2IMJA

X-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
AQVRPPLPPFTRESAIEKIRLAEDGWNSRDPERVSLAYTLDTQWRNRAEFAHNREEAKAFLTRKWAKELDYRLIKELWAFTDNRIAVRYAYEWHDDSGNWFRSYGNENWEFDEQGLMARRFACINDMPIKAQERKFHWPLGRRPDDHPGLSELGLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the hypothetical protein (DUF1348) from Pseudomonas fluorescens, Northeast Structural Genomics target PlR14.
rcsb
source organism Pseudomonas fluorescens pf-5
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein DUF1348
total genus 54
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07080 DUF1348 Protein of unknown function (DUF1348)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2imjA01
2F99A 4OUQA 3G8ZA 3OV4A 1NDOB 2RFRA 7STDA 5KP4A 3B8LA 1E3VA 1WQLB 1DMQA 3VGNA 1ULIB 1HKXA 1TP6A 4X2HA 2OWPA 5IEPA 1ZO2A 3JUQA 3MG2A 1U5OA 1STDA 3NV0A 3EBTA 3OWYA 5DREA 1W00A 2CKFB 1NU3A 3GZRA 5D82A 5BXQA 3NM2A 3KKGA 1W6YA 4R9KA 5HGRA 2UX0A 5AEUB 4LMIA 1EA2A 4J8TA 2HMNB 4K1VA 1EG9B 3ROBA 1JB5A 5IG4A 2A15A 3Q90A 5AEWB 5IG0A 2B1XB 3CNMA 3F7XA 3GZXB 3FF0A 3MKIA 4R1KA 4HM2B 3CU3A 4HM8B 3T8NA 2GEYA 4XBXA 1GY6A 5AIIA 5JPPA 3ER7A 3EF8A 4WYKB 1JKGA 5KP1A 3MHEA 4GB5A 3FGYA 3FSDA 4HM6B 5IG5A 3NUVA 3KSPA 1C7HA 3B7CA 4R9LA 5IG3A 5BVBA 1GY7A 3F40A 4ORLA 3EX9A 4WP5A 3K0ZA 3NHXA 3SOAA 1OUNA 1QJGA 2GEXA 2RCDA 3EQQB 4HM5B 4J9AA 4L8OA 2RGQA 3EN8A 4I4KA 4L8PA 5CLKA 3RGAA 2HMKB 3HX8A 3MG1A 1VZZA 1O7MB 3OWUA 4L7KA 2K54A 3H51A 4LEHA 4WYKA 3NBRA 3F8HA 2Z76A 3F14A 3HK4A 3DUKA 4STDA 1W01A 2I9WA 4FCMA 5FW5A 3CNXA 3ECFA 4HZ9B 3MYTA 4HM3B 5STDA 3B4OA 2INXA 1NWWA 3MG3A 3H3HA 3S5CA 1JN5B 2BMRB 2STDA 1E97A 3F9SA 3K7CA 3DM8A 1O7PB 4PEJA 1ULJB 3SOYA 3WMDA 3E99A 2F98A 1QMAA 3F8XA 5IENA 1E3RA 1JB4A 1GS3A 1UUVB 2GXFA 4HM4B 4U13A 3LZAA 1DMMA 3A76A 5AIGA 5AIHA 8CHOA 1JN5A 1O7NB 6STDA 2QIYA 1IDPA 1O7WB 2YFJB 3IPTA 4IIAA 5AIFA 4XDVA 1TUHA 3EC9A 1BUQA 3I0YA 3B4PA 3LYGA 4HM7B 2CHCA 2XRXB 3JUNA 5AI1A 4XDWA 3DMCA 2GBXB 3OWSA 1Q42A 2BMOB 2HMMB 3BLZA 3GZYB 3KZTA 2BMQB 5G2GA 5IEOA 1JKGB 3F7SA 1OGZA 3EBYA 4KVHA 4HKVB 3STDA 5CF1A 3VSYA 5D83A 2IMJA 4K1UA 3HZPA 3UJMA 1OCVA 3CPOA 2PZVA 5IF6A 4MJDA 4X2OA 3UNLA 4CDLA 3FH1A 3JUOA 1GY5A 4N3VA 1O7HB 5EVHA 5TGNA 5JPUA 4Q53A 3JUMA 1A2KA 3JUPA 1OH0A 4OVMA 4XB5A 3SEDA 5CK6A 3RGRA 3G0KA 2Z7AA 1ISKA 3EHCA 1JB2A 2F86B 3GWRA 1K41A 4HVNA 1O7GB 3FKAA 5IERA 1OGXA 2B24B 3FZWA 1SJWA 3EN1B 1CQSA 2JQ5A 4RZMA 5CXOA 3T8UA 4HJLB 3BB9A 3MSOA 3NV0B 4HM0B 2GBWB 5KP3A 2Z77A 3NXJA 3DZLA 4XBTA 1S5AA 3M8CA 3OX9A 1W02A 3FF2A 1OPYA 5DRVA 3GZBA 3OXAA 2XSHB 1Z1SA 3D9RA 4FCJA 1ZX2A 4H3UA 1OHOA 4XBYA 2XR8B 2YFLB 3GRDA 2HMJB 2QGUA 5CF2A 3FLJA 1OHPA 3DXOA 1Q40A 4XM4A 1OF5A 1OHSA 1GYBA 3EJVA 3KE7A 1DMNA 2YFIB 1UUWB 4HM1B 4LGQA 2W2CA 3G16A 2HMOB 5D81A 1AR0A 2BNGA 2HMLB 2XSOB 4HZBB 2R4IA 1ASKA 1OF5B 4WWUC 1Q40B
chains in the Genus database with same CATH superfamily
3CCL3 2RFRA 1Q7HA 1UCLA 3B8LA 4HOHA 1E3VA 1WQLB 1BUJA 1QVF2 1TP6A 3NM7A 3HOHA 3I553 3V92A 1FGOA 1U5OA 3MG2A 2P0XA 3OWYA 3EBTA 1RNTA 1W00A 2CKFB 3GZRA 3UB1A 4CPKA 3DGMA 1DETA 1ZS7A 3O8YA 3UL5A 1N5PA 1V74A 1ROVA 1EG9B 1LOXA 2HMNB 4KZ1A 1Q7Y4 5IG0A 1V58A 1UUGB 1W6CA 1PYLA 3N9HA 1CYUA 4HAAA 4N6LA 4QWTA 4HM2B 1RN4A 1BRKA 5ELUA 3SXXA 4I5QA 4CJNA 1GY6A 5AIIA 3ER7A 4WYKB 1BSCA 1JKGA 1NO3A 1FYSA 1I3IA 2K0MA 1GD3A 1UGHI 1YVBI 2KF5A 1N8R4 1TFOA 1K734 1RDSA 1EKMA 2GEXA 2RCDA 4HM5B 1IK3A 3EN8A 4I4KA 1Y4KA 5CLKA 2W9PA 2KAAA 3CCM3 2JDIH 1VZZA 3QK9A 1TU5A 2K54A 4LEHA 1D6UA 2C11A 2C10A 3F14A 3DUKA 1W2B2 1QVG2 3PXMA 4IPBA 3V98A 2CWVA 1NWWA 5M19A 1BNJA 1SQWA 2BMRB 2P05A 1E97A 2CWUA 3AHSA 4BL3A 1BRNL 1O7PB 1VQQA 1JV2B 3NQYA 1E3RA 4HM4B 4U13A 3LZAA 3A76A 4LYLB 2W6JH 3N8BA 3K63A 2ZA4A 3DH2A 1YI23 1W5ZA 4ZM8A 5AI1A 3DGOA 4TX4A 1Q42A 2HMMB 1STFI 1GOUA 1CH0A 3RNTA 1OGZA 3EBYA 3X41A 2RNTA 5CF1A 1X1UA 3D4AA 3Q1CA 2Q07A 4EC6A 5IF6A 3NX0A 2CIUA 3CPW2 5IW9A 1VQK3 1D6YA 4N3VA 5EVHA 2OQEC 1B2UA 2OTJ3 4XB5A 3PCSA 1ISKA 1YVSA 4CCVA 3GWRA 2F86B 2GU3A 4HVNA 1B2ZA 1SIIA 1O7GB 2B24B 1RRLA 2ML5A 2CX1A 2ZL8A 3FKAA 4K90B 2JQ5A 4RNZA 4RZMA 3CCR3 4N6MA 4HJLB 3WA3A 3T0UA 2GBWB 2Z77A 3NXJA 1SIHA 2CC3A 5M18A 3CCS3 3OW22 3D9RA 2IYJA 4FCJA 1L5GB 1YHQ3 1OHOA 2XR8B 1WTHA 3GRDA 3UL6A 2QGUA 5AYRB 1BU4A 1RTUA 3DXOA 1N8QA 4NREA 1Q40A 5BIRA 5A0OB 4XM4A 2SBLA 1PU4A 1UUWB 4HM1B 1BNFA 4NHFA 1I2GA 2OQEA 3DY5A 5G1LA 3I563 4BTXA 1JBTA 4KT3B 2XSOB 1GMRA 1Q40B 1X1WA 3G8ZA 3CXC2 1YIT3 3LTDA 1QALA 5FGOA 2OWPA 1TRPA 1V57A 2V1LA 2P09A 3JUQA 4J5GA 1I3FA 1RHLA 1IVWA 2L1SA 4O2HA 5DREA 2WO0A 3KN4A 1NU3A 1RMSA 1RCLA 1CEWI 3HI7A 4IT7A 2UX0A 4WFOA 3ZG0A 1EA2A 5IG4A 3ROBA 1BAOA 1BNGA 3Q90A 3LH4A 1IQYA 1M1XB 2D42A 1WMNA 3LOYA 4NPBA 4BIRA 1FA3A 1UW1A 1RGCA 3MKIA 3CCV3 3WHOA 4R1KA 2ML6A 3CU3A 1RCKA 1SARA 3T8NA 1HZ1A 1GOYA 9RNTA 4XBXA 1B27A 3FCSB 4MMYB 2O3OA 1LOYA 2CG1A 2D1WA 1IV9A 3MHEA 4GB5A 2E2TA 3FGYA 3FSDA 3G6E3 1BSEA 3VF1A 5IG5A 2XEPA 3KSPA 3NUVA 3B7CA 3KFQC 2QA43 3CCQ3 2KCDA 3EX9A 4ORLA 3NHXA 3SOAA 1BRHA 5FW5A 1GOVA 1G96A 2PNCA 3MG1A 1RRHA 1BRIA 4L7KA 4EYCA 1R4CA 3HK4A 4STDA 1AQZA 2CFWA 1W01A 2MC8A 4JRFA 5LC7A 3CNXA 1UGIA 1NB3I 3ECFA 1TJDA 3MYTA 5STDA 1VQ63 1LNIA 3S5CA 1GD4A 2E2VA 2STDA 1I8VA 2KF3A 4KFFA 1W7CA 3DM8A 2KXGA 4PEJA 2KF4A 1ULJB 3JVCA 1X1YA 1WMOA 2ZDJA 4J5KA 1BRGA 1M904 3E99A 1QMAA 3F8XA 4BL2A 1BRSA 8CHOA 1JN5A 1O7NB 3AMOB 1R4YA 3CMA3 1IVUA 2YFJB 1HU9A 2CH9A 2OCTA 1TUHA 1BUQA 4HM7B 3B4PA 3WR2A 3D79A 2XRXB 3LTBA 4LZIA 7GSPA 1D6ZA 2OOVC 3OWSA 3GZYB 1B2XA 2J8XB 3PYJA 5IEOA 1AVLA 2W56A 1UI7A 4EXRA 1MWUA 1T2HA 1RGHA 5CF2A 2IA7A 4HBRA 4N6TA 1YIJ3 1BRJA 3VSYA 3X42A 2IMJA 1DYUA 1OCVA 3CPOA 2PZVA 1N9EA 1QAKA 2XF3A 4MJDA 4X2OA 3PZWA 2YX9A 4GL6A 1B21A 1T2IA 1US1A 2H0GA 1IT7A 4Q53A 1OH0A 4MMZB 3SEDA 3RGRA 2CX0A 1EQKA 3EHCA 3KCHA 5IERA 1OGXA 1LRAA 1FGRA 1SJWA 1CQSA 3BB9A 3MSOA 1A67A 5KP3A 4AEQA 4XBTA 3FF2A 3S28A 2Y73A 1Z1SA 2P0MA 1IV7A 1ZX2A 1I0XA 2UUGC 4XBYA 6GSPA 2HMJB 1MWRA 3D3LA 3SX1A 4N6OB 1GYBA 1DMNA 1I2FA 3PCRA 4O3VA 3CCJ3 1K28A 2F5WA 1FUWA 1LXEA 1VQN3 1AR0A 2BNGA 4HZBB 2F4YA 2P38A 2R4IA 5EQLA 3CC43 5M1AA 1OF5B 3N54B 2AADA 1VQ73 1BNRA 2F99A 1NDOB 3X40A 4N6V0 2WOHA 1QAFA 1ZO2A 1RGKA 1TFKA 1TIJA 1IU7A 5ELJA 3ZG5A 2W0QA 1RN1A 3AMOA 1STDA 3CC73 1VQ93 1JZDA 3NM2A 3KKGA 2CFKA 1W6YA 2WGQA 3X3YA 3BU4A 3HIGA 4ILFA 5AEUB 3U97A 1A2PA 4J8TA 1UCIA 1RJOA 1RGGA 4K1VA 2XH9A 5RNTA 2A15A 3CCE3 1ZGXA 3DGLA 3D5IA 2B1XB 3GZXB 3F7XA 3FF0A 1LNHA 3FG3A 1MGWA 3NQZA 3X3ZA 2GEYA 4GSPA 2HOHA 5JPPA 3A5EA 5KP1A 2SARA 3J7Yd 2FNQA 1BVIA 3QRDA 4RNYA 4R9LA 5BVBA 3BNCA 1GY7A 3F40A 4LSOA 1OUNA 1QJGA 3VGNA 3CME3 2IUJA 5JBSA 2RGQA 4L8PA 2HMKB 5GSPA 1FGQA 3OWUA 1O7MB 2CG0A 2LYXA 3H51A 2UGIA 2Z76A 1K9M4 2I9WA 4FCMA 1BGSA 2H0IA 4OK0A 1B2MA 1DVDA 4N6UA 3S27A 4FMAA 3MG3A 3H3HA 1NB5I 1BNEA 1IT8A 1BSBA 2CFDA 1B20A 3K7CA 1RGFA 3CC23 1FGTA 1Q9EA 3SOYA 4AKZA 4MMXB 1FUSA 4R4KA 1YGWA 1I70A 3AGNA 1C54A 2BIRA 5LC6A 2XGLA 2GXFA 3BNDA 1JJ22 5AIHA 1DMMA 2WOFA 6STDA 3BIRA 1O7WB 5AIFA 2Y74A 3EC9A 1M9GA 1K8A4 1EEJA 3JUNA 1IVXA 3DMCA 3LT9A 2H0HA 3BLZA 1PFPA 3WOFB 1NJI4 1J2BA 4MEIA 2W9QA 1W2ZA 1GMQA 1RGAA 2C4BA 2W56B 3ALAA 1VQ43 4KVHA 4HKVB 1AV4A 3GAXA 3GSPA 4K1UA 3UJMA 3HZPA 4RNTA 3UNLA 3ZFZA 1G0TA 2M7OA 4N6NB 4CDLA 2IY2A 3G4S3 1RGLA 3FH1A 1SPUA 1O7HB 3NBJA 1I0VA 2BO9B 3JUMA 1A2KA 1VQ53 1HYFA 4OVMA 1VQM3 5CK6A 3G0KA 1YGEA 1IQXA 1IQ8A 1K41A 2F5MA 3U1WA 3FZWA 1MNLA 2CW9A 4FMBA 3T8UA 1A90A 1RLSA 3LTAA 4G1MB 1UDII 3NV0B 4HM0B 3S29A 1YJW3 1IYYA 1BSAA 1DVCA 1LVNA 3L0RA 5DRVA 2KRTA 5G1KA 3IJEB 3GZBA 3OXAA 2XGNA 1G02A 1S723 4EV5A 3G713 4JF8A 3FLJA 3KSED 1OHPA 3MPHA 2OOVA 3BNBA 3DGYA 1OHSA 3EJVA 3KE7A 1KWIA 4EV2A 3Q2PA 2KF6A 4LGQA 3NBBA 2W2CA 5BU4A 1Q864 2HMOB 2O9UX 3WOEB 4WHAA 2L4VA 3LMLA 4WWUC 3AGOA 4OUQA 3SVAA 3OV4A 5KP4A 7STDA 1RN7A 1KQS2 2GU1A 1DMQA 1ULIB 1HKXA 3KIIA 1MWSA 4X2HA 2W03A 5IEPA 1YJ93 4FR9A 1M1K4 3BNEA 1B3SA 1Q814 3NV0A 1VQL3 4EW5A 5D82A 5BXQA 4AKYA 1BSDA 1MGRA 1U8CB 4R9KA 4BTWA 1RKYA 5HGRA 1TTOA 3LXUX 4LMIA 3TDGA 1JB5A 2W04A 2MF7A 5AEWB 3LT8A 4KFDA 3S67A 1MWTA 2CWTA 1LOWA 2OTL3 1BNSA 1PY3A 4HYZA 3RDEA 1RNBA 1KD14 3CNMA 4O8SA 4O02B 4R80A 2FXTA 3AHWA 4HM8B 2CK3H 2IUKA 3DGNA 3HIIA 1W6GA 3EF8A 4HM6B 2BHMA 1C7HA 3K5TA 1JNQA 4BTYA 5IG3A 4WP5A 1F8NA 3K0ZA 3EQQB 5AIGA 4L8OA 4J9AA 1JBSA 3RGAA 1LQGC 3EB8A 3HX8A 2RSXA 1KSIA 4WYKA 4EBGA 1DE3A 3NBRA 3F8HA 4HZ9B 4HM3B 1ROAA 1UCJA 1WMPA 3B4OA 2INXA 1JBRA 3URPA 1JN5B 2XFTA 3F9SA 3SLUA 1TRQA 3CCU3 2AAEA 1BNIA 1OACA 1X1XA 1VQP3 1YJN3 1BANA 4FMCA 2F98A 3WMDA 3WA2X 5IENA 1GS3A 1JB4A 1FGMA 1UUVB 1W4NA 1YNVX 3WDGB 1FUTA 2BT3A 1FZUA 3K9MC 3IMAB 2QIYA 3MWZA 1IDPA 3IPTA 4IIAA 1FW7A 4XDVA 3V99A 3I0YA 3LYGA 4H61A 2LQVA 2CHCA 3D5GA 4XDWA 2XFSA 2GBXB 1EUIC 4GHOA 2BMOB 3KZTA 2BMQB 5G2GA 3CD63 1VQ83 1JKGB 2F56A 3F7SA 2R41A 3LTCA 1AVKA 3STDA 1GMPA 5D83A 5I97A 1JRQA 2ZHXB 1GSPA 1A2VA 3JUOA 1B2SA 1I2EA 3X3XA 1GY5A 8RNTA 1LQMB 5TGNA 5JPUA 2CFLA 3JUPA 1WNHA 2RBIA 2Z7AA 2BU4A 2E2UA 1JB2A 2K3DA 1CYVA 1LOVA 4KFEA 1VQO3 5EEOA 1IVVA 1NNVA 1MOLA 3EN1B 3SYUA 2CFGA 5CXOA 1RSNA 4FCZA 7RNTA 1JZOA 3DZLA 1S5AA 3M8CA 3OX9A 1BIRA 1W02A 1OPYA 1T5YA 4H3UA 2XSHB 3PGBA 4FMDA 3WODG 2YFLB 3Q3FA 4BU4A 1T3BA 1UCKA 2GSPA 1OF5A 2WGOA 2Z6BA 5AYSC 1BOXA 1KC84 1N5HA 4DKIA 4K61A 1UI8A 5HOHA 1Q824 2QEX3 3G16A 3FG1A 3PS8A 5D81A 3FG4A 2HMLB 3EE1A 1ASKA 2YFIB 2FGTA 4RBNA 1AY7A 6RNTA 1RGEA 1N9JA
chains in the Genus database with same CATH topology
3CCL3 2RFRA 3B8LA 1E3VA 1WQLB 1QVF2 1TP6A 3NM7A 3I553 3V92A 1FGOA 1U5OA 3MG2A 2P0XA 3OWYA 3EBTA 1W00A 2CKFB 3GZRA 3DGMA 3O8YA 3UL5A 1N5PA 1V74A 1ROVA 1EG9B 1LOXA 2HMNB 4KZ1A 1Q7Y4 5IG0A 1W6CA 3N9HA 1CYUA 4N6LA 4QWTA 4HM2B 5ELUA 3SXXA 1GY6A 5AIIA 3ER7A 4WYKB 1JKGA 1NO3A 2K0MA 1GD3A 1YVBI 1N8R4 1TFOA 1K734 1EKMA 2GEXA 2RCDA 4HM5B 1IK3A 3EN8A 4I4KA 1Y4KA 5CLKA 2W9PA 3CCM3 2JDIH 1VZZA 3QK9A 1TU5A 2K54A 4LEHA 1D6UA 2C11A 2C10A 3F14A 3DUKA 1W2B2 1QVG2 3PXMA 4IPBA 3V98A 2CWVA 1NWWA 1SQWA 2BMRB 2P05A 1E97A 2CWUA 1O7PB 1JV2B 3NQYA 1E3RA 4HM4B 4U13A 3LZAA 3A76A 2W6JH 3N8BA 3K63A 1YI23 1W5ZA 4ZM8A 5AI1A 3DGOA 4TX4A 1Q42A 2HMMB 1STFI 1OGZA 3EBYA 3X41A 5CF1A 3Q1CA 2Q07A 4EC6A 5IF6A 3NX0A 2CIUA 3CPW2 5IW9A 1VQK3 1D6YA 4N3VA 5EVHA 2OQEC 2OTJ3 4XB5A 3PCSA 1ISKA 4CCVA 3GWRA 2F86B 2GU3A 4HVNA 1O7GB 1SIIA 2ML5A 2B24B 1RRLA 3FKAA 2ZL8A 4K90B 4RNZA 4RZMA 2JQ5A 3CCR3 4N6MA 4HJLB 3WA3A 3T0UA 2GBWB 2Z77A 3NXJA 1SIHA 2CC3A 3CCS3 3OW22 3D9RA 4FCJA 1L5GB 1YHQ3 1OHOA 2XR8B 1WTHA 3GRDA 3UL6A 2QGUA 5AYRB 5CF2A 3DXOA 1N8QA 4NREA 1Q40A 5A0OB 4XM4A 2SBLA 1PU4A 1UUWB 4HM1B 4NHFA 2OQEA 3DY5A 3I563 4BTXA 2XSOB 1Q40B 3G8ZA 3CXC2 1YIT3 3LTDA 1QALA 5FGOA 2OWPA 2V1LA 2P09A 3JUQA 1IVWA 4O2HA 5DREA 2WO0A 3KN4A 1NU3A 1CEWI 3HI7A 4IT7A 2UX0A 4WFOA 1EA2A 5IG4A 3ROBA 3Q90A 3LH4A 1IQYA 1M1XB 2D42A 1WMNA 3LOYA 1FA3A 1UW1A 3MKIA 3CCV3 4R1KA 2ML6A 3CU3A 3T8NA 4XBXA 3FCSB 4MMYB 2O3OA 2CG1A 2D1WA 1IV9A 3MHEA 4GB5A 2E2TA 3FGYA 3FSDA 3G6E3 3VF1A 5IG5A 2XEPA 3KSPA 3NUVA 3B7CA 3KFQC 2QA43 3CCQ3 2KCDA 3EX9A 4ORLA 3NHXA 3SOAA 5FW5A 1G96A 2PNCA 3MG1A 1RRHA 4L7KA 4EYCA 1R4CA 3HK4A 4STDA 2CFWA 2MC8A 1W01A 4JRFA 5LC7A 3CNXA 3ECFA 1NB3I 3MYTA 5STDA 1VQ63 3S5CA 1GD4A 2E2VA 2STDA 4KFFA 1W7CA 3DM8A 2KXGA 4PEJA 3UB1A 1ULJB 3JVCA 1M904 1WMOA 2ZDJA 3E99A 1QMAA 3F8XA 8CHOA 1JN5A 1O7NB 3AMOB 3CMA3 1IVUA 2YFJB 1HU9A 2CH9A 2OCTA 1TUHA 1BUQA 4HM7B 3B4PA 2XRXB 3LTBA 4LZIA 1D6ZA 2OOVC 3OWSA 3GZYB 3PYJA 5IEOA 1AVLA 2W56A 1UI7A 4EXRA 2IA7A 4HBRA 4N6TA 1YIJ3 3X42A 3VSYA 2IMJA 1DYUA 1OCVA 3CPOA 2PZVA 1N9EA 1QAKA 2XF3A 4MJDA 4X2OA 3PZWA 2YX9A 4GL6A 1US1A 1IT7A 4Q53A 1OH0A 4MMZB 3SEDA 3RGRA 1EQKA 3EHCA 5IERA 1OGXA 1FGRA 1SJWA 1CQSA 3BB9A 3MSOA 1A67A 5KP3A 4AEQA 4XBTA 3FF2A 3S28A 2Y73A 1Z1SA 2P0MA 1IV7A 1ZX2A 4XBYA 2HMJB 3D3LA 3SX1A 4N6OB 1GYBA 1DMNA 3PCRA 4O3VA 3CCJ3 1K28A 1FUWA 1LXEA 1VQN3 1AR0A 2BNGA 4HZBB 2P38A 2R4IA 5EQLA 3CC43 1OF5B 3N54B 1VQ73 2F99A 1NDOB 3X40A 4N6V0 2WOHA 1QAFA 1ZO2A 1TFKA 1TIJA 1IU7A 5ELJA 3CC73 2W0QA 3AMOA 1STDA 1VQ93 3NM2A 3KKGA 2CFKA 1W6YA 2WGQA 3X3YA 5AEUB 3HIGA 3U97A 4J8TA 1RJOA 4K1VA 2XH9A 3CCE3 2A15A 3DGLA 2B1XB 3GZXB 3F7XA 3FF0A 1LNHA 3FG3A 3NQZA 3X3ZA 2GEYA 5KP1A 5JPPA 3J7Yd 2FNQA 3QRDA 4RNYA 4R9LA 5BVBA 3BNCA 1GY7A 3F40A 4LSOA 1OUNA 1QJGA 3VGNA 3CME3 2IUJA 5JBSA 2RGQA 4L8PA 2HMKB 1FGQA 3OWUA 1O7MB 2CG0A 2LYXA 3H51A 2Z76A 1K9M4 2I9WA 4FCMA 4OK0A 1DVDA 4N6UA 3S27A 4FMAA 3MG3A 3H3HA 1NB5I 1IT8A 2CFDA 3K7CA 3CC23 1FGTA 3SOYA 4AKZA 4MMXB 4R4KA 5LC6A 2XGLA 2GXFA 3BNDA 1JJ22 5AIHA 1DMMA 2WOFA 6STDA 1O7WB 5AIFA 2Y74A 3EC9A 1M9GA 1K8A4 3JUNA 1IVXA 3DMCA 3LT9A 3BLZA 3WOFB 1PFPA 1NJI4 1J2BA 4MEIA 2W9QA 1W2ZA 3ALAA 2W56B 1VQ43 4KVHA 4HKVB 1AV4A 3GAXA 3UJMA 4K1UA 3HZPA 3UNLA 2M7OA 4N6NB 4CDLA 3G4S3 3FH1A 1SPUA 1O7HB 3NBJA 2BO9B 3JUMA 1A2KA 1VQ53 4OVMA 1VQM3 5CK6A 3G0KA 1YGEA 1IQXA 1IQ8A 1K41A 3U1WA 3FZWA 1MNLA 2CW9A 4FMBA 3T8UA 1A90A 3LTAA 4G1MB 3NV0B 4HM0B 3S29A 1YJW3 1DVCA 1LVNA 3L0RA 5DRVA 2KRTA 3IJEB 3GZBA 3OXAA 2XGNA 1S723 4EV5A 3G713 4JF8A 3FLJA 3KSED 1OHPA 3MPHA 2OOVA 3BNBA 1OHSA 3EJVA 3KE7A 1KWIA 4EV2A 3Q2PA 4LGQA 3NBBA 2W2CA 1Q864 2HMOB 2O9UX 3WOEB 4WHAA 2L4VA 3LMLA 4WWUC 4OUQA 3SVAA 3OV4A 5KP4A 7STDA 1RN7A 1KQS2 2GU1A 1DMQA 1ULIB 1HKXA 3KIIA 4X2HA 1M1K4 2W03A 5IEPA 1YJ93 4FR9A 3BNEA 1Q814 3NV0A 1VQL3 5D82A 5BXQA 4AKYA 1U8CB 4R9KA 4BTWA 1RKYA 5HGRA 3LXUX 4LMIA 3TDGA 1JB5A 2W04A 2MF7A 5AEWB 3LT8A 4KFDA 3S67A 2OTL3 2CWTA 4HYZA 3RDEA 1KD14 3CNMA 4O8SA 4O02B 4R80A 2FXTA 4HM8B 2CK3H 2IUKA 3DGNA 3HIIA 1W6GA 3EF8A 4HM6B 2BHMA 1C7HA 3K5TA 1JNQA 4BTYA 5IG3A 4WP5A 1F8NA 3K0ZA 3EQQB 5AIGA 4L8OA 4J9AA 3RGAA 3EB8A 3HX8A 2RSXA 4WYKA 4EBGA 3NBRA 3F8HA 4HZ9B 4HM3B 1ROAA 1WMPA 3B4OA 2INXA 1JN5B 2XFTA 3F9SA 3SLUA 3CCU3 1OACA 1VQP3 1YJN3 4FMCA 3WMDA 2F98A 3WA2X 5IENA 1GS3A 1JB4A 1FGMA 1UUVB 1W4NA 3WDGB 2BT3A 3K9MC 3MWZA 3IMAB 2QIYA 1IDPA 3IPTA 4IIAA 4XDVA 3V99A 3I0YA 3LYGA 4H61A 2LQVA 2CHCA 4XDWA 2XFSA 2GBXB 2BMOB 3KZTA 2BMQB 5G2GA 3CD63 1VQ83 1JKGB 3F7SA 3LTCA 1AVKA 3STDA 5D83A 5I97A 1JRQA 1A2VA 3JUOA 3X3XA 1GY5A 5TGNA 5JPUA 2CFLA 3JUPA 1WNHA 2Z7AA 2E2UA 1JB2A 1VQO3 1CYVA 4KFEA 5EEOA 1IVVA 3EN1B 1MOLA 2CFGA 5CXOA 4FCZA 3DZLA 1S5AA 3M8CA 3OX9A 1W02A 1OPYA 1T5YA 4H3UA 2XSHB 3PGBA 4FMDA 3WODG 2YFLB 1OF5A 2WGOA 2Z6BA 5AYSC 1KC84 1N5HA 4K61A 1UI8A 1Q824 2QEX3 3G16A 3FG1A 3PS8A 5D81A 3FG4A 2HMLB 3EE1A 1ASKA 2YFIB 2FGTA 1N9JA 4RBNA 1KSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F99 A;  4OUQ A;  3G8Z A;  3OV4 A;  1NDO B;  2RFR A;  7STD A;  5KP4 A;  3B8L A;  1E3V A;  1WQL B;  1DMQ A;  3VGN A;  1ULI B;  1HKX A;  1TP6 A;  4X2H A;  2OWP A;  5IEP A;  1ZO2 A;  3JUQ A;  3MG2 A;  1U5O A;  1STD A;  3NV0 A;  3EBT A;  3OWY A;  5DRE A;  1W00 A;  2CKF B;  1NU3 A;  3GZR A;  5D82 A;  5BXQ A;  3NM2 A;  3KKG A;  1W6Y A;  4R9K A;  5HGR A;  2UX0 A;  5AEU B;  4LMI A;  1EA2 A;  4J8T A;  2HMN B;  4K1V A;  1EG9 B;  3ROB A;  1JB5 A;  5IG4 A;  2A15 A;  3Q90 A;  5AEW B;  5IG0 A;  2B1X B;  3CNM A;  3F7X A;  3GZX B;  3FF0 A;  3MKI A;  4R1K A;  4HM2 B;  3CU3 A;  4HM8 B;  3T8N A;  2GEY A;  4XBX A;  1GY6 A;  5AII A;  5JPP A;  3ER7 A;  3EF8 A;  4WYK B;  1JKG A;  5KP1 A;  3MHE A;  4GB5 A;  3FGY A;  3FSD A;  4HM6 B;  5IG5 A;  3NUV A;  3KSP A;  1C7H A;  3B7C A;  4R9L A;  5IG3 A;  5BVB A;  1GY7 A;  3F40 A;  4ORL A;  3EX9 A;  4WP5 A;  3K0Z A;  3NHX A;  3SOA A;  1OUN A;  1QJG A;  2GEX A;  2RCD A;  3EQQ B;  4HM5 B;  4J9A A;  4L8O A;  2RGQ A;  3EN8 A;  4I4K A;  4L8P A;  5CLK A;  3RGA A;  2HMK B;  3HX8 A;  3MG1 A;  1VZZ A;  1O7M B;  3OWU A;  4L7K A;  2K54 A;  3H51 A;  4LEH A;  4WYK A;  3NBR A;  3F8H A;  2Z76 A;  3F14 A;  3HK4 A;  3DUK A;  4STD A;  1W01 A;  2I9W A;  4FCM A;  5FW5 A;  3CNX A;  3ECF A;  4HZ9 B;  3MYT A;  4HM3 B;  5STD A;  3B4O A;  2INX A;  1NWW A;  3MG3 A;  3H3H A;  3S5C A;  1JN5 B;  2BMR B;  2STD A;  1E97 A;  3F9S A;  3K7C A;  3DM8 A;  1O7P B;  4PEJ A;  1ULJ B;  3SOY A;  3WMD A;  3E99 A;  2F98 A;  1QMA A;  3F8X A;  5IEN A;  1E3R A;  1JB4 A;  1GS3 A;  1UUV B;  2GXF A;  4HM4 B;  4U13 A;  3LZA A;  1DMM A;  3A76 A;  5AIG A;  5AIH A;  8CHO A;  1JN5 A;  1O7N B;  6STD A;  2QIY A;  1IDP A;  1O7W B;  2YFJ B;  3IPT A;  4IIA A;  5AIF A;  4XDV A;  1TUH A;  3EC9 A;  1BUQ A;  3I0Y A;  3B4P A;  3LYG A;  4HM7 B;  2CHC A;  2XRX B;  3JUN A;  5AI1 A;  4XDW A;  3DMC A;  2GBX B;  3OWS A;  1Q42 A;  2BMO B;  2HMM B;  3BLZ A;  3GZY B;  3KZT A;  2BMQ B;  5G2G A;  5IEO A;  1JKG B;  3F7S A;  1OGZ A;  3EBY A;  4KVH A;  4HKV B;  3STD A;  5CF1 A;  3VSY A;  5D83 A;  2IMJ A;  4K1U A;  3HZP A;  3UJM A;  1OCV A;  3CPO A;  2PZV A;  5IF6 A;  4MJD A;  4X2O A;  3UNL A;  4CDL A;  3FH1 A;  3JUO A;  1GY5 A;  4N3V A;  1O7H B;  5EVH A;  5TGN A;  5JPU A;  4Q53 A;  3JUM A;  1A2K A;  3JUP A;  1OH0 A;  4OVM A;  4XB5 A;  3SED A;  5CK6 A;  3RGR A;  3G0K A;  2Z7A A;  1ISK A;  3EHC A;  1JB2 A;  2F86 B;  3GWR A;  1K41 A;  4HVN A;  1O7G B;  3FKA A;  5IER A;  1OGX A;  2B24 B;  3FZW A;  1SJW A;  3EN1 B;  1CQS A;  2JQ5 A;  4RZM A;  5CXO A;  3T8U A;  4HJL B;  3BB9 A;  3MSO A;  3NV0 B;  4HM0 B;  2GBW B;  5KP3 A;  2Z77 A;  3NXJ A;  3DZL A;  4XBT A;  1S5A A;  3M8C A;  3OX9 A;  1W02 A;  3FF2 A;  1OPY A;  5DRV A;  3GZB A;  3OXA A;  2XSH B;  1Z1S A;  3D9R A;  4FCJ A;  1ZX2 A;  4H3U A;  1OHO A;  4XBY A;  2XR8 B;  2YFL B;  3GRD A;  2HMJ B;  2QGU A;  5CF2 A;  3FLJ A;  1OHP A;  3DXO A;  1Q40 A;  4XM4 A;  1OF5 A;  1OHS A;  1GYB A;  3EJV A;  3KE7 A;  1DMN A;  2YFI B;  1UUW B;  4HM1 B;  4LGQ A;  2W2C A;  3G16 A;  2HMO B;  5D81 A;  1AR0 A;  2BNG A;  2HML B;  2XSO B;  4HZB B;  2R4I A;  1ASK A;  1OF5 B;  4WWU C;  1Q40 B; 
#chains in the Genus database with same CATH topology
 3CCL 3;  2RFR A;  1Q7H A;  1UCL A;  3B8L A;  4HOH A;  1E3V A;  1WQL B;  1BUJ A;  1QVF 2;  1TP6 A;  3NM7 A;  3HOH A;  3I55 3;  3V92 A;  1FGO A;  1U5O A;  3MG2 A;  2P0X A;  3OWY A;  3EBT A;  1RNT A;  1W00 A;  2CKF B;  3GZR A;  3UB1 A;  4CPK A;  3DGM A;  1DET A;  1ZS7 A;  3O8Y A;  3UL5 A;  1N5P A;  1V74 A;  1ROV A;  1EG9 B;  1LOX A;  2HMN B;  4KZ1 A;  1Q7Y 4;  5IG0 A;  1V58 A;  1UUG B;  1W6C A;  1PYL A;  3N9H A;  1CYU A;  4HAA A;  4N6L A;  4QWT A;  4HM2 B;  1RN4 A;  1BRK A;  5ELU A;  3SXX A;  4I5Q A;  4CJN A;  1GY6 A;  5AII A;  3ER7 A;  4WYK B;  1BSC A;  1JKG A;  1NO3 A;  1FYS A;  1I3I A;  2K0M A;  1GD3 A;  1UGH I;  1YVB I;  2KF5 A;  1N8R 4;  1TFO A;  1K73 4;  1RDS A;  1EKM A;  2GEX A;  2RCD A;  4HM5 B;  1IK3 A;  3EN8 A;  4I4K A;  1Y4K A;  5CLK A;  2W9P A;  2KAA A;  3CCM 3;  2JDI H;  1VZZ A;  3QK9 A;  1TU5 A;  2K54 A;  4LEH A;  1D6U A;  2C11 A;  2C10 A;  3F14 A;  3DUK A;  1W2B 2;  1QVG 2;  3PXM A;  4IPB A;  3V98 A;  2CWV A;  1NWW A;  5M19 A;  1BNJ A;  1SQW A;  2BMR B;  2P05 A;  1E97 A;  2CWU A;  3AHS A;  4BL3 A;  1BRN L;  1O7P B;  1VQQ A;  1JV2 B;  3NQY A;  1E3R A;  4HM4 B;  4U13 A;  3LZA A;  3A76 A;  4LYL B;  2W6J H;  3N8B A;  3K63 A;  2ZA4 A;  3DH2 A;  1YI2 3;  1W5Z A;  4ZM8 A;  5AI1 A;  3DGO A;  4TX4 A;  1Q42 A;  2HMM B;  1STF I;  1GOU A;  1CH0 A;  3RNT A;  1OGZ A;  3EBY A;  3X41 A;  2RNT A;  5CF1 A;  1X1U A;  3D4A A;  3Q1C A;  2Q07 A;  4EC6 A;  5IF6 A;  3NX0 A;  2CIU A;  3CPW 2;  5IW9 A;  1VQK 3;  1D6Y A;  4N3V A;  5EVH A;  2OQE C;  1B2U A;  2OTJ 3;  4XB5 A;  3PCS A;  1ISK A;  1YVS A;  4CCV A;  3GWR A;  2F86 B;  2GU3 A;  4HVN A;  1B2Z A;  1SII A;  1O7G B;  2B24 B;  1RRL A;  2ML5 A;  2CX1 A;  2ZL8 A;  3FKA A;  4K90 B;  2JQ5 A;  4RNZ A;  4RZM A;  3CCR 3;  4N6M A;  4HJL B;  3WA3 A;  3T0U A;  2GBW B;  2Z77 A;  3NXJ A;  1SIH A;  2CC3 A;  5M18 A;  3CCS 3;  3OW2 2;  3D9R A;  2IYJ A;  4FCJ A;  1L5G B;  1YHQ 3;  1OHO A;  2XR8 B;  1WTH A;  3GRD A;  3UL6 A;  2QGU A;  5AYR B;  1BU4 A;  1RTU A;  3DXO A;  1N8Q A;  4NRE A;  1Q40 A;  5BIR A;  5A0O B;  4XM4 A;  2SBL A;  1PU4 A;  1UUW B;  4HM1 B;  1BNF A;  4NHF A;  1I2G A;  2OQE A;  3DY5 A;  5G1L A;  3I56 3;  4BTX A;  1JBT A;  4KT3 B;  2XSO B;  1GMR A;  1Q40 B;  1X1W A;  3G8Z A;  3CXC 2;  1YIT 3;  3LTD A;  1QAL A;  5FGO A;  2OWP A;  1TRP A;  1V57 A;  2V1L A;  2P09 A;  3JUQ A;  4J5G A;  1I3F A;  1RHL A;  1IVW A;  2L1S A;  4O2H A;  5DRE A;  2WO0 A;  3KN4 A;  1NU3 A;  1RMS A;  1RCL A;  1CEW I;  3HI7 A;  4IT7 A;  2UX0 A;  4WFO A;  3ZG0 A;  1EA2 A;  5IG4 A;  3ROB A;  1BAO A;  1BNG A;  3Q90 A;  3LH4 A;  1IQY A;  1M1X B;  2D42 A;  1WMN A;  3LOY A;  4NPB A;  4BIR A;  1FA3 A;  1UW1 A;  1RGC A;  3MKI A;  3CCV 3;  3WHO A;  4R1K A;  2ML6 A;  3CU3 A;  1RCK A;  1SAR A;  3T8N A;  1HZ1 A;  1GOY A;  9RNT A;  4XBX A;  1B27 A;  3FCS B;  4MMY B;  2O3O A;  1LOY A;  2CG1 A;  2D1W A;  1IV9 A;  3MHE A;  4GB5 A;  2E2T A;  3FGY A;  3FSD A;  3G6E 3;  1BSE A;  3VF1 A;  5IG5 A;  2XEP A;  3KSP A;  3NUV A;  3B7C A;  3KFQ C;  2QA4 3;  3CCQ 3;  2KCD A;  3EX9 A;  4ORL A;  3NHX A;  3SOA A;  1BRH A;  5FW5 A;  1GOV A;  1G96 A;  2PNC A;  3MG1 A;  1RRH A;  1BRI A;  4L7K A;  4EYC A;  1R4C A;  3HK4 A;  4STD A;  1AQZ A;  2CFW A;  1W01 A;  2MC8 A;  4JRF A;  5LC7 A;  3CNX A;  1UGI A;  1NB3 I;  3ECF A;  1TJD A;  3MYT A;  5STD A;  1VQ6 3;  1LNI A;  3S5C A;  1GD4 A;  2E2V A;  2STD A;  1I8V A;  2KF3 A;  4KFF A;  1W7C A;  3DM8 A;  2KXG A;  4PEJ A;  2KF4 A;  1ULJ B;  3JVC A;  1X1Y A;  1WMO A;  2ZDJ A;  4J5K A;  1BRG A;  1M90 4;  3E99 A;  1QMA A;  3F8X A;  4BL2 A;  1BRS A;  8CHO A;  1JN5 A;  1O7N B;  3AMO B;  1R4Y A;  3CMA 3;  1IVU A;  2YFJ B;  1HU9 A;  2CH9 A;  2OCT A;  1TUH A;  1BUQ A;  4HM7 B;  3B4P A;  3WR2 A;  3D79 A;  2XRX B;  3LTB A;  4LZI A;  7GSP A;  1D6Z A;  2OOV C;  3OWS A;  3GZY B;  1B2X A;  2J8X B;  3PYJ A;  5IEO A;  1AVL A;  2W56 A;  1UI7 A;  4EXR A;  1MWU A;  1T2H A;  1RGH A;  5CF2 A;  2IA7 A;  4HBR A;  4N6T A;  1YIJ 3;  1BRJ A;  3VSY A;  3X42 A;  2IMJ A;  1DYU A;  1OCV A;  3CPO A;  2PZV A;  1N9E A;  1QAK A;  2XF3 A;  4MJD A;  4X2O A;  3PZW A;  2YX9 A;  4GL6 A;  1B21 A;  1T2I A;  1US1 A;  2H0G A;  1IT7 A;  4Q53 A;  1OH0 A;  4MMZ B;  3SED A;  3RGR A;  2CX0 A;  1EQK A;  3EHC A;  3KCH A;  5IER A;  1OGX A;  1LRA A;  1FGR A;  1SJW A;  1CQS A;  3BB9 A;  3MSO A;  1A67 A;  5KP3 A;  4AEQ A;  4XBT A;  3FF2 A;  3S28 A;  2Y73 A;  1Z1S A;  2P0M A;  1IV7 A;  1ZX2 A;  1I0X A;  2UUG C;  4XBY A;  6GSP A;  2HMJ B;  1MWR A;  3D3L A;  3SX1 A;  4N6O B;  1GYB A;  1DMN A;  1I2F A;  3PCR A;  4O3V A;  3CCJ 3;  1K28 A;  2F5W A;  1FUW A;  1LXE A;  1VQN 3;  1AR0 A;  2BNG A;  4HZB B;  2F4Y A;  2P38 A;  2R4I A;  5EQL A;  3CC4 3;  5M1A A;  1OF5 B;  3N54 B;  2AAD A;  1VQ7 3;  1BNR A;  2F99 A;  1NDO B;  3X40 A;  4N6V 0;  2WOH A;  1QAF A;  1ZO2 A;  1RGK A;  1TFK A;  1TIJ A;  1IU7 A;  5ELJ A;  3ZG5 A;  2W0Q A;  1RN1 A;  3AMO A;  1STD A;  3CC7 3;  1VQ9 3;  1JZD A;  3NM2 A;  3KKG A;  2CFK A;  1W6Y A;  2WGQ A;  3X3Y A;  3BU4 A;  3HIG A;  4ILF A;  5AEU B;  3U97 A;  1A2P A;  4J8T A;  1UCI A;  1RJO A;  1RGG A;  4K1V A;  2XH9 A;  5RNT A;  2A15 A;  3CCE 3;  1ZGX A;  3DGL A;  3D5I A;  2B1X B;  3GZX B;  3F7X A;  3FF0 A;  1LNH A;  3FG3 A;  1MGW A;  3NQZ A;  3X3Z A;  2GEY A;  4GSP A;  2HOH A;  5JPP A;  3A5E A;  5KP1 A;  2SAR A;  3J7Y d;  2FNQ A;  1BVI A;  3QRD A;  4RNY A;  4R9L A;  5BVB A;  3BNC A;  1GY7 A;  3F40 A;  4LSO A;  1OUN A;  1QJG A;  3VGN A;  3CME 3;  2IUJ A;  5JBS A;  2RGQ A;  4L8P A;  2HMK B;  5GSP A;  1FGQ A;  3OWU A;  1O7M B;  2CG0 A;  2LYX A;  3H51 A;  2UGI A;  2Z76 A;  1K9M 4;  2I9W A;  4FCM A;  1BGS A;  2H0I A;  4OK0 A;  1B2M A;  1DVD A;  4N6U A;  3S27 A;  4FMA A;  3MG3 A;  3H3H A;  1NB5 I;  1BNE A;  1IT8 A;  1BSB A;  2CFD A;  1B20 A;  3K7C A;  1RGF A;  3CC2 3;  1FGT A;  1Q9E A;  3SOY A;  4AKZ A;  4MMX B;  1FUS A;  4R4K A;  1YGW A;  1I70 A;  3AGN A;  1C54 A;  2BIR A;  5LC6 A;  2XGL A;  2GXF A;  3BND A;  1JJ2 2;  5AIH A;  1DMM A;  2WOF A;  6STD A;  3BIR A;  1O7W B;  5AIF A;  2Y74 A;  3EC9 A;  1M9G A;  1K8A 4;  1EEJ A;  3JUN A;  1IVX A;  3DMC A;  3LT9 A;  2H0H A;  3BLZ A;  1PFP A;  3WOF B;  1NJI 4;  1J2B A;  4MEI A;  2W9Q A;  1W2Z A;  1GMQ A;  1RGA A;  2C4B A;  2W56 B;  3ALA A;  1VQ4 3;  4KVH A;  4HKV B;  1AV4 A;  3GAX A;  3GSP A;  4K1U A;  3UJM A;  3HZP A;  4RNT A;  3UNL A;  3ZFZ A;  1G0T A;  2M7O A;  4N6N B;  4CDL A;  2IY2 A;  3G4S 3;  1RGL A;  3FH1 A;  1SPU A;  1O7H B;  3NBJ A;  1I0V A;  2BO9 B;  3JUM A;  1A2K A;  1VQ5 3;  1HYF A;  4OVM A;  1VQM 3;  5CK6 A;  3G0K A;  1YGE A;  1IQX A;  1IQ8 A;  1K41 A;  2F5M A;  3U1W A;  3FZW A;  1MNL A;  2CW9 A;  4FMB A;  3T8U A;  1A90 A;  1RLS A;  3LTA A;  4G1M B;  1UDI I;  3NV0 B;  4HM0 B;  3S29 A;  1YJW 3;  1IYY A;  1BSA A;  1DVC A;  1LVN A;  3L0R A;  5DRV A;  2KRT A;  5G1K A;  3IJE B;  3GZB A;  3OXA A;  2XGN A;  1G02 A;  1S72 3;  4EV5 A;  3G71 3;  4JF8 A;  3FLJ A;  3KSE D;  1OHP A;  3MPH A;  2OOV A;  3BNB A;  3DGY A;  1OHS A;  3EJV A;  3KE7 A;  1KWI A;  4EV2 A;  3Q2P A;  2KF6 A;  4LGQ A;  3NBB A;  2W2C A;  5BU4 A;  1Q86 4;  2HMO B;  2O9U X;  3WOE B;  4WHA A;  2L4V A;  3LML A;  4WWU C;  3AGO A;  4OUQ A;  3SVA A;  3OV4 A;  5KP4 A;  7STD A;  1RN7 A;  1KQS 2;  2GU1 A;  1DMQ A;  1ULI B;  1HKX A;  3KII A;  1MWS A;  4X2H A;  2W03 A;  5IEP A;  1YJ9 3;  4FR9 A;  1M1K 4;  3BNE A;  1B3S A;  1Q81 4;  3NV0 A;  1VQL 3;  4EW5 A;  5D82 A;  5BXQ A;  4AKY A;  1BSD A;  1MGR A;  1U8C B;  4R9K A;  4BTW A;  1RKY A;  5HGR A;  1TTO A;  3LXU X;  4LMI A;  3TDG A;  1JB5 A;  2W04 A;  2MF7 A;  5AEW B;  3LT8 A;  4KFD A;  3S67 A;  1MWT A;  2CWT A;  1LOW A;  2OTL 3;  1BNS A;  1PY3 A;  4HYZ A;  3RDE A;  1RNB A;  1KD1 4;  3CNM A;  4O8S A;  4O02 B;  4R80 A;  2FXT A;  3AHW A;  4HM8 B;  2CK3 H;  2IUK A;  3DGN A;  3HII A;  1W6G A;  3EF8 A;  4HM6 B;  2BHM A;  1C7H A;  3K5T A;  1JNQ A;  4BTY A;  5IG3 A;  4WP5 A;  1F8N A;  3K0Z A;  3EQQ B;  5AIG A;  4L8O A;  4J9A A;  1JBS A;  3RGA A;  1LQG C;  3EB8 A;  3HX8 A;  2RSX A;  1KSI A;  4WYK A;  4EBG A;  1DE3 A;  3NBR A;  3F8H A;  4HZ9 B;  4HM3 B;  1ROA A;  1UCJ A;  1WMP A;  3B4O A;  2INX A;  1JBR A;  3URP A;  1JN5 B;  2XFT A;  3F9S A;  3SLU A;  1TRQ A;  3CCU 3;  2AAE A;  1BNI A;  1OAC A;  1X1X A;  1VQP 3;  1YJN 3;  1BAN A;  4FMC A;  2F98 A;  3WMD A;  3WA2 X;  5IEN A;  1GS3 A;  1JB4 A;  1FGM A;  1UUV B;  1W4N A;  1YNV X;  3WDG B;  1FUT A;  2BT3 A;  1FZU A;  3K9M C;  3IMA B;  2QIY A;  3MWZ A;  1IDP A;  3IPT A;  4IIA A;  1FW7 A;  4XDV A;  3V99 A;  3I0Y A;  3LYG A;  4H61 A;  2LQV A;  2CHC A;  3D5G A;  4XDW A;  2XFS A;  2GBX B;  1EUI C;  4GHO A;  2BMO B;  3KZT A;  2BMQ B;  5G2G A;  3CD6 3;  1VQ8 3;  1JKG B;  2F56 A;  3F7S A;  2R41 A;  3LTC A;  1AVK A;  3STD A;  1GMP A;  5D83 A;  5I97 A;  1JRQ A;  2ZHX B;  1GSP A;  1A2V A;  3JUO A;  1B2S A;  1I2E A;  3X3X A;  1GY5 A;  8RNT A;  1LQM B;  5TGN A;  5JPU A;  2CFL A;  3JUP A;  1WNH A;  2RBI A;  2Z7A A;  2BU4 A;  2E2U A;  1JB2 A;  2K3D A;  1CYV A;  1LOV A;  4KFE A;  1VQO 3;  5EEO A;  1IVV A;  1NNV A;  1MOL A;  3EN1 B;  3SYU A;  2CFG A;  5CXO A;  1RSN A;  4FCZ A;  7RNT A;  1JZO A;  3DZL A;  1S5A A;  3M8C A;  3OX9 A;  1BIR A;  1W02 A;  1OPY A;  1T5Y A;  4H3U A;  2XSH B;  3PGB A;  4FMD A;  3WOD G;  2YFL B;  3Q3F A;  4BU4 A;  1T3B A;  1UCK A;  2GSP A;  1OF5 A;  2WGO A;  2Z6B A;  5AYS C;  1BOX A;  1KC8 4;  1N5H A;  4DKI A;  4K61 A;  1UI8 A;  5HOH A;  1Q82 4;  2QEX 3;  3G16 A;  3FG1 A;  3PS8 A;  5D81 A;  3FG4 A;  2HML B;  3EE1 A;  1ASK A;  2YFI B;  2FGT A;  4RBN A;  1AY7 A;  6RNT A;  1RGE A;  1N9J A; 
#chains in the Genus database with same CATH homology
 3CCL 3;  2RFR A;  3B8L A;  1E3V A;  1WQL B;  1QVF 2;  1TP6 A;  3NM7 A;  3I55 3;  3V92 A;  1FGO A;  1U5O A;  3MG2 A;  2P0X A;  3OWY A;  3EBT A;  1W00 A;  2CKF B;  3GZR A;  3DGM A;  3O8Y A;  3UL5 A;  1N5P A;  1V74 A;  1ROV A;  1EG9 B;  1LOX A;  2HMN B;  4KZ1 A;  1Q7Y 4;  5IG0 A;  1W6C A;  3N9H A;  1CYU A;  4N6L A;  4QWT A;  4HM2 B;  5ELU A;  3SXX A;  1GY6 A;  5AII A;  3ER7 A;  4WYK B;  1JKG A;  1NO3 A;  2K0M A;  1GD3 A;  1YVB I;  1N8R 4;  1TFO A;  1K73 4;  1EKM A;  2GEX A;  2RCD A;  4HM5 B;  1IK3 A;  3EN8 A;  4I4K A;  1Y4K A;  5CLK A;  2W9P A;  3CCM 3;  2JDI H;  1VZZ A;  3QK9 A;  1TU5 A;  2K54 A;  4LEH A;  1D6U A;  2C11 A;  2C10 A;  3F14 A;  3DUK A;  1W2B 2;  1QVG 2;  3PXM A;  4IPB A;  3V98 A;  2CWV A;  1NWW A;  1SQW A;  2BMR B;  2P05 A;  1E97 A;  2CWU A;  1O7P B;  1JV2 B;  3NQY A;  1E3R A;  4HM4 B;  4U13 A;  3LZA A;  3A76 A;  2W6J H;  3N8B A;  3K63 A;  1YI2 3;  1W5Z A;  4ZM8 A;  5AI1 A;  3DGO A;  4TX4 A;  1Q42 A;  2HMM B;  1STF I;  1OGZ A;  3EBY A;  3X41 A;  5CF1 A;  3Q1C A;  2Q07 A;  4EC6 A;  5IF6 A;  3NX0 A;  2CIU A;  3CPW 2;  5IW9 A;  1VQK 3;  1D6Y A;  4N3V A;  5EVH A;  2OQE C;  2OTJ 3;  4XB5 A;  3PCS A;  1ISK A;  4CCV A;  3GWR A;  2F86 B;  2GU3 A;  4HVN A;  1O7G B;  1SII A;  2ML5 A;  2B24 B;  1RRL A;  3FKA A;  2ZL8 A;  4K90 B;  4RNZ A;  4RZM A;  2JQ5 A;  3CCR 3;  4N6M A;  4HJL B;  3WA3 A;  3T0U A;  2GBW B;  2Z77 A;  3NXJ A;  1SIH A;  2CC3 A;  3CCS 3;  3OW2 2;  3D9R A;  4FCJ A;  1L5G B;  1YHQ 3;  1OHO A;  2XR8 B;  1WTH A;  3GRD A;  3UL6 A;  2QGU A;  5AYR B;  5CF2 A;  3DXO A;  1N8Q A;  4NRE A;  1Q40 A;  5A0O B;  4XM4 A;  2SBL A;  1PU4 A;  1UUW B;  4HM1 B;  4NHF A;  2OQE A;  3DY5 A;  3I56 3;  4BTX A;  2XSO B;  1Q40 B;  3G8Z A;  3CXC 2;  1YIT 3;  3LTD A;  1QAL A;  5FGO A;  2OWP A;  2V1L A;  2P09 A;  3JUQ A;  1IVW A;  4O2H A;  5DRE A;  2WO0 A;  3KN4 A;  1NU3 A;  1CEW I;  3HI7 A;  4IT7 A;  2UX0 A;  4WFO A;  1EA2 A;  5IG4 A;  3ROB A;  3Q90 A;  3LH4 A;  1IQY A;  1M1X B;  2D42 A;  1WMN A;  3LOY A;  1FA3 A;  1UW1 A;  3MKI A;  3CCV 3;  4R1K A;  2ML6 A;  3CU3 A;  3T8N A;  4XBX A;  3FCS B;  4MMY B;  2O3O A;  2CG1 A;  2D1W A;  1IV9 A;  3MHE A;  4GB5 A;  2E2T A;  3FGY A;  3FSD A;  3G6E 3;  3VF1 A;  5IG5 A;  2XEP A;  3KSP A;  3NUV A;  3B7C A;  3KFQ C;  2QA4 3;  3CCQ 3;  2KCD A;  3EX9 A;  4ORL A;  3NHX A;  3SOA A;  5FW5 A;  1G96 A;  2PNC A;  3MG1 A;  1RRH A;  4L7K A;  4EYC A;  1R4C A;  3HK4 A;  4STD A;  2CFW A;  2MC8 A;  1W01 A;  4JRF A;  5LC7 A;  3CNX A;  3ECF A;  1NB3 I;  3MYT A;  5STD A;  1VQ6 3;  3S5C A;  1GD4 A;  2E2V A;  2STD A;  4KFF A;  1W7C A;  3DM8 A;  2KXG A;  4PEJ A;  3UB1 A;  1ULJ B;  3JVC A;  1M90 4;  1WMO A;  2ZDJ A;  3E99 A;  1QMA A;  3F8X A;  8CHO A;  1JN5 A;  1O7N B;  3AMO B;  3CMA 3;  1IVU A;  2YFJ B;  1HU9 A;  2CH9 A;  2OCT A;  1TUH A;  1BUQ A;  4HM7 B;  3B4P A;  2XRX B;  3LTB A;  4LZI A;  1D6Z A;  2OOV C;  3OWS A;  3GZY B;  3PYJ A;  5IEO A;  1AVL A;  2W56 A;  1UI7 A;  4EXR A;  2IA7 A;  4HBR A;  4N6T A;  1YIJ 3;  3X42 A;  3VSY A;  2IMJ A;  1DYU A;  1OCV A;  3CPO A;  2PZV A;  1N9E A;  1QAK A;  2XF3 A;  4MJD A;  4X2O A;  3PZW A;  2YX9 A;  4GL6 A;  1US1 A;  1IT7 A;  4Q53 A;  1OH0 A;  4MMZ B;  3SED A;  3RGR A;  1EQK A;  3EHC A;  5IER A;  1OGX A;  1FGR A;  1SJW A;  1CQS A;  3BB9 A;  3MSO A;  1A67 A;  5KP3 A;  4AEQ A;  4XBT A;  3FF2 A;  3S28 A;  2Y73 A;  1Z1S A;  2P0M A;  1IV7 A;  1ZX2 A;  4XBY A;  2HMJ B;  3D3L A;  3SX1 A;  4N6O B;  1GYB A;  1DMN A;  3PCR A;  4O3V A;  3CCJ 3;  1K28 A;  1FUW A;  1LXE A;  1VQN 3;  1AR0 A;  2BNG A;  4HZB B;  2P38 A;  2R4I A;  5EQL A;  3CC4 3;  1OF5 B;  3N54 B;  1VQ7 3;  2F99 A;  1NDO B;  3X40 A;  4N6V 0;  2WOH A;  1QAF A;  1ZO2 A;  1TFK A;  1TIJ A;  1IU7 A;  5ELJ A;  3CC7 3;  2W0Q A;  3AMO A;  1STD A;  1VQ9 3;  3NM2 A;  3KKG A;  2CFK A;  1W6Y A;  2WGQ A;  3X3Y A;  5AEU B;  3HIG A;  3U97 A;  4J8T A;  1RJO A;  4K1V A;  2XH9 A;  3CCE 3;  2A15 A;  3DGL A;  2B1X B;  3GZX B;  3F7X A;  3FF0 A;  1LNH A;  3FG3 A;  3NQZ A;  3X3Z A;  2GEY A;  5KP1 A;  5JPP A;  3J7Y d;  2FNQ A;  3QRD A;  4RNY A;  4R9L A;  5BVB A;  3BNC A;  1GY7 A;  3F40 A;  4LSO A;  1OUN A;  1QJG A;  3VGN A;  3CME 3;  2IUJ A;  5JBS A;  2RGQ A;  4L8P A;  2HMK B;  1FGQ A;  3OWU A;  1O7M B;  2CG0 A;  2LYX A;  3H51 A;  2Z76 A;  1K9M 4;  2I9W A;  4FCM A;  4OK0 A;  1DVD A;  4N6U A;  3S27 A;  4FMA A;  3MG3 A;  3H3H A;  1NB5 I;  1IT8 A;  2CFD A;  3K7C A;  3CC2 3;  1FGT A;  3SOY A;  4AKZ A;  4MMX B;  4R4K A;  5LC6 A;  2XGL A;  2GXF A;  3BND A;  1JJ2 2;  5AIH A;  1DMM A;  2WOF A;  6STD A;  1O7W B;  5AIF A;  2Y74 A;  3EC9 A;  1M9G A;  1K8A 4;  3JUN A;  1IVX A;  3DMC A;  3LT9 A;  3BLZ A;  3WOF B;  1PFP A;  1NJI 4;  1J2B A;  4MEI A;  2W9Q A;  1W2Z A;  3ALA A;  2W56 B;  1VQ4 3;  4KVH A;  4HKV B;  1AV4 A;  3GAX A;  3UJM A;  4K1U A;  3HZP A;  3UNL A;  2M7O A;  4N6N B;  4CDL A;  3G4S 3;  3FH1 A;  1SPU A;  1O7H B;  3NBJ A;  2BO9 B;  3JUM A;  1A2K A;  1VQ5 3;  4OVM A;  1VQM 3;  5CK6 A;  3G0K A;  1YGE A;  1IQX A;  1IQ8 A;  1K41 A;  3U1W A;  3FZW A;  1MNL A;  2CW9 A;  4FMB A;  3T8U A;  1A90 A;  3LTA A;  4G1M B;  3NV0 B;  4HM0 B;  3S29 A;  1YJW 3;  1DVC A;  1LVN A;  3L0R A;  5DRV A;  2KRT A;  3IJE B;  3GZB A;  3OXA A;  2XGN A;  1S72 3;  4EV5 A;  3G71 3;  4JF8 A;  3FLJ A;  3KSE D;  1OHP A;  3MPH A;  2OOV A;  3BNB A;  1OHS A;  3EJV A;  3KE7 A;  1KWI A;  4EV2 A;  3Q2P A;  4LGQ A;  3NBB A;  2W2C A;  1Q86 4;  2HMO B;  2O9U X;  3WOE B;  4WHA A;  2L4V A;  3LML A;  4WWU C;  4OUQ A;  3SVA A;  3OV4 A;  5KP4 A;  7STD A;  1RN7 A;  1KQS 2;  2GU1 A;  1DMQ A;  1ULI B;  1HKX A;  3KII A;  4X2H A;  1M1K 4;  2W03 A;  5IEP A;  1YJ9 3;  4FR9 A;  3BNE A;  1Q81 4;  3NV0 A;  1VQL 3;  5D82 A;  5BXQ A;  4AKY A;  1U8C B;  4R9K A;  4BTW A;  1RKY A;  5HGR A;  3LXU X;  4LMI A;  3TDG A;  1JB5 A;  2W04 A;  2MF7 A;  5AEW B;  3LT8 A;  4KFD A;  3S67 A;  2OTL 3;  2CWT A;  4HYZ A;  3RDE A;  1KD1 4;  3CNM A;  4O8S A;  4O02 B;  4R80 A;  2FXT A;  4HM8 B;  2CK3 H;  2IUK A;  3DGN A;  3HII A;  1W6G A;  3EF8 A;  4HM6 B;  2BHM A;  1C7H A;  3K5T A;  1JNQ A;  4BTY A;  5IG3 A;  4WP5 A;  1F8N A;  3K0Z A;  3EQQ B;  5AIG A;  4L8O A;  4J9A A;  3RGA A;  3EB8 A;  3HX8 A;  2RSX A;  4WYK A;  4EBG A;  3NBR A;  3F8H A;  4HZ9 B;  4HM3 B;  1ROA A;  1WMP A;  3B4O A;  2INX A;  1JN5 B;  2XFT A;  3F9S A;  3SLU A;  3CCU 3;  1OAC A;  1VQP 3;  1YJN 3;  4FMC A;  3WMD A;  2F98 A;  3WA2 X;  5IEN A;  1GS3 A;  1JB4 A;  1FGM A;  1UUV B;  1W4N A;  3WDG B;  2BT3 A;  3K9M C;  3MWZ A;  3IMA B;  2QIY A;  1IDP A;  3IPT A;  4IIA A;  4XDV A;  3V99 A;  3I0Y A;  3LYG A;  4H61 A;  2LQV A;  2CHC A;  4XDW A;  2XFS A;  2GBX B;  2BMO B;  3KZT A;  2BMQ B;  5G2G A;  3CD6 3;  1VQ8 3;  1JKG B;  3F7S A;  3LTC A;  1AVK A;  3STD A;  5D83 A;  5I97 A;  1JRQ A;  1A2V A;  3JUO A;  3X3X A;  1GY5 A;  5TGN A;  5JPU A;  2CFL A;  3JUP A;  1WNH A;  2Z7A A;  2E2U A;  1JB2 A;  1VQO 3;  1CYV A;  4KFE A;  5EEO A;  1IVV A;  3EN1 B;  1MOL A;  2CFG A;  5CXO A;  4FCZ A;  3DZL A;  1S5A A;  3M8C A;  3OX9 A;  1W02 A;  1OPY A;  1T5Y A;  4H3U A;  2XSH B;  3PGB A;  4FMD A;  3WOD G;  2YFL B;  1OF5 A;  2WGO A;  2Z6B A;  5AYS C;  1KC8 4;  1N5H A;  4K61 A;  1UI8 A;  1Q82 4;  2QEX 3;  3G16 A;  3FG1 A;  3PS8 A;  5D81 A;  3FG4 A;  2HML B;  3EE1 A;  1ASK A;  2YFI B;  2FGT A;  1N9J A;  4RBN A;  1KSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...