  2LNT A;  20GS A;  2NTO A;  3ZLP A;  3IK7 A;  4AJ6 A;  3VWX A;  2QKE A;  1ZYE A;  2MMO A;  3Q6O A;  3MWH A;  1TRV A;  1U3I A;  4Q5N A;  4WEY A;  4FYB A;  3PIN A;  5CRG A;  1M9B A;  4FO5 A;  1THO A;  1A2M A;  3W6G A;  2FUG 2;  2H1B A;  2M72 A;  3RDW A;  1J9B A;  2AUV A;  2R37 A;  3D4M A;  3QCP A;  4MH2 A;  1QGV A;  2PU9 C;  4KDU A;  4L0W A;  5LD0 A;  2XBQ A;  6GSV A;  1JFU A;  1XWG A;  3QFB C;  3RHC A;  10GS A;  3UMA A;  4OFT A;  5JCW A;  4ZIL A;  4KGI A;  3G7J A;  4ULX A;  5D9W A;  1SD8 A;  4X1U A;  2O85 A;  1KBN A;  3ISO A;  3K8N A;  2PVQ A;  4MF5 A;  1O85 A;  2EIR A;  4DSQ A;  4LMW A;  4HQZ A;  4IEL A;  4V2N A;  1SYX A;  1ERT A;  5HFK A;  5IMD A;  5KN0 A;  1K0D A;  2OE3 A;  1O73 A;  3FR3 A;  4RI6 A;  4WR5 A;  4I8B A;  4CHS A;  1EEJ A;  1Z5Y E;  5H5R A;  3HJO A;  5ID2 B;  4O7H A;  3LSZ A;  3KTL A;  4RI7 A;  1BJX A;  1PN9 A;  4G9H A;  3VWW A;  2GT5 A;  1EV4 A;  4Q5R A;  3QAV A;  1ZYQ B;  1XW5 A;  5IPG A;  2IME A;  3WT1 A;  1EP7 A;  1SU9 A;  1GUM A;  2PBJ A;  3BCK A;  2HI7 A;  4MAB A;  2DLX A;  3UAR A;  5AIV A;  2PPT A;  2HRF A;  3FZ9 A;  2IMI A;  5CAX A;  1QQ2 A;  4I5Q A;  1I5G A;  3L0H A;  2YJ7 A;  3UL3 A;  2H70 A;  2D2Z A;  3SBC A;  4TKY A;  4AJ7 A;  1K3L A;  4ZB9 A;  4EXJ A;  1TRW A;  2OKA A;  2AHE A;  2NVL A;  3IC4 A;  5G5F A;  4LA1 A;  5HQP A;  1OAZ A;  2CA8 A;  2CX4 A;  1ML6 A;  2B7J A;  2H30 A;  1BAY A;  2RUE A;  2TIR A;  5D93 A;  2IIY A;  2E7P A;  2G2Q A;  5DJL A;  1OE8 A;  2DMM A;  3HJP A;  2GSR A;  1PL2 A;  4XHM A;  4K7O A;  3CBU A;  3TKR A;  1FG4 A;  2O7K A;  2IJY A;  3GYK A;  5DCG A;  1SL1 B;  3I69 A;  3BJ5 A;  3ZMK A;  4F2I A;  2H71 A;  3FHK A;  5ECN B;  2GS3 A;  2B5Y A;  4FIW A;  3CSJ A;  4L5O A;  14GS A;  3TB2 A;  2IWT A;  4WXT A;  2HT9 A;  4DEJ A;  3GN3 A;  5B7C A;  3DEX A;  4MZW A;  5L71 A;  2OBI A;  3ZIV A;  3ZML A;  1ZZY A;  2O8V B;  1HNC A;  3UBK A;  1V58 A;  1QK8 A;  5D8I A;  2E2M A;  3N5O A;  3QDN A;  2R6K A;  3FY7 A;  2REM A;  3TKS A;  4XS6 A;  1Q98 A;  1TP9 A;  2H6Z A;  1YJ6 A;  3EMX A;  1R7H A;  5J9C A;  1IYI A;  2RII A;  2F8F A;  3JCM L;  2WGR A;  19GS A;  2DIY A;  4K1F A;  3TDG A;  1GWC A;  2J23 A;  4OD7 A;  1MD3 A;  1YF0 A;  2B1K A;  2AJQ B;  2V6O A;  2OAD A;  1XOB A;  5GST A;  1FVK A;  2YN1 A;  1TK0 B;  13GS A;  2LNS A;  1MDI A;  5JWQ B;  3CTG A;  1AAZ A;  5INY A;  1GSE A;  2C3T A;  4KSO A;  4J57 E;  3TUE A;  3EMP A;  4QQ7 A;  2P5R A;  2DJ1 A;  2DSA A;  2N5B A;  5IMV A;  2YPM A;  1FB6 A;  4PUF C;  1O81 A;  2YZU A;  2XPE A;  3KGK A;  2IFQ B;  4K0G A;  2C3N A;  4KE3 A;  2VLV A;  1LJR A;  3KJY A;  4ZL9 A;  3LQ7 A;  1TOF A;  1FAA A;  3APS A;  5A4W A;  4YQU A;  1E6B A;  1BQ7 A;  3SWL A;  2FWH A;  1VF1 A;  1PD2 1;  1YQ1 A;  4TVE A;  4TOP A;  2H6Y A;  4V2M A;  2ON7 A;  3EYT A;  2K9F A;  2YV9 A;  4HI7 A;  2H1A A;  4ZIJ A;  4IP6 A;  5ECR B;  4K0N A;  3CRU A;  3FW2 A;  2JZT A;  2OA7 A;  1T4Y A;  1V2A A;  2XHF A;  3W8J A;  1E2Y A;  4MMM A;  5DCH A;  2HZE B;  2FLS A;  2JL4 A;  4PQH A;  4K8M A;  1B9Y C;  5J5N A;  1Z7R A;  3QR6 A;  3GA4 A;  4QL9 A;  1A2L A;  3VWU A;  2DBC A;  2MBT A;  4PGT A;  4IVF A;  2CZ2 A;  4KDX A;  2VCQ A;  5B8A A;  2OE0 A;  2Z9S A;  4I2T A;  3RAZ A;  2CVB A;  1G7E A;  3GKX A;  1K0M A;  2V41 A;  3CSI A;  3CSH A;  4KB3 A;  1AQV A;  4BPY A;  4KSM A;  2KP2 A;  3GKM A;  2EIQ A;  3GMF A;  4KCE A;  1T3B A;  5B8B A;  2YOI A;  6GSY A;  2AV4 A;  2GVP A;  4TR0 A;  4JU5 A;  1XOA A;  3FZ4 A;  5EPF A;  3ZRE A;  2CAQ A;  5C00 A;  3C71 A;  4N30 A;  3F9U A;  18GS A;  1EWX A;  4JED A;  4P3Y B;  1FVJ A;  2X8G A;  2PN8 A;  16GS A;  4F0B A;  3GSS A;  4V2L A;  1CQG A;  4K2D A;  1QUW A;  3HKR A;  4GWR A;  2K8S A;  5FT3 A;  2C0E A;  5F05 A;  3L9V A;  4WKW A;  2QGV A;  5IMZ A;  2OAC A;  4Q5F A;  2F9S A;  4CDO A;  5A5K A;  1GTB A;  2QSI A;  1XW6 A;  2B1L A;  2X64 A;  1N2A A;  2A4V A;  3ZIT A;  2GSS A;  2F3M A;  3DIE A;  1PQN A;  1OKT A;  3ZIJ A;  4DSR A;  2HZE A;  3DXB A;  3IR4 A;  1TI1 A;  1KTE A;  3EU4 A;  1B8X A;  2AB6 A;  1GL8 A;  1MEK A;  2C4J A;  3BD2 A;  2VCZ A;  4ZBA A;  1TU8 A;  4GCI A;  2V6K A;  2YWI A;  2XC2 A;  2H01 A;  1C72 A;  4G2E A;  4MK3 A;  1THX A;  3L9S A;  1GSU A;  3GUR A;  2NPB A;  3D6I A;  1DE2 A;  2L6D A;  1KNG A;  3FK8 A;  5LNK e;  4NV2 A;  2X99 A;  5COH A;  1EGR A;  1TU7 A;  1QXH A;  5CRE A;  4L8E A; 
#chains in the Genus database with same CATH topology
 4NMU A;  2DJJ A;  2CAI A;  3FKF A;  1ZL9 A;  3LTC A;  2R0C A;  4GXZ A;  3CCE 3;  1M99 A;  1XPV A;  2MBS A;  6GSU A;  4EL1 A;  4HM4 B;  4ZB8 A;  2LV3 A;  2KAA A;  3ZFL A;  2NBS A;  2MF7 A;  2N5A A;  1SKR B;  2CVD A;  3C1R A;  3D22 A;  2P31 A;  2H76 A;  2W6J H;  1GD4 A;  1X1X A;  1CH0 A;  3O76 A;  4K5R A;  1F6M C;  4PQI A;  4G0K A;  1YJ9 3;  2YFI B;  3Q19 A;  3H3H A;  1JZW A;  3BNE A;  3D79 A;  3F8U A;  4HJM A;  4TRX A;  3L9U A;  1T1V A;  2V2G A;  1RTU A;  2JZR A;  1OC3 A;  5DAL A;  5CF1 A;  4ACS A;  1AY7 A;  1TRS A;  3HJM A;  1XZO A;  3OX9 A;  3IPT A;  1QVG 2;  4IJI A;  5G30 A;  1IYY A;  1K0N A;  2VLT A;  1Z9H A;  3CCS 3;  1JBR A;  1W6Y A;  1RDS A;  3CRT A;  8RNT A;  2BMQ B;  4MJB A;  4HM7 B;  2WZ9 A;  1LBK A;  3CPO A;  4RNZ A;  2L5O A;  3CMI A;  1LOV A;  4HKV B;  4MF7 A;  1TFK A;  4N0Z A;  2VCW A;  5D9X A;  4AJ8 A;  1RLS A;  1RN1 A;  3A76 A;  3EC9 A;  3N9J A;  1DE1 A;  1RW1 A;  5IM9 A;  3NUV A;  4F03 A;  5J3R A;  4EV5 A;  4ZM8 A;  5EQL A;  1SII A;  2H8L A;  5KEJ A;  2VLU A;  4RZM A;  5A4V A;  1K0C A;  4XTS A;  1ZCP A;  3D5I A;  2LRN A;  2O87 A;  3FR9 A;  4YAP A;  3HIG A;  2EC4 A;  4J56 E;  3FGY A;  1U88 A;  4TR3 A;  3CCL 3;  3RPP A;  1WE0 A;  1ILO A;  4MLY A;  5EVO A;  5A4U A;  2G0F A;  2IFQ A;  1A8L A;  4PUR A;  4LL1 B;  1US1 A;  3F14 A;  1JBS A;  1OC9 A;  3H8Q A;  3Q18 A;  5IMF A;  4OO5 A;  4IP1 A;  1V9W A;  4HM6 B;  3E99 A;  3HVV A;  1UVZ A;  3SED A;  2WDU A;  4HU7 A;  1LOW A;  4J8T A;  1OUN A;  3PS8 A;  2HSM A;  1GSQ A;  1K3O A;  4K5S A;  4DKI A;  1M2D A;  3GZX B;  3WYW A;  3CNX A;  1IVV A;  2VL2 C;  1DVD A;  4EF0 A;  4MP4 A;  1BSB A;  2L6C A;  2JDI H;  3KEB A;  3JUM A;  4BVY B;  4WF4 A;  4N6U A;  3LT9 A;  5GAN D;  3ZG0 A;  4MNN A;  2Y74 A;  2FXT A;  1A0R P;  5FHI A;  2I9H A;  5CF2 A;  1AC1 A;  2H73 A;  3D9R A;  5AIF A;  1W00 A;  1IVX A;  4XBX A;  2AAW A;  3FCS B;  1J08 A;  2CZ3 A;  1X1W A;  4ZBD A;  4JRR A;  5DVB A;  3DH2 A;  3HD5 A;  5JWR B;  4PNG A;  1VQ6 3;  3E0U A;  2JQ5 A;  2XFS A;  4HOH A;  4XDV A;  3CME 3;  4MF6 A;  7GSP A;  2LQQ A;  2XPD A;  2CG0 A;  2VD0 A;  5E4W A;  4KUN A;  1UN2 A;  4GF0 A;  1W2B 2;  1YJW 3;  4L7K A;  2IMD A;  5JCG A;  2OOV C;  1WWJ A;  2W2C A;  3IRA A;  1ISK A;  2LST A;  3P7X A;  4HM8 B;  1D6Z A;  5CRD A;  1X9S B;  4EDZ A;  1N5P A;  3V1W A;  8CHO A;  4LSO A;  3KM6 A;  2CC3 A;  5D96 A;  1BNF A;  4G0I A;  4ILF A;  2H72 A;  2RLI A;  1VQP 3;  3KMO A;  2FCH A;  3G6E 3;  3WOE B;  2YFJ B;  2IY2 A;  1STD A;  4IBP A;  1EP8 A;  4ML6 A;  4XS4 B;  2MC8 A;  2W56 B;  1Z7P A;  2O89 A;  3MNG A;  1UUG B;  3LFL A;  4MMY B;  1HNA A;  3GH6 A;  4YH2 A;  2R3X A;  5ECH B;  1DYU A;  1A2P A;  4HU9 A;  3RDE A;  4MPG A;  5IF6 A;  1NB5 I;  1RK4 A;  5F07 A;  1Z6M A;  4LGQ A;  3CC7 3;  1PKZ A;  3TJB A;  4MH3 A;  2ES7 A;  2KF6 A;  3EIN A;  3F3R A;  5D73 A;  2P5Q A;  4I97 A;  3US3 A;  1IQX A;  4TXV A;  1U8C B;  2FY6 A;  2K8V A;  2VM2 A;  2HNL A;  1AV4 A;  1A2K A;  2H0G A;  3CMA 3;  1XXU A;  5CXO A;  2E0Q A;  2GQK A;  4NAX A;  2B3S A;  1G96 A;  2VUP A;  4WBR D;  4IQA A;  2GT6 A;  1UCJ A;  2VAF A;  3D21 A;  4ZBB A;  1W6C A;  4N0V A;  1BRG A;  1BRI A;  3LXZ A;  22GS A;  3D5J A;  1FGR A;  4HJ2 A;  5DJM A;  3S9F A;  1G7O A;  3OWY A;  4Q53 A;  5ECP B;  3WD6 A;  3C7M A;  2P0X A;  3EUR A;  4V1A p;  1TKD B;  2OWP A;  4IT7 A;  4QL7 A;  3CU3 A;  4K1U A;  1O6J A;  4I6X A;  4AEQ A;  2HLS A;  2KF4 A;  2E2G A;  2H66 A;  1UDI I;  3S27 A;  4K2X A;  1V98 A;  2VL3 A;  2RBI A;  2X8H A;  3MSO A;  11GS A;  3I56 3;  3MDK A;  1FW1 A;  1C7H A;  4D73 B;  5DAK A;  5IPH A;  3ZYW A;  2OE1 A;  4XBY A;  3EVI A;  3F63 A;  3CXC 2;  1HYU A;  5KOX A;  3PGT A;  2YZH A;  1GH2 A;  2AYT A;  1X9W B;  2IUK A;  3TRP A;  4IHU A;  4XS4 A;  4O92 A;  2CWV A;  1LNI A;  1GTU A;  3CC4 3;  3TJG A;  4E8E A;  4HZ2 A;  3MSZ A;  1BSA A;  2I4A A;  4RQR A;  3GL5 A;  1M2A A;  1N8R 4;  3ZTL A;  5HGR A;  1XVQ A;  4ZL7 A;  3UJ1 A;  1ZGX A;  4POL A;  1CEW I;  2X8C A;  1K0O A;  5CLK A;  2MZC A;  1OH0 A;  3HXS A;  2R0G A;  2E2U A;  5D82 A;  1NWW A;  3HZ8 A;  4AGS A;  1Z6N A;  3DRN A;  2J8X B;  5RNT A;  2PVO C;  4MZB A;  4ZXG A;  5ECI B;  5IMA A;  3RGA A;  4STD A;  2ALB A;  5D9T A;  2BTO T;  3FRC A;  1ZGN A;  4MCU A;  1X9M B;  1W4V A;  4ECJ A;  3OR5 A;  1TK8 B;  2H19 A;  1GLQ A;  2CFK A;  2CT6 A;  2CKF B;  1GNW A;  1SKW B;  2R41 A;  4POK A;  3TJK A;  3UVT A;  17GS A;  1Q40 A;  1T2I A;  1PX7 A;  3LYG A;  2DKH A;  1PX6 A;  4N10 A;  1RGC A;  4NPB A;  4Q5Q A;  3WOD G;  3D0Z A;  3KIJ A;  1T7P B;  3FF2 A;  3APQ A;  4NRE A;  4RQX A;  3KXO A;  1Y4K A;  2OJL A;  4XIH A;  3QMX A;  3EB8 A;  4ORL A;  2V1M A;  3NQY A;  5BXQ A;  1WJK A;  1YVB I;  5AIS A;  3OW2 2;  4LMV A;  3HI7 A;  2Z6B A;  1BVI A;  4NWY A;  4NHZ A;  1AW9 A;  1BNG A;  3HX8 A;  1OKD A;  1B4Q A;  1EZK A;  3DGM A;  4N6O B;  1B20 A;  3MPH A;  5EVH A;  1KWI A;  1UI7 A;  4BL2 A;  1C54 A;  3KH7 A;  3H93 A;  4KFF A;  1AIU A;  4KZ1 A;  3QAG A;  1M0U A;  5ECK B;  5AIX A;  3SOA A;  1ZMA A;  2GBX B;  1UA5 A;  2C80 A;  1GD3 A;  1BAN A;  12GS A;  3UBL A;  1JN5 B;  1RNB A;  2WS2 A;  1N9J A;  4TX4 A;  3KTB A;  4ECI A;  2B6M A;  1F2E A;  2HMO B;  2VOC A;  1IV9 A;  2QIY A;  1FO5 A;  5E59 A;  4GST A;  3URP A;  1O7H B;  2H75 A;  4KT3 B;  3FZ5 A;  3IDV A;  3LEF A;  4JR4 A;  4H3U A;  1F37 A;  1KEB A;  3LT8 A;  1IDP A;  1A90 A;  3HZ4 A;  4OFN A;  3CTF A;  4EUY A;  3EF8 A;  5DAL B;  1B48 A;  3DUK A;  2F86 B;  3IJE B;  3IV4 A;  4HEA 2;  3F0I A;  4HDE A;  2ZL8 A;  5J4U A;  1VF3 A;  4JE1 A;  2MMN A;  1NW2 A;  3T8U A;  3WGD A;  5DDL A;  1RGH A;  3GV1 A;  4WYK B;  3UEM A;  1HKX A;  2OBK A;  3LW9 A;  4HBR A;  4ICY A;  1B2X A;  1B2Z A;  1TI3 A;  4TR1 B;  3CCU 3;  1N8J A;  1QJG A;  1KD1 4;  5DQY A;  3VK9 A;  3P90 A;  2RSX A;  2WOH A;  3FKA A;  2KHP A;  1SL2 B;  2XGN A;  4JRF A;  1QVF 2;  1DET A;  1MDJ A;  3ME7 A;  1SYR A;  2TRC P;  1FUW A;  1U87 A;  1RGE A;  1OHS A;  2DJ2 A;  5ECS A;  4BA7 A;  5DAK B;  3CQF A;  1S3A A;  2BHM A;  1XBS A;  3CD6 3;  4K90 B;  2F51 A;  4YQV A;  2VCT A;  1RGF A;  4LMI A;  1M9A A;  5HR1 A;  4R9K A;  2LEG A;  3K7C A;  3OXA A;  1UUV B;  1RHL A;  4FMD A;  1X5D A;  4LL4 B;  1YDK A;  1AUC A;  5G2Z A;  3A2V A;  2UZ8 A;  2CHC A;  1SKS B;  2B1X B;  2FNO A;  5G2G A;  3ZZX A;  4GQF A;  4KAE A;  4RUV A;  1M7T A;  3VUR A;  4CJN A;  1R5A A;  4KW6 A;  3TOU A;  3PGB A;  2HOH A;  4RNY A;  1USB A;  3LGC A;  2DJ3 A;  3F8H A;  3IK9 A;  5IOX A;  5J41 A;  5KP4 A;  1PMT A;  1CYV A;  3GRD A;  3APO A;  1UGI A;  4MDC A;  2ML5 A;  3J7Y b;  3FZW A;  4I2U A;  4BWS A;  3FG1 A;  3KD0 A;  2YAN A;  3HY2 A;  1R4Y A;  2JU5 A;  3QPM A;  1SL0 B;  1R4W A;  3LYP A;  1FOV A;  2J9H A;  2IPA A;  5AIG A;  3LJR A;  1X0R A;  3EE1 A;  1I2E A;  1EOG A;  3QK9 A;  2JSZ A;  3JUP A;  2YJH A;  5DBQ A;  1TXX A;  2W56 A;  2WGQ A;  3L78 A;  1EOH A;  6GSX A;  5EL8 A;  3LXU X;  1BSE A;  3LWA A;  6GSS A;  2FWG A;  5ELU A;  1ERU A;  3WMD A;  3MHE A;  3D4T A;  5ECM B;  3F4S A;  5KN1 A;  1RQM A;  1O7U A;  1E3R A;  4FCM A;  3KSE D;  2BJX A;  1AQZ A;  2HRA A;  1TRP A;  2IMK A;  5H5Q A;  1ACV A;  2ZUP A;  3DGO A;  2R5G A;  3IXR A;  2FNQ A;  1B2U A;  2LQO A;  3O3T A;  5GZZ B;  4NXI A;  1LOY A;  3C8E A;  4DSS A;  2YWM A;  5LCZ A;  3PZW A;  3EBT A;  2AAD A;  5IIZ A;  4O5U A;  1EEM A;  4O5R A;  2L59 A;  4WFO A;  3IOS A;  1K9M 4;  2CIU A;  3PH9 A;  3M9J A;  4HUA A;  1AVL A;  2GST A;  4HM1 B;  3JUN A;  2C4B A;  1B27 A;  3DD3 A;  2F4Y A;  1YKA A;  4MJE A;  1W5Z A;  2QA4 3;  1WMJ A;  3P8W A;  3GKN A;  3GIX A;  1EV9 A;  3HA9 A;  3W8S A;  1F9M A;  3TRX A;  1H75 A;  1A24 A;  1W2Z A;  1HNB A;  2GZZ A;  1BRS A;  2GXF A;  1KC8 4;  4KF9 A;  4GRF A;  3BNC A;  4I4K A;  2DJK A;  4FMB A;  5HFI A;  4D73 A;  2NDO A;  4EV2 A;  4POB A;  5BMU A;  3ED3 A;  3E9J B;  3LOR A;  4TN8 A;  4N11 A;  2WB9 A;  2JAD A;  2LJR A;  5A0O B;  1T8E B;  2ZCT A;  1I0X A;  2Z76 A;  1VF2 A;  3BB9 A;  2KLX A;  3KP8 A;  3FLJ A;  1Q9E A;  3PYJ A;  4NHW A;  5C04 A;  1HD2 A;  1SQW A;  1UC7 A;  3QFA C;  3F8X A;  4IJ3 A;  1GTI A;  1RCL A;  4HZ4 A;  1HYF A;  3NZN A;  4PX1 A;  4ML1 A;  2LJA A;  4L8O A;  3GL3 A;  3GZB A;  4X0X A;  2A15 A;  1GUK A;  3WGX A;  2P09 A;  1VGL A;  1B9X C;  1URM A;  4POM A;  5KN3 A;  1BRK A;  1IVW A;  4E8H A;  2L57 A;  5AYS C;  4EC0 A;  3CCQ 3;  4K9Z A;  3FH1 A;  4HM5 B;  4TXO B;  5KP1 A;  3DGL A;  4TW5 A;  1J0F A;  2KF5 A;  2VCX A;  1IQ8 A;  4CPK A;  4FCJ A;  1Q81 4;  3H79 A;  2FGX A;  3ROB A;  2DKI A;  3GTU A;  1ST9 A;  3GAX A;  1R26 A;  2FGT A;  3F3Q A;  3LG6 A;  4KDY A;  1IYH A;  1VQ5 3;  3E3E A;  4WYK A;  1OAC A;  3K63 A;  4G1M B;  1YJN 3;  3IBH A;  4G10 A;  5AN1 A;  4ISD A;  5CK6 A;  2RM6 A;  1XWA A;  5JCU A;  4NV5 A;  5ELA A;  1CQS A;  5G1L A;  4DSS B;  4JBB A;  4MA9 A;  3I6A A;  1OF5 A;  1LU4 A;  4MZC A;  5AGY A;  1U3A A;  3ERF A;  4CY6 A;  1TU5 A;  1YZX A;  1FYS A;  4IW9 A;  3EPT A;  5ELG A;  2LTK A;  3PCR A;  2A2P A;  2QC7 A;  1ERV A;  3DML A;  3TKS E;  2H6X A;  4FH8 A;  1S72 3;  3CYN A;  4XB5 A;  3G7I A;  3AMO A;  3IHG A;  1PFO A;  4X4J A;  2VL9 A;  3LXT A;  2VO4 A;  3ERG A;  3TGZ A;  1STF I;  2VCV A;  2BIR A;  5BU4 A;  2M46 A;  1Q4J A;  3U1W A;  4Z7X A;  2XSO B;  3S5C A;  3GH9 A;  3KZQ A;  4A5P A;  3HYP A;  3D3L A;  3ZFB A;  3NBJ A;  1BX9 A;  5H5S A;  4WWU C;  1O7M B;  3NQZ A;  4OK0 A;  3GWR A;  1SK1 A;  3D4A A;  1W02 A;  3KKG A;  1MWT A;  4WP5 A;  2HML B;  2OOV A;  3GNJ A;  1I9D A;  3P2A A;  1SJW A;  2YNX A;  4ZL8 A;  2VM1 A;  5JBS A;  3HVS A;  1GOY A;  5CO3 A;  2HMJ B;  4WBJ A;  2I81 A;  1UUW B;  2DML A;  1ROV A;  5GAP D;  3BBY A;  4HSC X;  4BIR A;  5ID2 A;  3FR6 A;  3VLN A;  1M2B A;  4YKF A;  5HR3 A;  2W9P A;  1TK5 B;  2BMR B;  4Z2T A;  3LTA A;  1Q86 4;  1VQQ A;  2XSH B;  3GST A;  4G19 A;  3KZT A;  3B4P A;  4AF2 A;  3UIW A;  5F06 A;  3IHQ A;  1BSD A;  4GQC A;  1WOU A;  2GDR A;  2YFL B;  3DWV A;  3Q2P A;  5HFG A;  2XH9 A;  4IN0 A;  4EVM A;  3ERW A;  1BIR A;  3F4R A;  3QOU A;  2LYX A;  2IYJ A;  3O6T A;  3EWL A;  1F3A A;  2GGT A;  1T00 A;  2K54 A;  3PPU A;  1HU9 A;  4MJA A;  4BTY A;  1B21 A;  1VQM 3;  3HVX A;  3GTU B;  5GSS A;  1DMQ A;  1JB2 A;  1GRX A;  2GTU A;  2JSY A;  2Y73 A;  2JAC A;  3C1S A;  5KOW A;  4HOJ A;  4L5L A;  5B6M A;  2V32 A;  4OFM A;  1PFP A;  1MDK A;  1K28 A;  1OC9 B;  2Q07 A;  4FR9 A;  2I1U A;  5AYR B;  9GSS A;  3T0U A;  3ER7 A;  1JZD A;  2VL2 A;  3DVW A;  2PZV A;  3GRX A;  1LOX A;  1M1K 4;  3EU3 A;  1NHO A;  3FEU A;  2WRT A;  3GX0 A;  3X3Z A;  3H1N A;  1SIH A;  2F56 A;  1JLV A;  2DJ0 A;  4WF5 A;  5IO2 A;  3M8C A;  4KCA A;  1XW9 A;  2C0F A;  2D1W A;  1AR0 A;  2LS5 A;  5B6N A;  5JPU A;  3ZRD A;  2BMX A;  1DSB A;  1PYL A;  2GZY A;  2L5L A;  1SJ6 A;  3IC8 A;  4USS A;  2RM5 A;  3TKS C;  5IO0 A;  1FB0 A;  2C0D A;  1ZYP A;  3JUO A;  1ULJ B;  4GHO A;  4F82 A;  1X1Y A;  3CCR 3;  3C73 A;  4OWY A;  2FA8 A;  2QGU A;  4OCF A;  3BCI A;  3PXM A;  1K0B A;  1JKG B;  4WET A;  1PRX A;  4XRD A;  3LYK A;  4HVN A;  1XWB A;  2IN3 A;  3AY8 A;  1GNE A;  1DMN A;  1JLW A;  3ZG5 A;  4HS1 A;  1PY3 A;  1RRL A;  3JUQ A;  3KFQ C;  1SEN A;  2K18 A;  4LEH A;  3EC3 A;  4IKH A;  5HR2 A;  4GLT A;  4HYZ A;  1E97 A;  2KRT A;  3Q74 A;  1AQW A;  1I2G A;  2PWJ A;  3BND A;  3EQQ B;  2A2S A;  2C8U A;  1NHY A;  1R4C A;  3K0Z A;  2VIM A;  4JR6 A;  1ERW A;  4FYC A;  4R4K A;  1X5C A;  1QAK A;  1BUJ A;  2E2T A;  1BED A;  2VD1 A;  3KCM A;  4AKZ A;  3M0F A;  1H4O A;  3KCH A;  5ENU A;  3VFI A;  2UUG C;  5M19 A;  2H74 A;  1MGW A;  3NOF A;  2KUC A;  2XR8 B;  3EJV A;  1WIK A;  1TDI A;  2DIZ A;  4GSS A;  5AI1 A;  1GSY A;  4U13 A;  1B2M A;  2H0I A;  1GP1 A;  4BVX A;  2H1D A;  1I0V A;  2M7O A;  4BL7 A;  1MTC A;  2B24 B;  1YKC A;  4EE0 A;  3TKP A;  1KQS 2;  4ECB A;  2AAE A;  1YVS A;  1LXE A;  1F3B A;  3VI5 A;  2ZA4 A;  4OUQ A;  4KX4 A;  1SJZ A;  2CX3 A;  4EIQ A;  4F0C A;  4GTU A;  1TRU A;  1PA3 A;  2YWN A;  4H61 A;  3H4K A;  4PTS A;  2YV7 A;  3A5E A;  2GLR A;  3IE3 A;  1DBY A;  2SBL A;  5AEU B;  1A23 A;  1DE3 A;  2OTL 3;  2KOK A;  3M9K A;  2TRX A;  3IA1 A;  1GUL A;  4DVC A;  3GUS A;  3EE2 A;  2LJK A;  2GSP A;  1XFL A;  3S29 A;  4MJC A;  4TR1 A;  3U6V A;  3NM7 A;  4L0U A;  1Q7H A;  1A0F A;  4TR4 A;  3VPQ A;  3N9H A;  2LRT A;  3ECF A;  5LC7 A;  1G0T A;  2M80 A;  1PN0 A;  5CYY A;  2C3Q A;  3M1G A;  1EQK A;  1A2J A;  2PER A;  3GHA A;  2KCD A;  2GQL A;  2O9U X;  4GSN A;  1V40 A;  2WUL A;  3NIV A;  3ME8 A;  7STD A;  1N9E A;  4FMA A;  5JPP A;  2HMK B;  5G1K A;  3UNL A;  3WT2 A;  1BU4 A;  1S5A A;  2OQE C;  1ZYN A;  1XG8 A;  1S3D A;  2YCD A;  4BVY A;  2C0G A;  1F8N A;  5HOH A;  3A2X A;  1WMN A;  2F98 A;  5GSP A;  3T8N A;  1Y6E A;  3MYD A;  4MMX B;  3JVC A;  2H0H A;  1UI8 A;  3EN1 B;  3FZA A;  4YQM A;  2DC5 A;  4LLR A;  4BL7 B;  3F7S A;  1GTA A;  4KFD A;  3KP9 A;  1GOU A;  4YAV A;  4CW9 A;  1U6T A;  1YEX A;  2OCT A;  3RPN A;  7GSS A;  4EKZ A;  4LYL B;  3ZVJ A;  2MMZ A;  3I0Y A;  3A5I A;  3GZY B;  1GUH A;  5IQY A;  2RNT A;  1A2V A;  4J9A A;  2KF3 A;  4BVX B;  3FSD A;  2R4V A;  3N54 B;  1WP0 A;  2HRK A;  2W04 A;  3NM2 A;  3G9B A;  1FZU A;  3U5R E;  3M8N A;  1OF5 B;  3X40 A;  4KFE A;  1UW1 A;  4HZ9 B;  3UOM A;  2PMT A;  1XWC A;  1IT8 A;  4O32 A;  1SK0 A;  3TRQ A;  1R5P A;  1DMM A;  8GSS A;  1A8Y A;  3I43 A;  1OE7 A;  2K0M A;  3DYR A;  3TJF A;  1S3C A;  1TTZ A;  5BVB A;  4XDW A;  1JZR A;  1ROA A;  4OCE A;  2CFD A;  4FCZ A;  2XBI A;  3CPW 2;  4GL6 A;  1XVW A;  1GYB A;  1OC8 A;  2HSH A;  3A3T A;  3GKK A;  2CH9 A;  3AGN A;  1WQL B;  2ZNM A;  3BLZ A;  3M3M A;  4V1A g;  1MNL A;  4AKY A;  1YF1 A;  4FQU A;  6STD A;  1L5G B;  3VPT A;  3WDG B;  1EGO A;  3G0K A;  1FGM A;  1K73 4;  3RGR A;  4IIA A;  2LUS A;  1NSW A;  3TKQ A;  1BYE A;  4O3V A;  2RUF A;  2B5E A;  5IEO A;  1FGO A;  3NXJ A;  1VQ8 3;  1N8Q A;  4O2H A;  1XWK A;  3N8B A;  2P0G A;  2YWO A;  1EA2 A;  1ZO2 A;  1TFO A;  1WMP A;  4RNT A;  2LRC A;  1SK2 A;  1MD4 A;  1BRN L;  4R9L A;  1YEP A;  4HM0 B;  2KP1 A;  2W0Q A;  3VF1 A;  1JZO A;  1Y25 A;  2GZP A;  4EO3 A;  2R2J A;  1OPY A;  3VI7 A;  4IQ1 A;  2K6V A;  1D6U A;  1VF4 A;  5HR0 A;  1GS3 A;  5KN2 A;  2RFR A;  3AGO A;  4MPF A;  1WRY A;  2GQM A;  3CCV 3;  5J9B A;  5ECO B;  3B8L A;  5CRH A;  1VRS D;  2OTJ 3;  1QMV A;  2I3Y A;  3KMN A;  1RNT A;  2X4A A;  1W01 A;  1NDO B;  4K6X A;  3TCO A;  2UGI A;  2ON5 A;  2L4Q A;  3RBT A;  2I9W A;  2IUJ A;  1GSD A;  1ON4 A;  4Z2R A;  1G02 A;  5I97 A;  1RGG A;  5EEO A;  1RMS A;  1DUG A;  1ZOF A;  6GST A;  2CX1 A;  4HM3 B;  4KND A;  4BWQ A;  1S3R A;  2CQ9 A;  1I3I A;  3DMC A;  1JV2 B;  3IAM 2;  5G31 A;  3DVX A;  5BIR A;  1Q7Y 4;  1CQH A;  5ECQ B;  1GSS A;  3UB1 A;  3DGQ A;  5CNW A;  5AEW B;  1GSF A;  4X43 A;  1IQY A;  2CWU A;  2CFW A;  1Z3E A;  2JZS A;  2MYG A;  4ECC A;  4XCS A;  3FYG A;  1X5E A;  2HMM B;  1BNE A;  4ID0 A;  3STD A;  5AIH A;  3A5W A;  1VQO 3;  3HOH A;  5F8B A;  1SPU A;  2FA4 A;  2F8A A;  2ML6 A;  5IG5 A;  3J7Y k;  3UVH A;  3Q1C A;  4H86 A;  5IMC A;  2HXK A;  4KA0 A;  1TUH A;  2MMA A;  1Q82 4;  2HSY A;  1M90 4;  4K7N A;  2HFD A;  2PUK C;  4PQ1 A;  4N3V A;  2L4V A;  3NHX A;  3UAP A;  5FWG A;  3WGE A;  4PNF A;  3MAK A;  5DQS A;  1PKW A;  5IOW A;  4ZB6 A;  1GY5 A;  5IEN A;  1VZZ A;  1RGA A;  1B4P A;  4HQS A;  2YX9 A;  4JZQ A;  3TJJ A;  1ZX2 A;  3FMW A;  2B5X A;  5ECL B;  3VWV A;  1TJD A;  2A2R A;  3KH9 A;  3FG4 A;  1WTH A;  3WOF B;  1W89 A;  3EBY A;  5IER A;  2EIO A;  2W9Q A;  1G6W A;  3G7Y A;  1BG5 A;  2FWF A;  1KSI A;  1RN4 A;  1SJI A;  3V99 A;  1Q42 A;  1MWU A;  1V57 A;  4OMV A;  3X41 A;  4N6M A;  5JWO B;  1OHO A;  5G5E A;  1GLP A;  3GFK A;  1QFN A;  2GU3 A;  1NNV A;  4MJD A;  1O8W A;  1IVU A;  4F9Z A;  4Z2U A;  2RGQ A;  2GU1 A;  5CP1 A;  4EDY A;  5DRE A;  1OYJ A;  2GSQ A;  2L4C A;  2HRN A;  3ZL5 A;  1NM3 A;  3TOT A;  3RHB A;  1OGX A;  1TIJ A;  5IG4 A;  5ELJ A;  1FGQ A;  4IS0 A;  2PGT A;  2FHE A;  4PEJ A;  4XRA A;  1FHE A;  3IAS 2;  1I8V A;  1RCK A;  5D9V A;  3R3E A;  2B7K A;  3F4T A;  3GX8 A;  3HHV A;  5IG3 A;  5CRW A;  3QD9 A;  4K7I A;  1QMA A;  1NB3 I;  3K5T A;  1K0A A;  3DKS A;  1ABA A;  2CW9 A;  3LTD A;  4OO4 A;  1YY7 A;  1A67 A;  2N5F A;  3R2Q A;  3VGN A;  1JB5 A;  1GY6 A;  4TXO A;  1T4Z A;  3U97 A;  5M1A A;  3ZVJ D;  3RNT A;  1IT7 A;  4HAA A;  1TW9 A;  2FWE A;  1PL1 A;  5ABR A;  4BTW A;  1GMQ A;  4WR4 A;  1SD9 A;  3HDC A;  3VSY A;  2H1G A;  2F5W A;  1K8A 4;  1WNH A;  2FD3 A;  3HCZ A;  4XS1 A;  2LKU A;  1PGT A;  2WCI A;  2QA2 A;  3F6F A;  3WA3 A;  3LML A;  2WJU A;  4LZI A;  1OVN A;  2IMF A;  1HQO A;  1EKM A;  1AQX A;  2CVK A;  1BUQ A;  3X42 A;  4HJL B;  3MWZ A;  3BOA A;  3L4N A;  1TRQ A;  2OQE A;  2HZF A;  2IL3 A;  1XIY A;  5F0G A;  2YP6 A;  3I9V 2;  4G0L A;  2HE3 A;  4JF8 A;  2WFC A;  3G4S 3;  1XCC A;  4N6N B;  4WHA A;  3IPZ A;  5EY6 A;  4BL3 A;  4FYU A;  3A2W A;  1AXD A;  1BSC A;  3OV4 A;  1PSQ A;  3QAW A;  1WPI A;  3PR8 A;  4IGJ A;  1G6Y A;  4KH7 A;  1M1X B;  1TP6 A;  2IMJ A;  4J2F A;  1O8X A;  3NBB A;  4CY8 A;  1EUI C;  1DVC A;  1HZ1 A;  4EBG A;  2CV4 A;  4EYC A;  1TTO A;  1K3Y A;  4KVH A;  2D42 A;  4PXO A;  2C1Y A;  3F6D A;  2HYX A;  3OWU A;  9RNT A;  3WR2 A;  4PUA A;  2IA7 A;  1JHB A;  3MYT A;  3CXG A;  3GZR A;  4J5K A;  1O7W B;  2LNT A;  6GSW A;  2CX0 A;  1UCK A;  5STD A;  3AHS A;  20GS A;  2NTO A;  3G16 A;  3ZLP A;  5KP3 A;  3IK7 A;  1Z1S A;  5TGN A;  4AJ6 A;  3VWX A;  2XEP A;  2QKE A;  3OWS A;  1ZYE A;  2MMO A;  3Q6O A;  3HII A;  1YGE A;  3MWH A;  1TRV A;  1VQL 3;  1U3I A;  4Q5N A;  3DM8 A;  4WEY A;  4FMC A;  4FYB A;  3PIN A;  5CRG A;  1M9B A;  4FO5 A;  1THO A;  2ZDJ A;  1A2M A;  3W6G A;  2FUG 2;  2H1B A;  2M72 A;  3RDW A;  1LNH A;  1YGW A;  1J9B A;  2AUV A;  1BOX A;  2R37 A;  3D4M A;  2BNG A;  3QCP A;  3EN8 A;  4MH2 A;  1BAO A;  1QGV A;  2PU9 C;  3MG1 A;  4KDU A;  4L0W A;  1VQ9 3;  5LD0 A;  3SVA A;  2XBQ A;  6GSV A;  1JFU A;  5IEP A;  1XWG A;  3QFB C;  2A4H A;  3DGY A;  3RHC A;  10GS A;  3UMA A;  1LQM B;  4OFT A;  1U5O A;  5JCW A;  1QAL A;  4ZIL A;  4KGI A;  3G7J A;  4ULX A;  1VQ4 3;  5D9W A;  2ZHX B;  1SD8 A;  4X1U A;  2O85 A;  1KBN A;  3ISO A;  3NBR A;  3UL5 A;  2PVQ A;  3K8N A;  4MF5 A;  1O85 A;  2EIR A;  4DSQ A;  4LMW A;  4R80 A;  3MG3 A;  1M9G A;  4HQZ A;  1YHQ 3;  4IEL A;  4V2N A;  1SAR A;  1SYX A;  1ERT A;  5HFK A;  5IMD A;  5KN0 A;  1K0D A;  3H51 A;  2OE3 A;  1O73 A;  3FR3 A;  1FOH A;  3FG3 A;  4RI6 A;  4WR5 A;  4I8B A;  4CHS A;  1EEJ A;  1K41 A;  1Z5Y E;  5H5R A;  3HJO A;  5ID2 B;  3LTB A;  2BMO B;  4BTX A;  2INX A;  4O7H A;  3LSZ A;  4RBN A;  3KTL A;  4RI7 A;  3DXO A;  2WGO A;  1BJX A;  5IG0 A;  4HZB B;  1PN9 A;  1WMO A;  2F5M A;  2K3D A;  4G9H A;  3CCJ 3;  3NX0 A;  3EX9 A;  1IV7 A;  1BNR A;  3VWW A;  2GT5 A;  2F99 A;  1EV4 A;  3DY5 A;  4Q5R A;  3QAV A;  1ZYQ B;  3SXX A;  1XW5 A;  2V1L A;  5IPG A;  2P05 A;  2IME A;  3WT1 A;  1EP7 A;  4CDL A;  1SU9 A;  1GUM A;  2PBJ A;  1MWS A;  1BGS A;  3BCK A;  4EIP A;  3LH4 A;  2HI7 A;  4MAB A;  2DLX A;  3UAR A;  2RCD A;  2PPT A;  5AIV A;  2HRF A;  3FZ9 A;  2IMI A;  5CAX A;  1QQ2 A;  4I5Q A;  1JRQ A;  1I5G A;  2KXG A;  3L0H A;  2YJ7 A;  3UL3 A;  2H70 A;  2D2Z A;  3SBC A;  1LQG C;  3V92 A;  4TKY A;  4AJ7 A;  3WA2 X;  3FF0 A;  1K3L A;  2P38 A;  4J5G A;  4ZB9 A;  1I70 A;  1TRW A;  2OKA A;  1B2S A;  2AHE A;  4EXJ A;  2NVL A;  4XBT A;  3IC4 A;  2GBW B;  5G5F A;  3O8Y A;  4LA1 A;  5HQP A;  2BO9 B;  1OAZ A;  2C11 A;  2CA8 A;  2CX4 A;  1AVK A;  1ML6 A;  2B7J A;  2H30 A;  1BAY A;  2RUE A;  2TIR A;  5D93 A;  2IIY A;  2E7P A;  3LOY A;  1MGR A;  1FUS A;  2G2Q A;  1B3S A;  5DJL A;  1N5H A;  1OE8 A;  1RSN A;  2DMM A;  3HJP A;  2GSR A;  1PL2 A;  4XHM A;  2R0P A;  4K7O A;  3CBU A;  1QAF A;  1BRJ A;  3NV0 A;  3TKR A;  1MWR A;  4N6V 0;  1FG4 A;  1ZS7 A;  3GSP A;  4EXR A;  2O7K A;  2IJY A;  3GYK A;  5DCG A;  1SL1 B;  3I69 A;  3BJ5 A;  3ZMK A;  4F2I A;  4HM2 B;  2H71 A;  1VQK 3;  1RRH A;  1FGT A;  2P0M A;  2BU4 A;  3FHK A;  5ECN B;  2CFG A;  4O5Q A;  5FGO A;  3MKI A;  1W7C A;  1V74 A;  3D5G A;  4IPB A;  5D83 A;  2B5Y A;  3MG2 A;  2GS3 A;  1MOL A;  2O3O A;  4FIW A;  3CSJ A;  4L5O A;  4XM4 A;  14GS A;  1YIJ 3;  3TB2 A;  1ULI B;  2IWT A;  4WXT A;  3PCS A;  1X1U A;  2HT9 A;  4DEJ A;  3GN3 A;  3AMO B;  1O7N B;  2QEX 3;  2BT3 A;  3KE7 A;  1CYU A;  6GSP A;  5B7C A;  3DEX A;  4MZW A;  5L71 A;  1EG9 B;  2OBI A;  3ZIV A;  1YNV X;  3ZML A;  1VQ7 3;  3F7X A;  2X49 A;  3DGN A;  1ZZY A;  2O8V B;  1JB4 A;  3ZFZ A;  1HNC A;  3UBK A;  1M3J A;  1V58 A;  2XFT A;  4GB5 A;  1QK8 A;  5D8I A;  2E2M A;  2GEY A;  4K61 A;  3S28 A;  3N5O A;  1OCV A;  3QDN A;  2GEX A;  2R6K A;  3FY7 A;  2UX0 A;  2REM A;  3TKS A;  4N6L A;  4XS6 A;  1JNQ A;  1Q98 A;  1TP9 A;  3QRD A;  1RKY A;  2H6Z A;  1YJ6 A;  3EMX A;  1R7H A;  4X2H A;  5J9C A;  1IYI A;  2RII A;  1LRA A;  2F8F A;  3JCM L;  2WGR A;  19GS A;  2DIY A;  4K1F A;  3TDG A;  1GWC A;  2J23 A;  4OD7 A;  1MD3 A;  1YF0 A;  3UJM A;  4R1K A;  2B1K A;  2AJQ B;  1IK3 A;  2V6O A;  2OAD A;  1XOB A;  3F40 A;  1UCI A;  5GST A;  1D6Y A;  1LVN A;  4EC6 A;  1FVK A;  5LC6 A;  2YN1 A;  1TK0 B;  13GS A;  2LNS A;  1MDI A;  2L1S A;  5JWQ B;  5D81 A;  3CTG A;  1AAZ A;  1BNS A;  5INY A;  5IW9 A;  2LQV A;  1GSE A;  2WOF A;  5M18 A;  2CFL A;  1J2B A;  3ALA A;  3SOY A;  1M3I A;  2C3T A;  4KSO A;  4J57 E;  3TUE A;  3EMP A;  4QQ7 A;  2P5R A;  2DJ1 A;  2DSA A;  2N5B A;  5IMV A;  3B4O A;  2YPM A;  1FB6 A;  4PUF C;  3K9M C;  1O81 A;  2YZU A;  2XPE A;  1RN7 A;  3KGK A;  1OHP A;  2IFQ B;  3F9S A;  4K0G A;  3DZL A;  3AHW A;  2C3N A;  2W03 A;  2Z7A A;  4KE3 A;  3CCM 3;  3V98 A;  2VLV A;  1LJR A;  3KJY A;  4ZL9 A;  1I3F A;  3LQ7 A;  1TOF A;  1FUT A;  1FAA A;  4MEI A;  3APS A;  5A4W A;  4YQU A;  3CC2 3;  1E6B A;  1BQ7 A;  3SWL A;  2FWH A;  1VF1 A;  1PD2 1;  1YQ1 A;  1RJO A;  1BRH A;  4TVE A;  4TOP A;  2H6Y A;  4V2M A;  2ON7 A;  3EYT A;  2K9F A;  2YV9 A;  4HI7 A;  2H1A A;  1NO3 A;  3SLU A;  4IP6 A;  4ZIJ A;  5ECR B;  4K0N A;  1JBT A;  1VQN 3;  3G8Z A;  2WO0 A;  3CRU A;  3FW2 A;  1JKG A;  2JZT A;  2OA7 A;  4QWT A;  1T4Y A;  3KII A;  1I2F A;  1V2A A;  2PNC A;  2XHF A;  3W8J A;  6RNT A;  1E2Y A;  4MMM A;  3S67 A;  5DCH A;  2HZE B;  1T2H A;  2FLS A;  1NJI 4;  2JL4 A;  4PQH A;  4K8M A;  1B9Y C;  4BU4 A;  5J5N A;  2XF3 A;  1Z7R A;  3QR6 A;  1FA3 A;  3GA4 A;  3BU4 A;  1A2L A;  4QL9 A;  3VWU A;  2DBC A;  4YKG A;  4L8P A;  2MBT A;  4PGT A;  4IVF A;  1GY7 A;  1E3V A;  2CZ2 A;  2XGL A;  2CG1 A;  1O7G B;  4KDX A;  3B7C A;  2VCQ A;  3HK4 A;  5B8A A;  2OE0 A;  2Z9S A;  1FW7 A;  4I2T A;  2CVB A;  3RAZ A;  4K1V A;  2R4I A;  1G7E A;  1JN5 A;  3GKX A;  3EHC A;  1GMR A;  1K0M A;  2CWT A;  3X3X A;  4CCV A;  4L8E A;  2V41 A;  3CSI A;  3CSH A;  3MIX A;  4KB3 A;  1AQV A;  4BPY A;  4KSM A;  2KP2 A;  3GKM A;  2EIQ A;  3GMF A;  4KCE A;  1T3B A;  5B8B A;  2YOI A;  5AII A;  6GSY A;  3I55 3;  3BNB A;  2AV4 A;  2GVP A;  4TR0 A;  4JU5 A;  2CK3 H;  1XOA A;  3FZ4 A;  5EPF A;  4GSP A;  3ZRE A;  2E2V A;  2CAQ A;  5C00 A;  1W6G A;  1GSP A;  3NV0 B;  3C71 A;  4N30 A;  3F9U A;  3CNM A;  18GS A;  1EWX A;  4JED A;  4P3Y B;  1FVJ A;  2X8G A;  3L0R A;  1T5Y A;  4N6T A;  3HZP A;  2PN8 A;  16GS A;  1UCL A;  4F0B A;  3X3Y A;  3GSS A;  3KN4 A;  4V2L A;  1CQG A;  4K2D A;  1QUW A;  1JJ2 2;  3G71 3;  1BNJ A;  3HKR A;  4GWR A;  2K8S A;  5FT3 A;  3IMA B;  2C0E A;  3HVN A;  1IU7 A;  5F05 A;  3L9V A;  1GMP A;  4WKW A;  2QGV A;  3WHO A;  5IMZ A;  2OAC A;  2HMN B;  1O7P B;  1OGZ A;  2QA1 A;  4Q5F A;  1UGH I;  2F9S A;  4CDO A;  2STD A;  5A5K A;  1GTB A;  1PU4 A;  2QSI A;  1XW6 A;  1GOV A;  1YIT 3;  1N2A A;  2A4V A;  2B1L A;  2GSS A;  2X64 A;  3ZIT A;  2F3M A;  3DIE A;  1PQN A;  1OKT A;  3ZIJ A;  4DSR A;  4O8S A;  4O02 B;  2HZE A;  3DXB A;  2C10 A;  3IR4 A;  1TI1 A;  2SAR A;  1KTE A;  3EU4 A;  1B8X A;  3SX1 A;  2AB6 A;  1GL8 A;  1Q40 B;  1MEK A;  4MMZ B;  2C4J A;  2VCZ A;  1ASK A;  3BD2 A;  4NHF A;  4ZBA A;  1TU8 A;  4GCI A;  5BRT A;  3BIR A;  1NU3 A;  2V6K A;  2YWI A;  3KSP A;  2XC2 A;  4BIK A;  3Q90 A;  1C72 A;  2H01 A;  4G2E A;  4MK3 A;  3LZA A;  1THX A;  3L9S A;  1W4N A;  1YI2 3;  1GSU A;  3GUR A;  2NPB A;  3UL6 A;  3D6I A;  1DE2 A;  2L6D A;  1BNI A;  1KNG A;  3FK8 A;  5LNK e;  4NV2 A;  2X99 A;  2Z77 A;  4EW5 A;  5COH A;  3J7Y d;  5DRV A;  7RNT A;  1RGK A;  4X2O A;  1EGR A;  2XRX B;  3Q3F A;  1TU7 A;  4OVM A;  1QXH A;  5CRE A;  3SYU A;  1RGL A;  5FW5 A; 
#chains in the Genus database with same CATH homology
 4NMU A;  2DJJ A;  2CAI A;  3FKF A;  1ZL9 A;  2R0C A;  4GXZ A;  1M99 A;  1XPV A;  2MBS A;  6GSU A;  4EL1 A;  4ZB8 A;  2LV3 A;  3ZFL A;  2NBS A;  2N5A A;  1SKR B;  2CVD A;  3C1R A;  3D22 A;  2P31 A;  2H76 A;  3O76 A;  4K5R A;  1F6M C;  4PQI A;  4G0K A;  3Q19 A;  1JZW A;  3F8U A;  4HJM A;  4TRX A;  3L9U A;  1T1V A;  2V2G A;  2JZR A;  1OC3 A;  5DAL A;  4ACS A;  1TRS A;  3HJM A;  1XZO A;  4IJI A;  5G30 A;  1K0N A;  2VLT A;  1Z9H A;  3CRT A;  4MJB A;  2WZ9 A;  1LBK A;  3CMI A;  2L5O A;  4MF7 A;  4N0Z A;  5D9X A;  2VCW A;  4AJ8 A;  3N9J A;  1DE1 A;  1RW1 A;  5IM9 A;  4F03 A;  5J3R A;  5KEJ A;  2H8L A;  2VLU A;  5A4V A;  1K0C A;  4XTS A;  1ZCP A;  2LRN A;  2O87 A;  3FR9 A;  4YAP A;  2EC4 A;  4J56 E;  1U88 A;  4TR3 A;  3RPP A;  1WE0 A;  1ILO A;  4MLY A;  5EVO A;  5A4U A;  2G0F A;  2IFQ A;  1A8L A;  4PUR A;  4LL1 B;  1OC9 A;  3H8Q A;  3Q18 A;  5IMF A;  4OO5 A;  4IP1 A;  1V9W A;  3HVV A;  1UVZ A;  2WDU A;  4HU7 A;  2HSM A;  1GSQ A;  1K3O A;  4K5S A;  1M2D A;  3WYW A;  2VL2 C;  4EF0 A;  4MP4 A;  2L6C A;  3KEB A;  4BVY B;  4WF4 A;  5GAN D;  4MNN A;  1A0R P;  5FHI A;  2I9H A;  1AC1 A;  2H73 A;  2AAW A;  2CZ3 A;  1J08 A;  4ZBD A;  4JRR A;  5DVB A;  3HD5 A;  5JWR B;  4PNG A;  3E0U A;  4MF6 A;  2LQQ A;  2XPD A;  2VD0 A;  5E4W A;  4KUN A;  1UN2 A;  4GF0 A;  2IMD A;  5JCG A;  1WWJ A;  3IRA A;  2LST A;  3P7X A;  5CRD A;  1X9S B;  4EDZ A;  3V1W A;  3KM6 A;  5D96 A;  4G0I A;  4ILF A;  2H72 A;  2RLI A;  3KMO A;  2FCH A;  2IY2 A;  4IBP A;  1EP8 A;  4ML6 A;  4XS4 B;  1Z7P A;  2O89 A;  3MNG A;  3LFL A;  1HNA A;  3GH6 A;  4YH2 A;  2R3X A;  5ECH B;  4HU9 A;  4MPG A;  1RK4 A;  5F07 A;  1Z6M A;  1PKZ A;  3TJB A;  4MH3 A;  2ES7 A;  3F3R A;  3EIN A;  5D73 A;  3US3 A;  2P5Q A;  4I97 A;  4TXV A;  2FY6 A;  2K8V A;  2VM2 A;  2HNL A;  2H0G A;  1XXU A;  2E0Q A;  2GQK A;  4NAX A;  2B3S A;  2VUP A;  4WBR D;  4IQA A;  2GT6 A;  2VAF A;  3D21 A;  4ZBB A;  4N0V A;  3LXZ A;  22GS A;  3D5J A;  4HJ2 A;  3S9F A;  5DJM A;  1G7O A;  5ECP B;  3WD6 A;  3C7M A;  3EUR A;  4V1A p;  1TKD B;  4QL7 A;  1O6J A;  4I6X A;  2HLS A;  2E2G A;  2H66 A;  4K2X A;  1V98 A;  2VL3 A;  2X8H A;  11GS A;  3MDK A;  1FW1 A;  4D73 B;  5DAK A;  5IPH A;  3ZYW A;  2OE1 A;  3EVI A;  3F63 A;  1HYU A;  5KOX A;  3PGT A;  2YZH A;  1GH2 A;  2AYT A;  1X9W B;  3TRP A;  4IHU A;  4XS4 A;  4O92 A;  1GTU A;  3TJG A;  4E8E A;  4HZ2 A;  3MSZ A;  2I4A A;  4RQR A;  3GL5 A;  1M2A A;  3ZTL A;  1XVQ A;  4ZL7 A;  3UJ1 A;  4POL A;  2X8C A;  1K0O A;  2MZC A;  3HXS A;  2R0G A;  3HZ8 A;  4AGS A;  1Z6N A;  3DRN A;  2PVO C;  4MZB A;  4ZXG A;  5ECI B;  5IMA A;  2ALB A;  5D9T A;  2BTO T;  3FRC A;  1ZGN A;  4MCU A;  1X9M B;  1W4V A;  4ECJ A;  3OR5 A;  1TK8 B;  2H19 A;  1GLQ A;  2CT6 A;  1GNW A;  1SKW B;  4POK A;  3TJK A;  3UVT A;  17GS A;  1PX7 A;  2DKH A;  1PX6 A;  4N10 A;  4NPB A;  4Q5Q A;  3D0Z A;  3KIJ A;  1T7P B;  3APQ A;  4RQX A;  3KXO A;  4XIH A;  2OJL A;  3QMX A;  2V1M A;  1WJK A;  5AIS A;  4LMV A;  4NWY A;  4NHZ A;  1AW9 A;  1OKD A;  1B4Q A;  1EZK A;  3KH7 A;  3H93 A;  1AIU A;  3QAG A;  1M0U A;  5ECK B;  5AIX A;  1ZMA A;  1UA5 A;  2C80 A;  12GS A;  3UBL A;  2WS2 A;  3KTB A;  4ECI A;  2B6M A;  1F2E A;  2VOC A;  1FO5 A;  5E59 A;  4GST A;  2H75 A;  3FZ5 A;  3IDV A;  4JR4 A;  3LEF A;  1F37 A;  1KEB A;  3HZ4 A;  4OFN A;  3CTF A;  4EUY A;  5DAL B;  1B48 A;  3IV4 A;  4HEA 2;  3F0I A;  4HDE A;  5J4U A;  1VF3 A;  4JE1 A;  2MMN A;  1NW2 A;  3WGD A;  5DDL A;  3GV1 A;  3UEM A;  2OBK A;  3LW9 A;  4ICY A;  1TI3 A;  4TR1 B;  1N8J A;  5DQY A;  3VK9 A;  3P90 A;  2KHP A;  1SL2 B;  3ME7 A;  1MDJ A;  1SYR A;  2TRC P;  1U87 A;  2DJ2 A;  5ECS A;  4BA7 A;  5DAK B;  1S3A A;  1XBS A;  2F51 A;  4YQV A;  2VCT A;  1M9A A;  5HR1 A;  2LEG A;  1X5D A;  4LL4 B;  1YDK A;  1AUC A;  5G2Z A;  3A2V A;  2UZ8 A;  1SKS B;  2FNO A;  3ZZX A;  4GQF A;  4KAE A;  4RUV A;  1M7T A;  3VUR A;  1R5A A;  4KW6 A;  3TOU A;  3LGC A;  1USB A;  2DJ3 A;  3IK9 A;  5IOX A;  5J41 A;  1PMT A;  3APO A;  4MDC A;  3J7Y b;  4BWS A;  4I2U A;  3KD0 A;  2YAN A;  3HY2 A;  2JU5 A;  3QPM A;  1SL0 B;  1R4W A;  3LYP A;  1FOV A;  2J9H A;  2IPA A;  3LJR A;  1X0R A;  1EOG A;  2JSZ A;  2YJH A;  5DBQ A;  1TXX A;  3L78 A;  1EOH A;  6GSX A;  5EL8 A;  3LWA A;  6GSS A;  2FWG A;  1ERU A;  5ECM B;  3D4T A;  3F4S A;  5KN1 A;  1RQM A;  1O7U A;  2BJX A;  2HRA A;  2IMK A;  5H5Q A;  1ACV A;  2ZUP A;  2R5G A;  3IXR A;  2LQO A;  3O3T A;  5GZZ B;  4NXI A;  3C8E A;  4DSS A;  2YWM A;  5LCZ A;  5IIZ A;  4O5U A;  1EEM A;  4O5R A;  2L59 A;  3PH9 A;  3IOS A;  4HUA A;  3M9J A;  2GST A;  3DD3 A;  1YKA A;  4MJE A;  1WMJ A;  3P8W A;  3GKN A;  3GIX A;  1EV9 A;  3HA9 A;  3W8S A;  1F9M A;  3TRX A;  1H75 A;  1A24 A;  1HNB A;  2GZZ A;  4KF9 A;  4GRF A;  2DJK A;  5HFI A;  4D73 A;  2NDO A;  4POB A;  5BMU A;  3ED3 A;  3E9J B;  3LOR A;  4TN8 A;  4N11 A;  2WB9 A;  2JAD A;  2LJR A;  1T8E B;  2ZCT A;  1VF2 A;  2KLX A;  3KP8 A;  4NHW A;  5C04 A;  1HD2 A;  1UC7 A;  3QFA C;  4IJ3 A;  1GTI A;  4HZ4 A;  3NZN A;  4PX1 A;  4ML1 A;  2LJA A;  3GL3 A;  4X0X A;  1GUK A;  3WGX A;  1URM A;  1VGL A;  1B9X C;  4POM A;  5KN3 A;  4E8H A;  2L57 A;  4EC0 A;  4K9Z A;  4TXO B;  4TW5 A;  1J0F A;  2VCX A;  3H79 A;  2FGX A;  2DKI A;  3GTU A;  1ST9 A;  1R26 A;  3F3Q A;  3LG6 A;  4KDY A;  1IYH A;  3IBH A;  3E3E A;  4G10 A;  5AN1 A;  4ISD A;  2RM6 A;  1XWA A;  5JCU A;  4NV5 A;  5ELA A;  5G1L A;  4DSS B;  4JBB A;  4MA9 A;  3I6A A;  1LU4 A;  4MZC A;  5AGY A;  1U3A A;  3ERF A;  4CY6 A;  1YZX A;  4IW9 A;  3EPT A;  5ELG A;  2LTK A;  2A2P A;  2QC7 A;  1ERV A;  3DML A;  3TKS E;  2H6X A;  4FH8 A;  3CYN A;  3G7I A;  3IHG A;  4X4J A;  2VL9 A;  3LXT A;  2VO4 A;  3ERG A;  3TGZ A;  2VCV A;  2M46 A;  1Q4J A;  4Z7X A;  3GH9 A;  3KZQ A;  4A5P A;  3HYP A;  3ZFB A;  1BX9 A;  5H5S A;  1SK1 A;  3GNJ A;  1I9D A;  3P2A A;  2YNX A;  4ZL8 A;  2VM1 A;  3HVS A;  5CO3 A;  4WBJ A;  2I81 A;  2DML A;  5GAP D;  3BBY A;  5ID2 A;  3FR6 A;  3VLN A;  1M2B A;  4YKF A;  5HR3 A;  1TK5 B;  4Z2T A;  3GST A;  4G19 A;  4AF2 A;  3UIW A;  5F06 A;  3IHQ A;  4GQC A;  1WOU A;  2GDR A;  3DWV A;  5HFG A;  4IN0 A;  4EVM A;  3ERW A;  3F4R A;  3QOU A;  2IYJ A;  3O6T A;  3EWL A;  1F3A A;  2GGT A;  1T00 A;  3PPU A;  4MJA A;  3HVX A;  3GTU B;  5GSS A;  1GRX A;  2GTU A;  2JSY A;  2JAC A;  3C1S A;  5KOW A;  4HOJ A;  4L5L A;  5B6M A;  2V32 A;  4OFM A;  1MDK A;  1OC9 B;  2I1U A;  9GSS A;  1JZD A;  2VL2 A;  3DVW A;  3GRX A;  3EU3 A;  1NHO A;  3FEU A;  2WRT A;  3GX0 A;  3H1N A;  1JLV A;  2DJ0 A;  4WF5 A;  5IO2 A;  4KCA A;  1XW9 A;  2C0F A;  2LS5 A;  5B6N A;  3ZRD A;  2BMX A;  1DSB A;  2GZY A;  2L5L A;  1SJ6 A;  3IC8 A;  4USS A;  2RM5 A;  3TKS C;  5IO0 A;  1FB0 A;  2C0D A;  1ZYP A;  4F82 A;  3C73 A;  4OWY A;  2FA8 A;  4OCF A;  3BCI A;  1K0B A;  4WET A;  1PRX A;  4XRD A;  3LYK A;  2IN3 A;  1XWB A;  3AY8 A;  1GNE A;  1JLW A;  4HS1 A;  1SEN A;  3EC3 A;  2K18 A;  4IKH A;  5HR2 A;  4GLT A;  3Q74 A;  1AQW A;  2PWJ A;  2A2S A;  2C8U A;  1NHY A;  2VIM A;  4JR6 A;  1ERW A;  4FYC A;  1X5C A;  1BED A;  2VD1 A;  3KCM A;  3M0F A;  1H4O A;  5ENU A;  3VFI A;  2H74 A;  3NOF A;  2KUC A;  1WIK A;  1TDI A;  2DIZ A;  4GSS A;  1GSY A;  2H0I A;  1GP1 A;  4BVX A;  2H1D A;  4BL7 A;  1MTC A;  1YKC A;  4EE0 A;  3TKP A;  4ECB A;  1F3B A;  3VI5 A;  4KX4 A;  1SJZ A;  2CX3 A;  4EIQ A;  4F0C A;  4GTU A;  1TRU A;  1PA3 A;  2YWN A;  3H4K A;  4PTS A;  2YV7 A;  2GLR A;  3IE3 A;  1DBY A;  1A23 A;  2KOK A;  3M9K A;  2TRX A;  3IA1 A;  1GUL A;  4DVC A;  3GUS A;  3EE2 A;  2LJK A;  1XFL A;  4MJC A;  4TR1 A;  3U6V A;  4L0U A;  1A0F A;  4TR4 A;  3VPQ A;  2LRT A;  1G0T A;  2M80 A;  1PN0 A;  5CYY A;  2C3Q A;  3M1G A;  1A2J A;  2PER A;  3GHA A;  2GQL A;  4GSN A;  1V40 A;  2WUL A;  3NIV A;  3ME8 A;  5G1K A;  3WT2 A;  1ZYN A;  1S3D A;  2YCD A;  4BVY A;  2C0G A;  3A2X A;  3MYD A;  1Y6E A;  2H0H A;  3FZA A;  4YQM A;  2DC5 A;  4LLR A;  4BL7 B;  1GTA A;  3KP9 A;  4YAV A;  4CW9 A;  1U6T A;  1YEX A;  3RPN A;  7GSS A;  4EKZ A;  3ZVJ A;  2MMZ A;  3A5I A;  1GUH A;  5IQY A;  4BVX B;  2R4V A;  1WP0 A;  2HRK A;  3G9B A;  3U5R E;  3M8N A;  3UOM A;  2PMT A;  1XWC A;  4O32 A;  1SK0 A;  3TRQ A;  1R5P A;  8GSS A;  1A8Y A;  3I43 A;  1OE7 A;  3DYR A;  3TJF A;  1S3C A;  1TTZ A;  1JZR A;  4OCE A;  2XBI A;  1XVW A;  1OC8 A;  2HSH A;  3A3T A;  3GKK A;  2ZNM A;  3M3M A;  4V1A g;  1YF1 A;  4FQU A;  3VPT A;  1EGO A;  2LUS A;  1NSW A;  3TKQ A;  1BYE A;  2RUF A;  2B5E A;  1XWK A;  2P0G A;  2YWO A;  2LRC A;  1SK2 A;  1MD4 A;  1YEP A;  2KP1 A;  1JZO A;  1Y25 A;  2GZP A;  4EO3 A;  2R2J A;  3VI7 A;  4IQ1 A;  2K6V A;  1VF4 A;  5HR0 A;  5KN2 A;  4MPF A;  1WRY A;  2GQM A;  5J9B A;  5ECO B;  5CRH A;  1VRS D;  1QMV A;  2I3Y A;  3KMN A;  2X4A A;  4K6X A;  3TCO A;  2ON5 A;  2L4Q A;  3RBT A;  1GSD A;  1ON4 A;  4Z2R A;  1DUG A;  1ZOF A;  6GST A;  4BWQ A;  4KND A;  2CQ9 A;  3IAM 2;  5G31 A;  3DVX A;  5ECQ B;  1CQH A;  1GSS A;  3DGQ A;  5CNW A;  1GSF A;  4X43 A;  1Z3E A;  2JZS A;  2MYG A;  4ECC A;  4XCS A;  3FYG A;  1X5E A;  4ID0 A;  3A5W A;  5F8B A;  2FA4 A;  2F8A A;  3J7Y k;  3UVH A;  4H86 A;  5IMC A;  2HXK A;  4KA0 A;  2MMA A;  2HSY A;  4K7N A;  2HFD A;  2PUK C;  4PQ1 A;  3UAP A;  5FWG A;  3WGE A;  4PNF A;  3MAK A;  5DQS A;  1PKW A;  5IOW A;  4ZB6 A;  1B4P A;  4HQS A;  4JZQ A;  3TJJ A;  3FMW A;  2B5X A;  5ECL B;  3VWV A;  1TJD A;  2A2R A;  3KH9 A;  1W89 A;  2EIO A;  1G6W A;  3G7Y A;  1BG5 A;  2FWF A;  1SJI A;  1V57 A;  4OMV A;  5JWO B;  5G5E A;  1GLP A;  3GFK A;  1QFN A;  1O8W A;  4F9Z A;  4Z2U A;  5CP1 A;  4EDY A;  1OYJ A;  2GSQ A;  2L4C A;  2HRN A;  3ZL5 A;  1NM3 A;  3TOT A;  3RHB A;  4IS0 A;  2PGT A;  2FHE A;  4XRA A;  1FHE A;  3IAS 2;  5D9V A;  3R3E A;  2B7K A;  3F4T A;  3GX8 A;  3HHV A;  5CRW A;  3QD9 A;  4K7I A;  1K0A A;  3DKS A;  1ABA A;  4OO4 A;  1YY7 A;  2N5F A;  3R2Q A;  4TXO A;  1T4Z A;  3ZVJ D;  1TW9 A;  2FWE A;  1PL1 A;  5ABR A;  4WR4 A;  1SD9 A;  3HDC A;  2H1G A;  2FD3 A;  3HCZ A;  4XS1 A;  2LKU A;  1PGT A;  2WCI A;  2QA2 A;  3F6F A;  2WJU A;  1OVN A;  2IMF A;  1HQO A;  1AQX A;  2CVK A;  3BOA A;  3L4N A;  2HZF A;  2IL3 A;  1XIY A;  5F0G A;  2YP6 A;  3I9V 2;  4G0L A;  2HE3 A;  2WFC A;  1XCC A;  3IPZ A;  5EY6 A;  4FYU A;  3A2W A;  1AXD A;  1PSQ A;  3QAW A;  1WPI A;  3PR8 A;  4IGJ A;  1G6Y A;  4KH7 A;  4J2F A;  1O8X A;  4CY8 A;  2CV4 A;  1K3Y A;  4PXO A;  2C1Y A;  3F6D A;  2HYX A;  4PUA A;  1JHB A;  3CXG A;  6GSW A;  2LNT A;  20GS A;  2NTO A;  3ZLP A;  3IK7 A;  4AJ6 A;  3VWX A;  2QKE A;  1ZYE A;  2MMO A;  3Q6O A;  3MWH A;  1TRV A;  1U3I A;  4Q5N A;  4WEY A;  4FYB A;  3PIN A;  5CRG A;  1M9B A;  4FO5 A;  1THO A;  1A2M A;  3W6G A;  2FUG 2;  2H1B A;  2M72 A;  3RDW A;  1J9B A;  2AUV A;  2R37 A;  3D4M A;  3QCP A;  4MH2 A;  1QGV A;  2PU9 C;  4KDU A;  4L0W A;  5LD0 A;  2XBQ A;  6GSV A;  1JFU A;  1XWG A;  3QFB C;  2A4H A;  3RHC A;  10GS A;  3UMA A;  4OFT A;  5JCW A;  4ZIL A;  4KGI A;  3G7J A;  4ULX A;  5D9W A;  1SD8 A;  4X1U A;  2O85 A;  1KBN A;  3ISO A;  3K8N A;  2PVQ A;  4MF5 A;  1O85 A;  2EIR A;  4DSQ A;  4LMW A;  4HQZ A;  4IEL A;  4V2N A;  1SYX A;  1ERT A;  5HFK A;  5IMD A;  5KN0 A;  1K0D A;  2OE3 A;  1O73 A;  3FR3 A;  1FOH A;  4RI6 A;  4WR5 A;  4I8B A;  4CHS A;  1EEJ A;  1Z5Y E;  5H5R A;  3HJO A;  5ID2 B;  4O7H A;  3LSZ A;  3KTL A;  4RI7 A;  1BJX A;  1PN9 A;  4G9H A;  3VWW A;  2GT5 A;  1EV4 A;  4Q5R A;  3QAV A;  1ZYQ B;  1XW5 A;  5IPG A;  2IME A;  3WT1 A;  1EP7 A;  1SU9 A;  1GUM A;  2PBJ A;  3BCK A;  4EIP A;  2HI7 A;  4MAB A;  2DLX A;  3UAR A;  5AIV A;  2PPT A;  2HRF A;  3FZ9 A;  2IMI A;  5CAX A;  1QQ2 A;  4I5Q A;  1I5G A;  3L0H A;  2YJ7 A;  3UL3 A;  2H70 A;  2D2Z A;  3SBC A;  4TKY A;  4AJ7 A;  1K3L A;  4ZB9 A;  4EXJ A;  1TRW A;  2OKA A;  2AHE A;  2NVL A;  3IC4 A;  5G5F A;  4LA1 A;  5HQP A;  1OAZ A;  2CA8 A;  2CX4 A;  1ML6 A;  2B7J A;  2H30 A;  1BAY A;  2RUE A;  2TIR A;  5D93 A;  2IIY A;  2E7P A;  2G2Q A;  5DJL A;  1OE8 A;  2DMM A;  3HJP A;  2GSR A;  1PL2 A;  4XHM A;  2R0P A;  4K7O A;  3CBU A;  3TKR A;  1FG4 A;  2O7K A;  2IJY A;  3GYK A;  5DCG A;  1SL1 B;  3I69 A;  3BJ5 A;  3ZMK A;  4F2I A;  2H71 A;  3FHK A;  5ECN B;  4O5Q A;  2GS3 A;  2B5Y A;  4FIW A;  3CSJ A;  4L5O A;  14GS A;  3TB2 A;  2IWT A;  4WXT A;  2HT9 A;  4DEJ A;  3GN3 A;  5B7C A;  3DEX A;  4MZW A;  5L71 A;  2OBI A;  3ZIV A;  3ZML A;  2X49 A;  1ZZY A;  2O8V B;  1HNC A;  3UBK A;  1V58 A;  1QK8 A;  5D8I A;  2E2M A;  3N5O A;  3QDN A;  2R6K A;  3FY7 A;  2REM A;  3TKS A;  4XS6 A;  1Q98 A;  1TP9 A;  2H6Z A;  1YJ6 A;  3EMX A;  1R7H A;  5J9C A;  1IYI A;  2RII A;  2F8F A;  3JCM L;  2WGR A;  19GS A;  2DIY A;  4K1F A;  3TDG A;  1GWC A;  2J23 A;  4OD7 A;  1MD3 A;  1YF0 A;  2B1K A;  2AJQ B;  2V6O A;  2OAD A;  1XOB A;  5GST A;  1FVK A;  2YN1 A;  1TK0 B;  13GS A;  2LNS A;  1MDI A;  5JWQ B;  3CTG A;  1AAZ A;  5INY A;  1GSE A;  2C3T A;  4KSO A;  4J57 E;  3TUE A;  3EMP A;  4QQ7 A;  2P5R A;  2DJ1 A;  2DSA A;  2N5B A;  5IMV A;  2YPM A;  1FB6 A;  4PUF C;  1O81 A;  2YZU A;  2XPE A;  3KGK A;  2IFQ B;  4K0G A;  2C3N A;  4KE3 A;  2VLV A;  1LJR A;  3KJY A;  4ZL9 A;  3LQ7 A;  1TOF A;  1FAA A;  3APS A;  5A4W A;  4YQU A;  1E6B A;  1BQ7 A;  3SWL A;  2FWH A;  1VF1 A;  1PD2 1;  1YQ1 A;  4TVE A;  4TOP A;  2H6Y A;  4V2M A;  2ON7 A;  3EYT A;  2K9F A;  2YV9 A;  4HI7 A;  2H1A A;  4ZIJ A;  4IP6 A;  5ECR B;  4K0N A;  3CRU A;  3FW2 A;  2JZT A;  2OA7 A;  1T4Y A;  1V2A A;  2XHF A;  3W8J A;  1E2Y A;  4MMM A;  5DCH A;  2HZE B;  2FLS A;  2JL4 A;  4PQH A;  4K8M A;  1B9Y C;  5J5N A;  1Z7R A;  3QR6 A;  3GA4 A;  4QL9 A;  1A2L A;  3VWU A;  2DBC A;  4YKG A;  2MBT A;  4PGT A;  4IVF A;  2CZ2 A;  4KDX A;  2VCQ A;  5B8A A;  2OE0 A;  2Z9S A;  4I2T A;  3RAZ A;  2CVB A;  1G7E A;  3GKX A;  1K0M A;  2V41 A;  3CSI A;  3CSH A;  3MIX A;  4KB3 A;  1AQV A;  4BPY A;  4KSM A;  2KP2 A;  3GKM A;  2EIQ A;  3GMF A;  4KCE A;  1T3B A;  5B8B A;  2YOI A;  6GSY A;  2AV4 A;  2GVP A;  4TR0 A;  4JU5 A;  1XOA A;  3FZ4 A;  5EPF A;  3ZRE A;  2CAQ A;  5C00 A;  3C71 A;  4N30 A;  3F9U A;  18GS A;  1EWX A;  4JED A;  4P3Y B;  1FVJ A;  2X8G A;  2PN8 A;  16GS A;  4F0B A;  3GSS A;  4V2L A;  1CQG A;  4K2D A;  1QUW A;  3HKR A;  4GWR A;  2K8S A;  5FT3 A;  2C0E A;  5F05 A;  3L9V A;  4WKW A;  2QGV A;  5IMZ A;  2OAC A;  2QA1 A;  4Q5F A;  2F9S A;  4CDO A;  5A5K A;  1GTB A;  2QSI A;  1XW6 A;  2B1L A;  2X64 A;  1N2A A;  2A4V A;  2GSS A;  3ZIT A;  2F3M A;  3DIE A;  1PQN A;  1OKT A;  3ZIJ A;  4DSR A;  2HZE A;  3DXB A;  3IR4 A;  1TI1 A;  1KTE A;  3EU4 A;  1B8X A;  2AB6 A;  1GL8 A;  1MEK A;  2C4J A;  3BD2 A;  2VCZ A;  4ZBA A;  1TU8 A;  4GCI A;  5BRT A;  2V6K A;  2YWI A;  2XC2 A;  2H01 A;  1C72 A;  4G2E A;  4MK3 A;  1THX A;  3L9S A;  1GSU A;  3GUR A;  2NPB A;  3D6I A;  1DE2 A;  2L6D A;  1KNG A;  3FK8 A;  5LNK e;  4NV2 A;  2X99 A;  5COH A;  1EGR A;  1TU7 A;  1QXH A;  5CRE A;  4L8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...