1BNEA

Barnase a43c/s80c disulfide mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLCDVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTCGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Disulfide mutants of barnase. I: Changes in stability and structure assessed by biophysical methods and X-ray crystallography.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 32
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bneA00
1BNIA 1B20A 1FW7A 1RGAA 1TTOA 1BSBA 1BOXA 1I0XA 1BNJA 3DH2A 1BNFA 1UCIA 1IYYA 1FYSA 3BIRA 1A2PA 8RNTA 1RGKA 1BIRA 1RNTA 3WHOA 9RNTA 1B2XA 1I2GA 1HYFA 1BRNL 1BUJA 1LOYA 1RTUA 4J5KA 1I2EA 1JBRA 2RBIA 1BRKA 3RNTA 3HOHA 1X1XA 1X1YA 2KAAA 1RNBA 1UCJA 1YVSA 3AGOA 1BSDA 3SYUA 1I70A 1BANA 3URPA 1RGLA 2ZA4A 1G02A 1B2UA 1DETA 1GOYA 1MGRA 1B2SA 1CH0A 2KF5A 6GSPA 1BU4A 2AAEA 2BU4A 4HAAA 1RGCA 2F56A 1BAOA 3A5EA 2F5WA 2RNTA 5BIRA 1T2IA 1BSAA 1BSCA 1TRPA 3D4AA 1RMSA 4HOHA 1RGGA 3AGNA 1SARA 3D5IA 4BIRA 6RNTA 1BGSA 1GMRA 4RNTA 1LRAA 1PY3A 1GSPA 3Q3FA 1X1WA 1MGWA 1I0VA 1RN4A 1LOVA 1I3IA 7RNTA 1LNIA 1X1UA 1FZUA 1BRIA 1HZ1A 1RCKA 1RGHA 1DE3A 1RLSA 1RDSA 1ZGXA 2SARA 1BSEA 1YNVX 1YGWA 1B3SA 1GMPA 1BRGA 2AADA 2C4BA 1BNRA 7GSPA 1I2FA 1RHLA 1BNSA 1GOUA 1BNEA 1GOVA 1RCLA 2KF4A 3BU4A 5BU4A 1RGEA 1B2ZA 1RN1A 4BU4A 1RSNA 3WR2A 1FUSA 3GSPA 1Q9EA 3DGYA 4GHOA 4J5GA 5GSPA 3AHSA 1B2MA 1FUTA 1UCLA 1T2HA 2BIRA 1AQZA 1UCKA 3D5GA 4GSPA 1BVIA 2F5MA 1BRSA 5RNTA 1AY7A 1BNGA 1BRJA 1RGFA 2KF3A 2HOHA 1C54A 2F4YA 1PYLA 1TRQA 1JBSA 1I8VA 2GSPA 1LOWA 2KF6A 1BRHA 1R4YA 5HOHA 3AHWA 1GMQA 1JBTA 1B27A 1B21A 1I3FA 3KCHA
chains in the Genus database with same CATH superfamily
4FCZA 3KSED 1OF5A 3T8UA 1TTOA 1I0XA 4NHFA 1JZOA 2I9WA 3DH2A 1UCIA 2HMLB 1KC84 2GXFA 3Q2PA 3BIRA 3LXUX 3N8BA 1A2PA 3I553 3OXAA 3BNDA 4WFOA 4HM2B 4EV5A 1HYFA 3NBJA 1LXEA 3JUNA 1RTUA 3BB9A 2LQVA 1FA3A 3HOHA 4N3VA 1CEWI 1X1YA 2GBXB 1DVCA 2P0XA 4HM3B 2JQ5A 2V1LA 1BSDA 3SYUA 4NREA 1GY6A 1A90A 3FH1A 1ULJB 1I70A 3DM8A 3URPA 5JPUA 1RGLA 2XSOB 5LC6A 1B2UA 1GOYA 1JRQA 2XFTA 1MGRA 3B7CA 3HI7A 1S723 1M904 2JDIH 6GSPA 3NV0B 2CC3A 4K1UA 3PGBA 1JN5B 2F56A 3DGMA 3EE1A 4HKVB 1FGQA 4WP5A 1AR0A 5IEOA 2CWTA 3MHEA 3NBRA 1W5ZA 5LC7A 2XR8B 1BSAA 1BSCA 2RGQA 3D4AA 1RMSA 4FR9A 1D6ZA 1RGGA 5FGOA 5JBSA 2A15A 3MPHA 3AGNA 4AEQA 2QEX3 2HMMB 4XDVA 2SBLA 5D83A 2MC8A 2WGOA 1Q7HA 2XGLA 1JJ22 1UDII 1E97A 1LRAA 1GSPA 1KD14 1MOLA 1KWIA 1K734 1CQSA 1I0VA 2YX9A 4L7KA 4KFDA 2D1WA 1I3IA 4O2HA 1LNIA 1QAFA 2H0GA 4MJDA 4CJNA 3ZG5A 3KIIA 1FZUA 4ZM8A 2F99A 4XB5A 2CWVA 2OOVC 5FW5A 3GZRA 2IA7A 2E2UA 4H3UA 4KFEA 3V99A 2XGNA 3LZAA 4R80A 3CCQ3 1NNVA 4O02B 3F8XA 3UL5A 1TIJA 1R4CA 2Z7AA 3MSOA 1WTHA 6STDA 5M19A 7GSPA 1O7PB 3OW22 1I2FA 1WMPA 3O8YA 4ORLA 4EW5A 3BNEA 3G8ZA 1E3RA 1Z1SA 1GD4A 1BNEA 1RCLA 4RNZA 1VQ53 3FF2A 3G16A 1W6GA 4R4KA 5I97A 4BU4A 1RSNA 4MMZB 4LSOA 4N6LA 5M18A 1FUSA 1W02A 3WODG 1TUHA 5KP1A 5IG4A 4PEJA 1RJOA 1AVLA 3AHSA 2YFLB 1FUTA 3FGYA 1VQ43 3Q90A 1T2HA 1W7CA 1AQZA 1N5PA 2GU1A 3GAXA 3K7CA 2CH9A 1VQN3 4Q53A 2W03A 5CK6A 2OQEC 1BVIA 2O9UX 2KF3A 3X3YA 1C54A 3MYTA 1DVDA 3S5CA 1IQ8A 4CDLA 2GSPA 4MMXB 1LOWA 3BNBA 4MEIA 4JRFA 1JB2A 1OH0A 2GEXA 3WA2X 2CFGA 4MMYB 1B21A 2XSHB 2CX0A 4XBYA 3CC43 1IV9A 1A2KA 3TDGA 3QK9A 1VQ63 4IIAA 1BSBA 1BNJA 1T5YA 1WQLB 3FG3A 1IYYA 1O7WB 4FCJA 1IU7A 4FCMA 1BIRA 2CG0A 1K41A 9RNTA 3MG3A 3N54B 2CWUA 2Q07A 2STDA 1OGXA 3MG1A 3SEDA 2PZVA 1CYUA 1I2EA 1GY7A 1JNQA 3DGNA 1LVNA 4EBGA 3SVAA 3WDGB 3AMOA 3ZFZA 3JVCA 3OX9A 4IT7A 1W00A 5KP3A 4BL2A 2KAAA 1RNBA 3UJMA 1YVSA 1TP6A 1A2VA 1JKGB 4O8SA 2BMOB 1M9GA 1BANA 3OWYA 4HZ9B 1BUQA 2GU3A 3CNMA 1G02A 3GZYB 4LMIA 3NQZA 5AEUB 2F86B 2ZL8A 3EHCA 1STFI 1VQ73 4FMAA 1JZDA 4K1VA 1CH0A 3GZBA 3GZXB 1W2B2 1LQMB 2P38A 2BU4A 2B24B 3KSPA 5IF6A 2L1SA 3EC9A 4N6OB 3CCV3 1AV4A 1MWRA 5BIRA 3F9SA 3PZWA 1UGIA 3D9RA 1AVKA 2XEPA 1TRPA 4HOHA 3RDEA 2WO0A 2CX1A 3DXOA 3ZG0A 1K9M4 1UGHI 5A0OB 1SARA 5AIHA 4XM4A 6RNTA 3NV0A 1BGSA 3CPW2 3Q3FA 2O3OA 1RRHA 1X1WA 1N8QA 1Q40B 1JN5A 3EJVA 3DGOA 2HMNB 3KFQC 7RNTA 3EQQB 2CK3H 1X1UA 1VQK3 4WYKB 1WMOA 1BRIA 4H61A 1RCKA 3K63A 1J2BA 1NU3A 3FCSB 1RLSA 1EUIC 1Q42A 5G1KA 2SARA 2BHMA 3PXMA 3HIIA 1EQKA 1EG9B 4KZ1A 4QWTA 3HIGA 1B3SA 1GMPA 1BRGA 2AADA 2C4BA 3FLJA 5CXOA 5DREA 3SOYA 1BNRA 3CCJ3 4HJLB 1K28A 2OCTA 5AYRB 4N6TA 1BNSA 1V57A 2KRTA 1FGOA 4OK0A 2KF4A 5BU4A 3BU4A 1NWWA 3NM2A 1B2ZA 2H0IA 1RN1A 1L5GB 2CFDA 3CU3A 5IERA 3WR2A 1QJGA 3ECFA 2YFIB 2W56B 3GSPA 5EVHA 3UB1A 4BTWA 5CF1A 2QIYA 1SIIA 3DGYA 3V98A 2P0MA 1JB4A 4WWUC 4HYZA 2IMJA 1MWTA 3F7XA 4HZBB 2K0MA 3SXXA 3EBYA 3DUKA 1OHSA 1OUNA 1UCLA 2BIRA 3OV4A 5AIGA 4CCVA 3D5GA 4GSPA 4HM7B 1GD3A 2OWPA 3EX9A 2KXGA 4LEHA 3FSDA 1RGFA 2F4YA 3X3XA 1PYLA 3MG2A 3S28A 3OWSA 1R4YA 1TJDA 5HOHA 3D3LA 2RSXA 3CME3 1JBTA 1U8CB 2P05A 1N9EA 1QMAA 1RGAA 1MWSA 4LZIA 5G1LA 1IDPA 2WOHA 1WMNA 3X3ZA 3PYJA 3GWRA 1IK3A 3CCR3 1VQ93 8RNTA 3S27A 2J8XB 3WHOA 5KP4A 2BMRB 5AIFA 1I2GA 2W9QA 5EEOA 2CHCA 1BRNL 3LTAA 5IG3A 1BUJA 1LOYA 1LQGC 1DMNA 1KSIA 5AEWB 1BRKA 3RNTA 1VQP3 1ROVA 3FKAA 3NHXA 3NUVA 4G1MB 3CXC2 1IVWA 5IEPA 5D82A 2Z76A 1UCJA 2W9PA 3AGOA 4XBTA 3X41A 1N8R4 1D6YA 2H0HA 5BVBA 1YHQ3 2HMKB 2FNQA 1Q814 1JB5A 2F98A 3RGAA 3U1WA 3Q1CA 2R41A 1UUGB 3WOEB 1V58A 1DETA 1VQO3 4X2HA 1FGMA 3F7SA 1B2SA 2R4IA 2ML5A 1VQL3 4AKYA 3X40A 4TX4A 4HAAA 1RGCA 3KKGA 5CLKA 3VSYA 1TFKA 2IY2A 3A5EA 1QALA 5IG5A 2CFKA 1T2IA 2UX0A 1MNLA 1YGEA 3KZTA 3H3HA 3B4OA 1EA2A 2E2TA 3S29A 1JKGA 1O7MB 4FMBA 3CCE3 4KFFA 2D42A 4KVHA 4K90B 3D5IA 4O3VA 3CCM3 1ZS7A 4FMDA 4BIRA 1CYVA 4J8TA 4I5QA 4HM8B 3CCL3 3MKIA 3PCRA 1ULIB 3K9MC 1PY3A 1WNHA 2XRXB 3EN1B 2UGIA 3UNLA 1OPYA 1QVG2 1MGWA 1UW1A 3BLZA 1ZO2A 1F8NA 1UI8A 2W2CA 4HM5B 4K61A 3RGRA 1JV2B 1STDA 1HZ1A 1DE3A 1Q7Y4 2XH9A 1PFPA 1BSEA 4R9LA 3IMAB 3V92A 1IVUA 3CCS3 4I4KA 1DMQA 1SQWA 1YVBI 2CIUA 1K8A4 4LYLB 4HBRA 4N6NB 1QAKA 3K5TA 1RHLA 2W04A 5HGRA 3G6E3 1IT7A 1Q40A 1OHPA 1YJ93 1GOVA 5AI1A 3D79A 3KE7A 1HKXA 4STDA 4WYKA 4IPBA 2OOVA 1U5OA 2Y73A 2OTL3 2OTJ3 1NDOB 1IVXA 3G4S3 1YI23 1O7NB 3J7Yd 1Q9EA 3CNXA 3LMLA 3HX8A 4GHOA 4GL6A 1LOXA 4J5GA 2BO9B 1GY5A 4L8OA 1FUWA 5DRVA 4U13A 4DKIA 1N9JA 3I563 3LYGA 7STDA 2INXA 1IVVA 1OF5B 1UCKA 1HU9A 2WOFA 4KT3B 3SLUA 5M1AA 3LTCA 2HMJB 3IPTA 1LNHA 4N6V0 2IUJA 3JUQA 1BRSA 3FG4A 4N6UA 1AY7A 1BNGA 3JUPA 3LOYA 4LGQA 4EC6A 1PU4A 2HOHA 3FG1A 1YJN3 3F8HA 3EN8A 2Z77A 2W56A 3HZPA 3LH4A 4AKZA 2KF6A 3STDA 2CFWA 4HM1B 2L4VA 1NB3I 1GMQA 5CF2A 3JUOA 2K54A 1G0TA 3KCHA 1BNIA 1B20A 1FW7A 1G96A 1Q824 1M1XB 1BOXA 1ISKA 1BNFA 2BT3A 2OQEA 3CPOA 1YJW3 1FYSA 5ELJA 3L0RA 3ALAA 3EF8A 3X42A 1RGKA 2FXTA 1OGZA 1RNTA 3N9HA 1B2XA 2MF7A 1Q864 3ROBA 4FMCA 1EKMA 4R9KA 4J5KA 3VF1A 1JBRA 2RBIA 1X1XA 2FGTA 2KCDA 2GEYA 3IJEB 2P09A 2ZDJA 4NPBA 3HK4A 2PNCA 3CD63 3BNCA 1O7GB 2BMQB 3LT9A 3VGNA 4JF8A 2ZHXB 3K0ZA 3LTBA 3NXJA 8CHOA 2ZA4A 2XFSA 2UUGC 3WMDA 1SJWA 2W6JH 1QVF2 1DMMA 1C7HA 1O7HB 3LT8A 2KF5A 1RRLA 4OVMA 1BU4A 4L8PA 2AAEA 2M7OA 1BAOA 3B8LA 4BTYA 4EV2A 1DYUA 2F5WA 1VQQA 2ML6A 2RNTA 3DGLA 5AIIA 3EBTA 3CMA3 1YIJ3 3UL6A 4EYCA 1EEJA 1FGRA 2W0QA 4BL3A 2GBWB 1Y4KA 1W6CA 5D81A 1W2ZA 4GB5A 5AYSC 1NJI4 5TGNA 1IT8A 2E2VA 2IYJA 3DY5A 1GMRA 4RNTA 2IUKA 3NX0A 4HVNA 3S67A 3WOFB 3ER7A 4HM4B 1RN4A 3F14A 1LOVA 1T3BA 1ASKA 5G2GA 2B1XB 3H51A 2C10A 1RGHA 5JPPA 5BXQA 1ROAA 3F40A 1OACA 3FZWA 1RDSA 3OWUA 1ZGXA 4ILFA 1SIHA 3NBBA 5EQLA 4CPKA 1YNVX 1YGWA 3M8CA 1US1A 2CFLA 1SPUA 4RBNA 3PCSA 1D6UA 1ZX2A 3PS8A 1YIT3 1VZZA 4WHAA 1A67A 1W4NA 1VQ83 1N5HA 3G0KA 4J9AA 4R1KA 1M1K4 2C11A 2RCDA 4N6MA 1FGTA 3DMCA 5STDA 3GRDA 3U97A 4BTXA 2QA43 4RZMA 4XBXA 4RNYA 1GOUA 1TU5A 1VQM3 1UUWB 1S5AA 3SOAA 1RGEA 3CC73 3T0UA 1KQS2 4HM6B 2Z6BA 1OHOA 2LYXA 5IW9A 2Y74A 3NM7A 1GS3A 5ELUA 1UI7A 4X2OA 2BNGA 2CG1A 1E3VA 3B4PA 5GSPA 4XDWA 1W6YA 5IENA 1B2MA 2CW9A 3WA3A 3MWZA 2YFJB 3I0YA 4EXRA 3CC23 3A76A 1RN7A 3NQYA 1V74A 3SX1A 1RKYA 1TFOA 5IG0A 2QGUA 3DZLA 3T8NA 2F5MA 2XF3A 3E99A 3EB8A 1OCVA 5RNTA 1BRJA 1MWUA 1IQXA 3JUMA 3LTDA 1IQYA 3G713 1NB5I 3QRDA 3CCU3 4OUQA 1TRQA 1JBSA 1GYBA 3KN4A 1I8VA 2CKFB 4HM0B 1BRHA 1UUVB 2HMOB 3AHWA 1NO3A 2RFRA 2K3DA 1IV7A 2WGQA 1B27A 1I3FA 1W01A 3FF0A 3AMOB
chains in the Genus database with same CATH topology
1BNIA 1B20A 1FW7A 1RGAA 1TTOA 1BSBA 1BOXA 1I0XA 1BNJA 3DH2A 1BNFA 1UCIA 1IYYA 1FYSA 3BIRA 1A2PA 8RNTA 1RGKA 1BIRA 1RNTA 3WHOA 9RNTA 1B2XA 1I2GA 1HYFA 1BRNL 1BUJA 1LOYA 1RTUA 4J5KA 1I2EA 1JBRA 2RBIA 1BRKA 3RNTA 3HOHA 1X1XA 1X1YA 2KAAA 1RNBA 1UCJA 1YVSA 3AGOA 1BSDA 3SYUA 1I70A 1BANA 3URPA 1RGLA 2ZA4A 1G02A 1B2UA 1DETA 1GOYA 1MGRA 1B2SA 1CH0A 2KF5A 6GSPA 1BU4A 2AAEA 2BU4A 4HAAA 1RGCA 2F56A 1BAOA 3A5EA 2F5WA 2RNTA 5BIRA 1T2IA 1BSAA 1BSCA 1TRPA 3D4AA 1RMSA 4HOHA 1RGGA 3AGNA 1SARA 3D5IA 4BIRA 6RNTA 1BGSA 1GMRA 4RNTA 1LRAA 1PY3A 1GSPA 3Q3FA 1X1WA 1MGWA 1I0VA 1RN4A 1LOVA 1I3IA 7RNTA 1LNIA 1X1UA 1FZUA 1BRIA 1HZ1A 1RCKA 1RGHA 1DE3A 1RLSA 1RDSA 1ZGXA 2SARA 1BSEA 1YNVX 1YGWA 1B3SA 1GMPA 1BRGA 2AADA 2C4BA 1BNRA 7GSPA 1I2FA 1RHLA 1BNSA 1GOUA 1BNEA 1GOVA 1RCLA 2KF4A 3BU4A 5BU4A 1RGEA 1B2ZA 1RN1A 4BU4A 1RSNA 3WR2A 1FUSA 3GSPA 1Q9EA 3DGYA 4GHOA 4J5GA 5GSPA 3AHSA 1B2MA 1FUTA 1UCLA 1T2HA 2BIRA 1AQZA 1UCKA 3D5GA 4GSPA 1BVIA 2F5MA 1BRSA 5RNTA 1AY7A 1BNGA 1BRJA 1RGFA 2KF3A 2HOHA 1C54A 2F4YA 1PYLA 1TRQA 1JBSA 1I8VA 2GSPA 1LOWA 2KF6A 1BRHA 1R4YA 5HOHA 3AHWA 1GMQA 1JBTA 1B27A 1B21A 1I3FA 3KCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNI A;  1B20 A;  1FW7 A;  1RGA A;  1TTO A;  1BSB A;  1BOX A;  1I0X A;  1BNJ A;  3DH2 A;  1BNF A;  1UCI A;  1IYY A;  1FYS A;  3BIR A;  1A2P A;  8RNT A;  1RGK A;  1BIR A;  1RNT A;  3WHO A;  9RNT A;  1B2X A;  1I2G A;  1HYF A;  1BRN L;  1BUJ A;  1LOY A;  1RTU A;  4J5K A;  1I2E A;  1JBR A;  2RBI A;  1BRK A;  3RNT A;  3HOH A;  1X1X A;  1X1Y A;  2KAA A;  1RNB A;  1UCJ A;  1YVS A;  3AGO A;  1BSD A;  3SYU A;  1I70 A;  1BAN A;  3URP A;  1RGL A;  2ZA4 A;  1G02 A;  1B2U A;  1DET A;  1GOY A;  1MGR A;  1B2S A;  1CH0 A;  2KF5 A;  6GSP A;  1BU4 A;  2AAE A;  2BU4 A;  4HAA A;  1RGC A;  2F56 A;  1BAO A;  3A5E A;  2F5W A;  2RNT A;  5BIR A;  1T2I A;  1BSA A;  1BSC A;  1TRP A;  3D4A A;  1RMS A;  4HOH A;  1RGG A;  3AGN A;  1SAR A;  3D5I A;  4BIR A;  6RNT A;  1BGS A;  1GMR A;  4RNT A;  1LRA A;  1PY3 A;  1GSP A;  3Q3F A;  1X1W A;  1MGW A;  1I0V A;  1RN4 A;  1LOV A;  1I3I A;  7RNT A;  1LNI A;  1X1U A;  1FZU A;  1BRI A;  1HZ1 A;  1RCK A;  1RGH A;  1DE3 A;  1RLS A;  1RDS A;  1ZGX A;  2SAR A;  1BSE A;  1YNV X;  1YGW A;  1B3S A;  1GMP A;  1BRG A;  2AAD A;  2C4B A;  1BNR A;  7GSP A;  1I2F A;  1RHL A;  1BNS A;  1GOU A;  1BNE A;  1GOV A;  1RCL A;  2KF4 A;  3BU4 A;  5BU4 A;  1RGE A;  1B2Z A;  1RN1 A;  4BU4 A;  1RSN A;  3WR2 A;  1FUS A;  3GSP A;  1Q9E A;  3DGY A;  4GHO A;  4J5G A;  5GSP A;  3AHS A;  1B2M A;  1FUT A;  1UCL A;  1T2H A;  2BIR A;  1AQZ A;  1UCK A;  3D5G A;  4GSP A;  1BVI A;  2F5M A;  1BRS A;  5RNT A;  1AY7 A;  1BNG A;  1BRJ A;  1RGF A;  2KF3 A;  2HOH A;  1C54 A;  2F4Y A;  1PYL A;  1TRQ A;  1JBS A;  1I8V A;  2GSP A;  1LOW A;  2KF6 A;  1BRH A;  1R4Y A;  5HOH A;  3AHW A;  1GMQ A;  1JBT A;  1B27 A;  1B21 A;  1I3F A;  3KCH A; 
#chains in the Genus database with same CATH topology
 4FCZ A;  3KSE D;  1OF5 A;  3T8U A;  1TTO A;  1I0X A;  4NHF A;  1JZO A;  2I9W A;  3DH2 A;  1UCI A;  2HML B;  1KC8 4;  2GXF A;  3Q2P A;  3BIR A;  3LXU X;  3N8B A;  1A2P A;  3I55 3;  3OXA A;  3BND A;  4WFO A;  4HM2 B;  4EV5 A;  1HYF A;  3NBJ A;  1LXE A;  3JUN A;  1RTU A;  3BB9 A;  2LQV A;  1FA3 A;  3HOH A;  4N3V A;  1CEW I;  1X1Y A;  2GBX B;  1DVC A;  2P0X A;  4HM3 B;  2JQ5 A;  2V1L A;  1BSD A;  3SYU A;  4NRE A;  1GY6 A;  1A90 A;  3FH1 A;  1ULJ B;  1I70 A;  3DM8 A;  3URP A;  5JPU A;  1RGL A;  2XSO B;  5LC6 A;  1B2U A;  1GOY A;  1JRQ A;  2XFT A;  1MGR A;  3B7C A;  3HI7 A;  1S72 3;  1M90 4;  2JDI H;  6GSP A;  3NV0 B;  2CC3 A;  4K1U A;  3PGB A;  1JN5 B;  2F56 A;  3DGM A;  3EE1 A;  4HKV B;  1FGQ A;  4WP5 A;  1AR0 A;  5IEO A;  2CWT A;  3MHE A;  3NBR A;  1W5Z A;  5LC7 A;  2XR8 B;  1BSA A;  1BSC A;  2RGQ A;  3D4A A;  1RMS A;  4FR9 A;  1D6Z A;  1RGG A;  5FGO A;  5JBS A;  2A15 A;  3MPH A;  3AGN A;  4AEQ A;  2QEX 3;  2HMM B;  4XDV A;  2SBL A;  5D83 A;  2MC8 A;  2WGO A;  1Q7H A;  2XGL A;  1JJ2 2;  1UDI I;  1E97 A;  1LRA A;  1GSP A;  1KD1 4;  1MOL A;  1KWI A;  1K73 4;  1CQS A;  1I0V A;  2YX9 A;  4L7K A;  4KFD A;  2D1W A;  1I3I A;  4O2H A;  1LNI A;  1QAF A;  2H0G A;  4MJD A;  4CJN A;  3ZG5 A;  3KII A;  1FZU A;  4ZM8 A;  2F99 A;  4XB5 A;  2CWV A;  2OOV C;  5FW5 A;  3GZR A;  2IA7 A;  2E2U A;  4H3U A;  4KFE A;  3V99 A;  2XGN A;  3LZA A;  4R80 A;  3CCQ 3;  1NNV A;  4O02 B;  3F8X A;  3UL5 A;  1TIJ A;  1R4C A;  2Z7A A;  3MSO A;  1WTH A;  6STD A;  5M19 A;  7GSP A;  1O7P B;  3OW2 2;  1I2F A;  1WMP A;  3O8Y A;  4ORL A;  4EW5 A;  3BNE A;  3G8Z A;  1E3R A;  1Z1S A;  1GD4 A;  1BNE A;  1RCL A;  4RNZ A;  1VQ5 3;  3FF2 A;  3G16 A;  1W6G A;  4R4K A;  5I97 A;  4BU4 A;  1RSN A;  4MMZ B;  4LSO A;  4N6L A;  5M18 A;  1FUS A;  1W02 A;  3WOD G;  1TUH A;  5KP1 A;  5IG4 A;  4PEJ A;  1RJO A;  1AVL A;  3AHS A;  2YFL B;  1FUT A;  3FGY A;  1VQ4 3;  3Q90 A;  1T2H A;  1W7C A;  1AQZ A;  1N5P A;  2GU1 A;  3GAX A;  3K7C A;  2CH9 A;  1VQN 3;  4Q53 A;  2W03 A;  5CK6 A;  2OQE C;  1BVI A;  2O9U X;  2KF3 A;  3X3Y A;  1C54 A;  3MYT A;  1DVD A;  3S5C A;  1IQ8 A;  4CDL A;  2GSP A;  4MMX B;  1LOW A;  3BNB A;  4MEI A;  4JRF A;  1JB2 A;  1OH0 A;  2GEX A;  3WA2 X;  2CFG A;  4MMY B;  1B21 A;  2XSH B;  2CX0 A;  4XBY A;  3CC4 3;  1IV9 A;  1A2K A;  3TDG A;  3QK9 A;  1VQ6 3;  4IIA A;  1BSB A;  1BNJ A;  1T5Y A;  1WQL B;  3FG3 A;  1IYY A;  1O7W B;  4FCJ A;  1IU7 A;  4FCM A;  1BIR A;  2CG0 A;  1K41 A;  9RNT A;  3MG3 A;  3N54 B;  2CWU A;  2Q07 A;  2STD A;  1OGX A;  3MG1 A;  3SED A;  2PZV A;  1CYU A;  1I2E A;  1GY7 A;  1JNQ A;  3DGN A;  1LVN A;  4EBG A;  3SVA A;  3WDG B;  3AMO A;  3ZFZ A;  3JVC A;  3OX9 A;  4IT7 A;  1W00 A;  5KP3 A;  4BL2 A;  2KAA A;  1RNB A;  3UJM A;  1YVS A;  1TP6 A;  1A2V A;  1JKG B;  4O8S A;  2BMO B;  1M9G A;  1BAN A;  3OWY A;  4HZ9 B;  1BUQ A;  2GU3 A;  3CNM A;  1G02 A;  3GZY B;  4LMI A;  3NQZ A;  5AEU B;  2F86 B;  2ZL8 A;  3EHC A;  1STF I;  1VQ7 3;  4FMA A;  1JZD A;  4K1V A;  1CH0 A;  3GZB A;  3GZX B;  1W2B 2;  1LQM B;  2P38 A;  2BU4 A;  2B24 B;  3KSP A;  5IF6 A;  2L1S A;  3EC9 A;  4N6O B;  3CCV 3;  1AV4 A;  1MWR A;  5BIR A;  3F9S A;  3PZW A;  1UGI A;  3D9R A;  1AVK A;  2XEP A;  1TRP A;  4HOH A;  3RDE A;  2WO0 A;  2CX1 A;  3DXO A;  3ZG0 A;  1K9M 4;  1UGH I;  5A0O B;  1SAR A;  5AIH A;  4XM4 A;  6RNT A;  3NV0 A;  1BGS A;  3CPW 2;  3Q3F A;  2O3O A;  1RRH A;  1X1W A;  1N8Q A;  1Q40 B;  1JN5 A;  3EJV A;  3DGO A;  2HMN B;  3KFQ C;  7RNT A;  3EQQ B;  2CK3 H;  1X1U A;  1VQK 3;  4WYK B;  1WMO A;  1BRI A;  4H61 A;  1RCK A;  3K63 A;  1J2B A;  1NU3 A;  3FCS B;  1RLS A;  1EUI C;  1Q42 A;  5G1K A;  2SAR A;  2BHM A;  3PXM A;  3HII A;  1EQK A;  1EG9 B;  4KZ1 A;  4QWT A;  3HIG A;  1B3S A;  1GMP A;  1BRG A;  2AAD A;  2C4B A;  3FLJ A;  5CXO A;  5DRE A;  3SOY A;  1BNR A;  3CCJ 3;  4HJL B;  1K28 A;  2OCT A;  5AYR B;  4N6T A;  1BNS A;  1V57 A;  2KRT A;  1FGO A;  4OK0 A;  2KF4 A;  5BU4 A;  3BU4 A;  1NWW A;  3NM2 A;  1B2Z A;  2H0I A;  1RN1 A;  1L5G B;  2CFD A;  3CU3 A;  5IER A;  3WR2 A;  1QJG A;  3ECF A;  2YFI B;  2W56 B;  3GSP A;  5EVH A;  3UB1 A;  4BTW A;  5CF1 A;  2QIY A;  1SII A;  3DGY A;  3V98 A;  2P0M A;  1JB4 A;  4WWU C;  4HYZ A;  2IMJ A;  1MWT A;  3F7X A;  4HZB B;  2K0M A;  3SXX A;  3EBY A;  3DUK A;  1OHS A;  1OUN A;  1UCL A;  2BIR A;  3OV4 A;  5AIG A;  4CCV A;  3D5G A;  4GSP A;  4HM7 B;  1GD3 A;  2OWP A;  3EX9 A;  2KXG A;  4LEH A;  3FSD A;  1RGF A;  2F4Y A;  3X3X A;  1PYL A;  3MG2 A;  3S28 A;  3OWS A;  1R4Y A;  1TJD A;  5HOH A;  3D3L A;  2RSX A;  3CME 3;  1JBT A;  1U8C B;  2P05 A;  1N9E A;  1QMA A;  1RGA A;  1MWS A;  4LZI A;  5G1L A;  1IDP A;  2WOH A;  1WMN A;  3X3Z A;  3PYJ A;  3GWR A;  1IK3 A;  3CCR 3;  1VQ9 3;  8RNT A;  3S27 A;  2J8X B;  3WHO A;  5KP4 A;  2BMR B;  5AIF A;  1I2G A;  2W9Q A;  5EEO A;  2CHC A;  1BRN L;  3LTA A;  5IG3 A;  1BUJ A;  1LOY A;  1LQG C;  1DMN A;  1KSI A;  5AEW B;  1BRK A;  3RNT A;  1VQP 3;  1ROV A;  3FKA A;  3NHX A;  3NUV A;  4G1M B;  3CXC 2;  1IVW A;  5IEP A;  5D82 A;  2Z76 A;  1UCJ A;  2W9P A;  3AGO A;  4XBT A;  3X41 A;  1N8R 4;  1D6Y A;  2H0H A;  5BVB A;  1YHQ 3;  2HMK B;  2FNQ A;  1Q81 4;  1JB5 A;  2F98 A;  3RGA A;  3U1W A;  3Q1C A;  2R41 A;  1UUG B;  3WOE B;  1V58 A;  1DET A;  1VQO 3;  4X2H A;  1FGM A;  3F7S A;  1B2S A;  2R4I A;  2ML5 A;  1VQL 3;  4AKY A;  3X40 A;  4TX4 A;  4HAA A;  1RGC A;  3KKG A;  5CLK A;  3VSY A;  1TFK A;  2IY2 A;  3A5E A;  1QAL A;  5IG5 A;  2CFK A;  1T2I A;  2UX0 A;  1MNL A;  1YGE A;  3KZT A;  3H3H A;  3B4O A;  1EA2 A;  2E2T A;  3S29 A;  1JKG A;  1O7M B;  4FMB A;  3CCE 3;  4KFF A;  2D42 A;  4KVH A;  4K90 B;  3D5I A;  4O3V A;  3CCM 3;  1ZS7 A;  4FMD A;  4BIR A;  1CYV A;  4J8T A;  4I5Q A;  4HM8 B;  3CCL 3;  3MKI A;  3PCR A;  1ULI B;  3K9M C;  1PY3 A;  1WNH A;  2XRX B;  3EN1 B;  2UGI A;  3UNL A;  1OPY A;  1QVG 2;  1MGW A;  1UW1 A;  3BLZ A;  1ZO2 A;  1F8N A;  1UI8 A;  2W2C A;  4HM5 B;  4K61 A;  3RGR A;  1JV2 B;  1STD A;  1HZ1 A;  1DE3 A;  1Q7Y 4;  2XH9 A;  1PFP A;  1BSE A;  4R9L A;  3IMA B;  3V92 A;  1IVU A;  3CCS 3;  4I4K A;  1DMQ A;  1SQW A;  1YVB I;  2CIU A;  1K8A 4;  4LYL B;  4HBR A;  4N6N B;  1QAK A;  3K5T A;  1RHL A;  2W04 A;  5HGR A;  3G6E 3;  1IT7 A;  1Q40 A;  1OHP A;  1YJ9 3;  1GOV A;  5AI1 A;  3D79 A;  3KE7 A;  1HKX A;  4STD A;  4WYK A;  4IPB A;  2OOV A;  1U5O A;  2Y73 A;  2OTL 3;  2OTJ 3;  1NDO B;  1IVX A;  3G4S 3;  1YI2 3;  1O7N B;  3J7Y d;  1Q9E A;  3CNX A;  3LML A;  3HX8 A;  4GHO A;  4GL6 A;  1LOX A;  4J5G A;  2BO9 B;  1GY5 A;  4L8O A;  1FUW A;  5DRV A;  4U13 A;  4DKI A;  1N9J A;  3I56 3;  3LYG A;  7STD A;  2INX A;  1IVV A;  1OF5 B;  1UCK A;  1HU9 A;  2WOF A;  4KT3 B;  3SLU A;  5M1A A;  3LTC A;  2HMJ B;  3IPT A;  1LNH A;  4N6V 0;  2IUJ A;  3JUQ A;  1BRS A;  3FG4 A;  4N6U A;  1AY7 A;  1BNG A;  3JUP A;  3LOY A;  4LGQ A;  4EC6 A;  1PU4 A;  2HOH A;  3FG1 A;  1YJN 3;  3F8H A;  3EN8 A;  2Z77 A;  2W56 A;  3HZP A;  3LH4 A;  4AKZ A;  2KF6 A;  3STD A;  2CFW A;  4HM1 B;  2L4V A;  1NB3 I;  1GMQ A;  5CF2 A;  3JUO A;  2K54 A;  1G0T A;  3KCH A;  1BNI A;  1B20 A;  1FW7 A;  1G96 A;  1Q82 4;  1M1X B;  1BOX A;  1ISK A;  1BNF A;  2BT3 A;  2OQE A;  3CPO A;  1YJW 3;  1FYS A;  5ELJ A;  3L0R A;  3ALA A;  3EF8 A;  3X42 A;  1RGK A;  2FXT A;  1OGZ A;  1RNT A;  3N9H A;  1B2X A;  2MF7 A;  1Q86 4;  3ROB A;  4FMC A;  1EKM A;  4R9K A;  4J5K A;  3VF1 A;  1JBR A;  2RBI A;  1X1X A;  2FGT A;  2KCD A;  2GEY A;  3IJE B;  2P09 A;  2ZDJ A;  4NPB A;  3HK4 A;  2PNC A;  3CD6 3;  3BNC A;  1O7G B;  2BMQ B;  3LT9 A;  3VGN A;  4JF8 A;  2ZHX B;  3K0Z A;  3LTB A;  3NXJ A;  8CHO A;  2ZA4 A;  2XFS A;  2UUG C;  3WMD A;  1SJW A;  2W6J H;  1QVF 2;  1DMM A;  1C7H A;  1O7H B;  3LT8 A;  2KF5 A;  1RRL A;  4OVM A;  1BU4 A;  4L8P A;  2AAE A;  2M7O A;  1BAO A;  3B8L A;  4BTY A;  4EV2 A;  1DYU A;  2F5W A;  1VQQ A;  2ML6 A;  2RNT A;  3DGL A;  5AII A;  3EBT A;  3CMA 3;  1YIJ 3;  3UL6 A;  4EYC A;  1EEJ A;  1FGR A;  2W0Q A;  4BL3 A;  2GBW B;  1Y4K A;  1W6C A;  5D81 A;  1W2Z A;  4GB5 A;  5AYS C;  1NJI 4;  5TGN A;  1IT8 A;  2E2V A;  2IYJ A;  3DY5 A;  1GMR A;  4RNT A;  2IUK A;  3NX0 A;  4HVN A;  3S67 A;  3WOF B;  3ER7 A;  4HM4 B;  1RN4 A;  3F14 A;  1LOV A;  1T3B A;  1ASK A;  5G2G A;  2B1X B;  3H51 A;  2C10 A;  1RGH A;  5JPP A;  5BXQ A;  1ROA A;  3F40 A;  1OAC A;  3FZW A;  1RDS A;  3OWU A;  1ZGX A;  4ILF A;  1SIH A;  3NBB A;  5EQL A;  4CPK A;  1YNV X;  1YGW A;  3M8C A;  1US1 A;  2CFL A;  1SPU A;  4RBN A;  3PCS A;  1D6U A;  1ZX2 A;  3PS8 A;  1YIT 3;  1VZZ A;  4WHA A;  1A67 A;  1W4N A;  1VQ8 3;  1N5H A;  3G0K A;  4J9A A;  4R1K A;  1M1K 4;  2C11 A;  2RCD A;  4N6M A;  1FGT A;  3DMC A;  5STD A;  3GRD A;  3U97 A;  4BTX A;  2QA4 3;  4RZM A;  4XBX A;  4RNY A;  1GOU A;  1TU5 A;  1VQM 3;  1UUW B;  1S5A A;  3SOA A;  1RGE A;  3CC7 3;  3T0U A;  1KQS 2;  4HM6 B;  2Z6B A;  1OHO A;  2LYX A;  5IW9 A;  2Y74 A;  3NM7 A;  1GS3 A;  5ELU A;  1UI7 A;  4X2O A;  2BNG A;  2CG1 A;  1E3V A;  3B4P A;  5GSP A;  4XDW A;  1W6Y A;  5IEN A;  1B2M A;  2CW9 A;  3WA3 A;  3MWZ A;  2YFJ B;  3I0Y A;  4EXR A;  3CC2 3;  3A76 A;  1RN7 A;  3NQY A;  1V74 A;  3SX1 A;  1RKY A;  1TFO A;  5IG0 A;  2QGU A;  3DZL A;  3T8N A;  2F5M A;  2XF3 A;  3E99 A;  3EB8 A;  1OCV A;  5RNT A;  1BRJ A;  1MWU A;  1IQX A;  3JUM A;  3LTD A;  1IQY A;  3G71 3;  1NB5 I;  3QRD A;  3CCU 3;  4OUQ A;  1TRQ A;  1JBS A;  1GYB A;  3KN4 A;  1I8V A;  2CKF B;  4HM0 B;  1BRH A;  1UUV B;  2HMO B;  3AHW A;  1NO3 A;  2RFR A;  2K3D A;  1IV7 A;  2WGQ A;  1B27 A;  1I3F A;  1W01 A;  3FF0 A;  3AMO B; 
#chains in the Genus database with same CATH homology
 1BNI A;  1B20 A;  1FW7 A;  1RGA A;  1TTO A;  1BSB A;  1BOX A;  1I0X A;  1BNJ A;  3DH2 A;  1BNF A;  1UCI A;  1IYY A;  1FYS A;  3BIR A;  1A2P A;  8RNT A;  1RGK A;  1BIR A;  1RNT A;  3WHO A;  9RNT A;  1B2X A;  1I2G A;  1HYF A;  1BRN L;  1BUJ A;  1LOY A;  1RTU A;  4J5K A;  1I2E A;  1JBR A;  2RBI A;  1BRK A;  3RNT A;  3HOH A;  1X1X A;  1X1Y A;  2KAA A;  1RNB A;  1UCJ A;  1YVS A;  3AGO A;  1BSD A;  3SYU A;  1I70 A;  1BAN A;  3URP A;  1RGL A;  2ZA4 A;  1G02 A;  1B2U A;  1DET A;  1GOY A;  1MGR A;  1B2S A;  1CH0 A;  2KF5 A;  6GSP A;  1BU4 A;  2AAE A;  2BU4 A;  4HAA A;  1RGC A;  2F56 A;  1BAO A;  3A5E A;  2F5W A;  2RNT A;  5BIR A;  1T2I A;  1BSA A;  1BSC A;  1TRP A;  3D4A A;  1RMS A;  4HOH A;  1RGG A;  3AGN A;  1SAR A;  3D5I A;  4BIR A;  6RNT A;  1BGS A;  1GMR A;  4RNT A;  1LRA A;  1PY3 A;  1GSP A;  3Q3F A;  1X1W A;  1MGW A;  1I0V A;  1RN4 A;  1LOV A;  1I3I A;  7RNT A;  1LNI A;  1X1U A;  1FZU A;  1BRI A;  1HZ1 A;  1RCK A;  1RGH A;  1DE3 A;  1RLS A;  1RDS A;  1ZGX A;  2SAR A;  1BSE A;  1YNV X;  1YGW A;  1B3S A;  1GMP A;  1BRG A;  2AAD A;  2C4B A;  1BNR A;  7GSP A;  1I2F A;  1RHL A;  1BNS A;  1GOU A;  1BNE A;  1GOV A;  1RCL A;  2KF4 A;  3BU4 A;  5BU4 A;  1RGE A;  1B2Z A;  1RN1 A;  4BU4 A;  1RSN A;  3WR2 A;  1FUS A;  3GSP A;  1Q9E A;  3DGY A;  4GHO A;  4J5G A;  5GSP A;  3AHS A;  1B2M A;  1FUT A;  1UCL A;  1T2H A;  2BIR A;  1AQZ A;  1UCK A;  3D5G A;  4GSP A;  1BVI A;  2F5M A;  1BRS A;  5RNT A;  1AY7 A;  1BNG A;  1BRJ A;  1RGF A;  2KF3 A;  2HOH A;  1C54 A;  2F4Y A;  1PYL A;  1TRQ A;  1JBS A;  1I8V A;  2GSP A;  1LOW A;  2KF6 A;  1BRH A;  1R4Y A;  5HOH A;  3AHW A;  1GMQ A;  1JBT A;  1B27 A;  1B21 A;  1I3F A;  3KCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...