1BNEA

Barnase a43c/s80c disulfide mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLCDVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTCGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Disulfide mutants of barnase. I: Changes in stability and structure assessed by biophysical methods and X-ray crystallography.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 32
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bneA00
1RSNA 5HOHA 1I2FA 1RHLA 2HOHA 5RNTA 1R4YA 1RGLA 1RLSA 1RGEA 1I70A 2RBIA 1DE3A 1C54A 4J5GA 1RGAA 1G02A 1B20A 4RNTA 1LOYA 1BRKA 1GOVA 1RNBA 1BNFA 3D5IA 1ZGXA 1JBRA 1TTOA 1RGFA 1B2XA 1YVSA 6RNTA 1PYLA 3RNTA 4HAAA 1B2MA 1BNSA 1RMSA 2F5MA 2KF3A 1B21A 1RN1A 1YGWA 1B2ZA 2BU4A 1BNEA 3HOHA 1AY7A 1SARA 3DH2A 3BU4A 2BIRA 1RNTA 4HOHA 1GOYA 1BRSA 1LNIA 1X1UA 1JBSA 1PY3A 1BOXA 1Q9EA 1HZ1A 1B27A 1FYSA 1T2HA 1I8VA 1AQZA 3GSPA 2ZA4A 1RCKA 1RGKA 1DETA 1RGGA 1RGHA 1BUJA 3AHSA 3Q3FA 1UCJA 2F4YA 2KF5A 1IYYA 3AGOA 1LRAA 2AADA 3D4AA 2KF4A 2C4BA 4GHOA 1YNVX 4BU4A 1MGRA 1FZUA 2F56A 2KAAA 4BIRA 1BNJA 1BRNL 3AHWA 5BIRA 1X1XA 1BGSA 7RNTA 1B3SA 2F5WA 3KCHA 1FW7A 1BRGA 4J5KA 1TRPA 1CH0A 6GSPA 1LOVA 1UCLA 1GMRA 3A5EA 1UCIA 1JBTA 1TRQA 4GSPA 8RNTA 1GSPA 1BSEA 1RCLA 3D5GA 1B2UA 1BNGA 1I0VA 5BU4A 1BNRA 1RDSA 1BSBA 1I2GA 1RN4A 1BVIA 1GOUA 1HYFA 3URPA 1BIRA 1X1WA 1BSDA 2AAEA 3WR2A 3AGNA 1I3FA 1X1YA 1I0XA 2KF6A 1B2SA 1I3IA 1T2IA 3BIRA 1BSAA 2GSPA 3WHOA 1BRIA 1FUSA 2RNTA 1BNIA 1GMPA 7GSPA 9RNTA 1BU4A 1BSCA 1FUTA 1BRHA 1BAOA 1MGWA 1I2EA 3SYUA 1RTUA 3DGYA 1BRJA 1UCKA 1BANA 1RGCA 1A2PA 2SARA 5GSPA 1GMQA 1LOWA
chains in the Genus database with same CATH superfamily
2W9PA 2MC8A 1MWTA 4H61A 2HOHA 1JN5B 5EQLA 2UGIA 4EV5A 4HM8B 3RGAA 4WFOA 1VZZA 3N54B 1RGEA 1A90A 1WMOA 1C7HA 4FMAA 5M1AA 3EQQB 1G96A 1V74A 4FR9A 3B7CA 3UB1A 2D1WA 2V1LA 1QMAA 3FF0A 4HM5B 2FNQA 3S67A 1YJN3 2XR8B 1A2KA 3WDGB 3D5IA 4J8TA 2XF3A 3VGNA 4FCMA 4OK0A 1STDA 1TTOA 2P38A 5HGRA 5BVBA 3RDEA 1LOXA 1YI23 1B2XA 3PCRA 4J9AA 3X3ZA 4JRFA 3RNTA 3CCE3 2H0HA 2WOFA 1BUQA 2GBWB 3UL5A 2ZDJA 4IIAA 3CMA3 1MNLA 1IK3A 1WMPA 3NM7A 3IJEB 2YX9A 2CX1A 2IY2A 1ZS7A 3ZG5A 3D3LA 3ZFZA 3EC9A 4KFFA 4HM7B 1IQ8A 1FGQA 5BXQA 2BIRA 1IV7A 1CYVA 1GOYA 3SLUA 5JBSA 4HM1B 5D82A 3CC73 4WP5A 3CCJ3 4HZ9B 2ZL8A 1TUHA 1RRHA 1PY3A 3ECFA 3DGMA 3FCSB 1I8VA 1AQZA 1UI7A 2GEXA 4EV2A 2XFSA 3NV0A 1IVVA 1RGGA 2CHCA 1UI8A 1RGHA 2STDA 1VQL3 4RNZA 3MG3A 1O7HB 2FXTA 3SOYA 3J7Yd 1NB5I 3AGOA 1VQO3 1W5ZA 5AIGA 5G1LA 1NWWA 2ML6A 2OQEC 4HVNA 4HJLB 3D4AA 2KF4A 4GHOA 4EXRA 1O7WB 4BL2A 2KAAA 3LTCA 2SBLA 3EBYA 1BGSA 1B3SA 3KCHA 1R4CA 3BLZA 1OHPA 3EN1B 4J5KA 3EHCA 2L4VA 1UCLA 2W03A 1GMRA 2XSOB 1JN5A 4FMDA 4HM6B 4I4KA 3DM8A 2ZHXB 1GSPA 2Z6BA 1BSEA 1U8CB 3CNMA 4N6NB 1Q814 2OWPA 1VQ83 1B2UA 3CPW2 1DMQA 1M1XB 1RN7A 2W2CA 1W02A 3KIIA 1RDSA 1SPUA 3S29A 1I2GA 4X2HA 1W6CA 1GOUA 1MWUA 3OWUA 1UGIA 3EBTA 3DY5A 3LXUX 3PCSA 1BSDA 3M8CA 5AI1A 2H0IA 2GU3A 5KP3A 1I0XA 1CEWI 1B2SA 1IDPA 1T2IA 4ORLA 1BSAA 3KE7A 4N3VA 4AKZA 1Y4KA 3STDA 3G713 1FUSA 2CC3A 1BNIA 4KT3B 1GMPA 2KRTA 1IQXA 2OTL3 3HZPA 7GSPA 3QK9A 4MJDA 4L7KA 2K54A 2W0QA 1BSCA 1FUTA 3MG1A 3OXAA 3OX9A 1BAOA 5CK6A 1FA3A 4MMYB 1HU9A 4U13A 1WMNA 1OH0A 3K5TA 4N6OB 5IENA 5EVHA 4BTWA 4XBTA 5GSPA 2JDIH 5IW9A 4PEJA 3E99A 2P0XA 2GEYA 1RNTA 2KF5A 3DXOA 3F14A 1LOWA 2B1XB 1VQ63 1J2BA 5AEWB 5HOHA 1VQK3 3LMLA 1R4YA 2XH9A 4DKIA 1E3VA 3UJMA 3SX1A 3CCM3 4NREA 1AR0A 1QJGA 1S5AA 1JRQA 4IPBA 1GY5A 4J5GA 1W00A 3BNBA 1C54A 1G02A 1B20A 1RJOA 2YFLB 1BRKA 2BO9B 3F8HA 3H51A 4GL6A 2B24B 3F40A 1ZGXA 3CCQ3 2C11A 4ILFA 3IPTA 2H0GA 3N8BA 1RGFA 3X41A 3QRDA 3CCR3 2FGTA 2W6JH 4HAAA 1JB4A 4HYZA 2A15A 1VQN3 1BNSA 2F5MA 1GYBA 2CK3H 4N6LA 1B21A 5CXOA 5STDA 1UUGB 5AIIA 2XGLA 1T3BA 1N9EA 3NM2A 3CCL3 4O8SA 4CPKA 3HOHA 4R1KA 3WA2X 3FH1A 3CD63 3EJVA 1SARA 2C10A 1DVDA 5CLKA 4I5QA 1AV4A 1UDII 5IG0A 1IT7A 2HMOB 4HOHA 1TU5A 3L0RA 1QAKA 3JUPA 1KSIA 1X1UA 4K1UA 1JBSA 1Q9EA 3GZXB 2Z7AA 3S28A 1TFKA 3GRDA 3K63A 5IG3A 1AVKA 3LTDA 1EKMA 4R9KA 1RCKA 3UNLA 3NUVA 1O7NB 1GY7A 1UW1A 2CIUA 2HMNB 3MPHA 1IVXA 4TX4A 4O02B 1UCJA 3WMDA 3JUQA 3PS8A 1D6UA 1LRAA 3ER7A 1GD4A 2IUJA 2CG1A 4BIRA 1BRNL 3CC43 3NHXA 1FGOA 2QEX3 1CQSA 1K28A 3AHWA 1X1XA 1GY6A 1FW7A 2F5WA 2O9UX 6STDA 2CKFB 3HIGA 1BRGA 3OV4A 1TRPA 4HKVB 1CH0A 3V99A 6GSPA 3WA3A 3NXJA 1UCIA 1TFOA 3LT8A 4GB5A 4RNYA 3FF2A 4IT7A 2OTJ3 1IQYA 8RNTA 1E97A 2F86B 3WOFB 3CME3 1ISKA 3G8ZA 2E2VA 1KWIA 4XDVA 3IMAB 1BNGA 1IV9A 4FMCA 1JJ22 5AIHA 3BNEA 3KN4A 4EYCA 5A0OB 4N6V0 2CWTA 2RSXA 3EF8A 8CHOA 2BNGA 1A67A 3CNXA 3URPA 2HMMB 1W6YA 2AAEA 1WTHA 1X1WA 3D9RA 4RBNA 3Q90A 1OCVA 3KZTA 3FZWA 2OOVA 2HMKB 2KF6A 1EUIC 3I0YA 3OWYA 4EC6A 1Q42A 3BIRA 2GSPA 1N8QA 1VQQA 3V98A 4CDLA 2BHMA 1HKXA 2K0MA 3WHOA 5IEOA 5JPPA 2F98A 2RNTA 2XSHB 4MMZB 3K0ZA 1QVF2 2YFJB 2ML5A 1OF5A 1Q7Y4 3G4S3 1VQ53 1BU4A 1NNVA 2BMQB 2QIYA 1MGWA 1I2EA 2W56B 1M9GA 1ULIB 4N6MA 1V57A 3LT9A 1QALA 1A2PA 3JVCA 2Y73A 1OGXA 3EE1A 1PFPA 1Z1SA 4KVHA 1JNQA 2J8XB 3MSOA 1Q40B 1S723 5LC7A 3X42A 3S27A 1RSNA 2CX0A 1I2FA 1RHLA 1ROVA 3I553 5RNTA 1O7MB 1VQ43 4NPBA 4LZIA 1MWRA 1E3RA 1SQWA 1RLSA 1LNHA 1I70A 2RBIA 3HI7A 3JUOA 1ZX2A 2GXFA 3MG2A 2R41A 4N6UA 1W2ZA 3BNCA 1DYUA 1M904 4RNTA 1YVBI 2IYJA 3CCU3 1JZOA 1ULJB 5AYRB 5IERA 4O3VA 1RNBA 3JUNA 3A76A 2W9QA 3B4PA 3EB8A 2CFKA 1OPYA 3DGOA 4FCJA 2UUGC 5IF6A 1VQ93 1JBRA 1K9M4 3BNDA 3FGYA 1JB2A 3LOYA 1QAFA 1NDOB 2JQ5A 3FLJA 3O8YA 1VQP3 5FGOA 3H3HA 3WODG 5G1KA 3LTAA 3EX9A 4O2HA 1RMSA 4LSOA 1OHOA 1RN1A 1CYUA 4G1MB 1YGWA 1B2ZA 1O7PB 2P05A 1YJW3 2BU4A 1AY7A 2Z77A 3DH2A 1EEJA 1V58A 5AEUB 4R9LA 3UL6A 3KSED 1SJWA 2IA7A 1FGRA 2IUKA 4XBYA 4XDWA 4JF8A 2BT3A 1BRSA 1LNIA 1TP6A 3SXXA 3V92A 3PGBA 2GBXB 2CWVA 1BOXA 4H3UA 1HZ1A 1NU3A 1FYSA 1Q824 2RGQA 2CWUA 2ZA4A 3D79A 3DGNA 1UUVB 2RFRA 1RGKA 1DETA 3SVAA 1EA2A 3K7CA 3OW22 1MWSA 4WWUC 4HZBB 1IYYA 2W56A 3NQYA 1W2B2 1K734 2HMLB 3SOAA 2AADA 4HM4B 2C4BA 1MGRA 1KC84 2XEPA 2P0MA 2XGNA 5BIRA 1ASKA 1WQLB 1Q40A 1JV2B 1OF5B 3Q2PA 3EN8A 1W4NA 3FKAA 1LXEA 5CF2A 1LOVA 3GWRA 1OUNA 3HX8A 5JPUA 3A5EA 3B8LA 5FW5A 1YJ93 2Y74A 1JBTA 1JZDA 3DUKA 3CC23 5DRVA 1YGEA 4GSPA 2GU1A 3I563 1PU4A 1VQM3 2CH9A 3T8NA 4STDA 1IVWA 2LQVA 1FGMA 1FGTA 2Z76A 4WYKB 2LYXA 4X2OA 5IEPA 3U97A 4BL3A 1BNRA 2CW9A 1BSBA 2XFTA 4HM2B 3DGLA 1G0TA 3NQZA 1RN4A 4HM0B 4ZM8A 2QA43 5KP4A 1HYFA 2OQEA 3U1WA 3ROBA 3T8UA 3WR2A 2E2UA 2RCDA 1ROAA 1X1YA 1I3IA 2F99A 1YIT3 2O3OA 1D6YA 1BRIA 4NHFA 3GZBA 1T5YA 2WO0A 4L8OA 3N9HA 1KQS2 1W01A 2BMRB 4Q53A 3G16A 3F8XA 1RTUA 1BRJA 4LYLB 1IVUA 2INXA 3G6E3 1EQKA 1BANA 3X3YA 5M19A 1RGCA 3B4OA 1LVNA 3AMOB 3VSYA 3TDGA 3LYGA 4CCVA 3CPOA 3S5CA 4R80A 3HIIA 1GMQA 1PYLA 1N5HA 3MHEA 1W6GA 3CCS3 1K8A4 1NJI4 5EEOA 3DMCA 1RGLA 1TIJA 1D6ZA 1N9JA 3NBRA 3GAXA 5TGNA 1DE3A 1F8NA 1RGAA 3CU3A 2D42A 1JKGA 2K3DA 1O7GB 1LOYA 2CG0A 1GOVA 4WHAA 1BNFA 1U5OA 1JB5A 1N8R4 3KFQC 1DMMA 1VQ73 2YFIB 1YVSA 6RNTA 5ELUA 3NBBA 3NX0A 1RRLA 1OGZA 3DZLA 3GZYB 1B2MA 4L8PA 2MF7A 1IT8A 2KF3A 3FG3A 4WYKA 4XBXA 2WGQA 1N5PA 2R4IA 2W04A 3ALAA 3JUMA 5IG4A 3PZWA 1BNEA 4OVMA 3BU4A 1A2VA 3X40A 2Q07A 1L5GB 2BMOB 4LEHA 1EG9B 1LQMB 4EBGA 1YIJ3 1YHQ3 4MMXB 3WOEB 1UGHI 4EW5A 3MWZA 4XM4A 5G2GA 1B27A 1T2HA 3GSPA 1Q864 4FMBA 4KZ1A 1NB3I 1RKYA 4CJNA 1ZO2A 3PXMA 2UX0A 4RZMA 1BUJA 2WOHA 3AHSA 3Q3FA 2F4YA 2QGUA 2L1SA 1SIHA 1OACA 2I9WA 1OHSA 3CCV3 1W7CA 1IU7A 1YNVX 4BU4A 2KCDA 1Q7HA 1FZUA 1US1A 2F56A 2OOVC 1BNJA 1DMNA 3AMOA 3F7SA 3PYJA 3CXC2 1FUWA 7RNTA 5KP1A 4OUQA 4K61A 1STFI 3F7XA 7STDA 1AVLA 1MOLA 1TRQA 2CFLA 3G0KA 1LQGC 4BTYA 1TJDA 2HMJB 4MEIA 4AEQA 5DREA 4QWTA 3X3XA 1KD14 3KKGA 2CFGA 1M1K4 1RCLA 3D5GA 1I0VA 3MKIA 3ZG0A 2PNCA 4K1VA 5BU4A 3MYTA 1QVG2 2XRXB 3FSDA 4LMIA 5D81A 1GS3A 3RGRA 3NBJA 3GZRA 4R4KA 1BVIA 1DVCA 3K9MC 3T0UA 1K41A 3Q1CA 1BIRA 3LH4A 4LGQA 5LC6A 3AGNA 1I3FA 4AKYA 3FG1A 2KXGA 2OCTA 1JKGB 2IMJA 3BB9A 2PZVA 5ELJA 2CFDA 4K90B 4KFDA 3VF1A 1NO3A 5IG5A 3OWSA 2P09A 4HM3B 5AIFA 2CFWA 3NV0B 4FCZA 4KFEA 1UUWB 9RNTA 4BTXA 2WGOA 3SEDA 3KSPA 1BRHA 3F9SA 4N6TA 3SYUA 3DGYA 3LTBA 1UCKA 2M7OA 3HK4A 5D83A 1GD3A 1SIIA 5CF1A 5M18A 3LZAA 5I97A 3FG4A 2SARA 4XB5A 2E2TA 4HBRA 5AYSC 1WNHA
chains in the Genus database with same CATH topology
1RSNA 5HOHA 1I2FA 1RHLA 2HOHA 5RNTA 1R4YA 1RGLA 1RLSA 1RGEA 1I70A 2RBIA 1DE3A 1C54A 4J5GA 1RGAA 1G02A 1B20A 4RNTA 1LOYA 1BRKA 1GOVA 1RNBA 1BNFA 3D5IA 1ZGXA 1JBRA 1TTOA 1RGFA 1B2XA 1YVSA 6RNTA 1PYLA 3RNTA 4HAAA 1B2MA 1BNSA 1RMSA 2F5MA 2KF3A 1B21A 1RN1A 1YGWA 1B2ZA 2BU4A 1BNEA 3HOHA 1AY7A 1SARA 3DH2A 3BU4A 2BIRA 1RNTA 4HOHA 1GOYA 1BRSA 1LNIA 1X1UA 1JBSA 1PY3A 1BOXA 1Q9EA 1HZ1A 1B27A 1FYSA 1T2HA 1I8VA 1AQZA 3GSPA 2ZA4A 1RCKA 1RGKA 1DETA 1RGGA 1RGHA 1BUJA 3AHSA 3Q3FA 1UCJA 2F4YA 2KF5A 1IYYA 3AGOA 1LRAA 2AADA 3D4AA 2KF4A 2C4BA 4GHOA 1YNVX 4BU4A 1MGRA 1FZUA 2F56A 2KAAA 4BIRA 1BNJA 1BRNL 3AHWA 5BIRA 1X1XA 1BGSA 7RNTA 1B3SA 2F5WA 3KCHA 1FW7A 1BRGA 4J5KA 1TRPA 1CH0A 6GSPA 1LOVA 1UCLA 1GMRA 3A5EA 1UCIA 1JBTA 1TRQA 4GSPA 8RNTA 1GSPA 1BSEA 1RCLA 3D5GA 1B2UA 1BNGA 1I0VA 5BU4A 1BNRA 1RDSA 1BSBA 1I2GA 1RN4A 1BVIA 1GOUA 1HYFA 3URPA 1BIRA 1X1WA 1BSDA 2AAEA 3WR2A 3AGNA 1I3FA 1X1YA 1I0XA 2KF6A 1B2SA 1I3IA 1T2IA 3BIRA 1BSAA 2GSPA 3WHOA 1BRIA 1FUSA 2RNTA 1BNIA 1GMPA 7GSPA 9RNTA 1BU4A 1BSCA 1FUTA 1BRHA 1BAOA 1MGWA 1I2EA 3SYUA 1RTUA 3DGYA 1BRJA 1UCKA 1BANA 1RGCA 1A2PA 2SARA 5GSPA 1GMQA 1LOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RSN A;  5HOH A;  1I2F A;  1RHL A;  2HOH A;  5RNT A;  1R4Y A;  1RGL A;  1RLS A;  1RGE A;  1I70 A;  2RBI A;  1DE3 A;  1C54 A;  4J5G A;  1RGA A;  1G02 A;  1B20 A;  4RNT A;  1LOY A;  1BRK A;  1GOV A;  1RNB A;  1BNF A;  3D5I A;  1ZGX A;  1JBR A;  1TTO A;  1RGF A;  1B2X A;  1YVS A;  6RNT A;  1PYL A;  3RNT A;  4HAA A;  1B2M A;  1BNS A;  1RMS A;  2F5M A;  2KF3 A;  1B21 A;  1RN1 A;  1YGW A;  1B2Z A;  2BU4 A;  1BNE A;  3HOH A;  1AY7 A;  1SAR A;  3DH2 A;  3BU4 A;  2BIR A;  1RNT A;  4HOH A;  1GOY A;  1BRS A;  1LNI A;  1X1U A;  1JBS A;  1PY3 A;  1BOX A;  1Q9E A;  1HZ1 A;  1B27 A;  1FYS A;  1T2H A;  1I8V A;  1AQZ A;  3GSP A;  2ZA4 A;  1RCK A;  1RGK A;  1DET A;  1RGG A;  1RGH A;  1BUJ A;  3AHS A;  3Q3F A;  1UCJ A;  2F4Y A;  2KF5 A;  1IYY A;  3AGO A;  1LRA A;  2AAD A;  3D4A A;  2KF4 A;  2C4B A;  4GHO A;  1YNV X;  4BU4 A;  1MGR A;  1FZU A;  2F56 A;  2KAA A;  4BIR A;  1BNJ A;  1BRN L;  3AHW A;  5BIR A;  1X1X A;  1BGS A;  7RNT A;  1B3S A;  2F5W A;  3KCH A;  1FW7 A;  1BRG A;  4J5K A;  1TRP A;  1CH0 A;  6GSP A;  1LOV A;  1UCL A;  1GMR A;  3A5E A;  1UCI A;  1JBT A;  1TRQ A;  4GSP A;  8RNT A;  1GSP A;  1BSE A;  1RCL A;  3D5G A;  1B2U A;  1BNG A;  1I0V A;  5BU4 A;  1BNR A;  1RDS A;  1BSB A;  1I2G A;  1RN4 A;  1BVI A;  1GOU A;  1HYF A;  3URP A;  1BIR A;  1X1W A;  1BSD A;  2AAE A;  3WR2 A;  3AGN A;  1I3F A;  1X1Y A;  1I0X A;  2KF6 A;  1B2S A;  1I3I A;  1T2I A;  3BIR A;  1BSA A;  2GSP A;  3WHO A;  1BRI A;  1FUS A;  2RNT A;  1BNI A;  1GMP A;  7GSP A;  9RNT A;  1BU4 A;  1BSC A;  1FUT A;  1BRH A;  1BAO A;  1MGW A;  1I2E A;  3SYU A;  1RTU A;  3DGY A;  1BRJ A;  1UCK A;  1BAN A;  1RGC A;  1A2P A;  2SAR A;  5GSP A;  1GMQ A;  1LOW A; 
#chains in the Genus database with same CATH topology
 2W9P A;  2MC8 A;  1MWT A;  4H61 A;  2HOH A;  1JN5 B;  5EQL A;  2UGI A;  4EV5 A;  4HM8 B;  3RGA A;  4WFO A;  1VZZ A;  3N54 B;  1RGE A;  1A90 A;  1WMO A;  1C7H A;  4FMA A;  5M1A A;  3EQQ B;  1G96 A;  1V74 A;  4FR9 A;  3B7C A;  3UB1 A;  2D1W A;  2V1L A;  1QMA A;  3FF0 A;  4HM5 B;  2FNQ A;  3S67 A;  1YJN 3;  2XR8 B;  1A2K A;  3WDG B;  3D5I A;  4J8T A;  2XF3 A;  3VGN A;  4FCM A;  4OK0 A;  1STD A;  1TTO A;  2P38 A;  5HGR A;  5BVB A;  3RDE A;  1LOX A;  1YI2 3;  1B2X A;  3PCR A;  4J9A A;  3X3Z A;  4JRF A;  3RNT A;  3CCE 3;  2H0H A;  2WOF A;  1BUQ A;  2GBW B;  3UL5 A;  2ZDJ A;  4IIA A;  3CMA 3;  1MNL A;  1IK3 A;  1WMP A;  3NM7 A;  3IJE B;  2YX9 A;  2CX1 A;  2IY2 A;  1ZS7 A;  3ZG5 A;  3D3L A;  3ZFZ A;  3EC9 A;  4KFF A;  4HM7 B;  1IQ8 A;  1FGQ A;  5BXQ A;  2BIR A;  1IV7 A;  1CYV A;  1GOY A;  3SLU A;  5JBS A;  4HM1 B;  5D82 A;  3CC7 3;  4WP5 A;  3CCJ 3;  4HZ9 B;  2ZL8 A;  1TUH A;  1RRH A;  1PY3 A;  3ECF A;  3DGM A;  3FCS B;  1I8V A;  1AQZ A;  1UI7 A;  2GEX A;  4EV2 A;  2XFS A;  3NV0 A;  1IVV A;  1RGG A;  2CHC A;  1UI8 A;  1RGH A;  2STD A;  1VQL 3;  4RNZ A;  3MG3 A;  1O7H B;  2FXT A;  3SOY A;  3J7Y d;  1NB5 I;  3AGO A;  1VQO 3;  1W5Z A;  5AIG A;  5G1L A;  1NWW A;  2ML6 A;  2OQE C;  4HVN A;  4HJL B;  3D4A A;  2KF4 A;  4GHO A;  4EXR A;  1O7W B;  4BL2 A;  2KAA A;  3LTC A;  2SBL A;  3EBY A;  1BGS A;  1B3S A;  3KCH A;  1R4C A;  3BLZ A;  1OHP A;  3EN1 B;  4J5K A;  3EHC A;  2L4V A;  1UCL A;  2W03 A;  1GMR A;  2XSO B;  1JN5 A;  4FMD A;  4HM6 B;  4I4K A;  3DM8 A;  2ZHX B;  1GSP A;  2Z6B A;  1BSE A;  1U8C B;  3CNM A;  4N6N B;  1Q81 4;  2OWP A;  1VQ8 3;  1B2U A;  3CPW 2;  1DMQ A;  1M1X B;  1RN7 A;  2W2C A;  1W02 A;  3KII A;  1RDS A;  1SPU A;  3S29 A;  1I2G A;  4X2H A;  1W6C A;  1GOU A;  1MWU A;  3OWU A;  1UGI A;  3EBT A;  3DY5 A;  3LXU X;  3PCS A;  1BSD A;  3M8C A;  5AI1 A;  2H0I A;  2GU3 A;  5KP3 A;  1I0X A;  1CEW I;  1B2S A;  1IDP A;  1T2I A;  4ORL A;  1BSA A;  3KE7 A;  4N3V A;  4AKZ A;  1Y4K A;  3STD A;  3G71 3;  1FUS A;  2CC3 A;  1BNI A;  4KT3 B;  1GMP A;  2KRT A;  1IQX A;  2OTL 3;  3HZP A;  7GSP A;  3QK9 A;  4MJD A;  4L7K A;  2K54 A;  2W0Q A;  1BSC A;  1FUT A;  3MG1 A;  3OXA A;  3OX9 A;  1BAO A;  5CK6 A;  1FA3 A;  4MMY B;  1HU9 A;  4U13 A;  1WMN A;  1OH0 A;  3K5T A;  4N6O B;  5IEN A;  5EVH A;  4BTW A;  4XBT A;  5GSP A;  2JDI H;  5IW9 A;  4PEJ A;  3E99 A;  2P0X A;  2GEY A;  1RNT A;  2KF5 A;  3DXO A;  3F14 A;  1LOW A;  2B1X B;  1VQ6 3;  1J2B A;  5AEW B;  5HOH A;  1VQK 3;  3LML A;  1R4Y A;  2XH9 A;  4DKI A;  1E3V A;  3UJM A;  3SX1 A;  3CCM 3;  4NRE A;  1AR0 A;  1QJG A;  1S5A A;  1JRQ A;  4IPB A;  1GY5 A;  4J5G A;  1W00 A;  3BNB A;  1C54 A;  1G02 A;  1B20 A;  1RJO A;  2YFL B;  1BRK A;  2BO9 B;  3F8H A;  3H51 A;  4GL6 A;  2B24 B;  3F40 A;  1ZGX A;  3CCQ 3;  2C11 A;  4ILF A;  3IPT A;  2H0G A;  3N8B A;  1RGF A;  3X41 A;  3QRD A;  3CCR 3;  2FGT A;  2W6J H;  4HAA A;  1JB4 A;  4HYZ A;  2A15 A;  1VQN 3;  1BNS A;  2F5M A;  1GYB A;  2CK3 H;  4N6L A;  1B21 A;  5CXO A;  5STD A;  1UUG B;  5AII A;  2XGL A;  1T3B A;  1N9E A;  3NM2 A;  3CCL 3;  4O8S A;  4CPK A;  3HOH A;  4R1K A;  3WA2 X;  3FH1 A;  3CD6 3;  3EJV A;  1SAR A;  2C10 A;  1DVD A;  5CLK A;  4I5Q A;  1AV4 A;  1UDI I;  5IG0 A;  1IT7 A;  2HMO B;  4HOH A;  1TU5 A;  3L0R A;  1QAK A;  3JUP A;  1KSI A;  1X1U A;  4K1U A;  1JBS A;  1Q9E A;  3GZX B;  2Z7A A;  3S28 A;  1TFK A;  3GRD A;  3K63 A;  5IG3 A;  1AVK A;  3LTD A;  1EKM A;  4R9K A;  1RCK A;  3UNL A;  3NUV A;  1O7N B;  1GY7 A;  1UW1 A;  2CIU A;  2HMN B;  3MPH A;  1IVX A;  4TX4 A;  4O02 B;  1UCJ A;  3WMD A;  3JUQ A;  3PS8 A;  1D6U A;  1LRA A;  3ER7 A;  1GD4 A;  2IUJ A;  2CG1 A;  4BIR A;  1BRN L;  3CC4 3;  3NHX A;  1FGO A;  2QEX 3;  1CQS A;  1K28 A;  3AHW A;  1X1X A;  1GY6 A;  1FW7 A;  2F5W A;  2O9U X;  6STD A;  2CKF B;  3HIG A;  1BRG A;  3OV4 A;  1TRP A;  4HKV B;  1CH0 A;  3V99 A;  6GSP A;  3WA3 A;  3NXJ A;  1UCI A;  1TFO A;  3LT8 A;  4GB5 A;  4RNY A;  3FF2 A;  4IT7 A;  2OTJ 3;  1IQY A;  8RNT A;  1E97 A;  2F86 B;  3WOF B;  3CME 3;  1ISK A;  3G8Z A;  2E2V A;  1KWI A;  4XDV A;  3IMA B;  1BNG A;  1IV9 A;  4FMC A;  1JJ2 2;  5AIH A;  3BNE A;  3KN4 A;  4EYC A;  5A0O B;  4N6V 0;  2CWT A;  2RSX A;  3EF8 A;  8CHO A;  2BNG A;  1A67 A;  3CNX A;  3URP A;  2HMM B;  1W6Y A;  2AAE A;  1WTH A;  1X1W A;  3D9R A;  4RBN A;  3Q90 A;  1OCV A;  3KZT A;  3FZW A;  2OOV A;  2HMK B;  2KF6 A;  1EUI C;  3I0Y A;  3OWY A;  4EC6 A;  1Q42 A;  3BIR A;  2GSP A;  1N8Q A;  1VQQ A;  3V98 A;  4CDL A;  2BHM A;  1HKX A;  2K0M A;  3WHO A;  5IEO A;  5JPP A;  2F98 A;  2RNT A;  2XSH B;  4MMZ B;  3K0Z A;  1QVF 2;  2YFJ B;  2ML5 A;  1OF5 A;  1Q7Y 4;  3G4S 3;  1VQ5 3;  1BU4 A;  1NNV A;  2BMQ B;  2QIY A;  1MGW A;  1I2E A;  2W56 B;  1M9G A;  1ULI B;  4N6M A;  1V57 A;  3LT9 A;  1QAL A;  1A2P A;  3JVC A;  2Y73 A;  1OGX A;  3EE1 A;  1PFP A;  1Z1S A;  4KVH A;  1JNQ A;  2J8X B;  3MSO A;  1Q40 B;  1S72 3;  5LC7 A;  3X42 A;  3S27 A;  1RSN A;  2CX0 A;  1I2F A;  1RHL A;  1ROV A;  3I55 3;  5RNT A;  1O7M B;  1VQ4 3;  4NPB A;  4LZI A;  1MWR A;  1E3R A;  1SQW A;  1RLS A;  1LNH A;  1I70 A;  2RBI A;  3HI7 A;  3JUO A;  1ZX2 A;  2GXF A;  3MG2 A;  2R41 A;  4N6U A;  1W2Z A;  3BNC A;  1DYU A;  1M90 4;  4RNT A;  1YVB I;  2IYJ A;  3CCU 3;  1JZO A;  1ULJ B;  5AYR B;  5IER A;  4O3V A;  1RNB A;  3JUN A;  3A76 A;  2W9Q A;  3B4P A;  3EB8 A;  2CFK A;  1OPY A;  3DGO A;  4FCJ A;  2UUG C;  5IF6 A;  1VQ9 3;  1JBR A;  1K9M 4;  3BND A;  3FGY A;  1JB2 A;  3LOY A;  1QAF A;  1NDO B;  2JQ5 A;  3FLJ A;  3O8Y A;  1VQP 3;  5FGO A;  3H3H A;  3WOD G;  5G1K A;  3LTA A;  3EX9 A;  4O2H A;  1RMS A;  4LSO A;  1OHO A;  1RN1 A;  1CYU A;  4G1M B;  1YGW A;  1B2Z A;  1O7P B;  2P05 A;  1YJW 3;  2BU4 A;  1AY7 A;  2Z77 A;  3DH2 A;  1EEJ A;  1V58 A;  5AEU B;  4R9L A;  3UL6 A;  3KSE D;  1SJW A;  2IA7 A;  1FGR A;  2IUK A;  4XBY A;  4XDW A;  4JF8 A;  2BT3 A;  1BRS A;  1LNI A;  1TP6 A;  3SXX A;  3V92 A;  3PGB A;  2GBX B;  2CWV A;  1BOX A;  4H3U A;  1HZ1 A;  1NU3 A;  1FYS A;  1Q82 4;  2RGQ A;  2CWU A;  2ZA4 A;  3D79 A;  3DGN A;  1UUV B;  2RFR A;  1RGK A;  1DET A;  3SVA A;  1EA2 A;  3K7C A;  3OW2 2;  1MWS A;  4WWU C;  4HZB B;  1IYY A;  2W56 A;  3NQY A;  1W2B 2;  1K73 4;  2HML B;  3SOA A;  2AAD A;  4HM4 B;  2C4B A;  1MGR A;  1KC8 4;  2XEP A;  2P0M A;  2XGN A;  5BIR A;  1ASK A;  1WQL B;  1Q40 A;  1JV2 B;  1OF5 B;  3Q2P A;  3EN8 A;  1W4N A;  3FKA A;  1LXE A;  5CF2 A;  1LOV A;  3GWR A;  1OUN A;  3HX8 A;  5JPU A;  3A5E A;  3B8L A;  5FW5 A;  1YJ9 3;  2Y74 A;  1JBT A;  1JZD A;  3DUK A;  3CC2 3;  5DRV A;  1YGE A;  4GSP A;  2GU1 A;  3I56 3;  1PU4 A;  1VQM 3;  2CH9 A;  3T8N A;  4STD A;  1IVW A;  2LQV A;  1FGM A;  1FGT A;  2Z76 A;  4WYK B;  2LYX A;  4X2O A;  5IEP A;  3U97 A;  4BL3 A;  1BNR A;  2CW9 A;  1BSB A;  2XFT A;  4HM2 B;  3DGL A;  1G0T A;  3NQZ A;  1RN4 A;  4HM0 B;  4ZM8 A;  2QA4 3;  5KP4 A;  1HYF A;  2OQE A;  3U1W A;  3ROB A;  3T8U A;  3WR2 A;  2E2U A;  2RCD A;  1ROA A;  1X1Y A;  1I3I A;  2F99 A;  1YIT 3;  2O3O A;  1D6Y A;  1BRI A;  4NHF A;  3GZB A;  1T5Y A;  2WO0 A;  4L8O A;  3N9H A;  1KQS 2;  1W01 A;  2BMR B;  4Q53 A;  3G16 A;  3F8X A;  1RTU A;  1BRJ A;  4LYL B;  1IVU A;  2INX A;  3G6E 3;  1EQK A;  1BAN A;  3X3Y A;  5M19 A;  1RGC A;  3B4O A;  1LVN A;  3AMO B;  3VSY A;  3TDG A;  3LYG A;  4CCV A;  3CPO A;  3S5C A;  4R80 A;  3HII A;  1GMQ A;  1PYL A;  1N5H A;  3MHE A;  1W6G A;  3CCS 3;  1K8A 4;  1NJI 4;  5EEO A;  3DMC A;  1RGL A;  1TIJ A;  1D6Z A;  1N9J A;  3NBR A;  3GAX A;  5TGN A;  1DE3 A;  1F8N A;  1RGA A;  3CU3 A;  2D42 A;  1JKG A;  2K3D A;  1O7G B;  1LOY A;  2CG0 A;  1GOV A;  4WHA A;  1BNF A;  1U5O A;  1JB5 A;  1N8R 4;  3KFQ C;  1DMM A;  1VQ7 3;  2YFI B;  1YVS A;  6RNT A;  5ELU A;  3NBB A;  3NX0 A;  1RRL A;  1OGZ A;  3DZL A;  3GZY B;  1B2M A;  4L8P A;  2MF7 A;  1IT8 A;  2KF3 A;  3FG3 A;  4WYK A;  4XBX A;  2WGQ A;  1N5P A;  2R4I A;  2W04 A;  3ALA A;  3JUM A;  5IG4 A;  3PZW A;  1BNE A;  4OVM A;  3BU4 A;  1A2V A;  3X40 A;  2Q07 A;  1L5G B;  2BMO B;  4LEH A;  1EG9 B;  1LQM B;  4EBG A;  1YIJ 3;  1YHQ 3;  4MMX B;  3WOE B;  1UGH I;  4EW5 A;  3MWZ A;  4XM4 A;  5G2G A;  1B27 A;  1T2H A;  3GSP A;  1Q86 4;  4FMB A;  4KZ1 A;  1NB3 I;  1RKY A;  4CJN A;  1ZO2 A;  3PXM A;  2UX0 A;  4RZM A;  1BUJ A;  2WOH A;  3AHS A;  3Q3F A;  2F4Y A;  2QGU A;  2L1S A;  1SIH A;  1OAC A;  2I9W A;  1OHS A;  3CCV 3;  1W7C A;  1IU7 A;  1YNV X;  4BU4 A;  2KCD A;  1Q7H A;  1FZU A;  1US1 A;  2F56 A;  2OOV C;  1BNJ A;  1DMN A;  3AMO A;  3F7S A;  3PYJ A;  3CXC 2;  1FUW A;  7RNT A;  5KP1 A;  4OUQ A;  4K61 A;  1STF I;  3F7X A;  7STD A;  1AVL A;  1MOL A;  1TRQ A;  2CFL A;  3G0K A;  1LQG C;  4BTY A;  1TJD A;  2HMJ B;  4MEI A;  4AEQ A;  5DRE A;  4QWT A;  3X3X A;  1KD1 4;  3KKG A;  2CFG A;  1M1K 4;  1RCL A;  3D5G A;  1I0V A;  3MKI A;  3ZG0 A;  2PNC A;  4K1V A;  5BU4 A;  3MYT A;  1QVG 2;  2XRX B;  3FSD A;  4LMI A;  5D81 A;  1GS3 A;  3RGR A;  3NBJ A;  3GZR A;  4R4K A;  1BVI A;  1DVC A;  3K9M C;  3T0U A;  1K41 A;  3Q1C A;  1BIR A;  3LH4 A;  4LGQ A;  5LC6 A;  3AGN A;  1I3F A;  4AKY A;  3FG1 A;  2KXG A;  2OCT A;  1JKG B;  2IMJ A;  3BB9 A;  2PZV A;  5ELJ A;  2CFD A;  4K90 B;  4KFD A;  3VF1 A;  1NO3 A;  5IG5 A;  3OWS A;  2P09 A;  4HM3 B;  5AIF A;  2CFW A;  3NV0 B;  4FCZ A;  4KFE A;  1UUW B;  9RNT A;  4BTX A;  2WGO A;  3SED A;  3KSP A;  1BRH A;  3F9S A;  4N6T A;  3SYU A;  3DGY A;  3LTB A;  1UCK A;  2M7O A;  3HK4 A;  5D83 A;  1GD3 A;  1SII A;  5CF1 A;  5M18 A;  3LZA A;  5I97 A;  3FG4 A;  2SAR A;  4XB5 A;  2E2T A;  4HBR A;  5AYS C;  1WNH A; 
#chains in the Genus database with same CATH homology
 1RSN A;  5HOH A;  1I2F A;  1RHL A;  2HOH A;  5RNT A;  1R4Y A;  1RGL A;  1RLS A;  1RGE A;  1I70 A;  2RBI A;  1DE3 A;  1C54 A;  4J5G A;  1RGA A;  1G02 A;  1B20 A;  4RNT A;  1LOY A;  1BRK A;  1GOV A;  1RNB A;  1BNF A;  3D5I A;  1ZGX A;  1JBR A;  1TTO A;  1RGF A;  1B2X A;  1YVS A;  6RNT A;  1PYL A;  3RNT A;  4HAA A;  1B2M A;  1BNS A;  1RMS A;  2F5M A;  2KF3 A;  1B21 A;  1RN1 A;  1YGW A;  1B2Z A;  2BU4 A;  1BNE A;  3HOH A;  1AY7 A;  1SAR A;  3DH2 A;  3BU4 A;  2BIR A;  1RNT A;  4HOH A;  1GOY A;  1BRS A;  1LNI A;  1X1U A;  1JBS A;  1PY3 A;  1BOX A;  1Q9E A;  1HZ1 A;  1B27 A;  1FYS A;  1T2H A;  1I8V A;  1AQZ A;  3GSP A;  2ZA4 A;  1RCK A;  1RGK A;  1DET A;  1RGG A;  1RGH A;  1BUJ A;  3AHS A;  3Q3F A;  1UCJ A;  2F4Y A;  2KF5 A;  1IYY A;  3AGO A;  1LRA A;  2AAD A;  3D4A A;  2KF4 A;  2C4B A;  4GHO A;  1YNV X;  4BU4 A;  1MGR A;  1FZU A;  2F56 A;  2KAA A;  4BIR A;  1BNJ A;  1BRN L;  3AHW A;  5BIR A;  1X1X A;  1BGS A;  7RNT A;  1B3S A;  2F5W A;  3KCH A;  1FW7 A;  1BRG A;  4J5K A;  1TRP A;  1CH0 A;  6GSP A;  1LOV A;  1UCL A;  1GMR A;  3A5E A;  1UCI A;  1JBT A;  1TRQ A;  4GSP A;  8RNT A;  1GSP A;  1BSE A;  1RCL A;  3D5G A;  1B2U A;  1BNG A;  1I0V A;  5BU4 A;  1BNR A;  1RDS A;  1BSB A;  1I2G A;  1RN4 A;  1BVI A;  1GOU A;  1HYF A;  3URP A;  1BIR A;  1X1W A;  1BSD A;  2AAE A;  3WR2 A;  3AGN A;  1I3F A;  1X1Y A;  1I0X A;  2KF6 A;  1B2S A;  1I3I A;  1T2I A;  3BIR A;  1BSA A;  2GSP A;  3WHO A;  1BRI A;  1FUS A;  2RNT A;  1BNI A;  1GMP A;  7GSP A;  9RNT A;  1BU4 A;  1BSC A;  1FUT A;  1BRH A;  1BAO A;  1MGW A;  1I2E A;  3SYU A;  1RTU A;  3DGY A;  1BRJ A;  1UCK A;  1BAN A;  1RGC A;  1A2P A;  2SAR A;  5GSP A;  1GMQ A;  1LOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...