2IMJA

X-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
AQVRPPLPPFTRESAIEKIRLAEDGWNSRDPERVSLAYTLDTQWRNRAEFAHNREEAKAFLTRKWAKELDYRLIKELWAFTDNRIAVRYAYEWHDDSGNWFRSYGNENWEFDEQGLMARRFACINDMPIKAQERKFHWPLGRRPDDHPGLSELGLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the hypothetical protein (DUF1348) from Pseudomonas fluorescens, Northeast Structural Genomics target PlR14.
rcsb
source organism Pseudomonas fluorescens pf-5
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein DUF1348
total genus 54
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07080 DUF1348 Protein of unknown function (DUF1348)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2imjA01
2Z76A 3B4PA 5BVBA 1E97A 2F99A 2F98A 2STDA 3VSYA 4HM0B 5AIFA 7STDA 1GYBA 3JUPA 3OWYA 4OUQA 3NUVA 3FGYA 4FCMA 3Q90A 4XB5A 4XDWA 3T8NA 2XSHB 1JB4A 1Q42A 3BLZA 4LMIA 5CF1A 5IEOA 3CPOA 2YFLB 1W00A 1O7HB 1TP6A 2B1XB 2I9WA 2Z77A 5DRVA 1OUNA 1Q40B 4HZ9B 5JPPA 8CHOA 1Q40A 4ORLA 5IG0A 1EG9B 3JUQA 3FLJA 2HMKB 3D9RA 2BMRB 4XDVA 1GY7A 3ROBA 3FZWA 3CNXA 1U5OA 1UUVB 2CHCA 4WWUC 3ER7A 4HVNA 2RFRA 1K41A 2GEYA 3FSDA 3DUKA 3FF0A 3JUOA 3F7XA 4HM8B 4RZMA 5DREA 3MG2A 1OHPA 1DMMA 1WQLB 2HMNB 3EF8A 3F8XA 3E99A 3MKIA 2W2CA 2RCDA 2HMJB 4HM7B 3EN8A 5IEPA 3F7SA 3FH1A 3KZTA 4L8PA 1ZX2A 3WMDA 2HMMB 4H3UA 4J9AA 5EVHA 3RGRA 3B8LA 1E3VA 3CU3A 3KSPA 2K54A 5AIIA 3KKGA 2BMQB 4HM3B 3DXOA 3OXAA 4LGQA 5AIHA 5HGRA 1OGZA 2HMOB 3EC9A 3GZRA 1JKGB 4HM4B 3CNMA 5G2GA 2GBWB 3STDA 5FW5A 1JB2A 2GXFA 1BUQA 2R4IA 4X2OA 2GEXA 2Z7AA 3FF2A 5STDA 3SOYA 5IG5A 5IG4A 3B7CA 3K0ZA 5AEWB 4K1UA 3UNLA 3T8UA 3A76A 3EBYA 3M8CA 1NWWA 4XBYA 1GY5A 1OHSA 4MJDA 4Q53A 4K1VA 2XSOB 5CF2A 2JQ5A 4KVHA 3H51A 4HKVB 3K7CA 2F86B 1CQSA 6STDA 5JPUA 1ASKA 1GS3A 2BMOB 4FCJA 3NV0A 1ULIB 3BB9A 3NXJA 3DM8A 2CKFB 3OX9A 3OWUA 1OF5B 3FKAA 1OPYA 1C7HA 3MYTA 4J8TA 4N3VA 4HM1B 4PEJA 4R9LA 5D81A 5CK6A 1NDOB 4HZBB 4STDA 1HKXA 1OF5A 3MG3A 3MG1A 4WP5A 4GB5A 2XRXB 4WYKB 3NHXA 4I4KA 3G0KA 1E3RA 1S5AA 5D83A 1AR0A 1Z1SA 3I0YA 1OGXA 3GWRA 4OVMA 2QGUA 3G16A 2QIYA 4XBXA 1O7NB 3HX8A 5AIGA 1ZO2A 4HM2B 4U13A 5AEUB 5KP4A 3OWSA 2HMLB 2INXA 1OHOA 2YFJB 4XM4A 3HK4A 1EA2A 2PZVA 1QJGA 3DZLA 3KE7A 3GRDA 4L7KA 1DMQA 3F14A 1TUHA 1A2KA 1VZZA 5BXQA 3HZPA 3EN1B 1NU3A 3MSOA 4HJLB 4L8OA 1OH0A 1ULJB 5IERA 2UX0A 3OV4A 3EQQB 1STDA 4HM6B 3NV0B 5IENA 3GZXB 3EBTA 5KP1A 3S5CA 2RGQA 1IDPA 1JN5A 2B24B 3EHCA 5AI1A 1OCVA 5IF6A 1QMAA 3F9SA 3UJMA 1JB5A 3SEDA 1ISKA 3JUNA 1W02A 4CDLA 3SOAA 3G8ZA 5CXOA 1O7WB 3EX9A 1JN5B 2XR8B 3EJVA 4LEHA 1UUWB 3F8HA 3NM2A 4R1KA 5CLKA 3JUMA 3GZBA 1O7MB 2BNGA 3IPTA 3LZAA 4R9KA 4WYKA 1JKGA 2GBXB 3H3HA 5KP3A 3F40A 1GY6A 2YFIB 2A15A 2OWPA 2IMJA 4X2HA 5D82A 3B4OA 1SJWA 3MHEA 4XBTA 5TGNA 3LYGA 1W6YA 1O7PB 3NBRA 5IG3A 3DMCA 4HM5B 4IIAA 1O7GB 3ECFA 3RGAA 3VGNA 1DMNA 3GZYB 1W01A
chains in the Genus database with same CATH superfamily
1LNHA 1BSBA 1Q814 5BVBA 1YJN3 2STDA 1RRHA 1RHLA 1U8CB 3VSYA 4N6NB 5AIFA 1SARA 3SYUA 3X3ZA 7STDA 1RGFA 4FCMA 4IT7A 3BLZA 2P38A 2BIRA 2AADA 2OQEC 3CPOA 5AYSC 1LOYA 3CC23 2LYXA 6RNTA 4EV2A 2I9WA 2Z77A 2E2UA 1OUNA 1Q40B 5IG0A 3UL6A 3G6E3 1BOXA 2P0MA 2BMRB 3CCS3 2KCDA 1GY7A 4CPKA 1U5OA 3AMOA 1IQXA 1MOLA 4O02B 4RZMA 4HM8B 3EE1A 1RMSA 4HOHA 1DMMA 1OHPA 3CMA3 1A90A 1N5HA 1VQN3 2W2CA 2UGIA 1JBTA 1I2EA 1ZX2A 2XEPA 1M1XB 2WO0A 1DETA 4H3UA 1GOYA 4J9AA 3WMDA 1TTOA 1M1K4 1MWUA 4G1MB 1RCKA 1BNJA 2V1LA 2W04A 4H61A 1WTHA 3DXOA 3ZG5A 1UUGB 2HMOB 1JKGB 1Q824 3U1WA 5FW5A 1BUQA 3WA2X 2D42A 1FGMA 1A2PA 1J2BA 3B7CA 4K1UA 3A76A 1NWWA 3NX0A 4TX4A 3CME3 4BTWA 2CG1A 1OHSA 4MJDA 4Q53A 1RNTA 4KVHA 3H51A 2F86B 3O8YA 5JPUA 1GS3A 2CWUA 2BMOB 3BNBA 4LSOA 1VQ73 4EXRA 3OX9A 4LMIA 1T3BA 2WOFA 3NXJA 3OWUA 2W9QA 1OF5B 3V99A 5IW9A 5M18A 1A67A 1N9EA 4N6MA 5M1AA 3CCL3 1DVDA 5CK6A 2XF3A 2FNQA 5LC7A 3NBBA 1S723 1GD4A 4HAAA 2JDIH 4I4KA 2OTJ3 3FG1A 1BIRA 1VQO3 1Z1SA 3CPW2 1Q7Y4 3GWRA 1VQ93 3G16A 2CFLA 1GD3A 4HM2B 1RGGA 4K90B 1IV7A 1BSEA 3OWSA 1G0TA 2HMLB 4R80A 2KF4A 5BU4A 2MC8A 1BRHA 1I3FA 2KF3A 5HOHA 4EC6A 1IT7A 1YJ93 4L7KA 2XFTA 1GOVA 1TUHA 1NO3A 1JV2B 1NU3A 3EN1B 1FGOA 2OCTA 1ULJB 1QAFA 1RCLA 2UX0A 1RN4A 1RNBA 2PNCA 2C10A 1K9M4 3NV0B 3EBTA 3HIGA 4N6OB 3S5CA 3LT8A 1KD14 2CH9A 2ML5A 1JN5A 3EHCA 1QMAA 4OK0A 1FZUA 4MMZB 3SOAA 1O7WB 2SARA 4CJNA 1JRQA 2E2VA 1SIIA 3F8HA 1L5GB 1IYYA 1FUWA 1GMQA 2OOVC 5CLKA 2CWTA 3DGNA 1O7MB 4WYKA 5JBSA 1LVNA 1FYSA 1N9JA 2GBXB 1AQZA 1RN7A 1W5ZA 3H3HA 1GY6A 2YFIB 2BHMA 4XBTA 4CCVA 4RNZA 3CD63 1B2SA 1I0VA 1PU4A 2FXTA 5G1LA 3ECFA 2CK3H 1W2ZA 1DMNA 1W01A 3Q2PA 7GSPA 2W9PA 1BNFA 1E97A 2W56B 4DKIA 1YGEA 2W6JH 1I0XA 2BU4A 4KZ1A 4RNYA 3S67A 3ZG0A 2YX9A 1D6UA 5M19A 4FMAA 4OUQA 4MEIA 1IQYA 1LRAA 3WODG 3QRDA 2Y74A 1VQK3 1W00A 3JVCA 1CEWI 1NNVA 4WFOA 1N8QA 1LOXA 5JPPA 1QALA 1EG9B 3FLJA 2HMKB 3PXMA 4XDVA 3ROBA 1V74A 2CHCA 3WOEB 1JJ22 4WWUC 4HVNA 2GEYA 3FF0A 4HYZA 5DREA 3X40A 1SQWA 1Q7HA 1W2B2 4MMXB 1BSDA 3EF8A 1SIHA 1YVBI 2ZDJA 3DGMA 5RNTA 2RCDA 1I3IA 3PS8A 2WOHA 4HM7B 4KT3B 3FH1A 2D1WA 1UGHI 2BO9B 2CW9A 3LMLA 3RGRA 3B8LA 3K5TA 3KN4A 1E3VA 2GU1A 3UB1A 3OXAA 1RLSA 4LGQA 5HGRA 2HOHA 1UI7A 4HM4B 5ELUA 1ZGXA 5G2GA 3STDA 2GBWB 3D79A 1CYVA 4QWTA 2R4IA 4X2OA 3FF2A 1B2UA 5STDA 1VQ83 3UNLA 3G4S3 1UCLA 3IJEB 3M8CA 1GY5A 2UUGC 3Q3FA 3J7Yd 1CQSA 2FGTA 2F56A 2MF7A 1VQP3 1LQGC 4JF8A 1GMPA 3X42A 2CKFB 1QAKA 4PEJA 3MYTA 1LQMB 4R9LA 3N8BA 2QEX3 4BL3A 4HZBB 1YHQ3 1OF5A 6GSPA 4GB5A 3NHXA 3V92A 4RBNA 1SPUA 3G0KA 1E3RA 2OTL3 1UDII 3DH2A 4XBXA 5D83A 2WGQA 2QIYA 1GSPA 1ZO2A 3ZFZA 1PY3A 1IU7A 2RNTA 1G96A 2YFJB 1OHOA 3GSPA 1MWSA 3D5GA 3QK9A 2IA7A 3HK4A 1RRLA 2WGOA 1BRJA 1EA2A 1TU5A 3KE7A 3GRDA 4AKYA 2QA43 1VZZA 5BXQA 3HZPA 4HJLB 4L8OA 1OH0A 1UGIA 3N9HA 2ZHXB 3N54B 1GMRA 1KWIA 1STDA 3AHWA 3EQQB 4HM6B 1MWTA 7RNTA 4EBGA 5BIRA 4AEQA 5IF6A 4AKZA 3SEDA 1BNGA 2KXGA 3EX9A 1US1A 1BAOA 3MPHA 4KFDA 2KRTA 1NB5I 4LEHA 3NM2A 1FGTA 1X1YA 1I70A 2K3DA 2SBLA 3OW22 1MNLA 3IPTA 3LZAA 4ZM8A 1IK3A 2M7OA 4KFFA 3D5IA 1CYUA 3LTCA 1ZS7A 2XH9A 4O8SA 5ELJA 1JNQA 3K63A 2A15A 2OWPA 2IMJA 1ROVA 1I8VA 1SJWA 4I5QA 1WNHA 3DY5A 1BNIA 2CFKA 3LYGA 3NBRA 5IG3A 3DMCA 3EB8A 4O2HA 1R4YA 1O7GB 1VQ63 3VGNA 3GZYB 5FGOA 3B4PA 3VF1A 3X41A 1RGLA 2F99A 1I2GA 1PYLA 1X1WA 3LTAA 1GYBA 3JUPA 4JRFA 1FUSA 1EEJA 3K9MC 1LOWA 3T8NA 1M904 2XSHB 1JB4A 3Q1CA 4J5GA 1B21A 5CF1A 2YFLB 4FMCA 1TP6A 1RGEA 2OOVA 5DRVA 4BL2A 3JUQA 3AGNA 3D9RA 1NJI4 1W6CA 3X3YA 3FZWA 3CNXA 3WA3A 1BRSA 2RFRA 2H0HA 1K41A 3JUOA 1Q9EA 3DUKA 3FSDA 1EUIC 1RTUA 1TRQA 1RGKA 3CCJ3 3CC43 1WQLB 1Y4KA 3F8XA 3MKIA 1BRNL 1LOVA 2RBIA 2HMJB 4NREA 3F7SA 1GOUA 1RN1A 4LZIA 1AVKA 1UCIA 3SX1A 1K8A4 1VQ53 5EVHA 1BUJA 1DE3A 2CFDA 3CU3A 3WR2A 2K54A 5LC6A 3CXC2 1FA3A 1YIT3 1YIJ3 2C4BA 3EC9A 3LT9A 3V98A 1D6YA 1EQKA 1FGRA 2GXFA 2Z7AA 3WHOA 2CFGA 1AV4A 3SOYA 3K0ZA 3T8UA 1TIJA 3NBJA 1UCJA 3S28A 1PFPA 2XSOB 3TDGA 2KF6A 1AY7A 2H0IA 2JQ5A 3NQYA 3K7CA 4HKVB 4NPBA 3CCE3 3CCM3 1ASKA 5GSPA 2BT3A 1A2VA 3ALAA 3AMOB 1IT8A 3S29A 5IEOA 1OPYA 4J8TA 1R4CA 2O3OA 1DVCA 1TJDA 1KSIA 1NDOB 1DYUA 1HKXA 3MG1A 4WP5A 2XRXB 4NHFA 1S5AA 1WMOA 3I0YA 1OGXA 3LTBA 3AHSA 4OVMA 5AIGA 3S27A 1YJW3 1BVIA 3DGYA 9RNTA 1EKMA 2L1SA 2R41A 2IUJA 3MWZA 5EQLA 1QJGA 3DZLA 3HI7A 1LNIA 4BIRA 1IVVA 3HIIA 3F14A 1WMNA 1RSNA 1HU9A 2W03A 2IYJA 4EYCA 2F5MA 1WMPA 3UL5A 2AAEA 1QVF2 1UCKA 4GSPA 1LXEA 1C54A 2CX0A 5IENA 5KP1A 2CFWA 1B20A 2IY2A 2RGQA 5AI1A 2B24B 5I97A 1OCVA 2XGNA 1RGAA 2H0GA 3F9SA 3FG3A 3UJMA 2ZA4A 3JUNA 1W02A 1RJOA 1YNVX 2Z6BA 3G8ZA 5CXOA 2OQEA 4N6TA 1B3SA 2J8XB 3EJVA 1VQQA 2CC3A 3JUMA 3GZBA 4GHOA 1YGWA 4O3VA 1BU4A 2GU3A 2XFSA 1JBRA 1UW1A 1JZDA 3PYJA 3KFQC 3U97A 1B2ZA 1I2FA 5TGNA 5EEOA 1BNEA 3SXXA 2CX1A 2F5WA 1UI8A 4J5KA 4K61A 2E2TA 2C11A 4HM5B 4IIAA 4MMYB 4WHAA 4R9KA 1D6ZA 4BU4A 3WDGB 1FW7A 2F4YA 2Z76A 1B2XA 2F98A 1BNSA 3KCHA 3URPA 1G02A 1MGWA 4HM0B 4N6UA 3I563 1BRGA 3DGLA 3OWYA 3NUVA 3FGYA 4XB5A 1HZ1A 1V57A 3Q90A 2W56A 1HYFA 4XDWA 1KQS2 1Q42A 4ILFA 3SLUA 3L0RA 1O7HB 1FGQA 1BGSA 2B1XB 1IVUA 1VQ43 4HZ9B 8CHOA 1Q40A 4ORLA 3FG4A 4FCZA 1BNRA 1W6GA 1STFI 3CCQ3 4EW5A 1AVLA 2P05A 2ML6A 1BANA 1UUVB 1MWRA 3ER7A 1YVSA 2XGLA 3PZWA 1YI23 3F7XA 3IMAB 1JZOA 3BNCA 3MG2A 1V58A 2CG0A 2HMNB 3E99A 1TFKA 3CCR3 5IEPA 3EN8A 3PGBA 3KZTA 4L8PA 2HMMB 1TRPA 1K734 3KIIA 2GSPA 3T0UA 3CCU3 3KSPA 3I553 5AIIA 3KKGA 2BMQB 2CWVA 2P0XA 4KFEA 4HM3B 4LYLB 4RNTA 1OACA 2KF5A 5AIHA 1OGZA 3GZRA 2KAAA 1T5YA 3CNMA 3CCV3 4BTXA 1JB2A 1MGRA 2GEXA 5IG5A 1VQL3 5IG4A 1RGCA 5AEWB 3EBYA 3HOHA 3SVAA 4XBYA 3LOYA 8RNTA 3G713 4K1VA 1BRIA 2Q07A 5CF2A 3BNEA 6STDA 1W4NA 3RDEA 4IPBA 4FCJA 3NV0A 1ULIB 3BB9A 3DM8A 1RKYA 1X1XA 3FKAA 4N3VA 1C7HA 3GAXA 4HM1B 5D81A 1CH0A 3FCSB 5A0OB 2P09A 1K28A 4STDA 3CC73 3MG3A 1Q864 1NB3I 4WYKB 1FUTA 2LQVA 1IVWA 2L4VA 2IUKA 1AR0A 1ROAA 4BTYA 4EV5A 2QGUA 2Y73A 1O7NB 3HX8A 2W0QA 4U13A 5AEUB 5KP4A 2K0MA 5AYRB 2INXA 4R4KA 4XM4A 1IV9A 1RGHA 2PZVA 3KSED 3LTDA 1DMQA 1QVG2 1X1UA 4FMBA 1M9GA 4N6V0 1A2KA 1IQ8A 3BIRA 3DGOA 3MSOA 3NM7A 3D3LA 5IERA 4FR9A 3OV4A 4GL6A 3GZXB 3BU4A 1BRKA 1JBSA 1IDPA 2RSXA 1N8R4 1T2IA 3NQZA 1JB5A 1ISKA 1VQM3 3D4AA 3LH4A 3WOFB 4CDLA 3LXUX 1RDSA 2O9UX 3PCSA 1JN5B 1W7CA 2XR8B 1F8NA 3RNTA 1BSAA 1UUWB 3X3XA 2ZL8A 3BNDA 4R1KA 1BSCA 1B2MA 2BNGA 1B27A 1IVXA 1JKGA 4N6LA 4HBRA 5KP3A 3F40A 1KC84 1TFOA 4X2HA 5D82A 3B4OA 3MHEA 2CIUA 5G1KA 1N5PA 1W6YA 1O7PB 3A5EA 3AGOA 3PCRA 1T2HA 3RGAA 4FMDA
chains in the Genus database with same CATH topology
1LNHA 1Q814 5BVBA 1YJN3 2STDA 1RRHA 1U8CB 3VSYA 4N6NB 5AIFA 3X3ZA 7STDA 4FCMA 4IT7A 3BLZA 2P38A 3CPOA 2OQEC 5AYSC 3CC23 2LYXA 4EV2A 2I9WA 2Z77A 2E2UA 1OUNA 1Q40B 5IG0A 3UL6A 3G6E3 2P0MA 2BMRB 3CCS3 2KCDA 1GY7A 1U5OA 3AMOA 1IQXA 1MOLA 4O02B 4RZMA 4HM8B 3EE1A 1DMMA 1OHPA 3CMA3 1A90A 1N5HA 1VQN3 2W2CA 1ZX2A 2XEPA 1M1XB 2WO0A 4H3UA 4J9AA 3WMDA 1M1K4 4G1MB 2V1LA 4H61A 2W04A 1WTHA 3DXOA 2HMOB 1JKGB 1Q824 3U1WA 5FW5A 1BUQA 3WA2X 2D42A 1FGMA 1J2BA 3B7CA 4K1UA 3A76A 1NWWA 3NX0A 4TX4A 4BTWA 2CG1A 1OHSA 4MJDA 4Q53A 4KVHA 3H51A 2F86B 3O8YA 5JPUA 1GS3A 2CWUA 2BMOB 3BNBA 4LSOA 1VQ73 4EXRA 3OX9A 4LMIA 3NXJA 2WOFA 3OWUA 3V99A 2W9QA 1OF5B 5IW9A 1A67A 1N9EA 4N6MA 3CCL3 1DVDA 5CK6A 2XF3A 2FNQA 5LC7A 3NBBA 1S723 1GD4A 2JDIH 4I4KA 2OTJ3 3FG1A 1VQO3 1Q7Y4 1Z1SA 3CPW2 1VQ93 3GWRA 3G16A 2CFLA 1GD3A 4HM2B 4K90B 1IV7A 3OWSA 4R80A 2HMLB 2MC8A 4EC6A 1IT7A 1YJ93 4L7KA 2XFTA 1TUHA 1NO3A 3EN1B 1JV2B 1NU3A 1FGOA 2OCTA 1ULJB 1QAFA 2UX0A 2PNCA 2C10A 1K9M4 3NV0B 3EBTA 3HIGA 4N6OB 3S5CA 3LT8A 1KD14 2CH9A 2ML5A 1JN5A 3EHCA 1QMAA 4OK0A 4MMZB 3SOAA 1O7WB 1JRQA 2E2VA 1SIIA 3F8HA 1L5GB 1FUWA 2OOVC 5CLKA 2CWTA 3DGNA 1O7MB 4WYKA 5JBSA 1LVNA 1N9JA 2GBXB 1W5ZA 1RN7A 3H3HA 1GY6A 2YFIB 2BHMA 4XBTA 4CCVA 4RNZA 3CD63 1PU4A 2FXTA 3ECFA 2CK3H 1W2ZA 1DMNA 1W01A 3Q2PA 2W9PA 1E97A 2W56B 1YGEA 2W6JH 4KZ1A 4RNYA 3S67A 2YX9A 1D6UA 4FMAA 4OUQA 4MEIA 1IQYA 3WODG 3QRDA 2Y74A 1VQK3 1W00A 3JVCA 1CEWI 4WFOA 5JPPA 1N8QA 1LOXA 1QALA 1EG9B 3FLJA 2HMKB 3PXMA 4XDVA 3ROBA 1V74A 2CHCA 3WOEB 1JJ22 4WWUC 4HVNA 2GEYA 3FF0A 4HYZA 5DREA 3X40A 1SQWA 1W2B2 4MMXB 3EF8A 1SIHA 1YVBI 2ZDJA 3DGMA 2RCDA 3PS8A 2WOHA 4HM7B 3FH1A 2D1WA 2BO9B 2CW9A 3LMLA 3RGRA 3B8LA 3K5TA 3KN4A 1E3VA 2GU1A 3UB1A 3OXAA 4LGQA 5HGRA 3CME3 5ELUA 1UI7A 4HM4B 3STDA 5G2GA 2GBWB 4QWTA 1CYVA 2R4IA 4X2OA 3FF2A 1VQ83 5STDA 3UNLA 3G4S3 3IJEB 3M8CA 1GY5A 3J7Yd 1CQSA 2FGTA 2MF7A 1VQP3 4JF8A 3X42A 2CKFB 1QAKA 4PEJA 3MYTA 4R9LA 3N8BA 2QEX3 4HZBB 1YHQ3 1OF5A 4GB5A 3NHXA 3V92A 4RBNA 1SPUA 3G0KA 1E3RA 2OTL3 5D83A 4XBXA 2WGQA 2QIYA 1ZO2A 1IU7A 1G96A 2YFJB 1OHOA 3QK9A 2IA7A 3HK4A 1RRLA 2WGOA 1EA2A 1TU5A 3KE7A 3GRDA 4AKYA 2QA43 1VZZA 5BXQA 3HZPA 4HJLB 4L8OA 1OH0A 3N9HA 3N54B 3EQQB 1KWIA 1STDA 4HM6B 4EBGA 4AEQA 5IF6A 4AKZA 3SEDA 2KXGA 3EX9A 1US1A 3MPHA 4KFDA 2KRTA 1NB5I 4LEHA 3NM2A 1FGTA 2SBLA 3OW22 1MNLA 3IPTA 3LZAA 4ZM8A 1IK3A 2M7OA 4KFFA 1CYUA 3LTCA 2XH9A 4O8SA 5ELJA 1JNQA 3K63A 2A15A 2OWPA 2IMJA 1ROVA 1SJWA 1WNHA 3DY5A 2CFKA 3LYGA 3NBRA 5IG3A 3DMCA 3EB8A 4O2HA 1O7GB 1VQ63 3VGNA 3GZYB 5FGOA 3B4PA 3VF1A 3X41A 2F99A 3LTAA 1GYBA 3JUPA 4JRFA 3K9MC 3T8NA 1M904 2XSHB 1JB4A 3Q1CA 5CF1A 2YFLB 4FMCA 1TP6A 2OOVA 5DRVA 3JUQA 3D9RA 1NJI4 1W6CA 3X3YA 3FZWA 3CNXA 3WA3A 2RFRA 1K41A 3JUOA 3FSDA 3DUKA 3CCJ3 3CC43 1WQLB 1Y4KA 3F8XA 3MKIA 2HMJB 4NREA 3F7SA 4LZIA 1VQ53 1AVKA 3SX1A 1K8A4 5EVHA 2CFDA 3CU3A 2K54A 5LC6A 3CXC2 1FA3A 1YIT3 1YIJ3 3EC9A 3LT9A 3V98A 1D6YA 1EQKA 1FGRA 2GXFA 2Z7AA 2CFGA 1AV4A 3SOYA 3K0ZA 3T8UA 1TIJA 3NBJA 3S28A 1PFPA 2XSOB 3TDGA 2JQ5A 3CCE3 4HKVB 3NQYA 3K7CA 3CCM3 1ASKA 2BT3A 1A2VA 3ALAA 3AMOB 1IT8A 3S29A 5IEOA 1OPYA 4J8TA 1R4CA 2O3OA 1DVCA 1KSIA 1NDOB 1DYUA 1HKXA 3MG1A 4WP5A 2XRXB 4NHFA 1S5AA 1WMOA 3I0YA 1OGXA 3LTBA 4OVMA 5AIGA 3S27A 1YJW3 1EKMA 2IUJA 3MWZA 5EQLA 1QJGA 3DZLA 3HI7A 1IVVA 3HIIA 3F14A 1WMNA 1HU9A 2W03A 4EYCA 1WMPA 3UL5A 1QVF2 1LXEA 5IENA 5KP1A 2CFWA 2RGQA 5AI1A 5I97A 2B24B 1OCVA 2XGNA 3F9SA 3FG3A 3UJMA 3JUNA 1W02A 1RJOA 2Z6BA 3G8ZA 5CXOA 2OQEA 4N6TA 3EJVA 2CC3A 3JUMA 3GZBA 4O3VA 2GU3A 2XFSA 1UW1A 3PYJA 3KFQC 3U97A 5TGNA 5EEOA 3SXXA 1UI8A 4K61A 2E2TA 2C11A 4HM5B 4IIAA 4MMYB 4WHAA 4R9KA 1D6ZA 3WDGB 2Z76A 2F98A 4HM0B 4N6UA 3I563 3DGLA 3OWYA 3NUVA 3FGYA 4XB5A 3Q90A 4XDWA 1KQS2 2W56A 1Q42A 3SLUA 3L0RA 1O7HB 1FGQA 2B1XB 1VQ43 1IVUA 4HZ9B 8CHOA 1Q40A 4ORLA 3FG4A 4FCZA 1W6GA 1STFI 3CCQ3 1AVLA 2P05A 2ML6A 1UUVB 3ER7A 2XGLA 3PZWA 1YI23 3F7XA 3IMAB 3BNCA 3MG2A 2CG0A 2HMNB 3E99A 1TFKA 3CCR3 5IEPA 3EN8A 3PGBA 3KZTA 4L8PA 2HMMB 1K734 3KIIA 3T0UA 3CCU3 3KSPA 3I553 5AIIA 3KKGA 2BMQB 2CWVA 2P0XA 4KFEA 4HM3B 5AIHA 1OACA 1OGZA 3GZRA 1T5YA 3CNMA 3CCV3 4BTXA 1JB2A 2GEXA 5IG5A 1VQL3 5IG4A 5AEWB 3EBYA 3SVAA 4XBYA 3LOYA 3G713 4K1VA 2Q07A 5CF2A 3BNEA 6STDA 1W4NA 3RDEA 4IPBA 4FCJA 3NV0A 1ULIB 3BB9A 3DM8A 1RKYA 3FKAA 4N3VA 1C7HA 3GAXA 4HM1B 5D81A 3FCSB 5A0OB 2P09A 1K28A 4STDA 3CC73 3MG3A 1Q864 1NB3I 4WYKB 2LQVA 1IVWA 2L4VA 2IUKA 1AR0A 1ROAA 4BTYA 4EV5A 2QGUA 2Y73A 1O7NB 3HX8A 2W0QA 4U13A 5AEUB 5KP4A 2K0MA 5AYRB 2INXA 4R4KA 4XM4A 1IV9A 2PZVA 3KSED 3LTDA 1DMQA 1QVG2 4FMBA 4N6V0 1M9GA 1A2KA 1IQ8A 3DGOA 3MSOA 3NM7A 3D3LA 5IERA 4FR9A 3OV4A 4GL6A 3GZXB 1IDPA 2RSXA 1N8R4 3NQZA 1JB5A 1ISKA 1VQM3 3LH4A 3WOFB 4CDLA 3LXUX 2O9UX 3PCSA 1JN5B 1W7CA 2XR8B 1F8NA 3X3XA 1UUWB 2ZL8A 3BNDA 4R1KA 2BNGA 1IVXA 1JKGA 4N6LA 4HBRA 5KP3A 3F40A 1KC84 1TFOA 4X2HA 5D82A 3B4OA 3MHEA 2CIUA 1N5PA 1W6YA 1O7PB 3PCRA 3RGAA 4FMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z76 A;  3B4P A;  5BVB A;  1E97 A;  2F99 A;  2F98 A;  2STD A;  3VSY A;  4HM0 B;  5AIF A;  7STD A;  1GYB A;  3JUP A;  3OWY A;  4OUQ A;  3NUV A;  3FGY A;  4FCM A;  3Q90 A;  4XB5 A;  4XDW A;  3T8N A;  2XSH B;  1JB4 A;  1Q42 A;  3BLZ A;  4LMI A;  5CF1 A;  5IEO A;  3CPO A;  2YFL B;  1W00 A;  1O7H B;  1TP6 A;  2B1X B;  2I9W A;  2Z77 A;  5DRV A;  1OUN A;  1Q40 B;  4HZ9 B;  5JPP A;  8CHO A;  1Q40 A;  4ORL A;  5IG0 A;  1EG9 B;  3JUQ A;  3FLJ A;  2HMK B;  3D9R A;  2BMR B;  4XDV A;  1GY7 A;  3ROB A;  3FZW A;  3CNX A;  1U5O A;  1UUV B;  2CHC A;  4WWU C;  3ER7 A;  4HVN A;  2RFR A;  1K41 A;  2GEY A;  3FSD A;  3DUK A;  3FF0 A;  3JUO A;  3F7X A;  4HM8 B;  4RZM A;  5DRE A;  3MG2 A;  1OHP A;  1DMM A;  1WQL B;  2HMN B;  3EF8 A;  3F8X A;  3E99 A;  3MKI A;  2W2C A;  2RCD A;  2HMJ B;  4HM7 B;  3EN8 A;  5IEP A;  3F7S A;  3FH1 A;  3KZT A;  4L8P A;  1ZX2 A;  3WMD A;  2HMM B;  4H3U A;  4J9A A;  5EVH A;  3RGR A;  3B8L A;  1E3V A;  3CU3 A;  3KSP A;  2K54 A;  5AII A;  3KKG A;  2BMQ B;  4HM3 B;  3DXO A;  3OXA A;  4LGQ A;  5AIH A;  5HGR A;  1OGZ A;  2HMO B;  3EC9 A;  3GZR A;  1JKG B;  4HM4 B;  3CNM A;  5G2G A;  2GBW B;  3STD A;  5FW5 A;  1JB2 A;  2GXF A;  1BUQ A;  2R4I A;  4X2O A;  2GEX A;  2Z7A A;  3FF2 A;  5STD A;  3SOY A;  5IG5 A;  5IG4 A;  3B7C A;  3K0Z A;  5AEW B;  4K1U A;  3UNL A;  3T8U A;  3A76 A;  3EBY A;  3M8C A;  1NWW A;  4XBY A;  1GY5 A;  1OHS A;  4MJD A;  4Q53 A;  4K1V A;  2XSO B;  5CF2 A;  2JQ5 A;  4KVH A;  3H51 A;  4HKV B;  3K7C A;  2F86 B;  1CQS A;  6STD A;  5JPU A;  1ASK A;  1GS3 A;  2BMO B;  4FCJ A;  3NV0 A;  1ULI B;  3BB9 A;  3NXJ A;  3DM8 A;  2CKF B;  3OX9 A;  3OWU A;  1OF5 B;  3FKA A;  1OPY A;  1C7H A;  3MYT A;  4J8T A;  4N3V A;  4HM1 B;  4PEJ A;  4R9L A;  5D81 A;  5CK6 A;  1NDO B;  4HZB B;  4STD A;  1HKX A;  1OF5 A;  3MG3 A;  3MG1 A;  4WP5 A;  4GB5 A;  2XRX B;  4WYK B;  3NHX A;  4I4K A;  3G0K A;  1E3R A;  1S5A A;  5D83 A;  1AR0 A;  1Z1S A;  3I0Y A;  1OGX A;  3GWR A;  4OVM A;  2QGU A;  3G16 A;  2QIY A;  4XBX A;  1O7N B;  3HX8 A;  5AIG A;  1ZO2 A;  4HM2 B;  4U13 A;  5AEU B;  5KP4 A;  3OWS A;  2HML B;  2INX A;  1OHO A;  2YFJ B;  4XM4 A;  3HK4 A;  1EA2 A;  2PZV A;  1QJG A;  3DZL A;  3KE7 A;  3GRD A;  4L7K A;  1DMQ A;  3F14 A;  1TUH A;  1A2K A;  1VZZ A;  5BXQ A;  3HZP A;  3EN1 B;  1NU3 A;  3MSO A;  4HJL B;  4L8O A;  1OH0 A;  1ULJ B;  5IER A;  2UX0 A;  3OV4 A;  3EQQ B;  1STD A;  4HM6 B;  3NV0 B;  5IEN A;  3GZX B;  3EBT A;  5KP1 A;  3S5C A;  2RGQ A;  1IDP A;  1JN5 A;  2B24 B;  3EHC A;  5AI1 A;  1OCV A;  5IF6 A;  1QMA A;  3F9S A;  3UJM A;  1JB5 A;  3SED A;  1ISK A;  3JUN A;  1W02 A;  4CDL A;  3SOA A;  3G8Z A;  5CXO A;  1O7W B;  3EX9 A;  1JN5 B;  2XR8 B;  3EJV A;  4LEH A;  1UUW B;  3F8H A;  3NM2 A;  4R1K A;  5CLK A;  3JUM A;  3GZB A;  1O7M B;  2BNG A;  3IPT A;  3LZA A;  4R9K A;  4WYK A;  1JKG A;  2GBX B;  3H3H A;  5KP3 A;  3F40 A;  1GY6 A;  2YFI B;  2A15 A;  2OWP A;  2IMJ A;  4X2H A;  5D82 A;  3B4O A;  1SJW A;  3MHE A;  4XBT A;  5TGN A;  3LYG A;  1W6Y A;  1O7P B;  3NBR A;  5IG3 A;  3DMC A;  4HM5 B;  4IIA A;  1O7G B;  3ECF A;  3RGA A;  3VGN A;  1DMN A;  3GZY B;  1W01 A; 
#chains in the Genus database with same CATH topology
 1LNH A;  1BSB A;  1Q81 4;  5BVB A;  1YJN 3;  2STD A;  1RRH A;  1RHL A;  1U8C B;  3VSY A;  4N6N B;  5AIF A;  1SAR A;  3SYU A;  3X3Z A;  7STD A;  1RGF A;  4FCM A;  4IT7 A;  3BLZ A;  2P38 A;  2BIR A;  2AAD A;  2OQE C;  3CPO A;  5AYS C;  1LOY A;  3CC2 3;  2LYX A;  6RNT A;  4EV2 A;  2I9W A;  2Z77 A;  2E2U A;  1OUN A;  1Q40 B;  5IG0 A;  3UL6 A;  3G6E 3;  1BOX A;  2P0M A;  2BMR B;  3CCS 3;  2KCD A;  1GY7 A;  4CPK A;  1U5O A;  3AMO A;  1IQX A;  1MOL A;  4O02 B;  4RZM A;  4HM8 B;  3EE1 A;  1RMS A;  4HOH A;  1DMM A;  1OHP A;  3CMA 3;  1A90 A;  1N5H A;  1VQN 3;  2W2C A;  2UGI A;  1JBT A;  1I2E A;  1ZX2 A;  2XEP A;  1M1X B;  2WO0 A;  1DET A;  4H3U A;  1GOY A;  4J9A A;  3WMD A;  1TTO A;  1M1K 4;  1MWU A;  4G1M B;  1RCK A;  1BNJ A;  2V1L A;  2W04 A;  4H61 A;  1WTH A;  3DXO A;  3ZG5 A;  1UUG B;  2HMO B;  1JKG B;  1Q82 4;  3U1W A;  5FW5 A;  1BUQ A;  3WA2 X;  2D42 A;  1FGM A;  1A2P A;  1J2B A;  3B7C A;  4K1U A;  3A76 A;  1NWW A;  3NX0 A;  4TX4 A;  3CME 3;  4BTW A;  2CG1 A;  1OHS A;  4MJD A;  4Q53 A;  1RNT A;  4KVH A;  3H51 A;  2F86 B;  3O8Y A;  5JPU A;  1GS3 A;  2CWU A;  2BMO B;  3BNB A;  4LSO A;  1VQ7 3;  4EXR A;  3OX9 A;  4LMI A;  1T3B A;  2WOF A;  3NXJ A;  3OWU A;  2W9Q A;  1OF5 B;  3V99 A;  5IW9 A;  5M18 A;  1A67 A;  1N9E A;  4N6M A;  5M1A A;  3CCL 3;  1DVD A;  5CK6 A;  2XF3 A;  2FNQ A;  5LC7 A;  3NBB A;  1S72 3;  1GD4 A;  4HAA A;  2JDI H;  4I4K A;  2OTJ 3;  3FG1 A;  1BIR A;  1VQO 3;  1Z1S A;  3CPW 2;  1Q7Y 4;  3GWR A;  1VQ9 3;  3G16 A;  2CFL A;  1GD3 A;  4HM2 B;  1RGG A;  4K90 B;  1IV7 A;  1BSE A;  3OWS A;  1G0T A;  2HML B;  4R80 A;  2KF4 A;  5BU4 A;  2MC8 A;  1BRH A;  1I3F A;  2KF3 A;  5HOH A;  4EC6 A;  1IT7 A;  1YJ9 3;  4L7K A;  2XFT A;  1GOV A;  1TUH A;  1NO3 A;  1JV2 B;  1NU3 A;  3EN1 B;  1FGO A;  2OCT A;  1ULJ B;  1QAF A;  1RCL A;  2UX0 A;  1RN4 A;  1RNB A;  2PNC A;  2C10 A;  1K9M 4;  3NV0 B;  3EBT A;  3HIG A;  4N6O B;  3S5C A;  3LT8 A;  1KD1 4;  2CH9 A;  2ML5 A;  1JN5 A;  3EHC A;  1QMA A;  4OK0 A;  1FZU A;  4MMZ B;  3SOA A;  1O7W B;  2SAR A;  4CJN A;  1JRQ A;  2E2V A;  1SII A;  3F8H A;  1L5G B;  1IYY A;  1FUW A;  1GMQ A;  2OOV C;  5CLK A;  2CWT A;  3DGN A;  1O7M B;  4WYK A;  5JBS A;  1LVN A;  1FYS A;  1N9J A;  2GBX B;  1AQZ A;  1RN7 A;  1W5Z A;  3H3H A;  1GY6 A;  2YFI B;  2BHM A;  4XBT A;  4CCV A;  4RNZ A;  3CD6 3;  1B2S A;  1I0V A;  1PU4 A;  2FXT A;  5G1L A;  3ECF A;  2CK3 H;  1W2Z A;  1DMN A;  1W01 A;  3Q2P A;  7GSP A;  2W9P A;  1BNF A;  1E97 A;  2W56 B;  4DKI A;  1YGE A;  2W6J H;  1I0X A;  2BU4 A;  4KZ1 A;  4RNY A;  3S67 A;  3ZG0 A;  2YX9 A;  1D6U A;  5M19 A;  4FMA A;  4OUQ A;  4MEI A;  1IQY A;  1LRA A;  3WOD G;  3QRD A;  2Y74 A;  1VQK 3;  1W00 A;  3JVC A;  1CEW I;  1NNV A;  4WFO A;  1N8Q A;  1LOX A;  5JPP A;  1QAL A;  1EG9 B;  3FLJ A;  2HMK B;  3PXM A;  4XDV A;  3ROB A;  1V74 A;  2CHC A;  3WOE B;  1JJ2 2;  4WWU C;  4HVN A;  2GEY A;  3FF0 A;  4HYZ A;  5DRE A;  3X40 A;  1SQW A;  1Q7H A;  1W2B 2;  4MMX B;  1BSD A;  3EF8 A;  1SIH A;  1YVB I;  2ZDJ A;  3DGM A;  5RNT A;  2RCD A;  1I3I A;  3PS8 A;  2WOH A;  4HM7 B;  4KT3 B;  3FH1 A;  2D1W A;  1UGH I;  2BO9 B;  2CW9 A;  3LML A;  3RGR A;  3B8L A;  3K5T A;  3KN4 A;  1E3V A;  2GU1 A;  3UB1 A;  3OXA A;  1RLS A;  4LGQ A;  5HGR A;  2HOH A;  1UI7 A;  4HM4 B;  5ELU A;  1ZGX A;  5G2G A;  3STD A;  2GBW B;  3D79 A;  1CYV A;  4QWT A;  2R4I A;  4X2O A;  3FF2 A;  1B2U A;  5STD A;  1VQ8 3;  3UNL A;  3G4S 3;  1UCL A;  3IJE B;  3M8C A;  1GY5 A;  2UUG C;  3Q3F A;  3J7Y d;  1CQS A;  2FGT A;  2F56 A;  2MF7 A;  1VQP 3;  1LQG C;  4JF8 A;  1GMP A;  3X42 A;  2CKF B;  1QAK A;  4PEJ A;  3MYT A;  1LQM B;  4R9L A;  3N8B A;  2QEX 3;  4BL3 A;  4HZB B;  1YHQ 3;  1OF5 A;  6GSP A;  4GB5 A;  3NHX A;  3V92 A;  4RBN A;  1SPU A;  3G0K A;  1E3R A;  2OTL 3;  1UDI I;  3DH2 A;  4XBX A;  5D83 A;  2WGQ A;  2QIY A;  1GSP A;  1ZO2 A;  3ZFZ A;  1PY3 A;  1IU7 A;  2RNT A;  1G96 A;  2YFJ B;  1OHO A;  3GSP A;  1MWS A;  3D5G A;  3QK9 A;  2IA7 A;  3HK4 A;  1RRL A;  2WGO A;  1BRJ A;  1EA2 A;  1TU5 A;  3KE7 A;  3GRD A;  4AKY A;  2QA4 3;  1VZZ A;  5BXQ A;  3HZP A;  4HJL B;  4L8O A;  1OH0 A;  1UGI A;  3N9H A;  2ZHX B;  3N54 B;  1GMR A;  1KWI A;  1STD A;  3AHW A;  3EQQ B;  4HM6 B;  1MWT A;  7RNT A;  4EBG A;  5BIR A;  4AEQ A;  5IF6 A;  4AKZ A;  3SED A;  1BNG A;  2KXG A;  3EX9 A;  1US1 A;  1BAO A;  3MPH A;  4KFD A;  2KRT A;  1NB5 I;  4LEH A;  3NM2 A;  1FGT A;  1X1Y A;  1I70 A;  2K3D A;  2SBL A;  3OW2 2;  1MNL A;  3IPT A;  3LZA A;  4ZM8 A;  1IK3 A;  2M7O A;  4KFF A;  3D5I A;  1CYU A;  3LTC A;  1ZS7 A;  2XH9 A;  4O8S A;  5ELJ A;  1JNQ A;  3K63 A;  2A15 A;  2OWP A;  2IMJ A;  1ROV A;  1I8V A;  1SJW A;  4I5Q A;  1WNH A;  3DY5 A;  1BNI A;  2CFK A;  3LYG A;  3NBR A;  5IG3 A;  3DMC A;  3EB8 A;  4O2H A;  1R4Y A;  1O7G B;  1VQ6 3;  3VGN A;  3GZY B;  5FGO A;  3B4P A;  3VF1 A;  3X41 A;  1RGL A;  2F99 A;  1I2G A;  1PYL A;  1X1W A;  3LTA A;  1GYB A;  3JUP A;  4JRF A;  1FUS A;  1EEJ A;  3K9M C;  1LOW A;  3T8N A;  1M90 4;  2XSH B;  1JB4 A;  3Q1C A;  4J5G A;  1B21 A;  5CF1 A;  2YFL B;  4FMC A;  1TP6 A;  1RGE A;  2OOV A;  5DRV A;  4BL2 A;  3JUQ A;  3AGN A;  3D9R A;  1NJI 4;  1W6C A;  3X3Y A;  3FZW A;  3CNX A;  3WA3 A;  1BRS A;  2RFR A;  2H0H A;  1K41 A;  3JUO A;  1Q9E A;  3DUK A;  3FSD A;  1EUI C;  1RTU A;  1TRQ A;  1RGK A;  3CCJ 3;  3CC4 3;  1WQL B;  1Y4K A;  3F8X A;  3MKI A;  1BRN L;  1LOV A;  2RBI A;  2HMJ B;  4NRE A;  3F7S A;  1GOU A;  1RN1 A;  4LZI A;  1AVK A;  1UCI A;  3SX1 A;  1K8A 4;  1VQ5 3;  5EVH A;  1BUJ A;  1DE3 A;  2CFD A;  3CU3 A;  3WR2 A;  2K54 A;  5LC6 A;  3CXC 2;  1FA3 A;  1YIT 3;  1YIJ 3;  2C4B A;  3EC9 A;  3LT9 A;  3V98 A;  1D6Y A;  1EQK A;  1FGR A;  2GXF A;  2Z7A A;  3WHO A;  2CFG A;  1AV4 A;  3SOY A;  3K0Z A;  3T8U A;  1TIJ A;  3NBJ A;  1UCJ A;  3S28 A;  1PFP A;  2XSO B;  3TDG A;  2KF6 A;  1AY7 A;  2H0I A;  2JQ5 A;  3NQY A;  3K7C A;  4HKV B;  4NPB A;  3CCE 3;  3CCM 3;  1ASK A;  5GSP A;  2BT3 A;  1A2V A;  3ALA A;  3AMO B;  1IT8 A;  3S29 A;  5IEO A;  1OPY A;  4J8T A;  1R4C A;  2O3O A;  1DVC A;  1TJD A;  1KSI A;  1NDO B;  1DYU A;  1HKX A;  3MG1 A;  4WP5 A;  2XRX B;  4NHF A;  1S5A A;  1WMO A;  3I0Y A;  1OGX A;  3LTB A;  3AHS A;  4OVM A;  5AIG A;  3S27 A;  1YJW 3;  1BVI A;  3DGY A;  9RNT A;  1EKM A;  2L1S A;  2R41 A;  2IUJ A;  3MWZ A;  5EQL A;  1QJG A;  3DZL A;  3HI7 A;  1LNI A;  4BIR A;  1IVV A;  3HII A;  3F14 A;  1WMN A;  1RSN A;  1HU9 A;  2W03 A;  2IYJ A;  4EYC A;  2F5M A;  1WMP A;  3UL5 A;  2AAE A;  1QVF 2;  1UCK A;  4GSP A;  1LXE A;  1C54 A;  2CX0 A;  5IEN A;  5KP1 A;  2CFW A;  1B20 A;  2IY2 A;  2RGQ A;  5AI1 A;  2B24 B;  5I97 A;  1OCV A;  2XGN A;  1RGA A;  2H0G A;  3F9S A;  3FG3 A;  3UJM A;  2ZA4 A;  3JUN A;  1W02 A;  1RJO A;  1YNV X;  2Z6B A;  3G8Z A;  5CXO A;  2OQE A;  4N6T A;  1B3S A;  2J8X B;  3EJV A;  1VQQ A;  2CC3 A;  3JUM A;  3GZB A;  4GHO A;  1YGW A;  4O3V A;  1BU4 A;  2GU3 A;  2XFS A;  1JBR A;  1UW1 A;  1JZD A;  3PYJ A;  3KFQ C;  3U97 A;  1B2Z A;  1I2F A;  5TGN A;  5EEO A;  1BNE A;  3SXX A;  2CX1 A;  2F5W A;  1UI8 A;  4J5K A;  4K61 A;  2E2T A;  2C11 A;  4HM5 B;  4IIA A;  4MMY B;  4WHA A;  4R9K A;  1D6Z A;  4BU4 A;  3WDG B;  1FW7 A;  2F4Y A;  2Z76 A;  1B2X A;  2F98 A;  1BNS A;  3KCH A;  3URP A;  1G02 A;  1MGW A;  4HM0 B;  4N6U A;  3I56 3;  1BRG A;  3DGL A;  3OWY A;  3NUV A;  3FGY A;  4XB5 A;  1HZ1 A;  1V57 A;  3Q90 A;  2W56 A;  1HYF A;  4XDW A;  1KQS 2;  1Q42 A;  4ILF A;  3SLU A;  3L0R A;  1O7H B;  1FGQ A;  1BGS A;  2B1X B;  1IVU A;  1VQ4 3;  4HZ9 B;  8CHO A;  1Q40 A;  4ORL A;  3FG4 A;  4FCZ A;  1BNR A;  1W6G A;  1STF I;  3CCQ 3;  4EW5 A;  1AVL A;  2P05 A;  2ML6 A;  1BAN A;  1UUV B;  1MWR A;  3ER7 A;  1YVS A;  2XGL A;  3PZW A;  1YI2 3;  3F7X A;  3IMA B;  1JZO A;  3BNC A;  3MG2 A;  1V58 A;  2CG0 A;  2HMN B;  3E99 A;  1TFK A;  3CCR 3;  5IEP A;  3EN8 A;  3PGB A;  3KZT A;  4L8P A;  2HMM B;  1TRP A;  1K73 4;  3KII A;  2GSP A;  3T0U A;  3CCU 3;  3KSP A;  3I55 3;  5AII A;  3KKG A;  2BMQ B;  2CWV A;  2P0X A;  4KFE A;  4HM3 B;  4LYL B;  4RNT A;  1OAC A;  2KF5 A;  5AIH A;  1OGZ A;  3GZR A;  2KAA A;  1T5Y A;  3CNM A;  3CCV 3;  4BTX A;  1JB2 A;  1MGR A;  2GEX A;  5IG5 A;  1VQL 3;  5IG4 A;  1RGC A;  5AEW B;  3EBY A;  3HOH A;  3SVA A;  4XBY A;  3LOY A;  8RNT A;  3G71 3;  4K1V A;  1BRI A;  2Q07 A;  5CF2 A;  3BNE A;  6STD A;  1W4N A;  3RDE A;  4IPB A;  4FCJ A;  3NV0 A;  1ULI B;  3BB9 A;  3DM8 A;  1RKY A;  1X1X A;  3FKA A;  4N3V A;  1C7H A;  3GAX A;  4HM1 B;  5D81 A;  1CH0 A;  3FCS B;  5A0O B;  2P09 A;  1K28 A;  4STD A;  3CC7 3;  3MG3 A;  1Q86 4;  1NB3 I;  4WYK B;  1FUT A;  2LQV A;  1IVW A;  2L4V A;  2IUK A;  1AR0 A;  1ROA A;  4BTY A;  4EV5 A;  2QGU A;  2Y73 A;  1O7N B;  3HX8 A;  2W0Q A;  4U13 A;  5AEU B;  5KP4 A;  2K0M A;  5AYR B;  2INX A;  4R4K A;  4XM4 A;  1IV9 A;  1RGH A;  2PZV A;  3KSE D;  3LTD A;  1DMQ A;  1QVG 2;  1X1U A;  4FMB A;  1M9G A;  4N6V 0;  1A2K A;  1IQ8 A;  3BIR A;  3DGO A;  3MSO A;  3NM7 A;  3D3L A;  5IER A;  4FR9 A;  3OV4 A;  4GL6 A;  3GZX B;  3BU4 A;  1BRK A;  1JBS A;  1IDP A;  2RSX A;  1N8R 4;  1T2I A;  3NQZ A;  1JB5 A;  1ISK A;  1VQM 3;  3D4A A;  3LH4 A;  3WOF B;  4CDL A;  3LXU X;  1RDS A;  2O9U X;  3PCS A;  1JN5 B;  1W7C A;  2XR8 B;  1F8N A;  3RNT A;  1BSA A;  1UUW B;  3X3X A;  2ZL8 A;  3BND A;  4R1K A;  1BSC A;  1B2M A;  2BNG A;  1B27 A;  1IVX A;  1JKG A;  4N6L A;  4HBR A;  5KP3 A;  3F40 A;  1KC8 4;  1TFO A;  4X2H A;  5D82 A;  3B4O A;  3MHE A;  2CIU A;  5G1K A;  1N5P A;  1W6Y A;  1O7P B;  3A5E A;  3AGO A;  3PCR A;  1T2H A;  3RGA A;  4FMD A; 
#chains in the Genus database with same CATH homology
 1LNH A;  1Q81 4;  5BVB A;  1YJN 3;  2STD A;  1RRH A;  1U8C B;  3VSY A;  4N6N B;  5AIF A;  3X3Z A;  7STD A;  4FCM A;  4IT7 A;  3BLZ A;  2P38 A;  3CPO A;  2OQE C;  5AYS C;  3CC2 3;  2LYX A;  4EV2 A;  2I9W A;  2Z77 A;  2E2U A;  1OUN A;  1Q40 B;  5IG0 A;  3UL6 A;  3G6E 3;  2P0M A;  2BMR B;  3CCS 3;  2KCD A;  1GY7 A;  1U5O A;  3AMO A;  1IQX A;  1MOL A;  4O02 B;  4RZM A;  4HM8 B;  3EE1 A;  1DMM A;  1OHP A;  3CMA 3;  1A90 A;  1N5H A;  1VQN 3;  2W2C A;  1ZX2 A;  2XEP A;  1M1X B;  2WO0 A;  4H3U A;  4J9A A;  3WMD A;  1M1K 4;  4G1M B;  2V1L A;  4H61 A;  2W04 A;  1WTH A;  3DXO A;  2HMO B;  1JKG B;  1Q82 4;  3U1W A;  5FW5 A;  1BUQ A;  3WA2 X;  2D42 A;  1FGM A;  1J2B A;  3B7C A;  4K1U A;  3A76 A;  1NWW A;  3NX0 A;  4TX4 A;  4BTW A;  2CG1 A;  1OHS A;  4MJD A;  4Q53 A;  4KVH A;  3H51 A;  2F86 B;  3O8Y A;  5JPU A;  1GS3 A;  2CWU A;  2BMO B;  3BNB A;  4LSO A;  1VQ7 3;  4EXR A;  3OX9 A;  4LMI A;  3NXJ A;  2WOF A;  3OWU A;  3V99 A;  2W9Q A;  1OF5 B;  5IW9 A;  1A67 A;  1N9E A;  4N6M A;  3CCL 3;  1DVD A;  5CK6 A;  2XF3 A;  2FNQ A;  5LC7 A;  3NBB A;  1S72 3;  1GD4 A;  2JDI H;  4I4K A;  2OTJ 3;  3FG1 A;  1VQO 3;  1Q7Y 4;  1Z1S A;  3CPW 2;  1VQ9 3;  3GWR A;  3G16 A;  2CFL A;  1GD3 A;  4HM2 B;  4K90 B;  1IV7 A;  3OWS A;  4R80 A;  2HML B;  2MC8 A;  4EC6 A;  1IT7 A;  1YJ9 3;  4L7K A;  2XFT A;  1TUH A;  1NO3 A;  3EN1 B;  1JV2 B;  1NU3 A;  1FGO A;  2OCT A;  1ULJ B;  1QAF A;  2UX0 A;  2PNC A;  2C10 A;  1K9M 4;  3NV0 B;  3EBT A;  3HIG A;  4N6O B;  3S5C A;  3LT8 A;  1KD1 4;  2CH9 A;  2ML5 A;  1JN5 A;  3EHC A;  1QMA A;  4OK0 A;  4MMZ B;  3SOA A;  1O7W B;  1JRQ A;  2E2V A;  1SII A;  3F8H A;  1L5G B;  1FUW A;  2OOV C;  5CLK A;  2CWT A;  3DGN A;  1O7M B;  4WYK A;  5JBS A;  1LVN A;  1N9J A;  2GBX B;  1W5Z A;  1RN7 A;  3H3H A;  1GY6 A;  2YFI B;  2BHM A;  4XBT A;  4CCV A;  4RNZ A;  3CD6 3;  1PU4 A;  2FXT A;  3ECF A;  2CK3 H;  1W2Z A;  1DMN A;  1W01 A;  3Q2P A;  2W9P A;  1E97 A;  2W56 B;  1YGE A;  2W6J H;  4KZ1 A;  4RNY A;  3S67 A;  2YX9 A;  1D6U A;  4FMA A;  4OUQ A;  4MEI A;  1IQY A;  3WOD G;  3QRD A;  2Y74 A;  1VQK 3;  1W00 A;  3JVC A;  1CEW I;  4WFO A;  5JPP A;  1N8Q A;  1LOX A;  1QAL A;  1EG9 B;  3FLJ A;  2HMK B;  3PXM A;  4XDV A;  3ROB A;  1V74 A;  2CHC A;  3WOE B;  1JJ2 2;  4WWU C;  4HVN A;  2GEY A;  3FF0 A;  4HYZ A;  5DRE A;  3X40 A;  1SQW A;  1W2B 2;  4MMX B;  3EF8 A;  1SIH A;  1YVB I;  2ZDJ A;  3DGM A;  2RCD A;  3PS8 A;  2WOH A;  4HM7 B;  3FH1 A;  2D1W A;  2BO9 B;  2CW9 A;  3LML A;  3RGR A;  3B8L A;  3K5T A;  3KN4 A;  1E3V A;  2GU1 A;  3UB1 A;  3OXA A;  4LGQ A;  5HGR A;  3CME 3;  5ELU A;  1UI7 A;  4HM4 B;  3STD A;  5G2G A;  2GBW B;  4QWT A;  1CYV A;  2R4I A;  4X2O A;  3FF2 A;  1VQ8 3;  5STD A;  3UNL A;  3G4S 3;  3IJE B;  3M8C A;  1GY5 A;  3J7Y d;  1CQS A;  2FGT A;  2MF7 A;  1VQP 3;  4JF8 A;  3X42 A;  2CKF B;  1QAK A;  4PEJ A;  3MYT A;  4R9L A;  3N8B A;  2QEX 3;  4HZB B;  1YHQ 3;  1OF5 A;  4GB5 A;  3NHX A;  3V92 A;  4RBN A;  1SPU A;  3G0K A;  1E3R A;  2OTL 3;  5D83 A;  4XBX A;  2WGQ A;  2QIY A;  1ZO2 A;  1IU7 A;  1G96 A;  2YFJ B;  1OHO A;  3QK9 A;  2IA7 A;  3HK4 A;  1RRL A;  2WGO A;  1EA2 A;  1TU5 A;  3KE7 A;  3GRD A;  4AKY A;  2QA4 3;  1VZZ A;  5BXQ A;  3HZP A;  4HJL B;  4L8O A;  1OH0 A;  3N9H A;  3N54 B;  3EQQ B;  1KWI A;  1STD A;  4HM6 B;  4EBG A;  4AEQ A;  5IF6 A;  4AKZ A;  3SED A;  2KXG A;  3EX9 A;  1US1 A;  3MPH A;  4KFD A;  2KRT A;  1NB5 I;  4LEH A;  3NM2 A;  1FGT A;  2SBL A;  3OW2 2;  1MNL A;  3IPT A;  3LZA A;  4ZM8 A;  1IK3 A;  2M7O A;  4KFF A;  1CYU A;  3LTC A;  2XH9 A;  4O8S A;  5ELJ A;  1JNQ A;  3K63 A;  2A15 A;  2OWP A;  2IMJ A;  1ROV A;  1SJW A;  1WNH A;  3DY5 A;  2CFK A;  3LYG A;  3NBR A;  5IG3 A;  3DMC A;  3EB8 A;  4O2H A;  1O7G B;  1VQ6 3;  3VGN A;  3GZY B;  5FGO A;  3B4P A;  3VF1 A;  3X41 A;  2F99 A;  3LTA A;  1GYB A;  3JUP A;  4JRF A;  3K9M C;  3T8N A;  1M90 4;  2XSH B;  1JB4 A;  3Q1C A;  5CF1 A;  2YFL B;  4FMC A;  1TP6 A;  2OOV A;  5DRV A;  3JUQ A;  3D9R A;  1NJI 4;  1W6C A;  3X3Y A;  3FZW A;  3CNX A;  3WA3 A;  2RFR A;  1K41 A;  3JUO A;  3FSD A;  3DUK A;  3CCJ 3;  3CC4 3;  1WQL B;  1Y4K A;  3F8X A;  3MKI A;  2HMJ B;  4NRE A;  3F7S A;  4LZI A;  1VQ5 3;  1AVK A;  3SX1 A;  1K8A 4;  5EVH A;  2CFD A;  3CU3 A;  2K54 A;  5LC6 A;  3CXC 2;  1FA3 A;  1YIT 3;  1YIJ 3;  3EC9 A;  3LT9 A;  3V98 A;  1D6Y A;  1EQK A;  1FGR A;  2GXF A;  2Z7A A;  2CFG A;  1AV4 A;  3SOY A;  3K0Z A;  3T8U A;  1TIJ A;  3NBJ A;  3S28 A;  1PFP A;  2XSO B;  3TDG A;  2JQ5 A;  3CCE 3;  4HKV B;  3NQY A;  3K7C A;  3CCM 3;  1ASK A;  2BT3 A;  1A2V A;  3ALA A;  3AMO B;  1IT8 A;  3S29 A;  5IEO A;  1OPY A;  4J8T A;  1R4C A;  2O3O A;  1DVC A;  1KSI A;  1NDO B;  1DYU A;  1HKX A;  3MG1 A;  4WP5 A;  2XRX B;  4NHF A;  1S5A A;  1WMO A;  3I0Y A;  1OGX A;  3LTB A;  4OVM A;  5AIG A;  3S27 A;  1YJW 3;  1EKM A;  2IUJ A;  3MWZ A;  5EQL A;  1QJG A;  3DZL A;  3HI7 A;  1IVV A;  3HII A;  3F14 A;  1WMN A;  1HU9 A;  2W03 A;  4EYC A;  1WMP A;  3UL5 A;  1QVF 2;  1LXE A;  5IEN A;  5KP1 A;  2CFW A;  2RGQ A;  5AI1 A;  5I97 A;  2B24 B;  1OCV A;  2XGN A;  3F9S A;  3FG3 A;  3UJM A;  3JUN A;  1W02 A;  1RJO A;  2Z6B A;  3G8Z A;  5CXO A;  2OQE A;  4N6T A;  3EJV A;  2CC3 A;  3JUM A;  3GZB A;  4O3V A;  2GU3 A;  2XFS A;  1UW1 A;  3PYJ A;  3KFQ C;  3U97 A;  5TGN A;  5EEO A;  3SXX A;  1UI8 A;  4K61 A;  2E2T A;  2C11 A;  4HM5 B;  4IIA A;  4MMY B;  4WHA A;  4R9K A;  1D6Z A;  3WDG B;  2Z76 A;  2F98 A;  4HM0 B;  4N6U A;  3I56 3;  3DGL A;  3OWY A;  3NUV A;  3FGY A;  4XB5 A;  3Q90 A;  4XDW A;  1KQS 2;  2W56 A;  1Q42 A;  3SLU A;  3L0R A;  1O7H B;  1FGQ A;  2B1X B;  1VQ4 3;  1IVU A;  4HZ9 B;  8CHO A;  1Q40 A;  4ORL A;  3FG4 A;  4FCZ A;  1W6G A;  1STF I;  3CCQ 3;  1AVL A;  2P05 A;  2ML6 A;  1UUV B;  3ER7 A;  2XGL A;  3PZW A;  1YI2 3;  3F7X A;  3IMA B;  3BNC A;  3MG2 A;  2CG0 A;  2HMN B;  3E99 A;  1TFK A;  3CCR 3;  5IEP A;  3EN8 A;  3PGB A;  3KZT A;  4L8P A;  2HMM B;  1K73 4;  3KII A;  3T0U A;  3CCU 3;  3KSP A;  3I55 3;  5AII A;  3KKG A;  2BMQ B;  2CWV A;  2P0X A;  4KFE A;  4HM3 B;  5AIH A;  1OAC A;  1OGZ A;  3GZR A;  1T5Y A;  3CNM A;  3CCV 3;  4BTX A;  1JB2 A;  2GEX A;  5IG5 A;  1VQL 3;  5IG4 A;  5AEW B;  3EBY A;  3SVA A;  4XBY A;  3LOY A;  3G71 3;  4K1V A;  2Q07 A;  5CF2 A;  3BNE A;  6STD A;  1W4N A;  3RDE A;  4IPB A;  4FCJ A;  3NV0 A;  1ULI B;  3BB9 A;  3DM8 A;  1RKY A;  3FKA A;  4N3V A;  1C7H A;  3GAX A;  4HM1 B;  5D81 A;  3FCS B;  5A0O B;  2P09 A;  1K28 A;  4STD A;  3CC7 3;  3MG3 A;  1Q86 4;  1NB3 I;  4WYK B;  2LQV A;  1IVW A;  2L4V A;  2IUK A;  1AR0 A;  1ROA A;  4BTY A;  4EV5 A;  2QGU A;  2Y73 A;  1O7N B;  3HX8 A;  2W0Q A;  4U13 A;  5AEU B;  5KP4 A;  2K0M A;  5AYR B;  2INX A;  4R4K A;  4XM4 A;  1IV9 A;  2PZV A;  3KSE D;  3LTD A;  1DMQ A;  1QVG 2;  4FMB A;  4N6V 0;  1M9G A;  1A2K A;  1IQ8 A;  3DGO A;  3MSO A;  3NM7 A;  3D3L A;  5IER A;  4FR9 A;  3OV4 A;  4GL6 A;  3GZX B;  1IDP A;  2RSX A;  1N8R 4;  3NQZ A;  1JB5 A;  1ISK A;  1VQM 3;  3LH4 A;  3WOF B;  4CDL A;  3LXU X;  2O9U X;  3PCS A;  1JN5 B;  1W7C A;  2XR8 B;  1F8N A;  3X3X A;  1UUW B;  2ZL8 A;  3BND A;  4R1K A;  2BNG A;  1IVX A;  1JKG A;  4N6L A;  4HBR A;  5KP3 A;  3F40 A;  1KC8 4;  1TFO A;  4X2H A;  5D82 A;  3B4O A;  3MHE A;  2CIU A;  1N5P A;  1W6Y A;  1O7P B;  3PCR A;  3RGA A;  4FMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...