2IMJA

X-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
AQVRPPLPPFTRESAIEKIRLAEDGWNSRDPERVSLAYTLDTQWRNRAEFAHNREEAKAFLTRKWAKELDYRLIKELWAFTDNRIAVRYAYEWHDDSGNWFRSYGNENWEFDEQGLMARRFACINDMPIKAQERKFHWPLGRRPDDHPGLSELGLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein DUF1348
publication title Crystal Structure of the hypothetical protein (DUF1348) from Pseudomonas fluorescens, Northeast Structural Genomics target PlR14.
rcsb
source organism Pseudomonas fluorescens pf-5
molecule tags Structural genomics, unknown function
total genus 54
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07080 DUF1348 Protein of unknown function (DUF1348)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2imjA01
1W01A 3EF8A 3GZXB 3DZLA 5IG4A 1TP6A 5DREA 3VSYA 6STDA 3NV0B 2HMMB 1AR0A 1HKXA 4CDLA 4XBTA 2Z7AA 1VZZA 3A76A 4XBXA 3B4PA 4PEJA 1A2KA 8CHOA 4OVMA 1GY7A 2GEYA 1DMMA 3RGAA 2BMRB 3KZTA 4IIAA 3JUOA 2CHCA 1OUNA 4RZMA 3M8CA 2B24B 2B1XB 3NXJA 3EHCA 2GXFA 4LEHA 3BB9A 3MG1A 5CXOA 3MHEA 2YFLB 4HVNA 4XDWA 4X2OA 2OWPA 1UUVB 1BUQA 4HZ9B 3T8NA 1E3VA 3UNLA 5AIFA 1OH0A 3Q90A 4HKVB 1JKGA 2W2CA 1TUHA 3HX8A 7STDA 2YFIB 1JKGB 2PZVA 3MG2A 3JUMA 4X2HA 2JQ5A 4R1KA 3RGRA 1JB5A 2BMOB 1OCVA 4Q53A 5HGRA 3MYTA 5CF1A 1ULIB 4N3VA 3MG3A 3B7CA 3DUKA 3F7SA 3CNMA 2IMJA 1W6YA 3KSPA 3EJVA 3FZWA 1QMAA 1DMNA 2HMOB 3B4OA 3UJMA 4HM8B 4WYKB 4HZBB 1OHOA 5AEWB 2QGUA 4HJLB 3S5CA 3MKIA 4GB5A 1ULJB 4HM1B 3K0ZA 4XM4A 3F7XA 3NM2A 5IF6A 3KE7A 1OGXA 1JN5A 1OF5A 3NHXA 1O7MB 4KVHA 5DRVA 3H51A 1WQLB 2RCDA 1STDA 3EQQB 5TGNA 1O7GB 5JPUA 4H3UA 1QJGA 1O7PB 1UUWB 3JUNA 1JN5B 1OF5B 2XRXB 3LYGA 4XDVA 4LMIA 4J8TA 2I9WA 2XR8B 1ZX2A 3OXAA 1O7HB 2CKFB 3ER7A 1GS3A 5IG5A 4L7KA 5IEPA 3DM8A 2A15A 1O7WB 3I0YA 5IG3A 5AI1A 5BXQA 2GEXA 1O7NB 2STDA 1K41A 1OPYA 2UX0A 3IPTA 5IENA 3BLZA 3FF0A 1EA2A 1SJWA 3FGYA 3SOAA 1OHPA 2RFRA 4R9LA 3GRDA 4ORLA 3F40A 1C7HA 3OV4A 2HMJB 3E99A 3STDA 4OUQA 5D81A 3MSOA 2F86B 5AEUB 3FH1A 4STDA 4L8PA 1DMQA 4HM2B 2RGQA 3EBTA 3F9SA 5G2GA 5AIGA 5IEOA 4HM6B 1W02A 4WYKA 3EC9A 2Z77A 3GZBA 5AIHA 3F8XA 4XB5A 5IG0A 4J9AA 4I4KA 5BVBA 3G0KA 2XSOB 3ECFA 3FF2A 3DMCA 4HM7B 4HM4B 5CF2A 5D82A 1NDOB 2HMNB 5CLKA 3HZPA 1OGZA 1NWWA 3EN1B 5D83A 3FLJA 4WP5A 5IERA 1JB2A 3VGNA 3D9RA 1ASKA 1NU3A 4K1UA 1GY6A 4FCJA 3CNXA 1E97A 3F8HA 2HMLB 3NBRA 3F14A 5KP4A 3ROBA 5JPPA 3JUPA 2YFJB 3OX9A 2GBXB 5KP1A 1GY5A 3KKGA 4HM5B 3DXOA 1IDPA 4LGQA 3SEDA 2QIYA 4U13A 3T8UA 3SOYA 4K1VA 2INXA 1ZO2A 3G16A 3FKAA 3HK4A 1JB4A 1GYBA 5CK6A 5KP3A 2Z76A 1CQSA 4HM3B 2HMKB 1U5OA 1OHSA 1Z1SA 4MJDA 3GZYB 5FW5A 3CPOA 3EX9A 4HM0B 2F99A 3OWYA 1ISKA 3WMDA 5AIIA 5STDA 3CU3A 1W00A 1Q40A 3OWUA 3OWSA 2GBWB 3GZRA 3JUQA 3K7CA 3H3HA 3NUVA 1Q40B 2K54A 4WWUC 2BMQB 3FSDA 4L8OA 2XSHB 1E3RA 2F98A 4R9KA 4FCMA 3GWRA 1Q42A 3G8ZA 2R4IA 3EBYA 5EVHA 3LZAA 1S5AA 1EG9B 2BNGA 3NV0A 3B8LA 3EN8A 4XBYA
chains in the Genus database with same CATH superfamily
1W01A 3EF8A 3GZXB 1BRSA 1V58A 2RSXA 1FUSA 2C4BA 1Q864 3DZLA 3NQZA 5EEOA 5IG4A 4N6LA 1TP6A 5DREA 4CPKA 1Q814 2F5MA 3VSYA 6STDA 3X41A 1W5ZA 2W9PA 2P0MA 3NV0B 3SYUA 3DGYA 1VQ63 2HMMB 1JBSA 1AR0A 1HKXA 1Q7HA 4CDLA 2UGIA 1RRLA 2Z7AA 1VZZA 4XBTA 3A76A 3DGNA 4N6TA 1BRIA 1VQL3 3FCSB 4O2HA 4XBXA 3B4PA 1JZOA 2OCTA 1M9GA 1GOYA 4PEJA 1A2KA 4KFDA 5HOHA 8CHOA 3CPW2 1GD3A 1JZDA 1Q9EA 1VQ43 4OVMA 4HAAA 1BNGA 4HOHA 1MWRA 1GY7A 3TDGA 2GEYA 1DMMA 4BL3A 1BGSA 3KCHA 3RGAA 2BMRB 3CCV3 3KZTA 1Q824 1RGLA 1IYYA 2CK3H 4IIAA 3JUOA 3V92A 1EQKA 1FA3A 1UI7A 3RNTA 3X3ZA 2BO9B 3V98A 3CC73 2CHCA 3Q1CA 3URPA 1OUNA 4RZMA 3M8CA 3N8BA 2Y73A 2B24B 1AVLA 4ZM8A 1JV2B 1B2UA 2B1XB 3NXJA 1RGAA 2D1WA 3BNEA 3EHCA 2GXFA 1PYLA 1BRGA 2CFDA 4LEHA 1T2HA 1F8NA 2CG1A 3BB9A 3MG1A 5CXOA 2W04A 3J7Yd 2CX0A 1N8R4 3CCQ3 1UW1A 3MHEA 2YFLB 1BRKA 4HVNA 4XDWA 4O3VA 1RNBA 3MWZA 2KF4A 2CFWA 3U1WA 4X2OA 2OWPA 4K61A 4N6MA 1UUVB 2W9QA 3X3XA 1BUQA 1VQP3 3AGOA 1SIIA 2OQEC 4HZ9B 3S67A 3T8NA 3LTCA 1E3VA 2GU1A 3UNLA 1YHQ3 1GOUA 5AIFA 3RDEA 3FG1A 1OH0A 3Q2PA 3Q90A 4HKVB 1JKGA 1KC84 1S723 2W2CA 1TRPA 1RGCA 2W56A 1TUHA 3HX8A 2L4VA 7STDA 2V1LA 2YFIB 2KF6A 1BNIA 3O8YA 1MNLA 1YNVX 3WR2A 1US1A 1JKGB 1RMSA 2PZVA 3CCE3 1IQ8A 1ROAA 6RNTA 3MG2A 3QK9A 1M904 4GHOA 2W56B 5M18A 4CCVA 1UCKA 3JUMA 4X2HA 2JQ5A 2FGTA 4R1KA 3RGRA 1Y4KA 1JB5A 2BMOB 1OCVA 2E2VA 4Q53A 5RNTA 1LOXA 3PXMA 3BNBA 5HGRA 4EYCA 4O8SA 1KD14 3MYTA 1GMPA 1I8VA 3T0UA 3CCU3 4AEQA 4DKIA 5CF1A 1UCJA 4WHAA 3D5IA 2P05A 1ULIB 1JRQA 3AMOB 4N3VA 1G96A 3MG3A 4O02B 3LH4A 3ZFZA 1DVDA 3B7CA 2K3DA 1NB3I 2IUJA 3DUKA 3F7SA 5JBSA 1KQS2 3CNMA 1SIHA 5ELUA 1UI8A 3LOYA 2IMJA 1BANA 3FG4A 1W6YA 1N5HA 3KSPA 3PS8A 2OQEA 3EJVA 2CWTA 1OACA 3FZWA 1QMAA 2ZHXB 3X40A 1DMNA 3QRDA 4LSOA 2HMOB 1IVVA 1FGOA 3B4OA 5GSPA 1DYUA 1SPUA 2CWVA 5ELJA 4HM8B 3UJMA 1A67A 4R4KA 3ALAA 1HYFA 4I5QA 2BT3A 4HZBB 1OHOA 1RGKA 1UGIA 4WYKB 5AEWB 2QGUA 4HJLB 3S5CA 3EB8A 2HOHA 1MGRA 1RRHA 1TJDA 3U97A 3MKIA 1IQXA 4GB5A 1UUGB 2CX1A 2WGQA 1ULJB 1N8QA 4RNZA 4HM1B 3K0ZA 1K28A 1TTOA 1AV4A 3DGLA 2BHMA 4OK0A 1YI23 3S28A 1TU5A 4XM4A 3F7XA 1B2SA 3NM2A 5IF6A 1W6GA 5FGOA 3KE7A 2QEX3 1M1XB 1OGXA 1IVWA 1RN7A 1I2EA 1ZGXA 5A0OB 3CCM3 1EUIC 1BSCA 1GMRA 3N54B 4TX4A 1DE3A 1JN5A 1OF5A 1BAOA 1IV7A 2GSPA 2CFLA 3LTBA 3NHXA 1O7MB 4KVHA 5DRVA 3H51A 1WQLB 1JBTA 1BNEA 2RCDA 1STDA 3EQQB 5TGNA 1O7GB 2KCDA 5JPUA 1FW7A 4H3UA 1CYUA 1QJGA 1O7PB 1UUWB 4EXRA 4EC6A 7GSPA 3JUNA 4IPBA 1R4CA 1JN5B 1OF5B 2XRXB 3LYGA 4JF8A 3LT8A 1MOLA 1QVG2 2KF5A 1K8A4 1VQ73 1K9M4 4XDVA 4LMIA 4J8TA 2P09A 2I9WA 2XR8B 4NREA 1ZX2A 3OXAA 1O7HB 2F5WA 2CKFB 1RCKA 1WMPA 2JDIH 3ER7A 4NPBA 3LTAA 1GS3A 1RGGA 6GSPA 1VQQA 1RTUA 1BSDA 3CCL3 1C54A 4N6V0 2KAAA 5IG5A 4L7KA 5IEPA 3DM8A 4CJNA 2A15A 1BVIA 2ZA4A 1YJW3 2J8XB 4LZIA 5LC6A 2IYJA 1N9EA 3CME3 3CD63 1O7WB 3I0YA 2Y74A 1BNSA 1Q7Y4 4KZ1A 3OW22 1GSPA 1UCLA 1TRQA 2O9UX 2WOFA 5IG3A 2OOVC 5AI1A 1RN1A 5BXQA 2GEXA 5I97A 1X1WA 1O7NB 5G1LA 1VQO3 2STDA 2RNTA 1K41A 1UCIA 3CCJ3 3S27A 1BRHA 2CG0A 1IT8A 1OPYA 4HYZA 1X1YA 2UX0A 1TFOA 3Q3FA 3WA3A 1SQWA 9RNTA 3IPTA 5AYSC 7RNTA 5IENA 1LXEA 1TFKA 3BLZA 3FF0A 1AVKA 1EA2A 1SJWA 2M7OA 3FGYA 3SOAA 2MF7A 2E2UA 3PCSA 1G02A 1M1K4 1OHPA 5M1AA 3I553 1PY3A 2RFRA 1LOYA 2C11A 2F4YA 4GL6A 1IK3A 1BSBA 3D79A 4R9LA 1I3FA 3GRDA 4ORLA 3CXC2 1FGTA 3F40A 1C7HA 4EV2A 1G0TA 3AMOA 3OV4A 2HMJB 1AY7A 1BRJA 1BOXA 2KRTA 3E99A 3STDA 3KFQC 4BIRA 3IJEB 2IY2A 4OUQA 2UUGC 2F86B 3MSOA 5D81A 5AEUB 1IVXA 1BU4A 1YGEA 3FH1A 1WMNA 3G6E3 4STDA 4AKYA 4ILFA 1DMQA 1EKMA 2GU3A 3N9HA 1RHLA 2BU4A 2RGQA 4HM2B 4L8PA 3UL5A 3WHOA 5BIRA 3EBTA 4RNTA 1QVF2 2CC3A 1LVNA 3F9SA 3WOFB 3G4S3 1LRAA 3S29A 5G2GA 4BTYA 5AIGA 3CMA3 2LQVA 5IEOA 4HM6B 4XBYA 2QA43 1W02A 3K5TA 1BUJA 4WYKA 1UGHI 3EC9A 1QALA 2Z77A 3GZBA 3GSPA 1D6ZA 1BNJA 2OOVA 4RBNA 5AIHA 3F8XA 1MWUA 4XB5A 5IG0A 1STFI 1GD4A 1JNQA 1I2GA 4J9AA 1QAKA 1VQK3 3DGOA 3LXUX 4I4KA 4BTWA 1WMOA 1WNHA 3PZWA 2ZL8A 1W2B2 5BVBA 3G0KA 2W6JH 2XSOB 3DH2A 3ECFA 3FF2A 4MMZB 3PYJA 1RSNA 3DGMA 3PCRA 2CIUA 1JBRA 4FCZA 1YJN3 1KSIA 3WODG 2K0MA 2PNCA 2KF3A 3DMCA 4HM7B 2CW9A 4R80A 1AQZA 4HM4B 1I2FA 2AADA 5CF2A 3HIIA 1NJI4 1TIJA 5D82A 1RDSA 1NDOB 4AKZA 3PGBA 2HMNB 3HOHA 1YVBI 2H0HA 4BU4A 2IUKA 4FMBA 4KT3B 1FYSA 5CLKA 4G1MB 2OTL3 3EE1A 4FR9A 1IVUA 2SBLA 1BSAA 1OGZA 3HZPA 3KN4A 2Q07A 1WTHA 1B27A 1L5GB 3BIRA 4QWTA 1NWWA 4BTXA 3EN1B 4FMAA 1LQGC 5D83A 3FLJA 2XEPA 4WFOA 1DETA 1I70A 1N5PA 3NQYA 4WP5A 5IERA 1V74A 3LMLA 2FNQA 2CFKA 1R4YA 1JB2A 2XH9A 3VGNA 2P38A 3GAXA 2ML6A 1IT7A 1A2VA 3D9RA 3LT9A 4BL2A 1BNFA 4HBRA 1ASKA 3CCR3 2XFSA 1NU3A 1HZ1A 1T3BA 2F56A 2CWUA 4K1UA 4LYLB 1LNIA 1W2ZA 1CH0A 2CFGA 1CYVA 1GY6A 3UB1A 2RBIA 4FCJA 2OTJ3 3CNXA 1GMQA 3D5GA 2R41A 2YX9A 1E97A 4FMCA 1ROVA 1RGEA 3SLUA 3KSED 1EEJA 2H0IA 3F8HA 1VQM3 4JRFA 4MMXB 3G713 5G1KA 2HMLB 3CC43 3NBRA 3F14A 5KP4A 3ROBA 5JPPA 3JUPA 2YFJB 4N6NB 2WGOA 2D42A 3OX9A 2GBXB 5KP1A 3BNDA 1GY5A 3KKGA 4HM5B 4KFEA 3SX1A 4EV5A 1KWIA 1JJ22 1RGFA 2ML5A 3DXOA 1BRNL 1IDPA 1RNTA 3D4AA 4LGQA 1B2ZA 3SEDA 2QIYA 3L0RA 5M19A 3HI7A 1B2MA 2WOHA 3SXXA 4U13A 1YVSA 1MGWA 5EQLA 3AGNA 1V57A 4H61A 4FMDA 1LOVA 1FUTA 3T8UA 3WOEB 5BU4A 3SOYA 3JVCA 1LQMB 1LNHA 4K1VA 2XF3A 3WDGB 2INXA 1RLSA 1ZO2A 3G16A 4K90B 1YIT3 3FKAA 1YGWA 3HK4A 3ZG0A 1PU4A 1JB4A 1RN4A 3CCS3 1ZS7A 1GYBA 1CEWI 1UDII 4EW5A 1A2PA 2FXTA 3CC23 2MC8A 1IQYA 5CK6A 5KP3A 3NM7A 2Z76A 1CQSA 4HM3B 4NHFA 2HMKB 1YIJ3 1MWSA 2W0QA 1YJ93 1I0XA 1U5OA 1OHSA 4GSPA 1Z1SA 4MJDA 1D6YA 3NBJA 1FGQA 1X1XA 1RCLA 1I3IA 1HU9A 2CH9A 3AHWA 3HIGA 2KXGA 1W4NA 1U8CB 1VQ53 1B20A 2XFTA 1FGMA 1FGRA 1DVCA 2O3OA 1NNVA 3MPHA 4EBGA 1B21A 3GZYB 1RGHA 5FW5A 3CPOA 1K734 8RNTA 2XGNA 3EX9A 4HM0B 1VQ83 3WA2X 3V99A 2AAEA 2LYXA 2W03A 2IA7A 2F99A 1X1UA 1B3SA 3OWYA 1SARA 4RNYA 1W6CA 3AHSA 3WMDA 1ISKA 3FG3A 5AIIA 5STDA 2L1SA 2ZDJA 3I563 3CU3A 1FUWA 2BIRA 1I0VA 5IW9A 3NX0A 1QAFA 1IV9A 4J5GA 1W7CA 1W00A 1B2XA 1D6UA 4MEIA 3UL6A 1Q40A 3ZG5A 3OWUA 3X3YA 1RKYA 2C10A 4J5KA 3DY5A 3NBBA 1BSEA 3LTDA 3OWSA 2GBWB 3SVAA 3GZRA 3JUQA 1NB5I 4KFFA 3IMAB 3K7CA 1A90A 2XGLA 3H3HA 3NUVA 1Q40B 1J2BA 2K54A 4WWUC 1BNRA 1MWTA 2BMQB 3FSDA 4L8OA 1VQ93 2XSHB 1E3RA 1FZUA 5AYRB 1PFPA 2F98A 4R9KA 1LOWA 4FCMA 3GWRA 2P0XA 2E2TA 2SARA 4IT7A 1Q42A 1IU7A 4N6UA 3BU4A 2H0GA 3G8ZA 3A5EA 1GOVA 1BIRA 2R4IA 2WO0A 1VQN3 3BNCA 3EBYA 5EVHA 1T5YA 3LZAA 1S5AA 3K63A 4N6OB 4MMYB 2Z6BA 1NO3A 3K9MC 3X42A 5LC7A 1EG9B 2BNGA 3NV0A 1N9JA 3D3LA 3KIIA 3VF1A 3B8LA 3EN8A 1RJOA 1T2IA
chains in the Genus database with same CATH topology
1W01A 3EF8A 3GZXB 2RSXA 1Q864 3DZLA 3NQZA 5EEOA 5IG4A 4N6LA 1TP6A 5DREA 1Q814 3VSYA 6STDA 3X41A 1W5ZA 2W9PA 2P0MA 3NV0B 1VQ63 2HMMB 1AR0A 1HKXA 4CDLA 1RRLA 2Z7AA 1VZZA 4XBTA 3A76A 3DGNA 4N6TA 1VQL3 3FCSB 4O2HA 4XBXA 3B4PA 2OCTA 1M9GA 3CPW2 4PEJA 1A2KA 4KFDA 8CHOA 1GD3A 1VQ43 4OVMA 1GY7A 3TDGA 2GEYA 1DMMA 3RGAA 2BMRB 3CCV3 3KZTA 1Q824 2CK3H 4IIAA 3JUOA 3V92A 1EQKA 1FA3A 1UI7A 3X3ZA 2BO9B 3V98A 3CC73 2CHCA 3Q1CA 1OUNA 4RZMA 3M8CA 3N8BA 2Y73A 2B24B 1AVLA 4ZM8A 1JV2B 2B1XB 3NXJA 2D1WA 3BNEA 3EHCA 2GXFA 2CFDA 4LEHA 1F8NA 2CG1A 3BB9A 3MG1A 5CXOA 2W04A 3J7Yd 1N8R4 3CCQ3 1UW1A 3MHEA 2YFLB 4HVNA 4XDWA 4O3VA 3MWZA 2CFWA 3U1WA 4X2OA 2OWPA 4K61A 4N6MA 1UUVB 2W9QA 3X3XA 1BUQA 1VQP3 1SIIA 2OQEC 4HZ9B 3S67A 3T8NA 3LTCA 1E3VA 2GU1A 3UNLA 1YHQ3 5AIFA 3RDEA 3FG1A 1OH0A 3Q2PA 3Q90A 4HKVB 1JKGA 1KC84 1S723 2W2CA 2W56A 1TUHA 3HX8A 2L4VA 7STDA 2V1LA 2YFIB 3O8YA 1MNLA 1US1A 1JKGB 2PZVA 3CCE3 1IQ8A 1ROAA 3MG2A 3QK9A 1M904 2W56B 4CCVA 3JUMA 4X2HA 2JQ5A 2FGTA 4R1KA 3RGRA 1Y4KA 1JB5A 2BMOB 1OCVA 2E2VA 4Q53A 1LOXA 3PXMA 3BNBA 5HGRA 4EYCA 4O8SA 1KD14 3MYTA 3T0UA 3CCU3 4AEQA 5CF1A 4WHAA 3AMOB 2P05A 1ULIB 1JRQA 4N3VA 1G96A 3MG3A 4O02B 3LH4A 1DVDA 3B7CA 2IUJA 1NB3I 3DUKA 3F7SA 5JBSA 1KQS2 3CNMA 1SIHA 5ELUA 1UI8A 3LOYA 2IMJA 3FG4A 1W6YA 1N5HA 3KSPA 3PS8A 2OQEA 3EJVA 2CWTA 1OACA 3FZWA 1QMAA 3X40A 1DMNA 3QRDA 4LSOA 2HMOB 1IVVA 1FGOA 3B4OA 1A67A 1DYUA 1SPUA 2CWVA 5ELJA 4HM8B 3UJMA 4R4KA 3ALAA 2BT3A 4HZBB 1OHOA 4WYKB 5AEWB 2QGUA 4HJLB 3S5CA 3EB8A 1RRHA 3U97A 3MKIA 1IQXA 4GB5A 2WGQA 1ULJB 1N8QA 4RNZA 4HM1B 3K0ZA 1K28A 1AV4A 3DGLA 2BHMA 4OK0A 1YI23 3S28A 1TU5A 4XM4A 3F7XA 3NM2A 5IF6A 1W6GA 5FGOA 3KE7A 2QEX3 1M1XB 1OGXA 1IVWA 1RN7A 3CCM3 5A0OB 3N54B 4TX4A 1JN5A 1OF5A 1IV7A 2CFLA 3LTBA 3NHXA 1O7MB 4KVHA 5DRVA 3H51A 1WQLB 2RCDA 1STDA 3EQQB 5TGNA 1O7GB 2KCDA 5JPUA 4H3UA 1CYUA 1QJGA 1O7PB 1UUWB 4EXRA 4EC6A 3JUNA 4IPBA 1R4CA 1JN5B 1OF5B 2XRXB 3LYGA 4JF8A 3LT8A 1MOLA 1QVG2 1K8A4 1VQ73 1K9M4 4XDVA 4LMIA 4J8TA 2P09A 2I9WA 2XR8B 4NREA 1ZX2A 3OXAA 1O7HB 2CKFB 1WMPA 2JDIH 3ER7A 3LTAA 1GS3A 3CCL3 4N6V0 5IG5A 4L7KA 5IEPA 3DM8A 2A15A 1YJW3 4LZIA 5LC6A 3CME3 1N9EA 3CD63 1O7WB 3I0YA 2Y74A 1Q7Y4 4KZ1A 3OW22 2O9UX 2WOFA 5IG3A 2OOVC 5AI1A 5BXQA 2GEXA 5I97A 1O7NB 1VQO3 2STDA 1K41A 3CCJ3 3S27A 2CG0A 1IT8A 1OPYA 4HYZA 2UX0A 1TFOA 3WA3A 1SQWA 3IPTA 5AYSC 5IENA 1LXEA 1TFKA 3BLZA 3FF0A 1AVKA 1EA2A 1SJWA 2M7OA 3FGYA 3SOAA 2MF7A 2E2UA 3PCSA 1M1K4 1OHPA 3I553 2RFRA 2C11A 4GL6A 1IK3A 4R9LA 3GRDA 4ORLA 3CXC2 1FGTA 3F40A 1C7HA 4EV2A 3AMOA 3OV4A 2HMJB 2KRTA 3E99A 3STDA 3KFQC 3IJEB 4OUQA 5D81A 3MSOA 2F86B 5AEUB 1IVXA 3FH1A 1YGEA 1WMNA 3G6E3 4STDA 4AKYA 4L8PA 1DMQA 1EKMA 2GU3A 3N9HA 2RGQA 4HM2B 1QVF2 3UL5A 3EBTA 2CC3A 1LVNA 3F9SA 3WOFB 3G4S3 3S29A 5G2GA 4BTYA 5AIGA 3CMA3 2LQVA 5IEOA 4HM6B 2QA43 1W02A 3K5TA 4WYKA 3EC9A 1QALA 2Z77A 3GZBA 1D6ZA 2OOVA 4RBNA 5AIHA 3F8XA 4XB5A 5IG0A 1GD4A 1JNQA 1STFI 4J9AA 1VQK3 1QAKA 3DGOA 3LXUX 4I4KA 4BTWA 1WMOA 1WNHA 3PZWA 2ZL8A 1W2B2 5BVBA 3G0KA 2W6JH 2XSOB 3ECFA 3FF2A 4MMZB 3PYJA 3DGMA 3PCRA 2CIUA 4FCZA 1YJN3 1KSIA 3WODG 2K0MA 2PNCA 3DMCA 4HM7B 2CW9A 4R80A 4HM4B 5CF2A 3HIIA 1NJI4 1TIJA 5D82A 1NDOB 4AKZA 3PGBA 2HMNB 1YVBI 2IUKA 4FMBA 5CLKA 4G1MB 2OTL3 3EE1A 4FR9A 1IVUA 2SBLA 1OGZA 3HZPA 3KN4A 2Q07A 1WTHA 1L5GB 4QWTA 1NWWA 4BTXA 3EN1B 4FMAA 5D83A 3FLJA 2XEPA 4WFOA 1N5PA 3NQYA 4WP5A 5IERA 1V74A 3LMLA 2FNQA 2CFKA 1JB2A 2XH9A 3VGNA 2P38A 3GAXA 2ML6A 1IT7A 1A2VA 3D9RA 3LT9A 4HBRA 1ASKA 3CCR3 2XFSA 1NU3A 2CWUA 4K1UA 1W2ZA 2CFGA 1CYVA 1GY6A 3UB1A 2OTJ3 4FCJA 3CNXA 2YX9A 1E97A 4FMCA 1ROVA 3SLUA 3KSED 3F8HA 1VQM3 4JRFA 4MMXB 3G713 2HMLB 3CC43 3NBRA 3F14A 5KP4A 3ROBA 5JPPA 3JUPA 2YFJB 4N6NB 2WGOA 2D42A 3OX9A 2GBXB 5KP1A 3BNDA 1GY5A 3KKGA 4HM5B 4KFEA 3SX1A 4EV5A 1KWIA 1JJ22 2ML5A 3DXOA 1IDPA 4LGQA 3SEDA 2QIYA 3L0RA 3HI7A 2WOHA 3SXXA 4U13A 5EQLA 4H61A 4FMDA 3T8UA 3WOEB 3SOYA 3JVCA 4K1VA 1LNHA 2XF3A 3WDGB 2INXA 4K90B 1ZO2A 3G16A 1YIT3 3FKAA 3HK4A 1PU4A 1JB4A 3CCS3 1GYBA 1CEWI 2FXTA 3CC23 2MC8A 1IQYA 5CK6A 5KP3A 3NM7A 2Z76A 1CQSA 4HM3B 4NHFA 2HMKB 1YIJ3 2W0QA 1YJ93 1U5OA 1OHSA 1Z1SA 4MJDA 1D6YA 3NBJA 1FGQA 1HU9A 2CH9A 3HIGA 2KXGA 1W4NA 1U8CB 1VQ53 2XFTA 1FGMA 1FGRA 1DVCA 2O3OA 3MPHA 4EBGA 3GZYB 5FW5A 3CPOA 1K734 2XGNA 3EX9A 4HM0B 1VQ83 3WA2X 3V99A 2W03A 2LYXA 2IA7A 2F99A 3OWYA 4RNYA 1W6CA 3WMDA 1ISKA 3FG3A 5AIIA 5STDA 2ZDJA 3I563 3CU3A 1FUWA 5IW9A 3NX0A 1QAFA 1IV9A 1W7CA 1W00A 1D6UA 4MEIA 3UL6A 1Q40A 3OWUA 3X3YA 1RKYA 2C10A 3DY5A 3NBBA 3LTDA 3OWSA 2GBWB 3SVAA 3GZRA 3JUQA 1NB5I 4KFFA 3IMAB 3K7CA 1A90A 2XGLA 3H3HA 3NUVA 1Q40B 1J2BA 2K54A 4WWUC 2BMQB 3FSDA 4L8OA 1VQ93 2XSHB 1E3RA 5AYRB 1PFPA 2F98A 4R9KA 4FCMA 3GWRA 2P0XA 2E2TA 4IT7A 1Q42A 1IU7A 4N6UA 3G8ZA 1VQN3 2WO0A 2R4IA 3BNCA 3EBYA 5EVHA 1T5YA 3LZAA 1S5AA 3K63A 4N6OB 4MMYB 2Z6BA 1NO3A 3K9MC 3X42A 5LC7A 1EG9B 2BNGA 3NV0A 1N9JA 3D3LA 3KIIA 3VF1A 3B8LA 3EN8A 1RJOA 4XBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W01 A;  3EF8 A;  3GZX B;  3DZL A;  5IG4 A;  1TP6 A;  5DRE A;  3VSY A;  6STD A;  3NV0 B;  2HMM B;  1AR0 A;  1HKX A;  4CDL A;  4XBT A;  2Z7A A;  1VZZ A;  3A76 A;  4XBX A;  3B4P A;  4PEJ A;  1A2K A;  8CHO A;  4OVM A;  1GY7 A;  2GEY A;  1DMM A;  3RGA A;  2BMR B;  3KZT A;  4IIA A;  3JUO A;  2CHC A;  1OUN A;  4RZM A;  3M8C A;  2B24 B;  2B1X B;  3NXJ A;  3EHC A;  2GXF A;  4LEH A;  3BB9 A;  3MG1 A;  5CXO A;  3MHE A;  2YFL B;  4HVN A;  4XDW A;  4X2O A;  2OWP A;  1UUV B;  1BUQ A;  4HZ9 B;  3T8N A;  1E3V A;  3UNL A;  5AIF A;  1OH0 A;  3Q90 A;  4HKV B;  1JKG A;  2W2C A;  1TUH A;  3HX8 A;  7STD A;  2YFI B;  1JKG B;  2PZV A;  3MG2 A;  3JUM A;  4X2H A;  2JQ5 A;  4R1K A;  3RGR A;  1JB5 A;  2BMO B;  1OCV A;  4Q53 A;  5HGR A;  3MYT A;  5CF1 A;  1ULI B;  4N3V A;  3MG3 A;  3B7C A;  3DUK A;  3F7S A;  3CNM A;  2IMJ A;  1W6Y A;  3KSP A;  3EJV A;  3FZW A;  1QMA A;  1DMN A;  2HMO B;  3B4O A;  3UJM A;  4HM8 B;  4WYK B;  4HZB B;  1OHO A;  5AEW B;  2QGU A;  4HJL B;  3S5C A;  3MKI A;  4GB5 A;  1ULJ B;  4HM1 B;  3K0Z A;  4XM4 A;  3F7X A;  3NM2 A;  5IF6 A;  3KE7 A;  1OGX A;  1JN5 A;  1OF5 A;  3NHX A;  1O7M B;  4KVH A;  5DRV A;  3H51 A;  1WQL B;  2RCD A;  1STD A;  3EQQ B;  5TGN A;  1O7G B;  5JPU A;  4H3U A;  1QJG A;  1O7P B;  1UUW B;  3JUN A;  1JN5 B;  1OF5 B;  2XRX B;  3LYG A;  4XDV A;  4LMI A;  4J8T A;  2I9W A;  2XR8 B;  1ZX2 A;  3OXA A;  1O7H B;  2CKF B;  3ER7 A;  1GS3 A;  5IG5 A;  4L7K A;  5IEP A;  3DM8 A;  2A15 A;  1O7W B;  3I0Y A;  5IG3 A;  5AI1 A;  5BXQ A;  2GEX A;  1O7N B;  2STD A;  1K41 A;  1OPY A;  2UX0 A;  3IPT A;  5IEN A;  3BLZ A;  3FF0 A;  1EA2 A;  1SJW A;  3FGY A;  3SOA A;  1OHP A;  2RFR A;  4R9L A;  3GRD A;  4ORL A;  3F40 A;  1C7H A;  3OV4 A;  2HMJ B;  3E99 A;  3STD A;  4OUQ A;  5D81 A;  3MSO A;  2F86 B;  5AEU B;  3FH1 A;  4STD A;  4L8P A;  1DMQ A;  4HM2 B;  2RGQ A;  3EBT A;  3F9S A;  5G2G A;  5AIG A;  5IEO A;  4HM6 B;  1W02 A;  4WYK A;  3EC9 A;  2Z77 A;  3GZB A;  5AIH A;  3F8X A;  4XB5 A;  5IG0 A;  4J9A A;  4I4K A;  5BVB A;  3G0K A;  2XSO B;  3ECF A;  3FF2 A;  3DMC A;  4HM7 B;  4HM4 B;  5CF2 A;  5D82 A;  1NDO B;  2HMN B;  5CLK A;  3HZP A;  1OGZ A;  1NWW A;  3EN1 B;  5D83 A;  3FLJ A;  4WP5 A;  5IER A;  1JB2 A;  3VGN A;  3D9R A;  1ASK A;  1NU3 A;  4K1U A;  1GY6 A;  4FCJ A;  3CNX A;  1E97 A;  3F8H A;  2HML B;  3NBR A;  3F14 A;  5KP4 A;  3ROB A;  5JPP A;  3JUP A;  2YFJ B;  3OX9 A;  2GBX B;  5KP1 A;  1GY5 A;  3KKG A;  4HM5 B;  3DXO A;  1IDP A;  4LGQ A;  3SED A;  2QIY A;  4U13 A;  3T8U A;  3SOY A;  4K1V A;  2INX A;  1ZO2 A;  3G16 A;  3FKA A;  3HK4 A;  1JB4 A;  1GYB A;  5CK6 A;  5KP3 A;  2Z76 A;  1CQS A;  4HM3 B;  2HMK B;  1U5O A;  1OHS A;  1Z1S A;  4MJD A;  3GZY B;  5FW5 A;  3CPO A;  3EX9 A;  4HM0 B;  2F99 A;  3OWY A;  1ISK A;  3WMD A;  5AII A;  5STD A;  3CU3 A;  1W00 A;  1Q40 A;  3OWU A;  3OWS A;  2GBW B;  3GZR A;  3JUQ A;  3K7C A;  3H3H A;  3NUV A;  1Q40 B;  2K54 A;  4WWU C;  2BMQ B;  3FSD A;  4L8O A;  2XSH B;  1E3R A;  2F98 A;  4R9K A;  4FCM A;  3GWR A;  1Q42 A;  3G8Z A;  2R4I A;  3EBY A;  5EVH A;  3LZA A;  1S5A A;  1EG9 B;  2BNG A;  3NV0 A;  3B8L A;  3EN8 A;  4XBY A; 
#chains in the Genus database with same CATH topology
 1W01 A;  3EF8 A;  3GZX B;  1BRS A;  1V58 A;  2RSX A;  1FUS A;  2C4B A;  1Q86 4;  3DZL A;  3NQZ A;  5EEO A;  5IG4 A;  4N6L A;  1TP6 A;  5DRE A;  4CPK A;  1Q81 4;  2F5M A;  3VSY A;  6STD A;  3X41 A;  1W5Z A;  2W9P A;  2P0M A;  3NV0 B;  3SYU A;  3DGY A;  1VQ6 3;  2HMM B;  1JBS A;  1AR0 A;  1HKX A;  1Q7H A;  4CDL A;  2UGI A;  1RRL A;  2Z7A A;  1VZZ A;  4XBT A;  3A76 A;  3DGN A;  4N6T A;  1BRI A;  1VQL 3;  3FCS B;  4O2H A;  4XBX A;  3B4P A;  1JZO A;  2OCT A;  1M9G A;  1GOY A;  4PEJ A;  1A2K A;  4KFD A;  5HOH A;  8CHO A;  3CPW 2;  1GD3 A;  1JZD A;  1Q9E A;  1VQ4 3;  4OVM A;  4HAA A;  1BNG A;  4HOH A;  1MWR A;  1GY7 A;  3TDG A;  2GEY A;  1DMM A;  4BL3 A;  1BGS A;  3KCH A;  3RGA A;  2BMR B;  3CCV 3;  3KZT A;  1Q82 4;  1RGL A;  1IYY A;  2CK3 H;  4IIA A;  3JUO A;  3V92 A;  1EQK A;  1FA3 A;  1UI7 A;  3RNT A;  3X3Z A;  2BO9 B;  3V98 A;  3CC7 3;  2CHC A;  3Q1C A;  3URP A;  1OUN A;  4RZM A;  3M8C A;  3N8B A;  2Y73 A;  2B24 B;  1AVL A;  4ZM8 A;  1JV2 B;  1B2U A;  2B1X B;  3NXJ A;  1RGA A;  2D1W A;  3BNE A;  3EHC A;  2GXF A;  1PYL A;  1BRG A;  2CFD A;  4LEH A;  1T2H A;  1F8N A;  2CG1 A;  3BB9 A;  3MG1 A;  5CXO A;  2W04 A;  3J7Y d;  2CX0 A;  1N8R 4;  3CCQ 3;  1UW1 A;  3MHE A;  2YFL B;  1BRK A;  4HVN A;  4XDW A;  4O3V A;  1RNB A;  3MWZ A;  2KF4 A;  2CFW A;  3U1W A;  4X2O A;  2OWP A;  4K61 A;  4N6M A;  1UUV B;  2W9Q A;  3X3X A;  1BUQ A;  1VQP 3;  3AGO A;  1SII A;  2OQE C;  4HZ9 B;  3S67 A;  3T8N A;  3LTC A;  1E3V A;  2GU1 A;  3UNL A;  1YHQ 3;  1GOU A;  5AIF A;  3RDE A;  3FG1 A;  1OH0 A;  3Q2P A;  3Q90 A;  4HKV B;  1JKG A;  1KC8 4;  1S72 3;  2W2C A;  1TRP A;  1RGC A;  2W56 A;  1TUH A;  3HX8 A;  2L4V A;  7STD A;  2V1L A;  2YFI B;  2KF6 A;  1BNI A;  3O8Y A;  1MNL A;  1YNV X;  3WR2 A;  1US1 A;  1JKG B;  1RMS A;  2PZV A;  3CCE 3;  1IQ8 A;  1ROA A;  6RNT A;  3MG2 A;  3QK9 A;  1M90 4;  4GHO A;  2W56 B;  5M18 A;  4CCV A;  1UCK A;  3JUM A;  4X2H A;  2JQ5 A;  2FGT A;  4R1K A;  3RGR A;  1Y4K A;  1JB5 A;  2BMO B;  1OCV A;  2E2V A;  4Q53 A;  5RNT A;  1LOX A;  3PXM A;  3BNB A;  5HGR A;  4EYC A;  4O8S A;  1KD1 4;  3MYT A;  1GMP A;  1I8V A;  3T0U A;  3CCU 3;  4AEQ A;  4DKI A;  5CF1 A;  1UCJ A;  4WHA A;  3D5I A;  2P05 A;  1ULI B;  1JRQ A;  3AMO B;  4N3V A;  1G96 A;  3MG3 A;  4O02 B;  3LH4 A;  3ZFZ A;  1DVD A;  3B7C A;  2K3D A;  1NB3 I;  2IUJ A;  3DUK A;  3F7S A;  5JBS A;  1KQS 2;  3CNM A;  1SIH A;  5ELU A;  1UI8 A;  3LOY A;  2IMJ A;  1BAN A;  3FG4 A;  1W6Y A;  1N5H A;  3KSP A;  3PS8 A;  2OQE A;  3EJV A;  2CWT A;  1OAC A;  3FZW A;  1QMA A;  2ZHX B;  3X40 A;  1DMN A;  3QRD A;  4LSO A;  2HMO B;  1IVV A;  1FGO A;  3B4O A;  5GSP A;  1DYU A;  1SPU A;  2CWV A;  5ELJ A;  4HM8 B;  3UJM A;  1A67 A;  4R4K A;  3ALA A;  1HYF A;  4I5Q A;  2BT3 A;  4HZB B;  1OHO A;  1RGK A;  1UGI A;  4WYK B;  5AEW B;  2QGU A;  4HJL B;  3S5C A;  3EB8 A;  2HOH A;  1MGR A;  1RRH A;  1TJD A;  3U97 A;  3MKI A;  1IQX A;  4GB5 A;  1UUG B;  2CX1 A;  2WGQ A;  1ULJ B;  1N8Q A;  4RNZ A;  4HM1 B;  3K0Z A;  1K28 A;  1TTO A;  1AV4 A;  3DGL A;  2BHM A;  4OK0 A;  1YI2 3;  3S28 A;  1TU5 A;  4XM4 A;  3F7X A;  1B2S A;  3NM2 A;  5IF6 A;  1W6G A;  5FGO A;  3KE7 A;  2QEX 3;  1M1X B;  1OGX A;  1IVW A;  1RN7 A;  1I2E A;  1ZGX A;  5A0O B;  3CCM 3;  1EUI C;  1BSC A;  1GMR A;  3N54 B;  4TX4 A;  1DE3 A;  1JN5 A;  1OF5 A;  1BAO A;  1IV7 A;  2GSP A;  2CFL A;  3LTB A;  3NHX A;  1O7M B;  4KVH A;  5DRV A;  3H51 A;  1WQL B;  1JBT A;  1BNE A;  2RCD A;  1STD A;  3EQQ B;  5TGN A;  1O7G B;  2KCD A;  5JPU A;  1FW7 A;  4H3U A;  1CYU A;  1QJG A;  1O7P B;  1UUW B;  4EXR A;  4EC6 A;  7GSP A;  3JUN A;  4IPB A;  1R4C A;  1JN5 B;  1OF5 B;  2XRX B;  3LYG A;  4JF8 A;  3LT8 A;  1MOL A;  1QVG 2;  2KF5 A;  1K8A 4;  1VQ7 3;  1K9M 4;  4XDV A;  4LMI A;  4J8T A;  2P09 A;  2I9W A;  2XR8 B;  4NRE A;  1ZX2 A;  3OXA A;  1O7H B;  2F5W A;  2CKF B;  1RCK A;  1WMP A;  2JDI H;  3ER7 A;  4NPB A;  3LTA A;  1GS3 A;  1RGG A;  6GSP A;  1VQQ A;  1RTU A;  1BSD A;  3CCL 3;  1C54 A;  4N6V 0;  2KAA A;  5IG5 A;  4L7K A;  5IEP A;  3DM8 A;  4CJN A;  2A15 A;  1BVI A;  2ZA4 A;  1YJW 3;  2J8X B;  4LZI A;  5LC6 A;  2IYJ A;  1N9E A;  3CME 3;  3CD6 3;  1O7W B;  3I0Y A;  2Y74 A;  1BNS A;  1Q7Y 4;  4KZ1 A;  3OW2 2;  1GSP A;  1UCL A;  1TRQ A;  2O9U X;  2WOF A;  5IG3 A;  2OOV C;  5AI1 A;  1RN1 A;  5BXQ A;  2GEX A;  5I97 A;  1X1W A;  1O7N B;  5G1L A;  1VQO 3;  2STD A;  2RNT A;  1K41 A;  1UCI A;  3CCJ 3;  3S27 A;  1BRH A;  2CG0 A;  1IT8 A;  1OPY A;  4HYZ A;  1X1Y A;  2UX0 A;  1TFO A;  3Q3F A;  3WA3 A;  1SQW A;  9RNT A;  3IPT A;  5AYS C;  7RNT A;  5IEN A;  1LXE A;  1TFK A;  3BLZ A;  3FF0 A;  1AVK A;  1EA2 A;  1SJW A;  2M7O A;  3FGY A;  3SOA A;  2MF7 A;  2E2U A;  3PCS A;  1G02 A;  1M1K 4;  1OHP A;  5M1A A;  3I55 3;  1PY3 A;  2RFR A;  1LOY A;  2C11 A;  2F4Y A;  4GL6 A;  1IK3 A;  1BSB A;  3D79 A;  4R9L A;  1I3F A;  3GRD A;  4ORL A;  3CXC 2;  1FGT A;  3F40 A;  1C7H A;  4EV2 A;  1G0T A;  3AMO A;  3OV4 A;  2HMJ B;  1AY7 A;  1BRJ A;  1BOX A;  2KRT A;  3E99 A;  3STD A;  3KFQ C;  4BIR A;  3IJE B;  2IY2 A;  4OUQ A;  2UUG C;  2F86 B;  3MSO A;  5D81 A;  5AEU B;  1IVX A;  1BU4 A;  1YGE A;  3FH1 A;  1WMN A;  3G6E 3;  4STD A;  4AKY A;  4ILF A;  1DMQ A;  1EKM A;  2GU3 A;  3N9H A;  1RHL A;  2BU4 A;  2RGQ A;  4HM2 B;  4L8P A;  3UL5 A;  3WHO A;  5BIR A;  3EBT A;  4RNT A;  1QVF 2;  2CC3 A;  1LVN A;  3F9S A;  3WOF B;  3G4S 3;  1LRA A;  3S29 A;  5G2G A;  4BTY A;  5AIG A;  3CMA 3;  2LQV A;  5IEO A;  4HM6 B;  4XBY A;  2QA4 3;  1W02 A;  3K5T A;  1BUJ A;  4WYK A;  1UGH I;  3EC9 A;  1QAL A;  2Z77 A;  3GZB A;  3GSP A;  1D6Z A;  1BNJ A;  2OOV A;  4RBN A;  5AIH A;  3F8X A;  1MWU A;  4XB5 A;  5IG0 A;  1STF I;  1GD4 A;  1JNQ A;  1I2G A;  4J9A A;  1QAK A;  1VQK 3;  3DGO A;  3LXU X;  4I4K A;  4BTW A;  1WMO A;  1WNH A;  3PZW A;  2ZL8 A;  1W2B 2;  5BVB A;  3G0K A;  2W6J H;  2XSO B;  3DH2 A;  3ECF A;  3FF2 A;  4MMZ B;  3PYJ A;  1RSN A;  3DGM A;  3PCR A;  2CIU A;  1JBR A;  4FCZ A;  1YJN 3;  1KSI A;  3WOD G;  2K0M A;  2PNC A;  2KF3 A;  3DMC A;  4HM7 B;  2CW9 A;  4R80 A;  1AQZ A;  4HM4 B;  1I2F A;  2AAD A;  5CF2 A;  3HII A;  1NJI 4;  1TIJ A;  5D82 A;  1RDS A;  1NDO B;  4AKZ A;  3PGB A;  2HMN B;  3HOH A;  1YVB I;  2H0H A;  4BU4 A;  2IUK A;  4FMB A;  4KT3 B;  1FYS A;  5CLK A;  4G1M B;  2OTL 3;  3EE1 A;  4FR9 A;  1IVU A;  2SBL A;  1BSA A;  1OGZ A;  3HZP A;  3KN4 A;  2Q07 A;  1WTH A;  1B27 A;  1L5G B;  3BIR A;  4QWT A;  1NWW A;  4BTX A;  3EN1 B;  4FMA A;  1LQG C;  5D83 A;  3FLJ A;  2XEP A;  4WFO A;  1DET A;  1I70 A;  1N5P A;  3NQY A;  4WP5 A;  5IER A;  1V74 A;  3LML A;  2FNQ A;  2CFK A;  1R4Y A;  1JB2 A;  2XH9 A;  3VGN A;  2P38 A;  3GAX A;  2ML6 A;  1IT7 A;  1A2V A;  3D9R A;  3LT9 A;  4BL2 A;  1BNF A;  4HBR A;  1ASK A;  3CCR 3;  2XFS A;  1NU3 A;  1HZ1 A;  1T3B A;  2F56 A;  2CWU A;  4K1U A;  4LYL B;  1LNI A;  1W2Z A;  1CH0 A;  2CFG A;  1CYV A;  1GY6 A;  3UB1 A;  2RBI A;  4FCJ A;  2OTJ 3;  3CNX A;  1GMQ A;  3D5G A;  2R41 A;  2YX9 A;  1E97 A;  4FMC A;  1ROV A;  1RGE A;  3SLU A;  3KSE D;  1EEJ A;  2H0I A;  3F8H A;  1VQM 3;  4JRF A;  4MMX B;  3G71 3;  5G1K A;  2HML B;  3CC4 3;  3NBR A;  3F14 A;  5KP4 A;  3ROB A;  5JPP A;  3JUP A;  2YFJ B;  4N6N B;  2WGO A;  2D42 A;  3OX9 A;  2GBX B;  5KP1 A;  3BND A;  1GY5 A;  3KKG A;  4HM5 B;  4KFE A;  3SX1 A;  4EV5 A;  1KWI A;  1JJ2 2;  1RGF A;  2ML5 A;  3DXO A;  1BRN L;  1IDP A;  1RNT A;  3D4A A;  4LGQ A;  1B2Z A;  3SED A;  2QIY A;  3L0R A;  5M19 A;  3HI7 A;  1B2M A;  2WOH A;  3SXX A;  4U13 A;  1YVS A;  1MGW A;  5EQL A;  3AGN A;  1V57 A;  4H61 A;  4FMD A;  1LOV A;  1FUT A;  3T8U A;  3WOE B;  5BU4 A;  3SOY A;  3JVC A;  1LQM B;  1LNH A;  4K1V A;  2XF3 A;  3WDG B;  2INX A;  1RLS A;  1ZO2 A;  3G16 A;  4K90 B;  1YIT 3;  3FKA A;  1YGW A;  3HK4 A;  3ZG0 A;  1PU4 A;  1JB4 A;  1RN4 A;  3CCS 3;  1ZS7 A;  1GYB A;  1CEW I;  1UDI I;  4EW5 A;  1A2P A;  2FXT A;  3CC2 3;  2MC8 A;  1IQY A;  5CK6 A;  5KP3 A;  3NM7 A;  2Z76 A;  1CQS A;  4HM3 B;  4NHF A;  2HMK B;  1YIJ 3;  1MWS A;  2W0Q A;  1YJ9 3;  1I0X A;  1U5O A;  1OHS A;  4GSP A;  1Z1S A;  4MJD A;  1D6Y A;  3NBJ A;  1FGQ A;  1X1X A;  1RCL A;  1I3I A;  1HU9 A;  2CH9 A;  3AHW A;  3HIG A;  2KXG A;  1W4N A;  1U8C B;  1VQ5 3;  1B20 A;  2XFT A;  1FGM A;  1FGR A;  1DVC A;  2O3O A;  1NNV A;  3MPH A;  4EBG A;  1B21 A;  3GZY B;  1RGH A;  5FW5 A;  3CPO A;  1K73 4;  8RNT A;  2XGN A;  3EX9 A;  4HM0 B;  1VQ8 3;  3WA2 X;  3V99 A;  2AAE A;  2LYX A;  2W03 A;  2IA7 A;  2F99 A;  1X1U A;  1B3S A;  3OWY A;  1SAR A;  4RNY A;  1W6C A;  3AHS A;  3WMD A;  1ISK A;  3FG3 A;  5AII A;  5STD A;  2L1S A;  2ZDJ A;  3I56 3;  3CU3 A;  1FUW A;  2BIR A;  1I0V A;  5IW9 A;  3NX0 A;  1QAF A;  1IV9 A;  4J5G A;  1W7C A;  1W00 A;  1B2X A;  1D6U A;  4MEI A;  3UL6 A;  1Q40 A;  3ZG5 A;  3OWU A;  3X3Y A;  1RKY A;  2C10 A;  4J5K A;  3DY5 A;  3NBB A;  1BSE A;  3LTD A;  3OWS A;  2GBW B;  3SVA A;  3GZR A;  3JUQ A;  1NB5 I;  4KFF A;  3IMA B;  3K7C A;  1A90 A;  2XGL A;  3H3H A;  3NUV A;  1Q40 B;  1J2B A;  2K54 A;  4WWU C;  1BNR A;  1MWT A;  2BMQ B;  3FSD A;  4L8O A;  1VQ9 3;  2XSH B;  1E3R A;  1FZU A;  5AYR B;  1PFP A;  2F98 A;  4R9K A;  1LOW A;  4FCM A;  3GWR A;  2P0X A;  2E2T A;  2SAR A;  4IT7 A;  1Q42 A;  1IU7 A;  4N6U A;  3BU4 A;  2H0G A;  3G8Z A;  3A5E A;  1GOV A;  1BIR A;  2R4I A;  2WO0 A;  1VQN 3;  3BNC A;  3EBY A;  5EVH A;  1T5Y A;  3LZA A;  1S5A A;  3K63 A;  4N6O B;  4MMY B;  2Z6B A;  1NO3 A;  3K9M C;  3X42 A;  5LC7 A;  1EG9 B;  2BNG A;  3NV0 A;  1N9J A;  3D3L A;  3KII A;  3VF1 A;  3B8L A;  3EN8 A;  1RJO A;  1T2I A; 
#chains in the Genus database with same CATH homology
 1W01 A;  3EF8 A;  3GZX B;  2RSX A;  1Q86 4;  3DZL A;  3NQZ A;  5EEO A;  5IG4 A;  4N6L A;  1TP6 A;  5DRE A;  1Q81 4;  3VSY A;  6STD A;  3X41 A;  1W5Z A;  2W9P A;  2P0M A;  3NV0 B;  1VQ6 3;  2HMM B;  1AR0 A;  1HKX A;  4CDL A;  1RRL A;  2Z7A A;  1VZZ A;  4XBT A;  3A76 A;  3DGN A;  4N6T A;  1VQL 3;  3FCS B;  4O2H A;  4XBX A;  3B4P A;  2OCT A;  1M9G A;  3CPW 2;  4PEJ A;  1A2K A;  4KFD A;  8CHO A;  1GD3 A;  1VQ4 3;  4OVM A;  1GY7 A;  3TDG A;  2GEY A;  1DMM A;  3RGA A;  2BMR B;  3CCV 3;  3KZT A;  1Q82 4;  2CK3 H;  4IIA A;  3JUO A;  3V92 A;  1EQK A;  1FA3 A;  1UI7 A;  3X3Z A;  2BO9 B;  3V98 A;  3CC7 3;  2CHC A;  3Q1C A;  1OUN A;  4RZM A;  3M8C A;  3N8B A;  2Y73 A;  2B24 B;  1AVL A;  4ZM8 A;  1JV2 B;  2B1X B;  3NXJ A;  2D1W A;  3BNE A;  3EHC A;  2GXF A;  2CFD A;  4LEH A;  1F8N A;  2CG1 A;  3BB9 A;  3MG1 A;  5CXO A;  2W04 A;  3J7Y d;  1N8R 4;  3CCQ 3;  1UW1 A;  3MHE A;  2YFL B;  4HVN A;  4XDW A;  4O3V A;  3MWZ A;  2CFW A;  3U1W A;  4X2O A;  2OWP A;  4K61 A;  4N6M A;  1UUV B;  2W9Q A;  3X3X A;  1BUQ A;  1VQP 3;  1SII A;  2OQE C;  4HZ9 B;  3S67 A;  3T8N A;  3LTC A;  1E3V A;  2GU1 A;  3UNL A;  1YHQ 3;  5AIF A;  3RDE A;  3FG1 A;  1OH0 A;  3Q2P A;  3Q90 A;  4HKV B;  1JKG A;  1KC8 4;  1S72 3;  2W2C A;  2W56 A;  1TUH A;  3HX8 A;  2L4V A;  7STD A;  2V1L A;  2YFI B;  3O8Y A;  1MNL A;  1US1 A;  1JKG B;  2PZV A;  3CCE 3;  1IQ8 A;  1ROA A;  3MG2 A;  3QK9 A;  1M90 4;  2W56 B;  4CCV A;  3JUM A;  4X2H A;  2JQ5 A;  2FGT A;  4R1K A;  3RGR A;  1Y4K A;  1JB5 A;  2BMO B;  1OCV A;  2E2V A;  4Q53 A;  1LOX A;  3PXM A;  3BNB A;  5HGR A;  4EYC A;  4O8S A;  1KD1 4;  3MYT A;  3T0U A;  3CCU 3;  4AEQ A;  5CF1 A;  4WHA A;  3AMO B;  2P05 A;  1ULI B;  1JRQ A;  4N3V A;  1G96 A;  3MG3 A;  4O02 B;  3LH4 A;  1DVD A;  3B7C A;  2IUJ A;  1NB3 I;  3DUK A;  3F7S A;  5JBS A;  1KQS 2;  3CNM A;  1SIH A;  5ELU A;  1UI8 A;  3LOY A;  2IMJ A;  3FG4 A;  1W6Y A;  1N5H A;  3KSP A;  3PS8 A;  2OQE A;  3EJV A;  2CWT A;  1OAC A;  3FZW A;  1QMA A;  3X40 A;  1DMN A;  3QRD A;  4LSO A;  2HMO B;  1IVV A;  1FGO A;  3B4O A;  1A67 A;  1DYU A;  1SPU A;  2CWV A;  5ELJ A;  4HM8 B;  3UJM A;  4R4K A;  3ALA A;  2BT3 A;  4HZB B;  1OHO A;  4WYK B;  5AEW B;  2QGU A;  4HJL B;  3S5C A;  3EB8 A;  1RRH A;  3U97 A;  3MKI A;  1IQX A;  4GB5 A;  2WGQ A;  1ULJ B;  1N8Q A;  4RNZ A;  4HM1 B;  3K0Z A;  1K28 A;  1AV4 A;  3DGL A;  2BHM A;  4OK0 A;  1YI2 3;  3S28 A;  1TU5 A;  4XM4 A;  3F7X A;  3NM2 A;  5IF6 A;  1W6G A;  5FGO A;  3KE7 A;  2QEX 3;  1M1X B;  1OGX A;  1IVW A;  1RN7 A;  3CCM 3;  5A0O B;  3N54 B;  4TX4 A;  1JN5 A;  1OF5 A;  1IV7 A;  2CFL A;  3LTB A;  3NHX A;  1O7M B;  4KVH A;  5DRV A;  3H51 A;  1WQL B;  2RCD A;  1STD A;  3EQQ B;  5TGN A;  1O7G B;  2KCD A;  5JPU A;  4H3U A;  1CYU A;  1QJG A;  1O7P B;  1UUW B;  4EXR A;  4EC6 A;  3JUN A;  4IPB A;  1R4C A;  1JN5 B;  1OF5 B;  2XRX B;  3LYG A;  4JF8 A;  3LT8 A;  1MOL A;  1QVG 2;  1K8A 4;  1VQ7 3;  1K9M 4;  4XDV A;  4LMI A;  4J8T A;  2P09 A;  2I9W A;  2XR8 B;  4NRE A;  1ZX2 A;  3OXA A;  1O7H B;  2CKF B;  1WMP A;  2JDI H;  3ER7 A;  3LTA A;  1GS3 A;  3CCL 3;  4N6V 0;  5IG5 A;  4L7K A;  5IEP A;  3DM8 A;  2A15 A;  1YJW 3;  4LZI A;  5LC6 A;  3CME 3;  1N9E A;  3CD6 3;  1O7W B;  3I0Y A;  2Y74 A;  1Q7Y 4;  4KZ1 A;  3OW2 2;  2O9U X;  2WOF A;  5IG3 A;  2OOV C;  5AI1 A;  5BXQ A;  2GEX A;  5I97 A;  1O7N B;  1VQO 3;  2STD A;  1K41 A;  3CCJ 3;  3S27 A;  2CG0 A;  1IT8 A;  1OPY A;  4HYZ A;  2UX0 A;  1TFO A;  3WA3 A;  1SQW A;  3IPT A;  5AYS C;  5IEN A;  1LXE A;  1TFK A;  3BLZ A;  3FF0 A;  1AVK A;  1EA2 A;  1SJW A;  2M7O A;  3FGY A;  3SOA A;  2MF7 A;  2E2U A;  3PCS A;  1M1K 4;  1OHP A;  3I55 3;  2RFR A;  2C11 A;  4GL6 A;  1IK3 A;  4R9L A;  3GRD A;  4ORL A;  3CXC 2;  1FGT A;  3F40 A;  1C7H A;  4EV2 A;  3AMO A;  3OV4 A;  2HMJ B;  2KRT A;  3E99 A;  3STD A;  3KFQ C;  3IJE B;  4OUQ A;  5D81 A;  3MSO A;  2F86 B;  5AEU B;  1IVX A;  3FH1 A;  1YGE A;  1WMN A;  3G6E 3;  4STD A;  4AKY A;  4L8P A;  1DMQ A;  1EKM A;  2GU3 A;  3N9H A;  2RGQ A;  4HM2 B;  1QVF 2;  3UL5 A;  3EBT A;  2CC3 A;  1LVN A;  3F9S A;  3WOF B;  3G4S 3;  3S29 A;  5G2G A;  4BTY A;  5AIG A;  3CMA 3;  2LQV A;  5IEO A;  4HM6 B;  2QA4 3;  1W02 A;  3K5T A;  4WYK A;  3EC9 A;  1QAL A;  2Z77 A;  3GZB A;  1D6Z A;  2OOV A;  4RBN A;  5AIH A;  3F8X A;  4XB5 A;  5IG0 A;  1GD4 A;  1JNQ A;  1STF I;  4J9A A;  1VQK 3;  1QAK A;  3DGO A;  3LXU X;  4I4K A;  4BTW A;  1WMO A;  1WNH A;  3PZW A;  2ZL8 A;  1W2B 2;  5BVB A;  3G0K A;  2W6J H;  2XSO B;  3ECF A;  3FF2 A;  4MMZ B;  3PYJ A;  3DGM A;  3PCR A;  2CIU A;  4FCZ A;  1YJN 3;  1KSI A;  3WOD G;  2K0M A;  2PNC A;  3DMC A;  4HM7 B;  2CW9 A;  4R80 A;  4HM4 B;  5CF2 A;  3HII A;  1NJI 4;  1TIJ A;  5D82 A;  1NDO B;  4AKZ A;  3PGB A;  2HMN B;  1YVB I;  2IUK A;  4FMB A;  5CLK A;  4G1M B;  2OTL 3;  3EE1 A;  4FR9 A;  1IVU A;  2SBL A;  1OGZ A;  3HZP A;  3KN4 A;  2Q07 A;  1WTH A;  1L5G B;  4QWT A;  1NWW A;  4BTX A;  3EN1 B;  4FMA A;  5D83 A;  3FLJ A;  2XEP A;  4WFO A;  1N5P A;  3NQY A;  4WP5 A;  5IER A;  1V74 A;  3LML A;  2FNQ A;  2CFK A;  1JB2 A;  2XH9 A;  3VGN A;  2P38 A;  3GAX A;  2ML6 A;  1IT7 A;  1A2V A;  3D9R A;  3LT9 A;  4HBR A;  1ASK A;  3CCR 3;  2XFS A;  1NU3 A;  2CWU A;  4K1U A;  1W2Z A;  2CFG A;  1CYV A;  1GY6 A;  3UB1 A;  2OTJ 3;  4FCJ A;  3CNX A;  2YX9 A;  1E97 A;  4FMC A;  1ROV A;  3SLU A;  3KSE D;  3F8H A;  1VQM 3;  4JRF A;  4MMX B;  3G71 3;  2HML B;  3CC4 3;  3NBR A;  3F14 A;  5KP4 A;  3ROB A;  5JPP A;  3JUP A;  2YFJ B;  4N6N B;  2WGO A;  2D42 A;  3OX9 A;  2GBX B;  5KP1 A;  3BND A;  1GY5 A;  3KKG A;  4HM5 B;  4KFE A;  3SX1 A;  4EV5 A;  1KWI A;  1JJ2 2;  2ML5 A;  3DXO A;  1IDP A;  4LGQ A;  3SED A;  2QIY A;  3L0R A;  3HI7 A;  2WOH A;  3SXX A;  4U13 A;  5EQL A;  4H61 A;  4FMD A;  3T8U A;  3WOE B;  3SOY A;  3JVC A;  4K1V A;  1LNH A;  2XF3 A;  3WDG B;  2INX A;  4K90 B;  1ZO2 A;  3G16 A;  1YIT 3;  3FKA A;  3HK4 A;  1PU4 A;  1JB4 A;  3CCS 3;  1GYB A;  1CEW I;  2FXT A;  3CC2 3;  2MC8 A;  1IQY A;  5CK6 A;  5KP3 A;  3NM7 A;  2Z76 A;  1CQS A;  4HM3 B;  4NHF A;  2HMK B;  1YIJ 3;  2W0Q A;  1YJ9 3;  1U5O A;  1OHS A;  1Z1S A;  4MJD A;  1D6Y A;  3NBJ A;  1FGQ A;  1HU9 A;  2CH9 A;  3HIG A;  2KXG A;  1W4N A;  1U8C B;  1VQ5 3;  2XFT A;  1FGM A;  1FGR A;  1DVC A;  2O3O A;  3MPH A;  4EBG A;  3GZY B;  5FW5 A;  3CPO A;  1K73 4;  2XGN A;  3EX9 A;  4HM0 B;  1VQ8 3;  3WA2 X;  3V99 A;  2W03 A;  2LYX A;  2IA7 A;  2F99 A;  3OWY A;  4RNY A;  1W6C A;  3WMD A;  1ISK A;  3FG3 A;  5AII A;  5STD A;  2ZDJ A;  3I56 3;  3CU3 A;  1FUW A;  5IW9 A;  3NX0 A;  1QAF A;  1IV9 A;  1W7C A;  1W00 A;  1D6U A;  4MEI A;  3UL6 A;  1Q40 A;  3OWU A;  3X3Y A;  1RKY A;  2C10 A;  3DY5 A;  3NBB A;  3LTD A;  3OWS A;  2GBW B;  3SVA A;  3GZR A;  3JUQ A;  1NB5 I;  4KFF A;  3IMA B;  3K7C A;  1A90 A;  2XGL A;  3H3H A;  3NUV A;  1Q40 B;  1J2B A;  2K54 A;  4WWU C;  2BMQ B;  3FSD A;  4L8O A;  1VQ9 3;  2XSH B;  1E3R A;  5AYR B;  1PFP A;  2F98 A;  4R9K A;  4FCM A;  3GWR A;  2P0X A;  2E2T A;  4IT7 A;  1Q42 A;  1IU7 A;  4N6U A;  3G8Z A;  1VQN 3;  2WO0 A;  2R4I A;  3BNC A;  3EBY A;  5EVH A;  1T5Y A;  3LZA A;  1S5A A;  3K63 A;  4N6O B;  4MMY B;  2Z6B A;  1NO3 A;  3K9M C;  3X42 A;  5LC7 A;  1EG9 B;  2BNG A;  3NV0 A;  1N9J A;  3D3L A;  3KII A;  3VF1 A;  3B8L A;  3EN8 A;  1RJO A;  4XBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...