2IMJA

X-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
AQVRPPLPPFTRESAIEKIRLAEDGWNSRDPERVSLAYTLDTQWRNRAEFAHNREEAKAFLTRKWAKELDYRLIKELWAFTDNRIAVRYAYEWHDDSGNWFRSYGNENWEFDEQGLMARRFACINDMPIKAQERKFHWPLGRRPDDHPGLSELGLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein DUF1348
publication title Crystal Structure of the hypothetical protein (DUF1348) from Pseudomonas fluorescens, Northeast Structural Genomics target PlR14.
rcsb
source organism Pseudomonas fluorescens pf-5
molecule tags Structural genomics, unknown function
total genus 54
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07080 DUF1348 Protein of unknown function (DUF1348)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2imjA01
1K41A 3K0ZA 4XDWA 5IEOA 4L8PA 4L7KA 5KP1A 4HM7B 4H3UA 2HMJB 3ER7A 4HM2B 3H51A 4HM5B 1OGXA 3CNMA 5STDA 2RFRA 1AR0A 4HKVB 4R9LA 2CKFB 3DUKA 4FCJA 2Z7AA 4XBTA 1OF5B 5BXQA 3OX9A 4WP5A 4RZMA 5IERA 3SOYA 1DMMA 1EG9B 3I0YA 1GYBA 5AIFA 4R1KA 2B24B 3B8LA 3OV4A 3KKGA 3GZBA 5CXOA 3MSOA 3D9RA 5AIGA 3OWSA 2INXA 1BUQA 1O7NB 2GBWB 2HMKB 4OVMA 5IG0A 4J8TA 3VSYA 3T8NA 1U5OA 5AEWB 1OHOA 3EN8A 4L8OA 3CPOA 3NHXA 3F40A 1Q40A 1A2KA 1JN5A 3E99A 1GS3A 3MYTA 4HM1B 1HKXA 4K1VA 4HM3B 2RCDA 4LMIA 3HX8A 5JPUA 3GZRA 3MG2A 3OXAA 1JKGB 2B1XB 4I4KA 2W2CA 5AIIA 4X2HA 2HMLB 5CF1A 3G8ZA 3DZLA 1GY6A 3JUQA 3B4OA 3JUMA 1NDOB 3KE7A 4XDVA 3NUVA 1O7HB 1VZZA 4OUQA 5KP3A 5CF2A 1OUNA 3NM2A 2I9WA 5AIHA 4HM0B 3NV0B 3G0KA 5IG3A 4KVHA 1E3RA 1QJGA 1W02A 3MKIA 3MHEA 3JUNA 4WWUC 1CQSA 4U13A 1C7HA 1NWWA 3EHCA 3FSDA 5CLKA 5BVBA 2F86B 3A76A 1Q42A 1ZX2A 2YFLB 1O7PB 4HZ9B 3BB9A 3FF2A 3HZPA 2XR8B 3F14A 1ULIB 5CK6A 1W00A 2XSOB 2BNGA 3EC9A 3MG1A 3IPTA 3K7CA 4HM6B 8CHOA 3FLJA 4WYKA 5IENA 4PEJA 3GZYB 4HVNA 5FW5A 3F7XA 3M8CA 3FGYA 2YFIB 4FCMA 3JUOA 2BMQB 5HGRA 3KSPA 3F7SA 1IDPA 1GY5A 1EA2A 5D82A 5G2GA 4N3VA 3ECFA 3T8UA 1WQLB 2BMOB 3EN1B 3WMDA 2OWPA 1E97A 7STDA 4XBXA 3EJVA 1OPYA 3ROBA 1O7GB 4CDLA 3F8XA 4X2OA 5TGNA 2Z77A 3MG3A 5IEPA 5DREA 2XSHB 3LZAA 1GY7A 2HMNB 1Q40B 1JN5B 3SEDA 4ORLA 1OF5A 3BLZA 4J9AA 2GEXA 1TUHA 3H3HA 4XBYA 3STDA 1OGZA 5JPPA 1JB5A 2HMOB 4IIAA 1O7WB 5KP4A 3S5CA 4XB5A 2Z76A 5IF6A 5AEUB 2GBXB 5D81A 4K1UA 3GZXB 1W01A 3GRDA 1DMNA 3KZTA 2R4IA 1JB2A 1UUWB 2CHCA 4R9KA 3JUPA 3CU3A 3DMCA 2GXFA 1Z1SA 1QMAA 2YFJB 1NU3A 4LGQA 4MJDA 3B4PA 3FZWA 1OHSA 1ZO2A 3CNXA 2F99A 3NXJA 1ASKA 2XRXB 1JKGA 3F8HA 3LYGA 4XM4A 4GB5A 3EF8A 2HMMB 3RGAA 2JQ5A 4HM4B 5IG4A 1JB4A 3GWRA 2GEYA 5EVHA 4LEHA 3EBYA 3B7CA 3DM8A 3OWUA 1DMQA 1UUVB 2K54A 1STDA 5DRVA 1S5AA 3UNLA 3F9SA 1E3VA 2BMRB 2QGUA 3FH1A 4WYKB 3SOAA 6STDA 2PZVA 1OH0A 4HM8B 2RGQA 3NV0A 3OWYA 1TP6A 3DXOA 5IG5A 4HZBB 3RGRA 1ISKA 2QIYA 1SJWA 1ULJB 2STDA 3UJMA 1OCVA 3EQQB 2IMJA 3VGNA 3HK4A 3G16A 1OHPA 4STDA 3EBTA 4Q53A 3EX9A 3Q90A 3FKAA 2F98A 2UX0A 4HJLB 3NBRA 2A15A 3FF0A 1O7MB 5AI1A 5D83A 1W6YA
chains in the Genus database with same CATH superfamily
1K41A 3CPW2 2IUKA 3K0ZA 4XDWA 3CCR3 5IEOA 3SX1A 1RGAA 1LOWA 4L8PA 1A2PA 1GOVA 2C11A 1RTUA 4L7KA 2O9UX 3X3XA 5KP1A 2YX9A 2LQVA 1RNTA 3DY5A 4H3UA 2E2VA 3O8YA 4HM7B 2HMJB 4FR9A 3ER7A 3BU4A 2O3OA 1N5HA 4MEIA 4HM2B 1BRGA 3H51A 4HM5B 1L5GB 3WR2A 1OGXA 3AGOA 3CNMA 3WDGB 5STDA 1I70A 2RFRA 3CCV3 1AR0A 4HKVB 1W5ZA 1UCJA 1OACA 4R9LA 3WHOA 7GSPA 2CKFB 3MPHA 4LZIA 2XFSA 3DUKA 1YVSA 1YIT3 3IJEB 3FG1A 2W56B 4FCJA 2Z7AA 4XBTA 2FGTA 4HBRA 1SPUA 3JVCA 1OF5B 1WNHA 1BNEA 1FUTA 1VQN3 5BXQA 4WFOA 2WOHA 1MOLA 3OX9A 3EE1A 4KZ1A 4EC6A 1BUJA 2GU3A 4WP5A 1Q9EA 4WHAA 1LRAA 1RN7A 1UCIA 4RZMA 1TRPA 1SIHA 3LXUX 5IERA 3AMOA 3SOYA 5EEOA 1DMMA 2Y74A 1EG9B 3I0YA 3V98A 2W03A 1A67A 1GYBA 5AIFA 1RCKA 1VQK3 4R1KA 1NJI4 2B24B 3B8LA 3OV4A 3KKGA 1G0TA 2BIRA 1BNGA 4I5QA 3GZBA 5CXOA 3MSOA 3D9RA 4HYZA 1FGQA 2QA43 5AIGA 1JBSA 5M1AA 2CFDA 2GSPA 3PGBA 3OWSA 2W6JH 3NM7A 2INXA 1BUQA 1YGEA 1Q864 1YJ93 1NB3I 3DGOA 3PCRA 1LOXA 1V57A 3G6E3 1O7NB 2GBWB 4CJNA 2CX1A 5JBSA 3S67A 1FZUA 1AVKA 1BU4A 2HMKB 1PFPA 2P0XA 2W0QA 4OVMA 1VQ63 2W9PA 1X1XA 3KSED 1IV7A 1M1K4 1GMPA 2W9QA 4BTXA 5IG0A 4J8TA 1UUGB 1JNQA 1KC84 1W2ZA 1B2UA 3VSYA 3T8NA 1U5OA 4IPBA 1BSDA 2AAEA 1I3FA 1OHOA 2XF3A 3EN8A 1RGLA 5AEWB 4L8OA 3D5GA 3LT8A 3WOFB 1EEJA 3IMAB 3CPOA 3NHXA 1VQ73 2FNQA 3F40A 1Q40A 1A2KA 1UI8A 1DE3A 3LTAA 1JN5A 3X40A 3E99A 3LH4A 1X1UA 3FG4A 4GL6A 1GS3A 1VQ93 1LQGC 3DGMA 3GAXA 3BIRA 3MYTA 1HZ1A 1HKXA 4HM1B 4K1VA 2P38A 4G1MB 4HM3B 4EW5A 3BNBA 3G4S3 2LYXA 1LOYA 2E2TA 2RCDA 4LMIA 4RNZA 1Q7HA 3HX8A 6GSPA 2KAAA 5G1LA 3D79A 5JPUA 2HOHA 3GZRA 2CFLA 3MG2A 3OXAA 1RKYA 1IQXA 1JKGB 2B1XB 4I4KA 4FCZA 3PYJA 1FGOA 3BNCA 2W2CA 1IK3A 5AIIA 4X2HA 2HMLB 2SARA 1W6GA 1W7CA 2KF4A 2C4BA 1GOUA 5CF1A 1MWUA 3X42A 4HAAA 1AV4A 1W4NA 1D6YA 2RNTA 3G8ZA 1G96A 3DZLA 1GY6A 3JUQA 2CWVA 3B4OA 1CEWI 1Y4KA 2BHMA 1GD4A 1I0XA 3JUMA 3QK9A 5HOHA 3DGLA 1W2B2 1NDOB 3KE7A 1QVG2 4XDVA 3NUVA 1I3IA 4FMAA 4FMCA 2CH9A 1B2XA 1O7HB 1VZZA 3CCS3 4OUQA 1WMOA 5KP3A 5CF2A 3Q1CA 5I97A 1OUNA 1Q7Y4 1D6UA 5ELJA 3NM2A 5M18A 1MWSA 2I9WA 1K734 1N9EA 1RRLA 5AIHA 3S28A 3L0RA 3ALAA 1M9GA 2XGNA 3NV0B 4HM0B 4KFFA 2ML5A 3WA2X 3G0KA 3CCQ3 2ZA4A 4EBGA 2WOFA 4EYCA 5IG3A 3FG3A 4KVHA 1E3RA 1UGHI 4O2HA 3CCJ3 2XH9A 3T0UA 1QJGA 1ROAA 1W02A 2E2UA 2MF7A 1V74A 3MKIA 3I563 3MHEA 3JUNA 4WWUC 3LOYA 1FUSA 1IVUA 2F56A 1CQSA 4N6LA 4NHFA 1QVF2 3J7Yd 4U13A 1C7HA 2UGIA 1NWWA 1IVXA 3EHCA 3FSDA 3HIGA 3PCSA 1HYFA 5ELUA 3KIIA 3U1WA 2MC8A 5CLKA 1JRQA 4EV2A 2AADA 5BVBA 1CYUA 2RBIA 3URPA 3VF1A 4O02B 2BU4A 4N6TA 1BSCA 2KF3A 1B27A 2F86B 1A90A 3I553 4BTWA 3A76A 1Q42A 3ZG5A 1ZX2A 2YFLB 3NBBA 1KSIA 1O7PB 4HZ9B 1M904 4KFEA 3A5EA 3BB9A 3FF2A 3HZPA 4NPBA 4CPKA 2XR8B 3F14A 1BANA 2F5MA 1ULIB 2KF5A 3QRDA 5CK6A 1LNIA 1QAFA 4GHOA 1W00A 3BNEA 2XSOB 1PY3A 1T3BA 1FUWA 1YVBI 1BOXA 1F8NA 2BNGA 3EC9A 3MG1A 1VQ53 1T5YA 3IPTA 3KN4A 2ML6A 8RNTA 1IT8A 1A2VA 3UL6A 2KXGA 3K7CA 3ZFZA 2D1WA 1JBTA 3AHWA 4HM6B 8CHOA 2SBLA 1YNVX 3FLJA 5LC6A 4WYKA 5IENA 1NB5I 3SXXA 3N54B 4PEJA 4AKZA 3GZYB 4HVNA 1LOVA 2IY2A 5FW5A 1VQL3 1TU5A 3U97A 2CFKA 2P09A 2GU1A 3NX0A 3F7XA 1DVCA 3M8CA 3FGYA 1K8A4 2OOVC 1RNBA 1TFKA 1Q814 5M19A 2YFIB 2OOVA 4FCMA 1NNVA 3GSPA 3JUOA 2OTL3 2BMQB 5HGRA 3KSPA 1BSEA 1I0VA 1D6ZA 4K90B 3F7SA 4J5KA 1IDPA 1JBRA 1GY5A 1I2GA 4KT3B 1EA2A 5D82A 5G2GA 1NO3A 4N3VA 1WMPA 2XEPA 2WGQA 3ECFA 3T8UA 3AMOB 4K61A 2K3DA 3KCHA 3WODG 1Q824 2FXTA 1WQLB 2BMOB 1IVWA 3EN1B 1SARA 3WMDA 2OWPA 1BSAA 1E97A 4AEQA 1B20A 7STDA 1AVLA 4XBXA 2F4YA 2WO0A 4MMXB 2ZL8A 4RNTA 1KWIA 1IVVA 3EJVA 1B2MA 5AYSC 1SIIA 4BU4A 1N8R4 1OPYA 5A0OB 1EQKA 1MNLA 3ROBA 1O7GB 1B2SA 1RJOA 3MWZA 3LT9A 3BNDA 4CDLA 2L1SA 3F8XA 3HI7A 1MWRA 1V58A 4X2OA 1B3SA 1IU7A 2Z77A 2ZDJA 3MG3A 5TGNA 3X41A 1LQMB 1UCLA 5IEPA 4N6OB 5DREA 4LSOA 1RCLA 1RGKA 2CWTA 1GMRA 2CC3A 2KF6A 2XSHB 3LZAA 5BIRA 1R4YA 3AHSA 3N8BA 1GY7A 2CIUA 3CC23 4BL3A 4JF8A 3X3ZA 1BRKA 4EV5A 4OK0A 2HMNB 1BGSA 1TTOA 2W56A 5GSPA 1Q40B 1I2FA 1RGEA 2OQEC 1JN5B 3SEDA 2CFWA 4ORLA 1BSBA 3SVAA 1OF5A 9RNTA 1QAKA 2OQEA 1IQYA 4R80A 2IUJA 3BLZA 4J9AA 2UUGC 2GEXA 3V99A 3KFQC 1TUHA 3G713 3H3HA 4XBYA 3STDA 1YHQ3 1VQ83 1OGZA 5JPPA 1B21A 3HOHA 5G1KA 4HOHA 1JB5A 3RNTA 4ZM8A 2HMOB 1UDII 4N6V0 3S27A 4IIAA 1GD3A 1O7WB 5KP4A 3S5CA 1SQWA 7RNTA 1JZDA 1G02A 1N8QA 2RSXA 1GSPA 1CYVA 1RGHA 4XB5A 4BIRA 2Z76A 1VQ43 1KQS2 4ILFA 2IYJA 4GSPA 5AEUB 5IF6A 2GBXB 1IQ8A 5D81A 1UW1A 4K1UA 2XFTA 3D5IA 1VQM3 1BNIA 2XGLA 3GZXB 2H0IA 2J8XB 3K5TA 1BNFA 1RDSA 4RNYA 3D4AA 1W01A 3UL5A 1YIJ3 3GRDA 1FYSA 1DMNA 1VQP3 4N6MA 3DH2A 2R4IA 3KZTA 4RBNA 1JB2A 1I8VA 1UUWB 1MGRA 1VQQA 2CHCA 2L4VA 4R9KA 1DYUA 3SLUA 1FGMA 5IW9A 2M7OA 1B2ZA 1RGCA 4JRFA 3JUPA 3CU3A 4BTYA 1BRNL 1BIRA 1ZGXA 4MMZB 4AKYA 4DKIA 3DMCA 3S29A 4FMDA 1YJW3 2H0HA 2D42A 1QALA 2GXFA 1RN1A 1Z1SA 1QMAA 2K0MA 2KCDA 2YFJB 4KFDA 2OTJ3 3LTBA 1AY7A 2BT3A 5AYRB 3HIIA 1LNHA 3Q2PA 3PZWA 3AGNA 1U8CB 1BNSA 1NU3A 1WTHA 4CCVA 4NREA 5EQLA 4LGQA 4QWTA 1IV9A 1AQZA 1EUIC 3DGYA 4MJDA 3B4PA 3FZWA 1OHSA 3CC73 3CC43 1RHLA 1ZO2A 1BNRA 3CNXA 3PXMA 2P05A 3CCU3 2F99A 3NQYA 3LTDA 1BNJA 1BRHA 3NXJA 1LXEA 1ASKA 1X1YA 2XRXB 3OW22 1JKGA 3NQZA 4FMBA 3F8HA 1PYLA 2QEX3 1BVIA 3LYGA 1I2EA 2H0GA 1US1A 2Z6BA 4R4KA 2C10A 1TRQA 4XM4A 4GB5A 1T2IA 1ZS7A 3EF8A 3K9MC 3LMLA 4MMYB 4J5GA 1BRSA 2HMMB 3RGAA 2JQ5A 2Q07A 1T2HA 1N5PA 2BO9B 4HM4B 1EKMA 1YI23 2W04A 5IG4A 1KD14 2KRTA 4O3VA 1DVDA 1JB4A 3GWRA 2GEYA 2Y73A 4TX4A 1RLSA 5EVHA 1FW7A 4LEHA 3EBYA 4BL2A 3B7CA 1DETA 3DM8A 3X3YA 2CW9A 1RRHA 1UGIA 3OWUA 1BAOA 1IT7A 5LC7A 1WMNA 3CMA3 1W6CA 1DMQA 3FCSB 3V92A 1UUVB 2CG0A 3NBJA 1PU4A 3CME3 2K54A 1STDA 1R4CA 1HU9A 5DRVA 1S5AA 3UNLA 3F9SA 1RN4A 3DGNA 3PS8A 1E3VA 2BMRB 2QGUA 3FH1A 4N6UA 4EXRA 1JV2B 3UB1A 4WYKB 2CFGA 3Q3FA 3SOAA 3N9HA 6STDA 1UCKA 2PZVA 1CH0A 1RGFA 3LTCA 1OH0A 4HM8B 2RGQA 1TFOA 3NV0A 3OWYA 1TP6A 5BU4A 2OCTA 2JDIH 1RMSA 1FA3A 1IYYA 1ROVA 2R41A 6RNTA 2F5WA 3WOEB 3DXOA 1N9JA 5IG5A 3SYUA 1K9M4 1JZOA 4HZBB 4IT7A 3RGRA 3K63A 1STFI 2IA7A 2QIYA 3CCE3 1ISKA 5RNTA 1SJWA 1ULJB 2STDA 3UJMA 3CCL3 1VQO3 1JJ22 1OCVA 3CCM3 1S723 1M1XB 3CD63 3EQQB 2IMJA 2ZHXB 1X1WA 3HK4A 3VGNA 1BRIA 1MGWA 2CK3H 3G16A 5FGOA 1OHPA 4STDA 1LVNA 3EB8A 3EBTA 2V1LA 1UI7A 1GMQA 1C54A 4Q53A 2CWUA 5D83A 2WGOA 1RSNA 1YJN3 1TJDA 3EX9A 3Q90A 4LYLB 3FKAA 2F98A 2PNCA 4H61A 1GOYA 4O8SA 1J2BA 4N6NB 2UX0A 2CX0A 3CXC2 1YGWA 1BRJA 4HJLB 3D3LA 3NBRA 3TDGA 2P0MA 3RDEA 2A15A 1FGRA 2CG1A 3ZG0A 1K28A 3FF0A 3WA3A 1FGTA 1RGGA 1O7MB 5AI1A 1TIJA 1MWTA 1W6YA
chains in the Genus database with same CATH topology
1K41A 3CPW2 2IUKA 3K0ZA 4XDWA 3CCR3 5IEOA 3SX1A 4L8PA 2C11A 4L7KA 2O9UX 3X3XA 5KP1A 2YX9A 2LQVA 3DY5A 4HM7B 4H3UA 2E2VA 3O8YA 2HMJB 4FR9A 3ER7A 2O3OA 1N5HA 4MEIA 4HM2B 3H51A 4HM5B 1L5GB 1OGXA 3CNMA 3WDGB 5STDA 2RFRA 3CCV3 1AR0A 4HKVB 1W5ZA 1OACA 4R9LA 2CKFB 3MPHA 4LZIA 2XFSA 3DUKA 1YIT3 3IJEB 3FG1A 2W56B 4FCJA 2Z7AA 4XBTA 2FGTA 4HBRA 1SPUA 3JVCA 1OF5B 1WNHA 1VQN3 5BXQA 4WFOA 2WOHA 1MOLA 3OX9A 3EE1A 4KZ1A 4EC6A 2GU3A 4WP5A 4WHAA 1RN7A 4RZMA 1SIHA 3LXUX 5IERA 3AMOA 3SOYA 5EEOA 1DMMA 2Y74A 1EG9B 3I0YA 3V98A 2W03A 1A67A 1GYBA 5AIFA 1VQK3 4R1KA 1NJI4 2B24B 3B8LA 3OV4A 3KKGA 3GZBA 5CXOA 3MSOA 3D9RA 4HYZA 1FGQA 2QA43 5AIGA 2CFDA 3PGBA 3OWSA 2W6JH 3NM7A 2INXA 1BUQA 1YGEA 1Q864 1YJ93 1NB3I 3DGOA 3PCRA 1LOXA 3G6E3 1O7NB 2GBWB 5JBSA 3S67A 1AVKA 2HMKB 4OVMA 1PFPA 2P0XA 2W0QA 1VQ63 2W9PA 3KSED 1IV7A 1M1K4 2W9QA 4BTXA 5IG0A 4J8TA 1JNQA 1KC84 1W2ZA 3VSYA 3T8NA 1U5OA 4IPBA 2XF3A 5AEWB 1OHOA 3EN8A 4L8OA 3LT8A 3WOFB 3IMAB 3CPOA 3NHXA 1VQ73 2FNQA 3F40A 1Q40A 1A2KA 1UI8A 3LTAA 1JN5A 3X40A 3E99A 3LH4A 3FG4A 4GL6A 1GS3A 1VQ93 3GAXA 3DGMA 3MYTA 4HM1B 1HKXA 4K1VA 2P38A 4G1MB 4HM3B 3G4S3 3BNBA 2LYXA 2RCDA 2E2TA 4LMIA 4RNZA 3HX8A 5JPUA 3GZRA 3MG2A 2CFLA 3OXAA 1RKYA 1IQXA 1JKGB 2B1XB 4I4KA 4FCZA 3PYJA 1FGOA 3BNCA 2W2CA 1IK3A 5AIIA 4X2HA 2HMLB 1W6GA 1W7CA 5CF1A 3X42A 1AV4A 1W4NA 1D6YA 3G8ZA 1G96A 3DZLA 1GY6A 3JUQA 2CWVA 3B4OA 1CEWI 1Y4KA 2BHMA 1GD4A 3JUMA 3QK9A 3DGLA 1W2B2 1NDOB 3KE7A 1QVG2 4XDVA 3NUVA 4FMAA 4FMCA 2CH9A 1O7HB 1VZZA 3CCS3 4OUQA 1WMOA 5KP3A 5CF2A 3Q1CA 5I97A 1OUNA 1D6UA 5ELJA 3NM2A 2I9WA 1K734 1N9EA 1RRLA 5AIHA 3S28A 3L0RA 3ALAA 1M9GA 2XGNA 3NV0B 4HM0B 4KFFA 2ML5A 3WA2X 3G0KA 3CCQ3 4EBGA 2WOFA 4EYCA 5IG3A 3FG3A 4KVHA 1E3RA 4O2HA 3CCJ3 2XH9A 3T0UA 1QJGA 1ROAA 1W02A 2E2UA 2MF7A 1V74A 3MKIA 3I563 3MHEA 3JUNA 4WWUC 3LOYA 1IVUA 4NHFA 1CQSA 4N6LA 1QVF2 3J7Yd 4U13A 1C7HA 1NWWA 1IVXA 3EHCA 3FSDA 3HIGA 3PCSA 5ELUA 3U1WA 3KIIA 2MC8A 5CLKA 1JRQA 4EV2A 5BVBA 1CYUA 3VF1A 4O02B 4N6TA 2F86B 1A90A 3I553 4BTWA 3A76A 1Q42A 1ZX2A 2YFLB 3NBBA 1KSIA 1O7PB 4HZ9B 1M904 4KFEA 3BB9A 3FF2A 3HZPA 2XR8B 3F14A 1ULIB 3QRDA 5CK6A 1QAFA 1W00A 3BNEA 2XSOB 1FUWA 1YVBI 1F8NA 2BNGA 3EC9A 3MG1A 1VQ53 1T5YA 3IPTA 3KN4A 2ML6A 1IT8A 1A2VA 3UL6A 2KXGA 3K7CA 2D1WA 4HM6B 8CHOA 2SBLA 3FLJA 5LC6A 4WYKA 5IENA 1NB5I 3SXXA 3N54B 4PEJA 4AKZA 3GZYB 4HVNA 5FW5A 1VQL3 1TU5A 3U97A 2CFKA 2P09A 2GU1A 3NX0A 3F7XA 1DVCA 3M8CA 3FGYA 1K8A4 2OOVC 1TFKA 1Q814 2YFIB 2OOVA 4FCMA 3JUOA 2OTL3 2BMQB 5HGRA 3KSPA 1D6ZA 4K90B 3F7SA 1IDPA 1GY5A 1EA2A 5D82A 5G2GA 1NO3A 4N3VA 1WMPA 2XEPA 2WGQA 3ECFA 3T8UA 3AMOB 4K61A 3WODG 1Q824 2FXTA 1WQLB 2BMOB 1IVWA 3EN1B 3WMDA 2OWPA 1E97A 4AEQA 7STDA 1AVLA 4XBXA 2WO0A 4MMXB 2ZL8A 1KWIA 1IVVA 3EJVA 5AYSC 1SIIA 1EQKA 1N8R4 1OPYA 5A0OB 1MNLA 3ROBA 1O7GB 1RJOA 3MWZA 3LT9A 3BNDA 4CDLA 3HI7A 3F8XA 4X2OA 5TGNA 1IU7A 2Z77A 2ZDJA 3MG3A 3X41A 5IEPA 4N6OB 5DREA 4LSOA 2CWTA 2CC3A 2XSHB 3LZAA 3N8BA 1GY7A 2CIUA 3CC23 4JF8A 3X3ZA 4EV5A 4OK0A 2HMNB 2W56A 1Q40B 2OQEC 1JN5B 3SEDA 2CFWA 4ORLA 3SVAA 1OF5A 1QAKA 2OQEA 1IQYA 4R80A 2IUJA 3BLZA 4J9AA 2GEXA 3V99A 3KFQC 1TUHA 3G713 3H3HA 4XBYA 3STDA 1YHQ3 1VQ83 1OGZA 5JPPA 1JB5A 4ZM8A 2HMOB 3S27A 4N6V0 4IIAA 1GD3A 1O7WB 5KP4A 3S5CA 1SQWA 1N8QA 2RSXA 4XB5A 1CYVA 1VQ43 2Z76A 1KQS2 5IF6A 5AEUB 2GBXB 1IQ8A 5D81A 1UW1A 4K1UA 2XFTA 1VQM3 2XGLA 3GZXB 4RNYA 3K5TA 1W01A 3UL5A 1YIJ3 3GRDA 1DMNA 1VQP3 4N6MA 3KZTA 2R4IA 4RBNA 1JB2A 1UUWB 2CHCA 2L4VA 4R9KA 1DYUA 3SLUA 1FGMA 5IW9A 2M7OA 4JRFA 3JUPA 3CU3A 4BTYA 4MMZB 4AKYA 3DMCA 3S29A 4FMDA 1YJW3 2D42A 1QALA 2GXFA 1Z1SA 2KCDA 1QMAA 2K0MA 2YFJB 4KFDA 2OTJ3 3LTBA 5AYRB 2BT3A 3HIIA 1LNHA 3Q2PA 3PZWA 1U8CB 1NU3A 1WTHA 4CCVA 4NREA 5EQLA 4LGQA 4QWTA 1IV9A 4MJDA 3CC43 3CC73 3B4PA 3FZWA 1OHSA 1ZO2A 3CNXA 3PXMA 2P05A 3CCU3 2F99A 3NQYA 3LTDA 3NXJA 1LXEA 1ASKA 2XRXB 3OW22 1JKGA 3NQZA 4FMBA 3F8HA 2QEX3 3LYGA 1US1A 2Z6BA 4R4KA 2C10A 4XM4A 4GB5A 3EF8A 3K9MC 3LMLA 4MMYB 2HMMB 3RGAA 2JQ5A 2Q07A 1N5PA 2BO9B 4HM4B 1EKMA 1YI23 2W04A 5IG4A 1KD14 2KRTA 4O3VA 1DVDA 1JB4A 3GWRA 2GEYA 2Y73A 4TX4A 5EVHA 4LEHA 3EBYA 3B7CA 3DM8A 3X3YA 2CW9A 1RRHA 3OWUA 1IT7A 5LC7A 1WMNA 3CMA3 1W6CA 1DMQA 3FCSB 3V92A 1UUVB 2CG0A 3NBJA 1PU4A 3CME3 2K54A 1STDA 1R4CA 1HU9A 5DRVA 1S5AA 3UNLA 3F9SA 3PS8A 3DGNA 4N6UA 1E3VA 2BMRB 2QGUA 3FH1A 4EXRA 1Q7Y4 1JV2B 3UB1A 4WYKB 2CFGA 3SOAA 3N9HA 6STDA 2PZVA 3LTCA 1OH0A 4HM8B 2RGQA 1TFOA 3NV0A 3OWYA 1TP6A 2OCTA 2JDIH 1FA3A 1ROVA 3WOEB 3DXOA 1N9JA 5IG5A 1K9M4 4HZBB 4IT7A 3RGRA 3K63A 1STFI 2IA7A 2QIYA 3CCE3 1ISKA 1SJWA 1ULJB 2STDA 3UJMA 3CCL3 1VQO3 1JJ22 1OCVA 3CCM3 1S723 1M1XB 3CD63 3EQQB 2IMJA 3VGNA 3HK4A 2CK3H 3G16A 5FGOA 1OHPA 4STDA 1LVNA 3EB8A 3EBTA 2V1LA 1UI7A 4Q53A 2CWUA 2WGOA 1YJN3 3EX9A 3Q90A 3FKAA 2F98A 2PNCA 4H61A 4O8SA 1J2BA 4N6NB 2UX0A 3CXC2 4HJLB 3D3LA 3NBRA 3TDGA 2P0MA 3RDEA 2A15A 1FGRA 2CG1A 1K28A 3FF0A 3WA3A 1FGTA 1O7MB 5AI1A 1TIJA 5D83A 1W6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K41 A;  3K0Z A;  4XDW A;  5IEO A;  4L8P A;  4L7K A;  5KP1 A;  4HM7 B;  4H3U A;  2HMJ B;  3ER7 A;  4HM2 B;  3H51 A;  4HM5 B;  1OGX A;  3CNM A;  5STD A;  2RFR A;  1AR0 A;  4HKV B;  4R9L A;  2CKF B;  3DUK A;  4FCJ A;  2Z7A A;  4XBT A;  1OF5 B;  5BXQ A;  3OX9 A;  4WP5 A;  4RZM A;  5IER A;  3SOY A;  1DMM A;  1EG9 B;  3I0Y A;  1GYB A;  5AIF A;  4R1K A;  2B24 B;  3B8L A;  3OV4 A;  3KKG A;  3GZB A;  5CXO A;  3MSO A;  3D9R A;  5AIG A;  3OWS A;  2INX A;  1BUQ A;  1O7N B;  2GBW B;  2HMK B;  4OVM A;  5IG0 A;  4J8T A;  3VSY A;  3T8N A;  1U5O A;  5AEW B;  1OHO A;  3EN8 A;  4L8O A;  3CPO A;  3NHX A;  3F40 A;  1Q40 A;  1A2K A;  1JN5 A;  3E99 A;  1GS3 A;  3MYT A;  4HM1 B;  1HKX A;  4K1V A;  4HM3 B;  2RCD A;  4LMI A;  3HX8 A;  5JPU A;  3GZR A;  3MG2 A;  3OXA A;  1JKG B;  2B1X B;  4I4K A;  2W2C A;  5AII A;  4X2H A;  2HML B;  5CF1 A;  3G8Z A;  3DZL A;  1GY6 A;  3JUQ A;  3B4O A;  3JUM A;  1NDO B;  3KE7 A;  4XDV A;  3NUV A;  1O7H B;  1VZZ A;  4OUQ A;  5KP3 A;  5CF2 A;  1OUN A;  3NM2 A;  2I9W A;  5AIH A;  4HM0 B;  3NV0 B;  3G0K A;  5IG3 A;  4KVH A;  1E3R A;  1QJG A;  1W02 A;  3MKI A;  3MHE A;  3JUN A;  4WWU C;  1CQS A;  4U13 A;  1C7H A;  1NWW A;  3EHC A;  3FSD A;  5CLK A;  5BVB A;  2F86 B;  3A76 A;  1Q42 A;  1ZX2 A;  2YFL B;  1O7P B;  4HZ9 B;  3BB9 A;  3FF2 A;  3HZP A;  2XR8 B;  3F14 A;  1ULI B;  5CK6 A;  1W00 A;  2XSO B;  2BNG A;  3EC9 A;  3MG1 A;  3IPT A;  3K7C A;  4HM6 B;  8CHO A;  3FLJ A;  4WYK A;  5IEN A;  4PEJ A;  3GZY B;  4HVN A;  5FW5 A;  3F7X A;  3M8C A;  3FGY A;  2YFI B;  4FCM A;  3JUO A;  2BMQ B;  5HGR A;  3KSP A;  3F7S A;  1IDP A;  1GY5 A;  1EA2 A;  5D82 A;  5G2G A;  4N3V A;  3ECF A;  3T8U A;  1WQL B;  2BMO B;  3EN1 B;  3WMD A;  2OWP A;  1E97 A;  7STD A;  4XBX A;  3EJV A;  1OPY A;  3ROB A;  1O7G B;  4CDL A;  3F8X A;  4X2O A;  5TGN A;  2Z77 A;  3MG3 A;  5IEP A;  5DRE A;  2XSH B;  3LZA A;  1GY7 A;  2HMN B;  1Q40 B;  1JN5 B;  3SED A;  4ORL A;  1OF5 A;  3BLZ A;  4J9A A;  2GEX A;  1TUH A;  3H3H A;  4XBY A;  3STD A;  1OGZ A;  5JPP A;  1JB5 A;  2HMO B;  4IIA A;  1O7W B;  5KP4 A;  3S5C A;  4XB5 A;  2Z76 A;  5IF6 A;  5AEU B;  2GBX B;  5D81 A;  4K1U A;  3GZX B;  1W01 A;  3GRD A;  1DMN A;  3KZT A;  2R4I A;  1JB2 A;  1UUW B;  2CHC A;  4R9K A;  3JUP A;  3CU3 A;  3DMC A;  2GXF A;  1Z1S A;  1QMA A;  2YFJ B;  1NU3 A;  4LGQ A;  4MJD A;  3B4P A;  3FZW A;  1OHS A;  1ZO2 A;  3CNX A;  2F99 A;  3NXJ A;  1ASK A;  2XRX B;  1JKG A;  3F8H A;  3LYG A;  4XM4 A;  4GB5 A;  3EF8 A;  2HMM B;  3RGA A;  2JQ5 A;  4HM4 B;  5IG4 A;  1JB4 A;  3GWR A;  2GEY A;  5EVH A;  4LEH A;  3EBY A;  3B7C A;  3DM8 A;  3OWU A;  1DMQ A;  1UUV B;  2K54 A;  1STD A;  5DRV A;  1S5A A;  3UNL A;  3F9S A;  1E3V A;  2BMR B;  2QGU A;  3FH1 A;  4WYK B;  3SOA A;  6STD A;  2PZV A;  1OH0 A;  4HM8 B;  2RGQ A;  3NV0 A;  3OWY A;  1TP6 A;  3DXO A;  5IG5 A;  4HZB B;  3RGR A;  1ISK A;  2QIY A;  1SJW A;  1ULJ B;  2STD A;  3UJM A;  1OCV A;  3EQQ B;  2IMJ A;  3VGN A;  3HK4 A;  3G16 A;  1OHP A;  4STD A;  3EBT A;  4Q53 A;  3EX9 A;  3Q90 A;  3FKA A;  2F98 A;  2UX0 A;  4HJL B;  3NBR A;  2A15 A;  3FF0 A;  1O7M B;  5AI1 A;  5D83 A;  1W6Y A; 
#chains in the Genus database with same CATH topology
 1K41 A;  3CPW 2;  2IUK A;  3K0Z A;  4XDW A;  3CCR 3;  5IEO A;  3SX1 A;  1RGA A;  1LOW A;  4L8P A;  1A2P A;  1GOV A;  2C11 A;  1RTU A;  4L7K A;  2O9U X;  3X3X A;  5KP1 A;  2YX9 A;  2LQV A;  1RNT A;  3DY5 A;  4H3U A;  2E2V A;  3O8Y A;  4HM7 B;  2HMJ B;  4FR9 A;  3ER7 A;  3BU4 A;  2O3O A;  1N5H A;  4MEI A;  4HM2 B;  1BRG A;  3H51 A;  4HM5 B;  1L5G B;  3WR2 A;  1OGX A;  3AGO A;  3CNM A;  3WDG B;  5STD A;  1I70 A;  2RFR A;  3CCV 3;  1AR0 A;  4HKV B;  1W5Z A;  1UCJ A;  1OAC A;  4R9L A;  3WHO A;  7GSP A;  2CKF B;  3MPH A;  4LZI A;  2XFS A;  3DUK A;  1YVS A;  1YIT 3;  3IJE B;  3FG1 A;  2W56 B;  4FCJ A;  2Z7A A;  4XBT A;  2FGT A;  4HBR A;  1SPU A;  3JVC A;  1OF5 B;  1WNH A;  1BNE A;  1FUT A;  1VQN 3;  5BXQ A;  4WFO A;  2WOH A;  1MOL A;  3OX9 A;  3EE1 A;  4KZ1 A;  4EC6 A;  1BUJ A;  2GU3 A;  4WP5 A;  1Q9E A;  4WHA A;  1LRA A;  1RN7 A;  1UCI A;  4RZM A;  1TRP A;  1SIH A;  3LXU X;  5IER A;  3AMO A;  3SOY A;  5EEO A;  1DMM A;  2Y74 A;  1EG9 B;  3I0Y A;  3V98 A;  2W03 A;  1A67 A;  1GYB A;  5AIF A;  1RCK A;  1VQK 3;  4R1K A;  1NJI 4;  2B24 B;  3B8L A;  3OV4 A;  3KKG A;  1G0T A;  2BIR A;  1BNG A;  4I5Q A;  3GZB A;  5CXO A;  3MSO A;  3D9R A;  4HYZ A;  1FGQ A;  2QA4 3;  5AIG A;  1JBS A;  5M1A A;  2CFD A;  2GSP A;  3PGB A;  3OWS A;  2W6J H;  3NM7 A;  2INX A;  1BUQ A;  1YGE A;  1Q86 4;  1YJ9 3;  1NB3 I;  3DGO A;  3PCR A;  1LOX A;  1V57 A;  3G6E 3;  1O7N B;  2GBW B;  4CJN A;  2CX1 A;  5JBS A;  3S67 A;  1FZU A;  1AVK A;  1BU4 A;  2HMK B;  1PFP A;  2P0X A;  2W0Q A;  4OVM A;  1VQ6 3;  2W9P A;  1X1X A;  3KSE D;  1IV7 A;  1M1K 4;  1GMP A;  2W9Q A;  4BTX A;  5IG0 A;  4J8T A;  1UUG B;  1JNQ A;  1KC8 4;  1W2Z A;  1B2U A;  3VSY A;  3T8N A;  1U5O A;  4IPB A;  1BSD A;  2AAE A;  1I3F A;  1OHO A;  2XF3 A;  3EN8 A;  1RGL A;  5AEW B;  4L8O A;  3D5G A;  3LT8 A;  3WOF B;  1EEJ A;  3IMA B;  3CPO A;  3NHX A;  1VQ7 3;  2FNQ A;  3F40 A;  1Q40 A;  1A2K A;  1UI8 A;  1DE3 A;  3LTA A;  1JN5 A;  3X40 A;  3E99 A;  3LH4 A;  1X1U A;  3FG4 A;  4GL6 A;  1GS3 A;  1VQ9 3;  1LQG C;  3DGM A;  3GAX A;  3BIR A;  3MYT A;  1HZ1 A;  1HKX A;  4HM1 B;  4K1V A;  2P38 A;  4G1M B;  4HM3 B;  4EW5 A;  3BNB A;  3G4S 3;  2LYX A;  1LOY A;  2E2T A;  2RCD A;  4LMI A;  4RNZ A;  1Q7H A;  3HX8 A;  6GSP A;  2KAA A;  5G1L A;  3D79 A;  5JPU A;  2HOH A;  3GZR A;  2CFL A;  3MG2 A;  3OXA A;  1RKY A;  1IQX A;  1JKG B;  2B1X B;  4I4K A;  4FCZ A;  3PYJ A;  1FGO A;  3BNC A;  2W2C A;  1IK3 A;  5AII A;  4X2H A;  2HML B;  2SAR A;  1W6G A;  1W7C A;  2KF4 A;  2C4B A;  1GOU A;  5CF1 A;  1MWU A;  3X42 A;  4HAA A;  1AV4 A;  1W4N A;  1D6Y A;  2RNT A;  3G8Z A;  1G96 A;  3DZL A;  1GY6 A;  3JUQ A;  2CWV A;  3B4O A;  1CEW I;  1Y4K A;  2BHM A;  1GD4 A;  1I0X A;  3JUM A;  3QK9 A;  5HOH A;  3DGL A;  1W2B 2;  1NDO B;  3KE7 A;  1QVG 2;  4XDV A;  3NUV A;  1I3I A;  4FMA A;  4FMC A;  2CH9 A;  1B2X A;  1O7H B;  1VZZ A;  3CCS 3;  4OUQ A;  1WMO A;  5KP3 A;  5CF2 A;  3Q1C A;  5I97 A;  1OUN A;  1Q7Y 4;  1D6U A;  5ELJ A;  3NM2 A;  5M18 A;  1MWS A;  2I9W A;  1K73 4;  1N9E A;  1RRL A;  5AIH A;  3S28 A;  3L0R A;  3ALA A;  1M9G A;  2XGN A;  3NV0 B;  4HM0 B;  4KFF A;  2ML5 A;  3WA2 X;  3G0K A;  3CCQ 3;  2ZA4 A;  4EBG A;  2WOF A;  4EYC A;  5IG3 A;  3FG3 A;  4KVH A;  1E3R A;  1UGH I;  4O2H A;  3CCJ 3;  2XH9 A;  3T0U A;  1QJG A;  1ROA A;  1W02 A;  2E2U A;  2MF7 A;  1V74 A;  3MKI A;  3I56 3;  3MHE A;  3JUN A;  4WWU C;  3LOY A;  1FUS A;  1IVU A;  2F56 A;  1CQS A;  4N6L A;  4NHF A;  1QVF 2;  3J7Y d;  4U13 A;  1C7H A;  2UGI A;  1NWW A;  1IVX A;  3EHC A;  3FSD A;  3HIG A;  3PCS A;  1HYF A;  5ELU A;  3KII A;  3U1W A;  2MC8 A;  5CLK A;  1JRQ A;  4EV2 A;  2AAD A;  5BVB A;  1CYU A;  2RBI A;  3URP A;  3VF1 A;  4O02 B;  2BU4 A;  4N6T A;  1BSC A;  2KF3 A;  1B27 A;  2F86 B;  1A90 A;  3I55 3;  4BTW A;  3A76 A;  1Q42 A;  3ZG5 A;  1ZX2 A;  2YFL B;  3NBB A;  1KSI A;  1O7P B;  4HZ9 B;  1M90 4;  4KFE A;  3A5E A;  3BB9 A;  3FF2 A;  3HZP A;  4NPB A;  4CPK A;  2XR8 B;  3F14 A;  1BAN A;  2F5M A;  1ULI B;  2KF5 A;  3QRD A;  5CK6 A;  1LNI A;  1QAF A;  4GHO A;  1W00 A;  3BNE A;  2XSO B;  1PY3 A;  1T3B A;  1FUW A;  1YVB I;  1BOX A;  1F8N A;  2BNG A;  3EC9 A;  3MG1 A;  1VQ5 3;  1T5Y A;  3IPT A;  3KN4 A;  2ML6 A;  8RNT A;  1IT8 A;  1A2V A;  3UL6 A;  2KXG A;  3K7C A;  3ZFZ A;  2D1W A;  1JBT A;  3AHW A;  4HM6 B;  8CHO A;  2SBL A;  1YNV X;  3FLJ A;  5LC6 A;  4WYK A;  5IEN A;  1NB5 I;  3SXX A;  3N54 B;  4PEJ A;  4AKZ A;  3GZY B;  4HVN A;  1LOV A;  2IY2 A;  5FW5 A;  1VQL 3;  1TU5 A;  3U97 A;  2CFK A;  2P09 A;  2GU1 A;  3NX0 A;  3F7X A;  1DVC A;  3M8C A;  3FGY A;  1K8A 4;  2OOV C;  1RNB A;  1TFK A;  1Q81 4;  5M19 A;  2YFI B;  2OOV A;  4FCM A;  1NNV A;  3GSP A;  3JUO A;  2OTL 3;  2BMQ B;  5HGR A;  3KSP A;  1BSE A;  1I0V A;  1D6Z A;  4K90 B;  3F7S A;  4J5K A;  1IDP A;  1JBR A;  1GY5 A;  1I2G A;  4KT3 B;  1EA2 A;  5D82 A;  5G2G A;  1NO3 A;  4N3V A;  1WMP A;  2XEP A;  2WGQ A;  3ECF A;  3T8U A;  3AMO B;  4K61 A;  2K3D A;  3KCH A;  3WOD G;  1Q82 4;  2FXT A;  1WQL B;  2BMO B;  1IVW A;  3EN1 B;  1SAR A;  3WMD A;  2OWP A;  1BSA A;  1E97 A;  4AEQ A;  1B20 A;  7STD A;  1AVL A;  4XBX A;  2F4Y A;  2WO0 A;  4MMX B;  2ZL8 A;  4RNT A;  1KWI A;  1IVV A;  3EJV A;  1B2M A;  5AYS C;  1SII A;  4BU4 A;  1N8R 4;  1OPY A;  5A0O B;  1EQK A;  1MNL A;  3ROB A;  1O7G B;  1B2S A;  1RJO A;  3MWZ A;  3LT9 A;  3BND A;  4CDL A;  2L1S A;  3F8X A;  3HI7 A;  1MWR A;  1V58 A;  4X2O A;  1B3S A;  1IU7 A;  2Z77 A;  2ZDJ A;  3MG3 A;  5TGN A;  3X41 A;  1LQM B;  1UCL A;  5IEP A;  4N6O B;  5DRE A;  4LSO A;  1RCL A;  1RGK A;  2CWT A;  1GMR A;  2CC3 A;  2KF6 A;  2XSH B;  3LZA A;  5BIR A;  1R4Y A;  3AHS A;  3N8B A;  1GY7 A;  2CIU A;  3CC2 3;  4BL3 A;  4JF8 A;  3X3Z A;  1BRK A;  4EV5 A;  4OK0 A;  2HMN B;  1BGS A;  1TTO A;  2W56 A;  5GSP A;  1Q40 B;  1I2F A;  1RGE A;  2OQE C;  1JN5 B;  3SED A;  2CFW A;  4ORL A;  1BSB A;  3SVA A;  1OF5 A;  9RNT A;  1QAK A;  2OQE A;  1IQY A;  4R80 A;  2IUJ A;  3BLZ A;  4J9A A;  2UUG C;  2GEX A;  3V99 A;  3KFQ C;  1TUH A;  3G71 3;  3H3H A;  4XBY A;  3STD A;  1YHQ 3;  1VQ8 3;  1OGZ A;  5JPP A;  1B21 A;  3HOH A;  5G1K A;  4HOH A;  1JB5 A;  3RNT A;  4ZM8 A;  2HMO B;  1UDI I;  4N6V 0;  3S27 A;  4IIA A;  1GD3 A;  1O7W B;  5KP4 A;  3S5C A;  1SQW A;  7RNT A;  1JZD A;  1G02 A;  1N8Q A;  2RSX A;  1GSP A;  1CYV A;  1RGH A;  4XB5 A;  4BIR A;  2Z76 A;  1VQ4 3;  1KQS 2;  4ILF A;  2IYJ A;  4GSP A;  5AEU B;  5IF6 A;  2GBX B;  1IQ8 A;  5D81 A;  1UW1 A;  4K1U A;  2XFT A;  3D5I A;  1VQM 3;  1BNI A;  2XGL A;  3GZX B;  2H0I A;  2J8X B;  3K5T A;  1BNF A;  1RDS A;  4RNY A;  3D4A A;  1W01 A;  3UL5 A;  1YIJ 3;  3GRD A;  1FYS A;  1DMN A;  1VQP 3;  4N6M A;  3DH2 A;  2R4I A;  3KZT A;  4RBN A;  1JB2 A;  1I8V A;  1UUW B;  1MGR A;  1VQQ A;  2CHC A;  2L4V A;  4R9K A;  1DYU A;  3SLU A;  1FGM A;  5IW9 A;  2M7O A;  1B2Z A;  1RGC A;  4JRF A;  3JUP A;  3CU3 A;  4BTY A;  1BRN L;  1BIR A;  1ZGX A;  4MMZ B;  4AKY A;  4DKI A;  3DMC A;  3S29 A;  4FMD A;  1YJW 3;  2H0H A;  2D42 A;  1QAL A;  2GXF A;  1RN1 A;  1Z1S A;  1QMA A;  2K0M A;  2KCD A;  2YFJ B;  4KFD A;  2OTJ 3;  3LTB A;  1AY7 A;  2BT3 A;  5AYR B;  3HII A;  1LNH A;  3Q2P A;  3PZW A;  3AGN A;  1U8C B;  1BNS A;  1NU3 A;  1WTH A;  4CCV A;  4NRE A;  5EQL A;  4LGQ A;  4QWT A;  1IV9 A;  1AQZ A;  1EUI C;  3DGY A;  4MJD A;  3B4P A;  3FZW A;  1OHS A;  3CC7 3;  3CC4 3;  1RHL A;  1ZO2 A;  1BNR A;  3CNX A;  3PXM A;  2P05 A;  3CCU 3;  2F99 A;  3NQY A;  3LTD A;  1BNJ A;  1BRH A;  3NXJ A;  1LXE A;  1ASK A;  1X1Y A;  2XRX B;  3OW2 2;  1JKG A;  3NQZ A;  4FMB A;  3F8H A;  1PYL A;  2QEX 3;  1BVI A;  3LYG A;  1I2E A;  2H0G A;  1US1 A;  2Z6B A;  4R4K A;  2C10 A;  1TRQ A;  4XM4 A;  4GB5 A;  1T2I A;  1ZS7 A;  3EF8 A;  3K9M C;  3LML A;  4MMY B;  4J5G A;  1BRS A;  2HMM B;  3RGA A;  2JQ5 A;  2Q07 A;  1T2H A;  1N5P A;  2BO9 B;  4HM4 B;  1EKM A;  1YI2 3;  2W04 A;  5IG4 A;  1KD1 4;  2KRT A;  4O3V A;  1DVD A;  1JB4 A;  3GWR A;  2GEY A;  2Y73 A;  4TX4 A;  1RLS A;  5EVH A;  1FW7 A;  4LEH A;  3EBY A;  4BL2 A;  3B7C A;  1DET A;  3DM8 A;  3X3Y A;  2CW9 A;  1RRH A;  1UGI A;  3OWU A;  1BAO A;  1IT7 A;  5LC7 A;  1WMN A;  3CMA 3;  1W6C A;  1DMQ A;  3FCS B;  3V92 A;  1UUV B;  2CG0 A;  3NBJ A;  1PU4 A;  3CME 3;  2K54 A;  1STD A;  1R4C A;  1HU9 A;  5DRV A;  1S5A A;  3UNL A;  3F9S A;  1RN4 A;  3DGN A;  3PS8 A;  1E3V A;  2BMR B;  2QGU A;  3FH1 A;  4N6U A;  4EXR A;  1JV2 B;  3UB1 A;  4WYK B;  2CFG A;  3Q3F A;  3SOA A;  3N9H A;  6STD A;  1UCK A;  2PZV A;  1CH0 A;  1RGF A;  3LTC A;  1OH0 A;  4HM8 B;  2RGQ A;  1TFO A;  3NV0 A;  3OWY A;  1TP6 A;  5BU4 A;  2OCT A;  2JDI H;  1RMS A;  1FA3 A;  1IYY A;  1ROV A;  2R41 A;  6RNT A;  2F5W A;  3WOE B;  3DXO A;  1N9J A;  5IG5 A;  3SYU A;  1K9M 4;  1JZO A;  4HZB B;  4IT7 A;  3RGR A;  3K63 A;  1STF I;  2IA7 A;  2QIY A;  3CCE 3;  1ISK A;  5RNT A;  1SJW A;  1ULJ B;  2STD A;  3UJM A;  3CCL 3;  1VQO 3;  1JJ2 2;  1OCV A;  3CCM 3;  1S72 3;  1M1X B;  3CD6 3;  3EQQ B;  2IMJ A;  2ZHX B;  1X1W A;  3HK4 A;  3VGN A;  1BRI A;  1MGW A;  2CK3 H;  3G16 A;  5FGO A;  1OHP A;  4STD A;  1LVN A;  3EB8 A;  3EBT A;  2V1L A;  1UI7 A;  1GMQ A;  1C54 A;  4Q53 A;  2CWU A;  5D83 A;  2WGO A;  1RSN A;  1YJN 3;  1TJD A;  3EX9 A;  3Q90 A;  4LYL B;  3FKA A;  2F98 A;  2PNC A;  4H61 A;  1GOY A;  4O8S A;  1J2B A;  4N6N B;  2UX0 A;  2CX0 A;  3CXC 2;  1YGW A;  1BRJ A;  4HJL B;  3D3L A;  3NBR A;  3TDG A;  2P0M A;  3RDE A;  2A15 A;  1FGR A;  2CG1 A;  3ZG0 A;  1K28 A;  3FF0 A;  3WA3 A;  1FGT A;  1RGG A;  1O7M B;  5AI1 A;  1TIJ A;  1MWT A;  1W6Y A; 
#chains in the Genus database with same CATH homology
 1K41 A;  3CPW 2;  2IUK A;  3K0Z A;  4XDW A;  3CCR 3;  5IEO A;  3SX1 A;  4L8P A;  2C11 A;  4L7K A;  2O9U X;  3X3X A;  5KP1 A;  2YX9 A;  2LQV A;  3DY5 A;  4HM7 B;  4H3U A;  2E2V A;  3O8Y A;  2HMJ B;  4FR9 A;  3ER7 A;  2O3O A;  1N5H A;  4MEI A;  4HM2 B;  3H51 A;  4HM5 B;  1L5G B;  1OGX A;  3CNM A;  3WDG B;  5STD A;  2RFR A;  3CCV 3;  1AR0 A;  4HKV B;  1W5Z A;  1OAC A;  4R9L A;  2CKF B;  3MPH A;  4LZI A;  2XFS A;  3DUK A;  1YIT 3;  3IJE B;  3FG1 A;  2W56 B;  4FCJ A;  2Z7A A;  4XBT A;  2FGT A;  4HBR A;  1SPU A;  3JVC A;  1OF5 B;  1WNH A;  1VQN 3;  5BXQ A;  4WFO A;  2WOH A;  1MOL A;  3OX9 A;  3EE1 A;  4KZ1 A;  4EC6 A;  2GU3 A;  4WP5 A;  4WHA A;  1RN7 A;  4RZM A;  1SIH A;  3LXU X;  5IER A;  3AMO A;  3SOY A;  5EEO A;  1DMM A;  2Y74 A;  1EG9 B;  3I0Y A;  3V98 A;  2W03 A;  1A67 A;  1GYB A;  5AIF A;  1VQK 3;  4R1K A;  1NJI 4;  2B24 B;  3B8L A;  3OV4 A;  3KKG A;  3GZB A;  5CXO A;  3MSO A;  3D9R A;  4HYZ A;  1FGQ A;  2QA4 3;  5AIG A;  2CFD A;  3PGB A;  3OWS A;  2W6J H;  3NM7 A;  2INX A;  1BUQ A;  1YGE A;  1Q86 4;  1YJ9 3;  1NB3 I;  3DGO A;  3PCR A;  1LOX A;  3G6E 3;  1O7N B;  2GBW B;  5JBS A;  3S67 A;  1AVK A;  2HMK B;  4OVM A;  1PFP A;  2P0X A;  2W0Q A;  1VQ6 3;  2W9P A;  3KSE D;  1IV7 A;  1M1K 4;  2W9Q A;  4BTX A;  5IG0 A;  4J8T A;  1JNQ A;  1KC8 4;  1W2Z A;  3VSY A;  3T8N A;  1U5O A;  4IPB A;  2XF3 A;  5AEW B;  1OHO A;  3EN8 A;  4L8O A;  3LT8 A;  3WOF B;  3IMA B;  3CPO A;  3NHX A;  1VQ7 3;  2FNQ A;  3F40 A;  1Q40 A;  1A2K A;  1UI8 A;  3LTA A;  1JN5 A;  3X40 A;  3E99 A;  3LH4 A;  3FG4 A;  4GL6 A;  1GS3 A;  1VQ9 3;  3GAX A;  3DGM A;  3MYT A;  4HM1 B;  1HKX A;  4K1V A;  2P38 A;  4G1M B;  4HM3 B;  3G4S 3;  3BNB A;  2LYX A;  2RCD A;  2E2T A;  4LMI A;  4RNZ A;  3HX8 A;  5JPU A;  3GZR A;  3MG2 A;  2CFL A;  3OXA A;  1RKY A;  1IQX A;  1JKG B;  2B1X B;  4I4K A;  4FCZ A;  3PYJ A;  1FGO A;  3BNC A;  2W2C A;  1IK3 A;  5AII A;  4X2H A;  2HML B;  1W6G A;  1W7C A;  5CF1 A;  3X42 A;  1AV4 A;  1W4N A;  1D6Y A;  3G8Z A;  1G96 A;  3DZL A;  1GY6 A;  3JUQ A;  2CWV A;  3B4O A;  1CEW I;  1Y4K A;  2BHM A;  1GD4 A;  3JUM A;  3QK9 A;  3DGL A;  1W2B 2;  1NDO B;  3KE7 A;  1QVG 2;  4XDV A;  3NUV A;  4FMA A;  4FMC A;  2CH9 A;  1O7H B;  1VZZ A;  3CCS 3;  4OUQ A;  1WMO A;  5KP3 A;  5CF2 A;  3Q1C A;  5I97 A;  1OUN A;  1D6U A;  5ELJ A;  3NM2 A;  2I9W A;  1K73 4;  1N9E A;  1RRL A;  5AIH A;  3S28 A;  3L0R A;  3ALA A;  1M9G A;  2XGN A;  3NV0 B;  4HM0 B;  4KFF A;  2ML5 A;  3WA2 X;  3G0K A;  3CCQ 3;  4EBG A;  2WOF A;  4EYC A;  5IG3 A;  3FG3 A;  4KVH A;  1E3R A;  4O2H A;  3CCJ 3;  2XH9 A;  3T0U A;  1QJG A;  1ROA A;  1W02 A;  2E2U A;  2MF7 A;  1V74 A;  3MKI A;  3I56 3;  3MHE A;  3JUN A;  4WWU C;  3LOY A;  1IVU A;  4NHF A;  1CQS A;  4N6L A;  1QVF 2;  3J7Y d;  4U13 A;  1C7H A;  1NWW A;  1IVX A;  3EHC A;  3FSD A;  3HIG A;  3PCS A;  5ELU A;  3U1W A;  3KII A;  2MC8 A;  5CLK A;  1JRQ A;  4EV2 A;  5BVB A;  1CYU A;  3VF1 A;  4O02 B;  4N6T A;  2F86 B;  1A90 A;  3I55 3;  4BTW A;  3A76 A;  1Q42 A;  1ZX2 A;  2YFL B;  3NBB A;  1KSI A;  1O7P B;  4HZ9 B;  1M90 4;  4KFE A;  3BB9 A;  3FF2 A;  3HZP A;  2XR8 B;  3F14 A;  1ULI B;  3QRD A;  5CK6 A;  1QAF A;  1W00 A;  3BNE A;  2XSO B;  1FUW A;  1YVB I;  1F8N A;  2BNG A;  3EC9 A;  3MG1 A;  1VQ5 3;  1T5Y A;  3IPT A;  3KN4 A;  2ML6 A;  1IT8 A;  1A2V A;  3UL6 A;  2KXG A;  3K7C A;  2D1W A;  4HM6 B;  8CHO A;  2SBL A;  3FLJ A;  5LC6 A;  4WYK A;  5IEN A;  1NB5 I;  3SXX A;  3N54 B;  4PEJ A;  4AKZ A;  3GZY B;  4HVN A;  5FW5 A;  1VQL 3;  1TU5 A;  3U97 A;  2CFK A;  2P09 A;  2GU1 A;  3NX0 A;  3F7X A;  1DVC A;  3M8C A;  3FGY A;  1K8A 4;  2OOV C;  1TFK A;  1Q81 4;  2YFI B;  2OOV A;  4FCM A;  3JUO A;  2OTL 3;  2BMQ B;  5HGR A;  3KSP A;  1D6Z A;  4K90 B;  3F7S A;  1IDP A;  1GY5 A;  1EA2 A;  5D82 A;  5G2G A;  1NO3 A;  4N3V A;  1WMP A;  2XEP A;  2WGQ A;  3ECF A;  3T8U A;  3AMO B;  4K61 A;  3WOD G;  1Q82 4;  2FXT A;  1WQL B;  2BMO B;  1IVW A;  3EN1 B;  3WMD A;  2OWP A;  1E97 A;  4AEQ A;  7STD A;  1AVL A;  4XBX A;  2WO0 A;  4MMX B;  2ZL8 A;  1KWI A;  1IVV A;  3EJV A;  5AYS C;  1SII A;  1EQK A;  1N8R 4;  1OPY A;  5A0O B;  1MNL A;  3ROB A;  1O7G B;  1RJO A;  3MWZ A;  3LT9 A;  3BND A;  4CDL A;  3HI7 A;  3F8X A;  4X2O A;  5TGN A;  1IU7 A;  2Z77 A;  2ZDJ A;  3MG3 A;  3X41 A;  5IEP A;  4N6O B;  5DRE A;  4LSO A;  2CWT A;  2CC3 A;  2XSH B;  3LZA A;  3N8B A;  1GY7 A;  2CIU A;  3CC2 3;  4JF8 A;  3X3Z A;  4EV5 A;  4OK0 A;  2HMN B;  2W56 A;  1Q40 B;  2OQE C;  1JN5 B;  3SED A;  2CFW A;  4ORL A;  3SVA A;  1OF5 A;  1QAK A;  2OQE A;  1IQY A;  4R80 A;  2IUJ A;  3BLZ A;  4J9A A;  2GEX A;  3V99 A;  3KFQ C;  1TUH A;  3G71 3;  3H3H A;  4XBY A;  3STD A;  1YHQ 3;  1VQ8 3;  1OGZ A;  5JPP A;  1JB5 A;  4ZM8 A;  2HMO B;  3S27 A;  4N6V 0;  4IIA A;  1GD3 A;  1O7W B;  5KP4 A;  3S5C A;  1SQW A;  1N8Q A;  2RSX A;  4XB5 A;  1CYV A;  1VQ4 3;  2Z76 A;  1KQS 2;  5IF6 A;  5AEU B;  2GBX B;  1IQ8 A;  5D81 A;  1UW1 A;  4K1U A;  2XFT A;  1VQM 3;  2XGL A;  3GZX B;  4RNY A;  3K5T A;  1W01 A;  3UL5 A;  1YIJ 3;  3GRD A;  1DMN A;  1VQP 3;  4N6M A;  3KZT A;  2R4I A;  4RBN A;  1JB2 A;  1UUW B;  2CHC A;  2L4V A;  4R9K A;  1DYU A;  3SLU A;  1FGM A;  5IW9 A;  2M7O A;  4JRF A;  3JUP A;  3CU3 A;  4BTY A;  4MMZ B;  4AKY A;  3DMC A;  3S29 A;  4FMD A;  1YJW 3;  2D42 A;  1QAL A;  2GXF A;  1Z1S A;  2KCD A;  1QMA A;  2K0M A;  2YFJ B;  4KFD A;  2OTJ 3;  3LTB A;  5AYR B;  2BT3 A;  3HII A;  1LNH A;  3Q2P A;  3PZW A;  1U8C B;  1NU3 A;  1WTH A;  4CCV A;  4NRE A;  5EQL A;  4LGQ A;  4QWT A;  1IV9 A;  4MJD A;  3CC4 3;  3CC7 3;  3B4P A;  3FZW A;  1OHS A;  1ZO2 A;  3CNX A;  3PXM A;  2P05 A;  3CCU 3;  2F99 A;  3NQY A;  3LTD A;  3NXJ A;  1LXE A;  1ASK A;  2XRX B;  3OW2 2;  1JKG A;  3NQZ A;  4FMB A;  3F8H A;  2QEX 3;  3LYG A;  1US1 A;  2Z6B A;  4R4K A;  2C10 A;  4XM4 A;  4GB5 A;  3EF8 A;  3K9M C;  3LML A;  4MMY B;  2HMM B;  3RGA A;  2JQ5 A;  2Q07 A;  1N5P A;  2BO9 B;  4HM4 B;  1EKM A;  1YI2 3;  2W04 A;  5IG4 A;  1KD1 4;  2KRT A;  4O3V A;  1DVD A;  1JB4 A;  3GWR A;  2GEY A;  2Y73 A;  4TX4 A;  5EVH A;  4LEH A;  3EBY A;  3B7C A;  3DM8 A;  3X3Y A;  2CW9 A;  1RRH A;  3OWU A;  1IT7 A;  5LC7 A;  1WMN A;  3CMA 3;  1W6C A;  1DMQ A;  3FCS B;  3V92 A;  1UUV B;  2CG0 A;  3NBJ A;  1PU4 A;  3CME 3;  2K54 A;  1STD A;  1R4C A;  1HU9 A;  5DRV A;  1S5A A;  3UNL A;  3F9S A;  3PS8 A;  3DGN A;  4N6U A;  1E3V A;  2BMR B;  2QGU A;  3FH1 A;  4EXR A;  1Q7Y 4;  1JV2 B;  3UB1 A;  4WYK B;  2CFG A;  3SOA A;  3N9H A;  6STD A;  2PZV A;  3LTC A;  1OH0 A;  4HM8 B;  2RGQ A;  1TFO A;  3NV0 A;  3OWY A;  1TP6 A;  2OCT A;  2JDI H;  1FA3 A;  1ROV A;  3WOE B;  3DXO A;  1N9J A;  5IG5 A;  1K9M 4;  4HZB B;  4IT7 A;  3RGR A;  3K63 A;  1STF I;  2IA7 A;  2QIY A;  3CCE 3;  1ISK A;  1SJW A;  1ULJ B;  2STD A;  3UJM A;  3CCL 3;  1VQO 3;  1JJ2 2;  1OCV A;  3CCM 3;  1S72 3;  1M1X B;  3CD6 3;  3EQQ B;  2IMJ A;  3VGN A;  3HK4 A;  2CK3 H;  3G16 A;  5FGO A;  1OHP A;  4STD A;  1LVN A;  3EB8 A;  3EBT A;  2V1L A;  1UI7 A;  4Q53 A;  2CWU A;  2WGO A;  1YJN 3;  3EX9 A;  3Q90 A;  3FKA A;  2F98 A;  2PNC A;  4H61 A;  4O8S A;  1J2B A;  4N6N B;  2UX0 A;  3CXC 2;  4HJL B;  3D3L A;  3NBR A;  3TDG A;  2P0M A;  3RDE A;  2A15 A;  1FGR A;  2CG1 A;  1K28 A;  3FF0 A;  3WA3 A;  1FGT A;  1O7M B;  5AI1 A;  1TIJ A;  5D83 A;  1W6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...