3DMCA

Crystal structure of a ntf2-like protein (ava_2261) from anabaena variabilis atcc 29413 at 1.65 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
GMMTHYSDNTLKVAHQGFEFFTQGLATGEWQKFLDMLTEDFTFWFPMGEFHGLNVGKERAKEFFTYVSESFHTGIQISSLDRVTSNETTVVFEFRDEGLFLGKPYKNRVAVSFDVRGDKICSYREYFGSDGKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords NTF2-like Protein
publication title Crystal structure of a NTF2-like Protein (YP_322774.1) from ANABAENA VARIABILIS ATCC 29413 at 1.65 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
total genus 34
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dmcA00
5IG4A 3HZPA 3MKIA 1JN5A 3NXJA 1Q42A 1WQLB 3EN1B 1GY5A 5D83A 2CKFB 1K41A 3VSYA 4LEHA 2XSOB 3K0ZA 3FH1A 1VZZA 2B1XB 3B4PA 2BNGA 3CNXA 1GY7A 1W00A 2BMQB 3GZBA 3MG3A 4L8OA 5IERA 1GYBA 3CNMA 3G0KA 4R9KA 3K7CA 1DMMA 2BMRB 3STDA 2F98A 1OHOA 3EX9A 5DRVA 3CPOA 4XDVA 1Z1SA 3RGAA 4WYKB 4FCJA 3T8UA 1S5AA 4XM4A 2QIYA 3A76A 3JUMA 1JB2A 2INXA 2HMLB 1O7GB 3Q90A 5IF6A 1GS3A 3EHCA 4J9AA 2GEXA 2YFIB 3ROBA 3T8NA 1O7HB 3GZXB 3B7CA 4XBTA 3SOAA 3HK4A 4XB5A 4I4KA 5CXOA 1O7WB 1UUWB 3NV0A 1DMNA 4ORLA 4LGQA 3ECFA 5D81A 1W02A 3GZRA 5IEOA 2XSHB 3ER7A 4XBYA 3CU3A 1JB4A 3MSOA 3UNLA 2BMOB 7STDA 1SJWA 5KP3A 3LYGA 3EF8A 4WWUC 3SEDA 2JQ5A 1ULJB 1C7HA 1JN5B 2RGQA 3MG1A 5CF1A 1E97A 4HM5B 1OCVA 1JB5A 5D82A 1NWWA 3GZYB 3FZWA 2Z76A 1BUQA 4HJLB 6STDA 3BB9A 4Q53A 4CDLA 3GWRA 3JUOA 3UJMA 4HM1B 3FGYA 3OX9A 3FF2A 1EA2A 3MYTA 4WP5A 3JUPA 3EJVA 3JUQA 1O7NB 4HM7B 5AEUB 2RFRA 3HX8A 5JPUA 1CQSA 3BLZA 1ZO2A 3E99A 3VGNA 2W2CA 3KKGA 3I0YA 3LZAA 1W6YA 3EC9A 1Q40B 3F14A 4LMIA 1GY6A 1OPYA 4R9LA 4H3UA 1Q40A 4PEJA 3KZTA 3B4OA 3IPTA 1OGXA 3F40A 3NV0B 1NU3A 4XBXA 1E3VA 4HKVB 4HM3B 2K54A 5BVBA 4IIAA 4HVNA 3NHXA 2GEYA 4J8TA 1STDA 3MHEA 5FW5A 1O7PB 3NUVA 5AIIA 3M8CA 3NM2A 3H3HA 4MJDA 5KP4A 1HKXA 1OHSA 2F99A 4X2OA 3KE7A 1OF5B 5CLKA 2PZVA 3GRDA 3S5CA 1EG9B 1OF5A 1QJGA 5AIHA 1OH0A 1AR0A 1JKGA 8CHOA 2RCDA 3G8ZA 4STDA 1OHPA 2XR8B 3FF0A 3EBYA 2GXFA 2B24B 5AIGA 2YFLB 4HM4B 2IMJA 2A15A 2R4IA 4FCMA 1O7MB 1UUVB 2HMKB 2Z77A 3EBTA 3MG2A 2STDA 5CF2A 4GB5A 4HZ9B 4K1UA 5JPPA 3DXOA 5IG3A 2OWPA 1TP6A 3JUNA 4X2HA 5IEPA 2UX0A 4N3VA 4U13A 3OXAA 3NBRA 2CHCA 1A2KA 5BXQA 3RGRA 3DZLA 2GBXB 2Z7AA 3G16A 3SOYA 4OVMA 2I9WA 1DMQA 3DM8A 5CK6A 4R1KA 5AEWB 5EVHA 1TUHA 2F86B 5KP1A 1ULIB 5G2GA 1E3RA 3OWUA 2GBWB 5DREA 3OV4A 3F7SA 3WMDA 5IENA 4L8PA 3F8XA 1QMAA 1NDOB 4K1VA 4WYKA 4HM8B 3DUKA 5IG5A 3FSDA 3FKAA 2HMNB 4OUQA 3DMCA 4RZMA 3F7XA 4KVHA 4XDWA 3B8LA 5AI1A 2YFJB 5IG0A 5AIFA 5TGNA 2XRXB 1ZX2A 2HMJB 3D9RA 1ASKA 4HZBB 1U5OA 1JKGB 3OWYA 5STDA 2HMMB 5HGRA 3F8HA 1OUNA 2HMOB 3EQQB 1OGZA 3OWSA 1IDPA 4HM6B 3H51A 3F9SA 3EN8A 3FLJA 1W01A 4HM0B 1ISKA 2QGUA 4L7KA 3KSPA 4HM2B
chains in the Genus database with same CATH superfamily
3S67A 5IG4A 3NX0A 1BSAA 3HZPA 3MKIA 1JN5A 1JJ22 3DGOA 6GSPA 1I70A 1BNIA 3NXJA 1Q42A 1WQLB 3EN1B 1I2FA 1GY5A 5D83A 3PCRA 1RGAA 2CKFB 1K41A 3VSYA 4LEHA 1G02A 1LXEA 2XSOB 4MMZB 4BTYA 1IT7A 3A5EA 3K0ZA 4HBRA 4MMXB 1OACA 1B2XA 3FH1A 1VZZA 1BNJA 2B1XB 5GSPA 3B4PA 2BNGA 3X3YA 1US1A 3CNXA 2WGOA 3QK9A 1RGCA 1MGRA 1GY7A 1JBRA 1RN4A 1W00A 5ELJA 2BMQB 4KT3B 1BRGA 1S723 2CFWA 1TJDA 3GZBA 1B2SA 3MG3A 4L8OA 4J5GA 3FCSB 5IERA 2WOHA 3LOYA 1GD4A 1GYBA 3CNMA 1BU4A 3DGNA 2CC3A 3G0KA 3J7Yd 2LYXA 3CXC2 2AAEA 2CFLA 2XFTA 1BRJA 2P0MA 4HM2B 3SX1A 4EBGA 5RNTA 3G713 2CW9A 4R9KA 3CPW2 3K7CA 1B3SA 1FW7A 1DMMA 2BMRB 2V1LA 4GL6A 3STDA 1KQS2 2F98A 4FMBA 1BGSA 2KXGA 1L5GB 1OHOA 1PYLA 3WOEB 1STFI 1BVIA 4RNZA 5EEOA 1Q7Y4 1N5PA 1B2MA 1Q814 3EX9A 1TFKA 2FNQA 5DRVA 1UI7A 3CPOA 1HU9A 3WODG 3SLUA 1FGQA 4XDVA 1CH0A 1Z1SA 3HI7A 3RGAA 3TDGA 3D5IA 4WYKB 4N6TA 1RGKA 1TIJA 4FCJA 3T8UA 1S5AA 4XM4A 1C54A 2QIYA 3A76A 3KIIA 3JUMA 1T2HA 1N5HA 1QALA 2SARA 1JB2A 4NHFA 4MEIA 2INXA 1A90A 1Y4KA 2HMLB 1RKYA 3DH2A 1FGOA 1I3IA 1D6YA 1O7GB 3NQYA 4G1MB 1RNBA 1FA3A 3Q90A 2L4VA 1BNEA 4BL2A 5IF6A 1KSIA 1GS3A 3UL5A 1RCLA 3MWZA 4HOHA 2Z6BA 3WDGB 1M904 2HOHA 2BIRA 3OW22 2H0GA 4GHOA 2IY2A 3EHCA 4LSOA 4J9AA 3NBBA 2GEXA 1UGIA 3KN4A 2ZL8A 2YFIB 1HZ1A 3AHSA 3AMOB 2IA7A 3U1WA 3ROBA 3T8NA 1O7HB 1LOVA 1YNVX 1FUTA 3B7CA 3GZXB 3PZWA 3HK4A 4XBTA 3SOAA 4XB5A 1YIJ3 1N8R4 1RDSA 2Q07A 4I4KA 1BAOA 1RHLA 3RDEA 1N9EA 5CXOA 1O7WB 1UCIA 1I2GA 3PS8A 1UUWB 3NV0A 1DMNA 4ORLA 3LTBA 3CCM3 5HOHA 4K90B 4LGQA 4N6OB 3S29A 3X3XA 1ZGXA 3JVCA 1VQ73 3ECFA 2KAAA 1A67A 3N9HA 4ZM8A 1KC84 4O8SA 3NQZA 1D6UA 5D81A 1M1XB 1W02A 2KCDA 1CYVA 2W04A 3EE1A 3GZRA 4EC6A 1F8NA 1IV9A 1BSDA 5IEOA 3LTDA 1RGEA 2W6JH 2J8XB 2XSHB 3ER7A 1GOVA 4KZ1A 5ELUA 4BTXA 4XBYA 4N6LA 3CU3A 2ML5A 1JB4A 3MSOA 3UNLA 1KD14 1BOXA 2UUGC 2BMOB 1RGHA 1X1XA 7STDA 1RGGA 1SJWA 1LOYA 1K28A 1QAKA 2OOVA 5KP3A 3LYGA 1W2B2 3EF8A 4WWUC 1BSBA 1U8CB 1WMPA 1QVF2 1YJ93 3SEDA 1BIRA 1I0VA 1IVXA 2D1WA 2JQ5A 1RGLA 1ULJB 3BIRA 1C7HA 1EEJA 1JN5B 1FZUA 2RGQA 3MG1A 4JF8A 5CF1A 1K734 4FCZA 1E97A 4HM5B 1OCVA 1LRAA 1TRQA 1JB5A 5D82A 3PGBA 4BL3A 1B27A 1NWWA 2CFGA 1JBSA 4KFEA 3GZYB 3FZWA 2IUJA 2Z76A 1LNIA 1BUQA 4HJLB 1BNSA 1NNVA 3BB9A 4NREA 2M7OA 2E2TA 2W03A 4Q53A 4CDLA 6STDA 4EW5A 4O02B 3CCS3 2P09A 2OQEA 2UGIA 4FMDA 3X3ZA 3IMAB 3Q3FA 2Y73A 2CFKA 3SXXA 4LYLB 2RBIA 3G4S3 3GWRA 3JUOA 2CFDA 3UJMA 4HM1B 1G0TA 5BU4A 3FGYA 5BIRA 4EXRA 4N6V0 1WTHA 1FGRA 1V58A 1MNLA 3OX9A 3FF2A 1W2ZA 1JNQA 2BHMA 1VQP3 1ROVA 1GMRA 1PY3A 1EA2A 2AADA 1BNGA 3MYTA 4WP5A 3VF1A 1EKMA 3X42A 1N8QA 3JUPA 2CG0A 2K3DA 3S28A 3EJVA 1QVG2 3V98A 3JUQA 1O7NB 1FUWA 3X40A 3FG1A 2L1SA 4HM7B 4ILFA 5AEUB 2P0XA 1W5ZA 1LNHA 2RFRA 3HX8A 4O3VA 5JPUA 1CYUA 3DY5A 1CQSA 3NM7A 4TX4A 2F4YA 1YGWA 3DGLA 4RNTA 3L0RA 1MWTA 2KRTA 2W56A 3LT9A 1IVWA 1VQ43 3O8YA 4FMCA 1I2EA 3BLZA 4H61A 4EV2A 1DVDA 2R41A 1ZO2A 2QA43 4O2HA 2W9PA 2GSPA 3E99A 4HYZA 3VGNA 9RNTA 1BANA 2W2CA 2XGLA 1X1UA 3N54B 3KKGA 1UGHI 1NB5I 3I0YA 3LZAA 1Q824 2CWUA 2FGTA 1W6YA 1W4NA 3LTAA 3LTCA 2IYJA 4AKZA 3EC9A 1T3BA 1SIIA 4N6NB 3WOFB 1Q40B 1Q7HA 3CCJ3 3F14A 3S27A 1NO3A 4CPKA 2FXTA 1GD3A 4LMIA 1GY6A 1OPYA 1YVBI 4R9LA 1NJI4 3WA2X 1ROAA 1RRLA 4H3UA 1RN1A 3D3LA 4HAAA 1Q40A 3LXUX 1EQKA 3ALAA 2O3OA 4WFOA 5M18A 1YIT3 4PEJA 3KZTA 3B4OA 5M19A 1WMNA 1Q864 1VQN3 1N9JA 1OGXA 3HIGA 3IPTA 2C10A 3F40A 3NV0B 2W0QA 1RGFA 1NU3A 4XBXA 1RN7A 1BRHA 1E3VA 3GSPA 4HKVB 3I553 4HM3B 5M1AA 2K54A 3DGYA 5BVBA 1VQ93 2F5WA 4IIAA 4HVNA 3PYJA 1VQM3 1M1K4 2OCTA 4RBNA 1X1WA 1IQ8A 1W7CA 3NHXA 3CCL3 3QRDA 1TTOA 2P05A 3G6E3 1AQZA 1VQL3 2GEYA 4J8TA 1FGMA 2BT3A 1STDA 3MHEA 3DGMA 2BO9B 3BNBA 5FW5A 3PCSA 1DE3A 3HOHA 1MWUA 2CH9A 3BU4A 2CIUA 1I8VA 4R4KA 3AHWA 2XH9A 1J2BA 1VQO3 1ZS7A 1VQ53 1O7PB 2MC8A 3NUVA 3FG3A 1A2PA 3GAXA 2XF3A 5AIIA 2KF4A 1FYSA 3WA3A 3M8CA 3NM2A 1W6CA 2MF7A 2YX9A 4DKIA 3I563 3H3HA 3D5GA 1RJOA 4MJDA 5KP4A 4I5QA 4EYCA 4J5KA 1HKXA 1OHSA 1W6GA 1FGTA 3N8BA 5LC6A 2F5MA 1SIHA 2K0MA 3ZG0A 4MMYB 5I97A 5EQLA 1K9M4 2F99A 2WGQA 5IW9A 1RMSA 2CK3H 5JBSA 4X2OA 2KF6A 3KE7A 2GU1A 1OF5B 3LH4A 3CC43 4BTWA 5CLKA 2PZVA 4NPBA 1RTUA 1RSNA 3CCV3 2LQVA 1UCKA 1B20A 2C11A 3IJEB 3RNTA 3GRDA 3S5CA 2RSXA 1EG9B 1OF5A 4N6UA 1VQK3 5FGOA 1QJGA 3CC73 3HIIA 4RNYA 5AIHA 1QAFA 1OH0A 1AR0A 1JKGA 8CHOA 1VQ83 3CCR3 1IVUA 2RCDA 1BSEA 1T2IA 2XEPA 1SQWA 3G8ZA 4STDA 1OHPA 1EUIC 2H0HA 2IUKA 3K5TA 1KWIA 1MGWA 2XR8B 3FF0A 3EBYA 2GXFA 2B24B 4EV5A 5AIGA 2YFLB 4HM4B 1TU5A 1RLSA 2IMJA 2D42A 3KCHA 1JRQA 2A15A 2R4IA 4FCMA 1DYUA 1O7MB 1UI8A 1UUVB 1HYFA 2HMKB 3MPHA 2Z77A 1BRSA 1Q9EA 4FMAA 3AGNA 3EBTA 3MG2A 3Q2PA 2P38A 7RNTA 2STDA 5CF2A 1YJW3 2W56B 2QEX3 1BUJA 1FUSA 5A0OB 4GB5A 4HZ9B 4K1UA 4AEQA 3LT8A 1R4CA 2KF3A 1IV7A 3D4AA 3DXOA 4KFFA 5JPPA 5IG3A 1V57A 2OWPA 3FG4A 1TP6A 1G96A 3JUNA 4X2HA 1B2UA 7GSPA 5IEPA 2UX0A 4N3VA 3KSED 4U13A 3NBJA 2H0IA 1IU7A 3NBRA 3OXAA 1LOXA 2JDIH 2E2VA 2CHCA 5AYSC 3CCU3 6RNTA 1AVLA 1A2KA 1BSCA 5BXQA 2SBLA 4FR9A 3RGRA 3DZLA 2GBXB 1CEWI 2BU4A 2Z7AA 3G16A 3SOYA 4OVMA 2I9WA 8RNTA 3EB8A 1DMQA 3DM8A 5CK6A 1PU4A 1K8A4 4K61A 2C4BA 4R1KA 5AEWB 2WO0A 5EVHA 1TUHA 1JZOA 2F86B 3BNCA 1GMPA 1IQXA 1R4YA 1UW1A 1ULIB 5KP1A 5G2GA 1E3RA 1GMQA 4LZIA 4WHAA 4BIRA 3OWUA 1JV2B 1LOWA 2GBWB 5DREA 3OV4A 1BNFA 3F7SA 4GSPA 4JRFA 3V99A 1UDII 2ZDJA 3WMDA 3CCQ3 5IENA 2KF5A 4L8PA 1AVKA 3F8XA 1VQQA 1QMAA 1I3FA 2OOVC 3ZG5A 1RNTA 1UCLA 4IPBA 3X41A 4BU4A 1DVCA 3BNEA 5AYRB 2XFSA 1YI23 1NDOB 4K1VA 3T0UA 1MWRA 4WYKA 1BNRA 2CWVA 4HM8B 1TRPA 1YHQ3 3CME3 1VQ63 1SPUA 1GSPA 2Y74A 3DUKA 5IG5A 2RNTA 1D6ZA 2OTJ3 3FSDA 1PFPA 3BNDA 3Q1CA 2F56A 3FKAA 4N6MA 2HMNB 2CX0A 1RCKA 1B21A 1SARA 4OUQA 3SYUA 3UB1A 3DMCA 4RZMA 1BRIA 1JBTA 1MOLA 3F7XA 3WHOA 4KVHA 1IK3A 2GU3A 3B8LA 4XDWA 1V74A 1IQYA 4OK0A 1UUGB 2YFJB 5AI1A 3UL6A 2OQEC 1UCJA 1B2ZA 5LC7A 3K9MC 5IG0A 2CX1A 3AMOA 3V92A 1YVSA 1AV4A 5G1LA 1LVNA 1YJN3 4R80A 3D79A 5AIFA 2ZHXB 5TGNA 1A2VA 1ZX2A 2XRXB 3AGOA 1T5YA 4KFDA 1RRHA 2HMJB 3D9RA 1ASKA 3WR2A 1NB3I 1AY7A 4HZBB 4QWTA 1BRKA 1U5OA 1TFOA 2WOFA 1JKGB 2XGNA 3OWYA 5STDA 4CJNA 1LQMB 2HMMB 3ZFZA 2CWTA 5HGRA 1LQGC 3PXMA 2PNCA 3F8HA 3CMA3 4AKYA 2OTL3 1WNHA 1MWSA 2W9QA 3CD63 1OUNA 2HMOB 1YGEA 2CG1A 1DETA 3EQQB 3K63A 4CCVA 1OGZA 3OWSA 1GOUA 1IDPA 2E2UA 2ZA4A 4HM6B 3H51A 3F9SA 3U97A 3SVAA 3EN8A 1JZDA 3FLJA 4IT7A 1IVVA 1W01A 3LMLA 4HM0B 2ML6A 5G1KA 1IT8A 2O9UX 3KFQC 1ISKA 1X1YA 1I0XA 1WMOA 1BRNL 2QGUA 1IYYA 4L7KA 3URPA 3CCE3 3KSPA 1GOYA 1M9GA 3CC23
chains in the Genus database with same CATH topology
3S67A 5IG4A 3NX0A 3HZPA 3MKIA 1JN5A 1JJ22 3DGOA 3NXJA 1Q42A 1WQLB 3EN1B 1GY5A 5D83A 3PCRA 2CKFB 1K41A 3VSYA 4LEHA 1LXEA 2XSOB 4MMZB 4BTYA 1IT7A 3K0ZA 4HBRA 4MMXB 1OACA 3FH1A 1VZZA 2B1XB 3B4PA 2BNGA 3X3YA 1US1A 3CNXA 2WGOA 3QK9A 1GY7A 1W00A 5ELJA 2BMQB 1S723 2CFWA 3GZBA 3MG3A 4L8OA 3FCSB 5IERA 2WOHA 3LOYA 1GD4A 1GYBA 3CNMA 3DGNA 3G0KA 2CC3A 3J7Yd 2LYXA 2CFLA 2XFTA 3SX1A 4HM2B 2P0MA 4EBGA 3G713 2CW9A 4R9KA 3CPW2 3K7CA 1DMMA 2BMRB 2V1LA 4GL6A 3STDA 1KQS2 2F98A 4FMBA 1L5GB 2KXGA 1OHOA 3WOEB 1STFI 4RNZA 5EEOA 1N5PA 1Q814 3EX9A 1TFKA 2FNQA 5DRVA 1UI7A 3CPOA 1HU9A 3WODG 3SLUA 1FGQA 4XDVA 1Z1SA 3HI7A 3RGAA 3TDGA 4WYKB 4N6TA 1TIJA 4FCJA 3T8UA 1S5AA 4XM4A 2QIYA 3A76A 3KIIA 3JUMA 1N5HA 1QALA 4NHFA 1JB2A 4MEIA 2INXA 1A90A 1Y4KA 2HMLB 1RKYA 1FGOA 1O7GB 1D6YA 3NQYA 4G1MB 1FA3A 3Q90A 2L4VA 5IF6A 1KSIA 1GS3A 3UL5A 3MWZA 3WDGB 2Z6BA 1M904 3OW22 3EHCA 4LSOA 4J9AA 3NBBA 2GEXA 3KN4A 2ZL8A 2YFIB 3AMOB 2IA7A 3U1WA 3ROBA 3T8NA 1O7HB 3GZXB 3B7CA 3PZWA 4XBTA 3HK4A 3SOAA 4XB5A 1YIJ3 1N8R4 2Q07A 4I4KA 3RDEA 1N9EA 5CXOA 1O7WB 3PS8A 1UUWB 3NV0A 1DMNA 4ORLA 3LTBA 3CCM3 4K90B 4LGQA 4N6OB 3S29A 3X3XA 3JVCA 1VQ73 3ECFA 1A67A 3N9HA 4ZM8A 1KC84 4O8SA 3NQZA 1D6UA 5D81A 1M1XB 2KCDA 1W02A 2W04A 1CYVA 3EE1A 3GZRA 4EC6A 1F8NA 1IV9A 5IEOA 3LTDA 2W6JH 2XSHB 3ER7A 4KZ1A 5ELUA 4BTXA 1Q7Y4 4XBYA 4N6LA 3CU3A 2ML5A 1JB4A 3MSOA 3UNLA 1KD14 2BMOB 7STDA 1SJWA 1K28A 1QAKA 2OOVA 5KP3A 3LYGA 1W2B2 3EF8A 4WWUC 1U8CB 1WMPA 1QVF2 1YJ93 3SEDA 1IVXA 2D1WA 2JQ5A 1ULJB 1C7HA 1JN5B 2RGQA 4JF8A 5CF1A 1K734 4FCZA 1E97A 4HM5B 1OCVA 1JB5A 5D82A 3PGBA 1NWWA 2CFGA 4KFEA 3GZYB 3FZWA 2IUJA 2Z76A 1BUQA 4HJLB 6STDA 3BB9A 4NREA 2M7OA 2E2TA 2W03A 4Q53A 4CDLA 3CCS3 4O02B 2P09A 2OQEA 4FMDA 3X3ZA 3IMAB 2Y73A 2CFKA 3SXXA 3G4S3 3GWRA 3JUOA 2CFDA 3UJMA 4HM1B 3FGYA 4EXRA 4N6V0 1WTHA 1FGRA 1MNLA 3OX9A 3FF2A 1W2ZA 1JNQA 2BHMA 1VQP3 1ROVA 1EA2A 3MYTA 4WP5A 3VF1A 1EKMA 3X42A 1N8QA 3JUPA 2CG0A 3S28A 3EJVA 1QVG2 3V98A 3JUQA 1O7NB 1FUWA 3X40A 3FG1A 4HM7B 5AEUB 2P0XA 1W5ZA 1LNHA 2RFRA 3HX8A 4O3VA 5JPUA 1CYUA 3DY5A 1CQSA 3NM7A 4TX4A 3DGLA 3L0RA 2KRTA 2W56A 3LT9A 1IVWA 1VQ43 3O8YA 4FMCA 3BLZA 4EV2A 4H61A 1DVDA 1ZO2A 2QA43 4O2HA 2W9PA 3E99A 4HYZA 3CXC2 3VGNA 2W2CA 2XGLA 3N54B 3KKGA 1NB5I 3I0YA 3LZAA 1Q824 2CWUA 2FGTA 1W6YA 1W4NA 3LTAA 3LTCA 4AKZA 3EC9A 1SIIA 4N6NB 3WOFB 1Q40B 3CCJ3 3F14A 3S27A 1NO3A 2FXTA 1GD3A 4LMIA 1GY6A 1OPYA 1YVBI 4R9LA 1NJI4 3WA2X 1ROAA 1RRLA 4H3UA 3D3LA 1Q40A 3LXUX 1EQKA 3ALAA 2O3OA 4WFOA 1YIT3 4PEJA 3KZTA 3B4OA 1WMNA 1Q864 1VQN3 1N9JA 1OGXA 3HIGA 3IPTA 2C10A 3F40A 3NV0B 2W0QA 1NU3A 4XBXA 1RN7A 1E3VA 4HKVB 3I553 4HM3B 2K54A 5BVBA 1VQ93 4IIAA 4HVNA 3PYJA 1VQM3 1M1K4 2OCTA 4RBNA 1IQ8A 1W7CA 3NHXA 3CCL3 3QRDA 2P05A 3G6E3 1VQL3 2GEYA 4J8TA 1FGMA 2BT3A 1STDA 3MHEA 3DGMA 2BO9B 3BNBA 5FW5A 3PCSA 2CH9A 2CIUA 4R4KA 1J2BA 2XH9A 1VQO3 1VQ53 1O7PB 2MC8A 3NUVA 3FG3A 3GAXA 5AIIA 2XF3A 3WA3A 3M8CA 3NM2A 1W6CA 2MF7A 2YX9A 3I563 3H3HA 1RJOA 4MJDA 5KP4A 4EYCA 1HKXA 1OHSA 1W6GA 1FGTA 3N8BA 5LC6A 2K0MA 1SIHA 4MMYB 5I97A 5EQLA 1K9M4 2F99A 2WGQA 5IW9A 2CK3H 5JBSA 4X2OA 3KE7A 2GU1A 1OF5B 3LH4A 3CC43 4BTWA 5CLKA 2PZVA 3CCV3 2LQVA 2C11A 3IJEB 3GRDA 3S5CA 2RSXA 1EG9B 1OF5A 4N6UA 1VQK3 5FGOA 1QJGA 3CC73 3HIIA 4RNYA 5AIHA 1QAFA 1OH0A 1AR0A 1JKGA 8CHOA 1VQ83 3CCR3 1IVUA 2RCDA 2XEPA 1SQWA 3G8ZA 4STDA 1OHPA 3K5TA 2IUKA 1KWIA 2XR8B 3FF0A 3EBYA 2GXFA 2B24B 4EV5A 5AIGA 2YFLB 4HM4B 1TU5A 2IMJA 2D42A 1JRQA 2A15A 2R4IA 4FCMA 1DYUA 1O7MB 1UI8A 1UUVB 2HMKB 3MPHA 2Z77A 4FMAA 2OTJ3 3EBTA 1YJW3 3MG2A 3Q2PA 2P38A 2STDA 5CF2A 2W56B 2QEX3 5A0OB 4GB5A 4HZ9B 4K1UA 4AEQA 3LT8A 1R4CA 4KFFA 1IV7A 3DXOA 5JPPA 5IG3A 2OWPA 3FG4A 1TP6A 1G96A 3JUNA 4X2HA 5IEPA 2UX0A 4N3VA 3KSED 4U13A 3NBJA 1IU7A 3NBRA 3OXAA 1LOXA 2JDIH 2E2VA 2CHCA 5AYSC 3CCU3 1AVLA 1A2KA 5BXQA 2SBLA 4FR9A 3RGRA 3DZLA 2GBXB 1CEWI 2Z7AA 3G16A 3SOYA 4OVMA 2I9WA 3EB8A 1DMQA 3DM8A 5CK6A 1PU4A 1K8A4 4K61A 4R1KA 5AEWB 2WO0A 5EVHA 1TUHA 2F86B 3BNCA 1IQXA 1UW1A 1ULIB 5KP1A 5G2GA 1E3RA 4LZIA 4WHAA 3OWUA 1JV2B 2GBWB 5DREA 3OV4A 3F7SA 4JRFA 3V99A 3WMDA 2ZDJA 3CCQ3 5IENA 4L8PA 1AVKA 3F8XA 1QMAA 2OOVC 4IPBA 3X41A 1DVCA 3BNEA 5AYRB 2XFSA 1YI23 1NDOB 4K1VA 3T0UA 4WYKA 2CWVA 4HM8B 1YHQ3 3CME3 1VQ63 1SPUA 2Y74A 3DUKA 5IG5A 1D6ZA 3FSDA 1PFPA 3BNDA 3Q1CA 3FKAA 4N6MA 2HMNB 4OUQA 3UB1A 3DMCA 4RZMA 1MOLA 3F7XA 4KVHA 1IK3A 2GU3A 3B8LA 4XDWA 1V74A 1IQYA 4OK0A 5AI1A 2YFJB 3UL6A 2OQEC 5LC7A 3K9MC 5IG0A 3AMOA 3V92A 1AV4A 1LVNA 1YJN3 4R80A 5AIFA 5TGNA 2XRXB 1A2VA 1ZX2A 1T5YA 4KFDA 1RRHA 2HMJB 3D9RA 1ASKA 1NB3I 4HZBB 4QWTA 1U5OA 1TFOA 2WOFA 1JKGB 2XGNA 3OWYA 5STDA 2HMMB 2CWTA 5HGRA 3PXMA 3CMA3 2PNCA 3F8HA 4AKYA 2OTL3 1WNHA 2W9QA 3CD63 1OUNA 2HMOB 1YGEA 2CG1A 3EQQB 3K63A 4CCVA 1OGZA 3OWSA 1IDPA 2E2UA 4HM6B 3H51A 3F9SA 3U97A 3SVAA 3EN8A 3FLJA 4IT7A 1IVVA 1W01A 3LMLA 4HM0B 2ML6A 1IT8A 2O9UX 3KFQC 1ISKA 1WMOA 2QGUA 4L7KA 3CCE3 3KSPA 3MG1A 1M9GA 3CC23
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IG4 A;  3HZP A;  3MKI A;  1JN5 A;  3NXJ A;  1Q42 A;  1WQL B;  3EN1 B;  1GY5 A;  5D83 A;  2CKF B;  1K41 A;  3VSY A;  4LEH A;  2XSO B;  3K0Z A;  3FH1 A;  1VZZ A;  2B1X B;  3B4P A;  2BNG A;  3CNX A;  1GY7 A;  1W00 A;  2BMQ B;  3GZB A;  3MG3 A;  4L8O A;  5IER A;  1GYB A;  3CNM A;  3G0K A;  4R9K A;  3K7C A;  1DMM A;  2BMR B;  3STD A;  2F98 A;  1OHO A;  3EX9 A;  5DRV A;  3CPO A;  4XDV A;  1Z1S A;  3RGA A;  4WYK B;  4FCJ A;  3T8U A;  1S5A A;  4XM4 A;  2QIY A;  3A76 A;  3JUM A;  1JB2 A;  2INX A;  2HML B;  1O7G B;  3Q90 A;  5IF6 A;  1GS3 A;  3EHC A;  4J9A A;  2GEX A;  2YFI B;  3ROB A;  3T8N A;  1O7H B;  3GZX B;  3B7C A;  4XBT A;  3SOA A;  3HK4 A;  4XB5 A;  4I4K A;  5CXO A;  1O7W B;  1UUW B;  3NV0 A;  1DMN A;  4ORL A;  4LGQ A;  3ECF A;  5D81 A;  1W02 A;  3GZR A;  5IEO A;  2XSH B;  3ER7 A;  4XBY A;  3CU3 A;  1JB4 A;  3MSO A;  3UNL A;  2BMO B;  7STD A;  1SJW A;  5KP3 A;  3LYG A;  3EF8 A;  4WWU C;  3SED A;  2JQ5 A;  1ULJ B;  1C7H A;  1JN5 B;  2RGQ A;  3MG1 A;  5CF1 A;  1E97 A;  4HM5 B;  1OCV A;  1JB5 A;  5D82 A;  1NWW A;  3GZY B;  3FZW A;  2Z76 A;  1BUQ A;  4HJL B;  6STD A;  3BB9 A;  4Q53 A;  4CDL A;  3GWR A;  3JUO A;  3UJM A;  4HM1 B;  3FGY A;  3OX9 A;  3FF2 A;  1EA2 A;  3MYT A;  4WP5 A;  3JUP A;  3EJV A;  3JUQ A;  1O7N B;  4HM7 B;  5AEU B;  2RFR A;  3HX8 A;  5JPU A;  1CQS A;  3BLZ A;  1ZO2 A;  3E99 A;  3VGN A;  2W2C A;  3KKG A;  3I0Y A;  3LZA A;  1W6Y A;  3EC9 A;  1Q40 B;  3F14 A;  4LMI A;  1GY6 A;  1OPY A;  4R9L A;  4H3U A;  1Q40 A;  4PEJ A;  3KZT A;  3B4O A;  3IPT A;  1OGX A;  3F40 A;  3NV0 B;  1NU3 A;  4XBX A;  1E3V A;  4HKV B;  4HM3 B;  2K54 A;  5BVB A;  4IIA A;  4HVN A;  3NHX A;  2GEY A;  4J8T A;  1STD A;  3MHE A;  5FW5 A;  1O7P B;  3NUV A;  5AII A;  3M8C A;  3NM2 A;  3H3H A;  4MJD A;  5KP4 A;  1HKX A;  1OHS A;  2F99 A;  4X2O A;  3KE7 A;  1OF5 B;  5CLK A;  2PZV A;  3GRD A;  3S5C A;  1EG9 B;  1OF5 A;  1QJG A;  5AIH A;  1OH0 A;  1AR0 A;  1JKG A;  8CHO A;  2RCD A;  3G8Z A;  4STD A;  1OHP A;  2XR8 B;  3FF0 A;  3EBY A;  2GXF A;  2B24 B;  5AIG A;  2YFL B;  4HM4 B;  2IMJ A;  2A15 A;  2R4I A;  4FCM A;  1O7M B;  1UUV B;  2HMK B;  2Z77 A;  3EBT A;  3MG2 A;  2STD A;  5CF2 A;  4GB5 A;  4HZ9 B;  4K1U A;  5JPP A;  3DXO A;  5IG3 A;  2OWP A;  1TP6 A;  3JUN A;  4X2H A;  5IEP A;  2UX0 A;  4N3V A;  4U13 A;  3OXA A;  3NBR A;  2CHC A;  1A2K A;  5BXQ A;  3RGR A;  3DZL A;  2GBX B;  2Z7A A;  3G16 A;  3SOY A;  4OVM A;  2I9W A;  1DMQ A;  3DM8 A;  5CK6 A;  4R1K A;  5AEW B;  5EVH A;  1TUH A;  2F86 B;  5KP1 A;  1ULI B;  5G2G A;  1E3R A;  3OWU A;  2GBW B;  5DRE A;  3OV4 A;  3F7S A;  3WMD A;  5IEN A;  4L8P A;  3F8X A;  1QMA A;  1NDO B;  4K1V A;  4WYK A;  4HM8 B;  3DUK A;  5IG5 A;  3FSD A;  3FKA A;  2HMN B;  4OUQ A;  3DMC A;  4RZM A;  3F7X A;  4KVH A;  4XDW A;  3B8L A;  5AI1 A;  2YFJ B;  5IG0 A;  5AIF A;  5TGN A;  2XRX B;  1ZX2 A;  2HMJ B;  3D9R A;  1ASK A;  4HZB B;  1U5O A;  1JKG B;  3OWY A;  5STD A;  2HMM B;  5HGR A;  3F8H A;  1OUN A;  2HMO B;  3EQQ B;  1OGZ A;  3OWS A;  1IDP A;  4HM6 B;  3H51 A;  3F9S A;  3EN8 A;  3FLJ A;  1W01 A;  4HM0 B;  1ISK A;  2QGU A;  4L7K A;  3KSP A;  4HM2 B; 
#chains in the Genus database with same CATH topology
 3S67 A;  5IG4 A;  3NX0 A;  1BSA A;  3HZP A;  3MKI A;  1JN5 A;  1JJ2 2;  3DGO A;  6GSP A;  1I70 A;  1BNI A;  3NXJ A;  1Q42 A;  1WQL B;  3EN1 B;  1I2F A;  1GY5 A;  5D83 A;  3PCR A;  1RGA A;  2CKF B;  1K41 A;  3VSY A;  4LEH A;  1G02 A;  1LXE A;  2XSO B;  4MMZ B;  4BTY A;  1IT7 A;  3A5E A;  3K0Z A;  4HBR A;  4MMX B;  1OAC A;  1B2X A;  3FH1 A;  1VZZ A;  1BNJ A;  2B1X B;  5GSP A;  3B4P A;  2BNG A;  3X3Y A;  1US1 A;  3CNX A;  2WGO A;  3QK9 A;  1RGC A;  1MGR A;  1GY7 A;  1JBR A;  1RN4 A;  1W00 A;  5ELJ A;  2BMQ B;  4KT3 B;  1BRG A;  1S72 3;  2CFW A;  1TJD A;  3GZB A;  1B2S A;  3MG3 A;  4L8O A;  4J5G A;  3FCS B;  5IER A;  2WOH A;  3LOY A;  1GD4 A;  1GYB A;  3CNM A;  1BU4 A;  3DGN A;  2CC3 A;  3G0K A;  3J7Y d;  2LYX A;  3CXC 2;  2AAE A;  2CFL A;  2XFT A;  1BRJ A;  2P0M A;  4HM2 B;  3SX1 A;  4EBG A;  5RNT A;  3G71 3;  2CW9 A;  4R9K A;  3CPW 2;  3K7C A;  1B3S A;  1FW7 A;  1DMM A;  2BMR B;  2V1L A;  4GL6 A;  3STD A;  1KQS 2;  2F98 A;  4FMB A;  1BGS A;  2KXG A;  1L5G B;  1OHO A;  1PYL A;  3WOE B;  1STF I;  1BVI A;  4RNZ A;  5EEO A;  1Q7Y 4;  1N5P A;  1B2M A;  1Q81 4;  3EX9 A;  1TFK A;  2FNQ A;  5DRV A;  1UI7 A;  3CPO A;  1HU9 A;  3WOD G;  3SLU A;  1FGQ A;  4XDV A;  1CH0 A;  1Z1S A;  3HI7 A;  3RGA A;  3TDG A;  3D5I A;  4WYK B;  4N6T A;  1RGK A;  1TIJ A;  4FCJ A;  3T8U A;  1S5A A;  4XM4 A;  1C54 A;  2QIY A;  3A76 A;  3KII A;  3JUM A;  1T2H A;  1N5H A;  1QAL A;  2SAR A;  1JB2 A;  4NHF A;  4MEI A;  2INX A;  1A90 A;  1Y4K A;  2HML B;  1RKY A;  3DH2 A;  1FGO A;  1I3I A;  1D6Y A;  1O7G B;  3NQY A;  4G1M B;  1RNB A;  1FA3 A;  3Q90 A;  2L4V A;  1BNE A;  4BL2 A;  5IF6 A;  1KSI A;  1GS3 A;  3UL5 A;  1RCL A;  3MWZ A;  4HOH A;  2Z6B A;  3WDG B;  1M90 4;  2HOH A;  2BIR A;  3OW2 2;  2H0G A;  4GHO A;  2IY2 A;  3EHC A;  4LSO A;  4J9A A;  3NBB A;  2GEX A;  1UGI A;  3KN4 A;  2ZL8 A;  2YFI B;  1HZ1 A;  3AHS A;  3AMO B;  2IA7 A;  3U1W A;  3ROB A;  3T8N A;  1O7H B;  1LOV A;  1YNV X;  1FUT A;  3B7C A;  3GZX B;  3PZW A;  3HK4 A;  4XBT A;  3SOA A;  4XB5 A;  1YIJ 3;  1N8R 4;  1RDS A;  2Q07 A;  4I4K A;  1BAO A;  1RHL A;  3RDE A;  1N9E A;  5CXO A;  1O7W B;  1UCI A;  1I2G A;  3PS8 A;  1UUW B;  3NV0 A;  1DMN A;  4ORL A;  3LTB A;  3CCM 3;  5HOH A;  4K90 B;  4LGQ A;  4N6O B;  3S29 A;  3X3X A;  1ZGX A;  3JVC A;  1VQ7 3;  3ECF A;  2KAA A;  1A67 A;  3N9H A;  4ZM8 A;  1KC8 4;  4O8S A;  3NQZ A;  1D6U A;  5D81 A;  1M1X B;  1W02 A;  2KCD A;  1CYV A;  2W04 A;  3EE1 A;  3GZR A;  4EC6 A;  1F8N A;  1IV9 A;  1BSD A;  5IEO A;  3LTD A;  1RGE A;  2W6J H;  2J8X B;  2XSH B;  3ER7 A;  1GOV A;  4KZ1 A;  5ELU A;  4BTX A;  4XBY A;  4N6L A;  3CU3 A;  2ML5 A;  1JB4 A;  3MSO A;  3UNL A;  1KD1 4;  1BOX A;  2UUG C;  2BMO B;  1RGH A;  1X1X A;  7STD A;  1RGG A;  1SJW A;  1LOY A;  1K28 A;  1QAK A;  2OOV A;  5KP3 A;  3LYG A;  1W2B 2;  3EF8 A;  4WWU C;  1BSB A;  1U8C B;  1WMP A;  1QVF 2;  1YJ9 3;  3SED A;  1BIR A;  1I0V A;  1IVX A;  2D1W A;  2JQ5 A;  1RGL A;  1ULJ B;  3BIR A;  1C7H A;  1EEJ A;  1JN5 B;  1FZU A;  2RGQ A;  3MG1 A;  4JF8 A;  5CF1 A;  1K73 4;  4FCZ A;  1E97 A;  4HM5 B;  1OCV A;  1LRA A;  1TRQ A;  1JB5 A;  5D82 A;  3PGB A;  4BL3 A;  1B27 A;  1NWW A;  2CFG A;  1JBS A;  4KFE A;  3GZY B;  3FZW A;  2IUJ A;  2Z76 A;  1LNI A;  1BUQ A;  4HJL B;  1BNS A;  1NNV A;  3BB9 A;  4NRE A;  2M7O A;  2E2T A;  2W03 A;  4Q53 A;  4CDL A;  6STD A;  4EW5 A;  4O02 B;  3CCS 3;  2P09 A;  2OQE A;  2UGI A;  4FMD A;  3X3Z A;  3IMA B;  3Q3F A;  2Y73 A;  2CFK A;  3SXX A;  4LYL B;  2RBI A;  3G4S 3;  3GWR A;  3JUO A;  2CFD A;  3UJM A;  4HM1 B;  1G0T A;  5BU4 A;  3FGY A;  5BIR A;  4EXR A;  4N6V 0;  1WTH A;  1FGR A;  1V58 A;  1MNL A;  3OX9 A;  3FF2 A;  1W2Z A;  1JNQ A;  2BHM A;  1VQP 3;  1ROV A;  1GMR A;  1PY3 A;  1EA2 A;  2AAD A;  1BNG A;  3MYT A;  4WP5 A;  3VF1 A;  1EKM A;  3X42 A;  1N8Q A;  3JUP A;  2CG0 A;  2K3D A;  3S28 A;  3EJV A;  1QVG 2;  3V98 A;  3JUQ A;  1O7N B;  1FUW A;  3X40 A;  3FG1 A;  2L1S A;  4HM7 B;  4ILF A;  5AEU B;  2P0X A;  1W5Z A;  1LNH A;  2RFR A;  3HX8 A;  4O3V A;  5JPU A;  1CYU A;  3DY5 A;  1CQS A;  3NM7 A;  4TX4 A;  2F4Y A;  1YGW A;  3DGL A;  4RNT A;  3L0R A;  1MWT A;  2KRT A;  2W56 A;  3LT9 A;  1IVW A;  1VQ4 3;  3O8Y A;  4FMC A;  1I2E A;  3BLZ A;  4H61 A;  4EV2 A;  1DVD A;  2R41 A;  1ZO2 A;  2QA4 3;  4O2H A;  2W9P A;  2GSP A;  3E99 A;  4HYZ A;  3VGN A;  9RNT A;  1BAN A;  2W2C A;  2XGL A;  1X1U A;  3N54 B;  3KKG A;  1UGH I;  1NB5 I;  3I0Y A;  3LZA A;  1Q82 4;  2CWU A;  2FGT A;  1W6Y A;  1W4N A;  3LTA A;  3LTC A;  2IYJ A;  4AKZ A;  3EC9 A;  1T3B A;  1SII A;  4N6N B;  3WOF B;  1Q40 B;  1Q7H A;  3CCJ 3;  3F14 A;  3S27 A;  1NO3 A;  4CPK A;  2FXT A;  1GD3 A;  4LMI A;  1GY6 A;  1OPY A;  1YVB I;  4R9L A;  1NJI 4;  3WA2 X;  1ROA A;  1RRL A;  4H3U A;  1RN1 A;  3D3L A;  4HAA A;  1Q40 A;  3LXU X;  1EQK A;  3ALA A;  2O3O A;  4WFO A;  5M18 A;  1YIT 3;  4PEJ A;  3KZT A;  3B4O A;  5M19 A;  1WMN A;  1Q86 4;  1VQN 3;  1N9J A;  1OGX A;  3HIG A;  3IPT A;  2C10 A;  3F40 A;  3NV0 B;  2W0Q A;  1RGF A;  1NU3 A;  4XBX A;  1RN7 A;  1BRH A;  1E3V A;  3GSP A;  4HKV B;  3I55 3;  4HM3 B;  5M1A A;  2K54 A;  3DGY A;  5BVB A;  1VQ9 3;  2F5W A;  4IIA A;  4HVN A;  3PYJ A;  1VQM 3;  1M1K 4;  2OCT A;  4RBN A;  1X1W A;  1IQ8 A;  1W7C A;  3NHX A;  3CCL 3;  3QRD A;  1TTO A;  2P05 A;  3G6E 3;  1AQZ A;  1VQL 3;  2GEY A;  4J8T A;  1FGM A;  2BT3 A;  1STD A;  3MHE A;  3DGM A;  2BO9 B;  3BNB A;  5FW5 A;  3PCS A;  1DE3 A;  3HOH A;  1MWU A;  2CH9 A;  3BU4 A;  2CIU A;  1I8V A;  4R4K A;  3AHW A;  2XH9 A;  1J2B A;  1VQO 3;  1ZS7 A;  1VQ5 3;  1O7P B;  2MC8 A;  3NUV A;  3FG3 A;  1A2P A;  3GAX A;  2XF3 A;  5AII A;  2KF4 A;  1FYS A;  3WA3 A;  3M8C A;  3NM2 A;  1W6C A;  2MF7 A;  2YX9 A;  4DKI A;  3I56 3;  3H3H A;  3D5G A;  1RJO A;  4MJD A;  5KP4 A;  4I5Q A;  4EYC A;  4J5K A;  1HKX A;  1OHS A;  1W6G A;  1FGT A;  3N8B A;  5LC6 A;  2F5M A;  1SIH A;  2K0M A;  3ZG0 A;  4MMY B;  5I97 A;  5EQL A;  1K9M 4;  2F99 A;  2WGQ A;  5IW9 A;  1RMS A;  2CK3 H;  5JBS A;  4X2O A;  2KF6 A;  3KE7 A;  2GU1 A;  1OF5 B;  3LH4 A;  3CC4 3;  4BTW A;  5CLK A;  2PZV A;  4NPB A;  1RTU A;  1RSN A;  3CCV 3;  2LQV A;  1UCK A;  1B20 A;  2C11 A;  3IJE B;  3RNT A;  3GRD A;  3S5C A;  2RSX A;  1EG9 B;  1OF5 A;  4N6U A;  1VQK 3;  5FGO A;  1QJG A;  3CC7 3;  3HII A;  4RNY A;  5AIH A;  1QAF A;  1OH0 A;  1AR0 A;  1JKG A;  8CHO A;  1VQ8 3;  3CCR 3;  1IVU A;  2RCD A;  1BSE A;  1T2I A;  2XEP A;  1SQW A;  3G8Z A;  4STD A;  1OHP A;  1EUI C;  2H0H A;  2IUK A;  3K5T A;  1KWI A;  1MGW A;  2XR8 B;  3FF0 A;  3EBY A;  2GXF A;  2B24 B;  4EV5 A;  5AIG A;  2YFL B;  4HM4 B;  1TU5 A;  1RLS A;  2IMJ A;  2D42 A;  3KCH A;  1JRQ A;  2A15 A;  2R4I A;  4FCM A;  1DYU A;  1O7M B;  1UI8 A;  1UUV B;  1HYF A;  2HMK B;  3MPH A;  2Z77 A;  1BRS A;  1Q9E A;  4FMA A;  3AGN A;  3EBT A;  3MG2 A;  3Q2P A;  2P38 A;  7RNT A;  2STD A;  5CF2 A;  1YJW 3;  2W56 B;  2QEX 3;  1BUJ A;  1FUS A;  5A0O B;  4GB5 A;  4HZ9 B;  4K1U A;  4AEQ A;  3LT8 A;  1R4C A;  2KF3 A;  1IV7 A;  3D4A A;  3DXO A;  4KFF A;  5JPP A;  5IG3 A;  1V57 A;  2OWP A;  3FG4 A;  1TP6 A;  1G96 A;  3JUN A;  4X2H A;  1B2U A;  7GSP A;  5IEP A;  2UX0 A;  4N3V A;  3KSE D;  4U13 A;  3NBJ A;  2H0I A;  1IU7 A;  3NBR A;  3OXA A;  1LOX A;  2JDI H;  2E2V A;  2CHC A;  5AYS C;  3CCU 3;  6RNT A;  1AVL A;  1A2K A;  1BSC A;  5BXQ A;  2SBL A;  4FR9 A;  3RGR A;  3DZL A;  2GBX B;  1CEW I;  2BU4 A;  2Z7A A;  3G16 A;  3SOY A;  4OVM A;  2I9W A;  8RNT A;  3EB8 A;  1DMQ A;  3DM8 A;  5CK6 A;  1PU4 A;  1K8A 4;  4K61 A;  2C4B A;  4R1K A;  5AEW B;  2WO0 A;  5EVH A;  1TUH A;  1JZO A;  2F86 B;  3BNC A;  1GMP A;  1IQX A;  1R4Y A;  1UW1 A;  1ULI B;  5KP1 A;  5G2G A;  1E3R A;  1GMQ A;  4LZI A;  4WHA A;  4BIR A;  3OWU A;  1JV2 B;  1LOW A;  2GBW B;  5DRE A;  3OV4 A;  1BNF A;  3F7S A;  4GSP A;  4JRF A;  3V99 A;  1UDI I;  2ZDJ A;  3WMD A;  3CCQ 3;  5IEN A;  2KF5 A;  4L8P A;  1AVK A;  3F8X A;  1VQQ A;  1QMA A;  1I3F A;  2OOV C;  3ZG5 A;  1RNT A;  1UCL A;  4IPB A;  3X41 A;  4BU4 A;  1DVC A;  3BNE A;  5AYR B;  2XFS A;  1YI2 3;  1NDO B;  4K1V A;  3T0U A;  1MWR A;  4WYK A;  1BNR A;  2CWV A;  4HM8 B;  1TRP A;  1YHQ 3;  3CME 3;  1VQ6 3;  1SPU A;  1GSP A;  2Y74 A;  3DUK A;  5IG5 A;  2RNT A;  1D6Z A;  2OTJ 3;  3FSD A;  1PFP A;  3BND A;  3Q1C A;  2F56 A;  3FKA A;  4N6M A;  2HMN B;  2CX0 A;  1RCK A;  1B21 A;  1SAR A;  4OUQ A;  3SYU A;  3UB1 A;  3DMC A;  4RZM A;  1BRI A;  1JBT A;  1MOL A;  3F7X A;  3WHO A;  4KVH A;  1IK3 A;  2GU3 A;  3B8L A;  4XDW A;  1V74 A;  1IQY A;  4OK0 A;  1UUG B;  2YFJ B;  5AI1 A;  3UL6 A;  2OQE C;  1UCJ A;  1B2Z A;  5LC7 A;  3K9M C;  5IG0 A;  2CX1 A;  3AMO A;  3V92 A;  1YVS A;  1AV4 A;  5G1L A;  1LVN A;  1YJN 3;  4R80 A;  3D79 A;  5AIF A;  2ZHX B;  5TGN A;  1A2V A;  1ZX2 A;  2XRX B;  3AGO A;  1T5Y A;  4KFD A;  1RRH A;  2HMJ B;  3D9R A;  1ASK A;  3WR2 A;  1NB3 I;  1AY7 A;  4HZB B;  4QWT A;  1BRK A;  1U5O A;  1TFO A;  2WOF A;  1JKG B;  2XGN A;  3OWY A;  5STD A;  4CJN A;  1LQM B;  2HMM B;  3ZFZ A;  2CWT A;  5HGR A;  1LQG C;  3PXM A;  2PNC A;  3F8H A;  3CMA 3;  4AKY A;  2OTL 3;  1WNH A;  1MWS A;  2W9Q A;  3CD6 3;  1OUN A;  2HMO B;  1YGE A;  2CG1 A;  1DET A;  3EQQ B;  3K63 A;  4CCV A;  1OGZ A;  3OWS A;  1GOU A;  1IDP A;  2E2U A;  2ZA4 A;  4HM6 B;  3H51 A;  3F9S A;  3U97 A;  3SVA A;  3EN8 A;  1JZD A;  3FLJ A;  4IT7 A;  1IVV A;  1W01 A;  3LML A;  4HM0 B;  2ML6 A;  5G1K A;  1IT8 A;  2O9U X;  3KFQ C;  1ISK A;  1X1Y A;  1I0X A;  1WMO A;  1BRN L;  2QGU A;  1IYY A;  4L7K A;  3URP A;  3CCE 3;  3KSP A;  1GOY A;  1M9G A;  3CC2 3; 
#chains in the Genus database with same CATH homology
 3S67 A;  5IG4 A;  3NX0 A;  3HZP A;  3MKI A;  1JN5 A;  1JJ2 2;  3DGO A;  3NXJ A;  1Q42 A;  1WQL B;  3EN1 B;  1GY5 A;  5D83 A;  3PCR A;  2CKF B;  1K41 A;  3VSY A;  4LEH A;  1LXE A;  2XSO B;  4MMZ B;  4BTY A;  1IT7 A;  3K0Z A;  4HBR A;  4MMX B;  1OAC A;  3FH1 A;  1VZZ A;  2B1X B;  3B4P A;  2BNG A;  3X3Y A;  1US1 A;  3CNX A;  2WGO A;  3QK9 A;  1GY7 A;  1W00 A;  5ELJ A;  2BMQ B;  1S72 3;  2CFW A;  3GZB A;  3MG3 A;  4L8O A;  3FCS B;  5IER A;  2WOH A;  3LOY A;  1GD4 A;  1GYB A;  3CNM A;  3DGN A;  3G0K A;  2CC3 A;  3J7Y d;  2LYX A;  2CFL A;  2XFT A;  3SX1 A;  4HM2 B;  2P0M A;  4EBG A;  3G71 3;  2CW9 A;  4R9K A;  3CPW 2;  3K7C A;  1DMM A;  2BMR B;  2V1L A;  4GL6 A;  3STD A;  1KQS 2;  2F98 A;  4FMB A;  1L5G B;  2KXG A;  1OHO A;  3WOE B;  1STF I;  4RNZ A;  5EEO A;  1N5P A;  1Q81 4;  3EX9 A;  1TFK A;  2FNQ A;  5DRV A;  1UI7 A;  3CPO A;  1HU9 A;  3WOD G;  3SLU A;  1FGQ A;  4XDV A;  1Z1S A;  3HI7 A;  3RGA A;  3TDG A;  4WYK B;  4N6T A;  1TIJ A;  4FCJ A;  3T8U A;  1S5A A;  4XM4 A;  2QIY A;  3A76 A;  3KII A;  3JUM A;  1N5H A;  1QAL A;  4NHF A;  1JB2 A;  4MEI A;  2INX A;  1A90 A;  1Y4K A;  2HML B;  1RKY A;  1FGO A;  1O7G B;  1D6Y A;  3NQY A;  4G1M B;  1FA3 A;  3Q90 A;  2L4V A;  5IF6 A;  1KSI A;  1GS3 A;  3UL5 A;  3MWZ A;  3WDG B;  2Z6B A;  1M90 4;  3OW2 2;  3EHC A;  4LSO A;  4J9A A;  3NBB A;  2GEX A;  3KN4 A;  2ZL8 A;  2YFI B;  3AMO B;  2IA7 A;  3U1W A;  3ROB A;  3T8N A;  1O7H B;  3GZX B;  3B7C A;  3PZW A;  4XBT A;  3HK4 A;  3SOA A;  4XB5 A;  1YIJ 3;  1N8R 4;  2Q07 A;  4I4K A;  3RDE A;  1N9E A;  5CXO A;  1O7W B;  3PS8 A;  1UUW B;  3NV0 A;  1DMN A;  4ORL A;  3LTB A;  3CCM 3;  4K90 B;  4LGQ A;  4N6O B;  3S29 A;  3X3X A;  3JVC A;  1VQ7 3;  3ECF A;  1A67 A;  3N9H A;  4ZM8 A;  1KC8 4;  4O8S A;  3NQZ A;  1D6U A;  5D81 A;  1M1X B;  2KCD A;  1W02 A;  2W04 A;  1CYV A;  3EE1 A;  3GZR A;  4EC6 A;  1F8N A;  1IV9 A;  5IEO A;  3LTD A;  2W6J H;  2XSH B;  3ER7 A;  4KZ1 A;  5ELU A;  4BTX A;  1Q7Y 4;  4XBY A;  4N6L A;  3CU3 A;  2ML5 A;  1JB4 A;  3MSO A;  3UNL A;  1KD1 4;  2BMO B;  7STD A;  1SJW A;  1K28 A;  1QAK A;  2OOV A;  5KP3 A;  3LYG A;  1W2B 2;  3EF8 A;  4WWU C;  1U8C B;  1WMP A;  1QVF 2;  1YJ9 3;  3SED A;  1IVX A;  2D1W A;  2JQ5 A;  1ULJ B;  1C7H A;  1JN5 B;  2RGQ A;  4JF8 A;  5CF1 A;  1K73 4;  4FCZ A;  1E97 A;  4HM5 B;  1OCV A;  1JB5 A;  5D82 A;  3PGB A;  1NWW A;  2CFG A;  4KFE A;  3GZY B;  3FZW A;  2IUJ A;  2Z76 A;  1BUQ A;  4HJL B;  6STD A;  3BB9 A;  4NRE A;  2M7O A;  2E2T A;  2W03 A;  4Q53 A;  4CDL A;  3CCS 3;  4O02 B;  2P09 A;  2OQE A;  4FMD A;  3X3Z A;  3IMA B;  2Y73 A;  2CFK A;  3SXX A;  3G4S 3;  3GWR A;  3JUO A;  2CFD A;  3UJM A;  4HM1 B;  3FGY A;  4EXR A;  4N6V 0;  1WTH A;  1FGR A;  1MNL A;  3OX9 A;  3FF2 A;  1W2Z A;  1JNQ A;  2BHM A;  1VQP 3;  1ROV A;  1EA2 A;  3MYT A;  4WP5 A;  3VF1 A;  1EKM A;  3X42 A;  1N8Q A;  3JUP A;  2CG0 A;  3S28 A;  3EJV A;  1QVG 2;  3V98 A;  3JUQ A;  1O7N B;  1FUW A;  3X40 A;  3FG1 A;  4HM7 B;  5AEU B;  2P0X A;  1W5Z A;  1LNH A;  2RFR A;  3HX8 A;  4O3V A;  5JPU A;  1CYU A;  3DY5 A;  1CQS A;  3NM7 A;  4TX4 A;  3DGL A;  3L0R A;  2KRT A;  2W56 A;  3LT9 A;  1IVW A;  1VQ4 3;  3O8Y A;  4FMC A;  3BLZ A;  4EV2 A;  4H61 A;  1DVD A;  1ZO2 A;  2QA4 3;  4O2H A;  2W9P A;  3E99 A;  4HYZ A;  3CXC 2;  3VGN A;  2W2C A;  2XGL A;  3N54 B;  3KKG A;  1NB5 I;  3I0Y A;  3LZA A;  1Q82 4;  2CWU A;  2FGT A;  1W6Y A;  1W4N A;  3LTA A;  3LTC A;  4AKZ A;  3EC9 A;  1SII A;  4N6N B;  3WOF B;  1Q40 B;  3CCJ 3;  3F14 A;  3S27 A;  1NO3 A;  2FXT A;  1GD3 A;  4LMI A;  1GY6 A;  1OPY A;  1YVB I;  4R9L A;  1NJI 4;  3WA2 X;  1ROA A;  1RRL A;  4H3U A;  3D3L A;  1Q40 A;  3LXU X;  1EQK A;  3ALA A;  2O3O A;  4WFO A;  1YIT 3;  4PEJ A;  3KZT A;  3B4O A;  1WMN A;  1Q86 4;  1VQN 3;  1N9J A;  1OGX A;  3HIG A;  3IPT A;  2C10 A;  3F40 A;  3NV0 B;  2W0Q A;  1NU3 A;  4XBX A;  1RN7 A;  1E3V A;  4HKV B;  3I55 3;  4HM3 B;  2K54 A;  5BVB A;  1VQ9 3;  4IIA A;  4HVN A;  3PYJ A;  1VQM 3;  1M1K 4;  2OCT A;  4RBN A;  1IQ8 A;  1W7C A;  3NHX A;  3CCL 3;  3QRD A;  2P05 A;  3G6E 3;  1VQL 3;  2GEY A;  4J8T A;  1FGM A;  2BT3 A;  1STD A;  3MHE A;  3DGM A;  2BO9 B;  3BNB A;  5FW5 A;  3PCS A;  2CH9 A;  2CIU A;  4R4K A;  1J2B A;  2XH9 A;  1VQO 3;  1VQ5 3;  1O7P B;  2MC8 A;  3NUV A;  3FG3 A;  3GAX A;  5AII A;  2XF3 A;  3WA3 A;  3M8C A;  3NM2 A;  1W6C A;  2MF7 A;  2YX9 A;  3I56 3;  3H3H A;  1RJO A;  4MJD A;  5KP4 A;  4EYC A;  1HKX A;  1OHS A;  1W6G A;  1FGT A;  3N8B A;  5LC6 A;  2K0M A;  1SIH A;  4MMY B;  5I97 A;  5EQL A;  1K9M 4;  2F99 A;  2WGQ A;  5IW9 A;  2CK3 H;  5JBS A;  4X2O A;  3KE7 A;  2GU1 A;  1OF5 B;  3LH4 A;  3CC4 3;  4BTW A;  5CLK A;  2PZV A;  3CCV 3;  2LQV A;  2C11 A;  3IJE B;  3GRD A;  3S5C A;  2RSX A;  1EG9 B;  1OF5 A;  4N6U A;  1VQK 3;  5FGO A;  1QJG A;  3CC7 3;  3HII A;  4RNY A;  5AIH A;  1QAF A;  1OH0 A;  1AR0 A;  1JKG A;  8CHO A;  1VQ8 3;  3CCR 3;  1IVU A;  2RCD A;  2XEP A;  1SQW A;  3G8Z A;  4STD A;  1OHP A;  3K5T A;  2IUK A;  1KWI A;  2XR8 B;  3FF0 A;  3EBY A;  2GXF A;  2B24 B;  4EV5 A;  5AIG A;  2YFL B;  4HM4 B;  1TU5 A;  2IMJ A;  2D42 A;  1JRQ A;  2A15 A;  2R4I A;  4FCM A;  1DYU A;  1O7M B;  1UI8 A;  1UUV B;  2HMK B;  3MPH A;  2Z77 A;  4FMA A;  2OTJ 3;  3EBT A;  1YJW 3;  3MG2 A;  3Q2P A;  2P38 A;  2STD A;  5CF2 A;  2W56 B;  2QEX 3;  5A0O B;  4GB5 A;  4HZ9 B;  4K1U A;  4AEQ A;  3LT8 A;  1R4C A;  4KFF A;  1IV7 A;  3DXO A;  5JPP A;  5IG3 A;  2OWP A;  3FG4 A;  1TP6 A;  1G96 A;  3JUN A;  4X2H A;  5IEP A;  2UX0 A;  4N3V A;  3KSE D;  4U13 A;  3NBJ A;  1IU7 A;  3NBR A;  3OXA A;  1LOX A;  2JDI H;  2E2V A;  2CHC A;  5AYS C;  3CCU 3;  1AVL A;  1A2K A;  5BXQ A;  2SBL A;  4FR9 A;  3RGR A;  3DZL A;  2GBX B;  1CEW I;  2Z7A A;  3G16 A;  3SOY A;  4OVM A;  2I9W A;  3EB8 A;  1DMQ A;  3DM8 A;  5CK6 A;  1PU4 A;  1K8A 4;  4K61 A;  4R1K A;  5AEW B;  2WO0 A;  5EVH A;  1TUH A;  2F86 B;  3BNC A;  1IQX A;  1UW1 A;  1ULI B;  5KP1 A;  5G2G A;  1E3R A;  4LZI A;  4WHA A;  3OWU A;  1JV2 B;  2GBW B;  5DRE A;  3OV4 A;  3F7S A;  4JRF A;  3V99 A;  3WMD A;  2ZDJ A;  3CCQ 3;  5IEN A;  4L8P A;  1AVK A;  3F8X A;  1QMA A;  2OOV C;  4IPB A;  3X41 A;  1DVC A;  3BNE A;  5AYR B;  2XFS A;  1YI2 3;  1NDO B;  4K1V A;  3T0U A;  4WYK A;  2CWV A;  4HM8 B;  1YHQ 3;  3CME 3;  1VQ6 3;  1SPU A;  2Y74 A;  3DUK A;  5IG5 A;  1D6Z A;  3FSD A;  1PFP A;  3BND A;  3Q1C A;  3FKA A;  4N6M A;  2HMN B;  4OUQ A;  3UB1 A;  3DMC A;  4RZM A;  1MOL A;  3F7X A;  4KVH A;  1IK3 A;  2GU3 A;  3B8L A;  4XDW A;  1V74 A;  1IQY A;  4OK0 A;  5AI1 A;  2YFJ B;  3UL6 A;  2OQE C;  5LC7 A;  3K9M C;  5IG0 A;  3AMO A;  3V92 A;  1AV4 A;  1LVN A;  1YJN 3;  4R80 A;  5AIF A;  5TGN A;  2XRX B;  1A2V A;  1ZX2 A;  1T5Y A;  4KFD A;  1RRH A;  2HMJ B;  3D9R A;  1ASK A;  1NB3 I;  4HZB B;  4QWT A;  1U5O A;  1TFO A;  2WOF A;  1JKG B;  2XGN A;  3OWY A;  5STD A;  2HMM B;  2CWT A;  5HGR A;  3PXM A;  3CMA 3;  2PNC A;  3F8H A;  4AKY A;  2OTL 3;  1WNH A;  2W9Q A;  3CD6 3;  1OUN A;  2HMO B;  1YGE A;  2CG1 A;  3EQQ B;  3K63 A;  4CCV A;  1OGZ A;  3OWS A;  1IDP A;  2E2U A;  4HM6 B;  3H51 A;  3F9S A;  3U97 A;  3SVA A;  3EN8 A;  3FLJ A;  4IT7 A;  1IVV A;  1W01 A;  3LML A;  4HM0 B;  2ML6 A;  1IT8 A;  2O9U X;  3KFQ C;  1ISK A;  1WMO A;  2QGU A;  4L7K A;  3CCE 3;  3KSP A;  3MG1 A;  1M9G A;  3CC2 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...