3DMCA

Crystal structure of a ntf2-like protein (ava_2261) from anabaena variabilis atcc 29413 at 1.65 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
b'GMMTHYSDNTLKVAHQGFEFFTQGLATGEWQKFLDMLTEDFTFWFPMGEFHGLNVGKERAKEFFTYVSESFHTGIQISSLDRVTSNETTVVFEFRDEGLFLGKPYKNRVAVSFDVRGDKICSYREYFGSDGKSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NTF2-like Protein
publication title Crystal structure of a NTF2-like Protein (YP_322774.1) from ANABAENA VARIABILIS ATCC 29413 at 1.65 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Unknown function
total genus 34
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dmcA00
5BVBA 4KVHA 3M8CA 1TUHA 1JN5B 5HGRA 3CU3A 3EBTA 3K7CA 3MG1A 3SEDA 5G2GA 4XDVA 2B24B 2BMOB 1ULIB 2QIYA 5AIIA 1NWWA 2A15A 2B1XB 2Z77A 1UUVB 3NV0B 3DMCA 3MYTA 2F98A 5BXQA 2BMQB 1DMNA 1W6YA 3F7SA 1OGZA 1OF5B 2R4IA 1QMAA 3HX8A 1ZO2A 5FW5A 3EHCA 4HM8B 1JB4A 1TP6A 4OVMA 3EN8A 3KKGA 3KZTA 8CHOA 5AIGA 1DMMA 1OHOA 5KP1A 4HM3B 1O7NB 3CNMA 3DM8A 5D81A 3F8HA 1DMQA 5AEUB 4HVNA 5AI1A 3FKAA 4N3VA 3JUPA 4WWUC 1EG9B 4RZMA 1GY7A 4X2HA 4GB5A 1Q40A 2XSHB 2K54A 5CXOA 2YFLB 2IMJA 1OHPA 5D83A 2GEXA 1GS3A 2HMOB 1ULJB 3FLJA 3VGNA 3BLZA 1E3RA 6STDA 3B4OA 2F99A 3JUOA 1E97A 1ASKA 2GXFA 3STDA 3HZPA 3B7CA 4ORLA 1JKGA 5IG4A 3DUKA 1S5AA 5CLKA 2BMRB 1GYBA 3E99A 1SJWA 3HK4A 5CF2A 3EF8A 3F9SA 3F14A 3WMDA 4X2OA 1OUNA 4HM7B 4J8TA 4HKVB 1O7PB 4FCJA 4HJLB 1K41A 4STDA 2Z76A 3F8XA 3GZRA 3RGRA 3ER7A 3JUMA 4I4KA 1VZZA 5AIHA 3D9RA 3DZLA 1W00A 4WYKB 5KP3A 2BNGA 5IEPA 5IENA 4HZBB 1BUQA 4HM4B 5IEOA 1A2KA 2XSOB 3OWUA 2F86B 4XBXA 5KP4A 1W01A 4H3UA 4R9KA 4K1UA 2HMJB 4L8PA 3S5CA 3VSYA 2YFJB 3SOAA 5AEWB 3JUNA 4J9AA 3BB9A 3EN1B 1HKXA 1O7GB 3MSOA 2YFIB 5IG3A 3KSPA 3CPOA 5IERA 2PZVA 1OCVA 3LZAA 4HM6B 3A76A 2HMNB 2STDA 3FZWA 3MKIA 2XRXB 3I0YA 3CNXA 4PEJA 3ROBA 3GRDA 1OHSA 3UNLA 3NXJA 3GZYB 3FH1A 5IG5A 5AIFA 2RGQA 2INXA 2HMLB 3G16A 4XDWA 3H51A 3DXOA 3B8LA 1AR0A 3RGAA 3OXAA 3H3HA 3NV0A 1Q42A 3OV4A 1OGXA 4HM1B 3K0ZA 5TGNA 3G0KA 5IG0A 5IF6A 3FSDA 2W2CA 3Q90A 3IPTA 2CHCA 1OF5A 1EA2A 1OPYA 3NUVA 3LYGA 5EVHA 2RFRA 1UUWB 1Q40B 1NDOB 3UJMA 4FCMA 2UX0A 5DREA 2CKFB 5JPUA 3EX9A 5JPPA 1CQSA 3SOYA 5CK6A 1ZX2A 3F40A 2XR8B 4HM2B 4XM4A 2GEYA 4L8OA 1WQLB 2QGUA 4R9LA 4IIAA 1IDPA 4LGQA 3B4PA 1JKGB 4LMIA 3FF2A 4LEHA 3ECFA 3OWSA 2Z7AA 2GBWB 3NM2A 3OX9A 1OH0A 2HMKB 4WP5A 4CDLA 1NU3A 1ISKA 1STDA 4HZ9B 3T8NA 5DRVA 4XBYA 5STDA 3MHEA 5D82A 3NBRA 4U13A 1E3VA 1GY6A 1JB5A 4Q53A 1O7HB 2OWPA 3GZXB 4L7KA 2HMMB 3T8UA 3EJVA 7STDA 3GZBA 3MG2A 1JN5A 4XBTA 3F7XA 3EBYA 2JQ5A 3EQQB 4HM5B 3KE7A 4XB5A 1U5OA 3MG3A 3GWRA 1O7WB 3NHXA 1GY5A 4WYKA 5CF1A 4K1VA 2GBXB 1C7HA 1W02A 1JB2A 3FF0A 3OWYA 1Z1SA 2I9WA 4MJDA 3G8ZA 1O7MB 3JUQA 3FGYA 4R1KA 4OUQA 3EC9A 1QJGA 4HM0B 2RCDA
chains in the Genus database with same CATH superfamily
3CCJ3 5BVBA 3U1WA 1QALA 4KVHA 1C54A 1SQWA 1MNLA 1RSNA 2AADA 2O3OA 3M8CA 1VQK3 3CXC2 2BHMA 1TUHA 1NO3A 1CH0A 1JN5B 3BIRA 5HGRA 3I563 1I2EA 3CU3A 3KN4A 3EBTA 1RMSA 3VF1A 1Y4KA 1FUSA 3DH2A 1ZGXA 3G6E3 4J5GA 3K7CA 1HZ1A 3MG1A 1BSAA 3JVCA 3SEDA 2W56A 4FMCA 5I97A 4BTYA 4R80A 1IV9A 5G2GA 3NQYA 4KT3B 3UL5A 1GOYA 2B24B 2CW9A 4XDVA 2BMOB 8RNTA 1RGGA 1NJI4 1ULIB 1RHLA 2QIYA 1WMNA 4N6OB 2RBIA 3K63A 3CME3 3CCU3 1SIIA 2BO9B 5AIIA 1NWWA 3CCS3 2A15A 9RNTA 1GD4A 1K9M4 1A67A 1BU4A 2B1XB 1T3BA 1DETA 1N9JA 2ZL8A 2Z77A 1UUVB 2Y73A 1ROVA 3NV0B 1WMPA 3DMCA 3MYTA 2YX9A 1IV7A 2F98A 4AEQA 4KFFA 3AGNA 2CFKA 2W6JH 3WODG 1YVBI 2FGTA 3X3ZA 5BXQA 2BMQB 1BRNL 1DMNA 1W6YA 7RNTA 3F7SA 1OGZA 3CC43 1LQGC 3N8BA 1RGLA 1OF5B 1IK3A 2BIRA 3CCL3 1FGTA 1QMAA 1SIHA 2R4IA 3AGOA 3URPA 1SARA 1X1WA 3DGOA 3HX8A 4BTWA 3KIIA 1ZO2A 3DGLA 5M18A 1CEWI 5FW5A 2PNCA 3Q3FA 3EHCA 1BNJA 6RNTA 4HM8B 3SVAA 1JB4A 5GSPA 1TP6A 4NHFA 2XGNA 3EN8A 4OVMA 3KKGA 3KZTA 5JBSA 2F4YA 1IU7A 8CHOA 1W2B2 5AIGA 1DMMA 5EEOA 1OHOA 5KP1A 2P05A 1DVCA 4HM3B 4N6TA 1JZOA 1O7NB 3CNMA 1BGSA 3DM8A 1A2VA 3ZG0A 5RNTA 5BIRA 5D81A 3F8HA 1DMQA 2WGOA 5AEUB 1IQXA 2W9QA 3HIGA 3UL6A 4HVNA 5AI1A 2W56B 3FKAA 1D6UA 1B2ZA 4OK0A 2QEX3 1YI23 3QRDA 1IYYA 4N3VA 2KF4A 3JUPA 1UCKA 4WWUC 1EG9B 4RZMA 2XH9A 1BSBA 1RGCA 1GY7A 1HU9A 5FGOA 2F5WA 1IVUA 1LNIA 2P38A 4X2HA 4GB5A 1Q40A 2XSHB 2SARA 2K54A 1LRAA 3A5EA 1RGAA 2OOVC 2CFDA 3BNDA 5CXOA 3KCHA 3TDGA 2YFLB 1SPUA 2IMJA 1OHPA 4LZIA 5D83A 5ELJA 2GEXA 4R4KA 5AYRB 1GS3A 4IT7A 3T0UA 3SLUA 2HMOB 3Q2PA 1MWSA 1ULJB 2ML6A 3NBJA 3PGBA 2KRTA 1BANA 3WMDA 4CCVA 2AAEA 3FLJA 5HOHA 4H61A 1VQN3 3VGNA 4K90B 4EXRA 1BAOA 1E3RA 2CWVA 3BLZA 3B4OA 3WOEB 6STDA 3LOYA 2F99A 3JUOA 1E97A 3AMOB 1B20A 1ASKA 1G96A 1B27A 1KSIA 2HOHA 1EQKA 3LTCA 1M904 1QAKA 2GXFA 3STDA 3HZPA 1WNHA 3PYJA 1N8QA 1V57A 3B7CA 1QVF2 4BL2A 1J2BA 1LOVA 3BNCA 3PCSA 4ORLA 1JKGA 3BNBA 3PCRA 4HOHA 3RDEA 3S27A 5IG4A 1BUJA 2IY2A 4JRFA 3FG1A 1W6GA 3DUKA 1PY3A 1RGKA 1IQ8A 7GSPA 2RNTA 1D6YA 1UI8A 1S5AA 2CX0A 2KF6A 2L1SA 1G0TA 5CLKA 2BMRB 1GYBA 3E99A 1SJWA 1BSCA 2OCTA 3HK4A 5CF2A 1VQP3 3HI7A 1W4NA 1VQM3 3EF8A 4JF8A 4ILFA 3F9SA 1W7CA 1M9GA 1STFI 3AHSA 3F14A 1UDII 3L0RA 1RDSA 4X2OA 3HOHA 1OUNA 1EUIC 4HM7B 4HYZA 3S29A 1GD3A 1R4CA 2OTL3 4J8TA 1RRHA 4HKVB 1PYLA 1MWRA 1O7PB 3HIIA 4FCJA 1WMOA 1I2GA 1YGEA 1K41A 4HJLB 4STDA 2Z76A 3F8XA 4RBNA 3GZRA 1MGRA 1N8R4 1ROAA 3RGRA 3D4AA 3NQZA 1FW7A 3ER7A 3JUMA 4I4KA 1IQYA 5BU4A 1VZZA 2Z6BA 5AIHA 3D9RA 2H0HA 3DZLA 1IVVA 1W00A 4O02B 1JZDA 2R41A 5IW9A 4EW5A 4O2HA 1TU5A 3Q1CA 4K61A 1IT7A 4WYKB 5KP3A 2CFLA 1JBRA 4AKYA 4N6V0 2BNGA 1DYUA 1LOYA 1LVNA 5IEPA 1N9EA 5IENA 1RTUA 3WA2X 1X1UA 1RGHA 4HZBB 1Q864 1BUQA 4N6LA 4HM4B 2WOHA 5IEOA 1UW1A 4NREA 1TJDA 1VQ63 1WTHA 1A2KA 1VQ83 2XSOB 3OWUA 3G4S3 1IT8A 4KFDA 4WFOA 1FGMA 2F86B 3KSED 4GHOA 3X3XA 4KFEA 1IVWA 2CFWA 2W0QA 4XBXA 3X3YA 2OQEA 2UGIA 1Q814 1BNEA 5KP4A 1W01A 2MF7A 1W5ZA 4H3UA 4R9KA 5LC6A 1FYSA 2WOFA 4K1UA 3LXUX 2HMJB 3WHOA 4L8PA 3S5CA 3VSYA 1I2FA 2YFJB 4I5QA 3SOAA 2F5MA 1W2ZA 5AEWB 1LQMB 3JUNA 1RRLA 3LT9A 4J9AA 2ZA4A 1AVLA 1EKMA 1VQ43 4KZ1A 3BB9A 2CWUA 1UCLA 1X1XA 2E2VA 3EN1B 4EYCA 3WA3A 1HYFA 2CG0A 1HKXA 6GSPA 1MGWA 1O7GB 3MSOA 1YJN3 2C11A 2YFIB 2P0MA 5IG3A 3V98A 2H0GA 3LTDA 3NBBA 4RNYA 2E2TA 1BIRA 1FGQA 3KSPA 3CPOA 3ALAA 3DGMA 2PZVA 5A0OB 5IERA 1BNRA 1US1A 4O8SA 1OCVA 3MWZA 4EV2A 2C4BA 1BNFA 1NB3I 2QA43 3LZAA 3EB8A 4HM6B 1RNTA 2D42A 1VQO3 4RNTA 3CCE3 3A76A 1BNIA 2HMNB 2STDA 1RJOA 3FZWA 2J8XB 3MKIA 1CYVA 1MWTA 2XRXB 3I0YA 1QAFA 1TRPA 3CNXA 1M1XB 2SBLA 2IUJA 3WOFB 4PEJA 3ROBA 1DVDA 1RKYA 1TFKA 1I3IA 1ZS7A 4N6UA 1JJ22 3GRDA 1AY7A 3LTBA 1NB5I 1VQQA 1OHSA 3UNLA 3NXJA 1F8NA 3GZYB 3FH1A 4EC6A 5IG5A 5AIFA 1BRSA 2WO0A 1LNHA 5G1LA 4BIRA 3K5TA 1RGEA 1RN1A 2RGQA 2INXA 4FMAA 2W04A 1KQS2 1T2HA 1UGIA 2HMLB 1Q9EA 3G16A 4XDWA 1GMRA 3H51A 4J5KA 3X40A 3DXOA 4ZM8A 4BL3A 1B2SA 3B8LA 1AR0A 3PZWA 2CIUA 3D79A 3D3LA 2CFGA 2K0MA 2L4VA 2GSPA 1GMQA 3RGAA 3D5GA 3NM7A 2XF3A 2UUGC 3OXAA 3H3HA 3NV0A 1Q42A 3OV4A 3SXXA 2Y74A 3BU4A 3U97A 1MWUA 1OGXA 4HM1B 3K0ZA 1FGRA 1JNQA 2IA7A 3DGYA 3G0KA 5IG0A 5TGNA 5IF6A 3FSDA 1S723 2C10A 2W2CA 1GOUA 1VQ73 3UB1A 1FA3A 3RNTA 1A2PA 2P09A 4BU4A 1QVG2 1JBTA 1BRHA 3Q90A 3K9MC 1L5GB 4N6MA 3IPTA 1G02A 1OF5A 1EA2A 1OPYA 2CHCA 4TX4A 2LYXA 1CYUA 3NUVA 2ZDJA 3J7Yd 2XFTA 1I3FA 3D5IA 4FCZA 3LYGA 4N6NB 2RFRA 1UUWB 5EVHA 1Q40B 4O3VA 3V92A 3CCR3 1N5HA 3V99A 1NDOB 2CWTA 1I8VA 3UJMA 1LOXA 2CX1A 2IUKA 3GSPA 3CC73 4FCMA 1LXEA 2F56A 1K734 4CPKA 1YJ93 1KD14 2UX0A 2GU1A 2CKFB 5DREA 5JPUA 1B2XA 2KAAA 1IVXA 3SX1A 1GOVA 3CD63 3EX9A 3ZFZA 4RNZA 2FNQA 1UCJA 1UI7A 1RCLA 1CQSA 4MMYB 1UCIA 5JPPA 3LH4A 2MC8A 4GSPA 3DGNA 1BNSA 1JBSA 1VQ53 2RSXA 1R4YA 2W9PA 2CG1A 3LT8A 2KF3A 3SOYA 3G713 1YVSA 5CK6A 1DE3A 1ZX2A 3F40A 2XR8B 4HM2B 1PFPA 5M1AA 4XM4A 2GEYA 4L8OA 1U8CB 2OQEC 1KWIA 1WQLB 1UGHI 1BNGA 2QGUA 4R9LA 4IIAA 4NPBA 1M1K4 1IDPA 4LGQA 1RGFA 1BRJA 3B4PA 1JKGB 4LMIA 2H0IA 3FF2A 2BT3A 1V58A 1RN4A 4LEHA 1MOLA 3ECFA 1Q7Y4 2GU3A 3OW22 3OWSA 2ZHXB 2Z7AA 4FR9A 3S28A 1B2MA 3WR2A 1AV4A 2V1LA 4DKIA 2GBWB 3NM2A 3OX9A 2W03A 3IMAB 1TRQA 1OH0A 1RN7A 2HMKB 4WP5A 1BSDA 4MMXB 4CDLA 2K3DA 2O9UX 1NU3A 1YJW3 2D1WA 1B3SA 1ISKA 1STDA 3AHWA 1B21A 3S67A 4HAAA 3O8YA 4HZ9B 3PS8A 2FXTA 3T8NA 4EBGA 5DRVA 3AMOA 2KCDA 4XBYA 1FUWA 1Q824 1JRQA 5STDA 3N9HA 3CC23 3N54B 1GMPA 3MHEA 5EQLA 5D82A 1I0XA 2XEPA 3CMA3 1NNVA 1BVIA 2IYJA 1KC84 3BNEA 3NBRA 3X42A 2KF5A 2CK3H 4U13A 1YGWA 4G1MB 1E3VA 1W6CA 1GY6A 3WDGB 1YIT3 1VQL3 1JB5A 4Q53A 3EE1A 1O7HB 2CC3A 1T2IA 2OWPA 4GL6A 4LYLB 3GZXB 1AQZA 4L7KA 3CCV3 2CH9A 3LTAA 1RNBA 1GSPA 2HMMB 3T8UA 3EJVA 7STDA 3CCM3 3GZBA 2E2UA 3MG2A 1FZUA 2XFSA 1JN5A 4XBTA 3GAXA 1Q7HA 3F7XA 1D6ZA 1LOWA 4QWTA 4WHAA 5AYSC 3EBYA 3CPW2 3LMLA 3MPHA 1BSEA 2M7OA 2WGQA 1RLSA 2JQ5A 3EQQB 1YNVX 4MMZB 3ZG5A 3DY5A 1PU4A 1VQ93 1I0VA 1K28A 1JV2B 4HM5B 3FG3A 4EV5A 3I553 4IPBA 1FGOA 4HBRA 1BRKA 1I70A 3KE7A 3KFQC 4XB5A 1U5OA 1K8A4 5ELUA 3MG3A 1TIJA 3GWRA 1O7WB 4MEIA 3NHXA 1GY5A 1B2UA 4WYKA 2OOVA 1A90A 4CJNA 5CF1A 1T5YA 1TFOA 4K1VA 2XGLA 2GBXB 1C7HA 3QK9A 5G1KA 1YHQ3 3FCSB 2KXGA 1BRIA 1W02A 3FG4A 1RCKA 2ML5A 1BOXA 1JB2A 3FF0A 4LSOA 1N5PA 2JDIH 4AKZA 4FMBA 2Q07A 1YIJ3 3OWYA 1UUGB 1Z1SA 5LC7A 1BRGA 2I9WA 3NX0A 1OACA 2P0XA 4MJDA 1V74A 3G8ZA 4FMDA 2OTJ3 3PXMA 1O7MB 3JUQA 3FGYA 3IJEB 4R1KA 4OUQA 2LQVA 3CCQ3 1FUTA 1TTOA 3X41A 1X1YA 3EC9A 1QJGA 3SYUA 4BTXA 2BU4A 4HM0B 1EEJA 1AVKA 2RCDA 5M19A
chains in the Genus database with same CATH topology
3CCJ3 5BVBA 3U1WA 1QALA 4KVHA 1SQWA 1MNLA 3M8CA 2O3OA 1VQK3 3CXC2 2BHMA 1TUHA 1NO3A 1JN5B 3I563 5HGRA 3CU3A 3KN4A 3EBTA 3VF1A 1Y4KA 3G6E3 3K7CA 3MG1A 3JVCA 3SEDA 2W56A 4FMCA 5I97A 4BTYA 4R80A 1IV9A 5G2GA 3NQYA 3UL5A 4XDVA 2B24B 2CW9A 1NJI4 2BMOB 1ULIB 2QIYA 1WMNA 4N6OB 3K63A 3CME3 3CCU3 1SIIA 2BO9B 5AIIA 1NWWA 3CCS3 2A15A 1GD4A 1K9M4 1A67A 2B1XB 1N9JA 2ZL8A 2Z77A 1UUVB 2Y73A 1ROVA 3NV0B 1WMPA 3DMCA 3MYTA 2YX9A 1IV7A 2F98A 4AEQA 4KFFA 2CFKA 2W6JH 3WODG 1YVBI 2FGTA 3X3ZA 5BXQA 2BMQB 1DMNA 1W6YA 3F7SA 1OGZA 3CC43 3N8BA 1OF5B 1IK3A 3CCL3 1FGTA 1QMAA 1SIHA 2R4IA 3DGOA 3HX8A 4BTWA 3KIIA 1ZO2A 3DGLA 1CEWI 5FW5A 2PNCA 3EHCA 4HM8B 3SVAA 1JB4A 1TP6A 4NHFA 2XGNA 3EN8A 4OVMA 3KKGA 3KZTA 5JBSA 1IU7A 8CHOA 1W2B2 5AIGA 1DMMA 5EEOA 1OHOA 5KP1A 2P05A 1DVCA 4HM3B 4N6TA 1O7NB 3CNMA 3DM8A 1A2VA 5D81A 3F8HA 1DMQA 2WGOA 5AEUB 1IQXA 2W9QA 3HIGA 3UL6A 4HVNA 5AI1A 2W56B 3FKAA 1D6UA 2QEX3 4OK0A 1YI23 3QRDA 4N3VA 3JUPA 4WWUC 1EG9B 4RZMA 2XH9A 1GY7A 1HU9A 5FGOA 1IVUA 2P38A 4X2HA 4GB5A 1Q40A 2XSHB 2K54A 2OOVC 2CFDA 3BNDA 5CXOA 3TDGA 2YFLB 1SPUA 2IMJA 1OHPA 4LZIA 5D83A 5ELJA 2GEXA 4R4KA 5AYRB 1GS3A 4IT7A 3T0UA 3SLUA 2HMOB 3Q2PA 2ML6A 1ULJB 3NBJA 3PGBA 2KRTA 4CCVA 3FLJA 4H61A 1VQN3 3VGNA 4K90B 4EXRA 2CWVA 1E3RA 3BLZA 6STDA 3B4OA 3WOEB 3LOYA 2F99A 3JUOA 1E97A 3AMOB 1ASKA 1G96A 1KSIA 1EQKA 3LTCA 1M904 1QAKA 2GXFA 3STDA 3HZPA 1WNHA 3PYJA 1N8QA 1QVF2 3B7CA 1J2BA 3BNCA 3PCSA 4ORLA 1JKGA 3BNBA 3PCRA 3RDEA 3S27A 5IG4A 4JRFA 3FG1A 1W6GA 3DUKA 1IQ8A 1D6YA 1UI8A 1S5AA 5CLKA 2BMRB 1GYBA 3E99A 1SJWA 2OCTA 3HK4A 5CF2A 1VQP3 3HI7A 1W4NA 1VQM3 3EF8A 4JF8A 3F9SA 1W7CA 1M9GA 1STFI 3F14A 3L0RA 3S29A 3WMDA 4X2OA 1OUNA 4HM7B 4HYZA 1GD3A 1R4CA 2OTL3 4J8TA 1RRHA 4HKVB 1O7PB 3HIIA 4FCJA 1WMOA 1YGEA 4HJLB 1K41A 4STDA 4RBNA 2Z76A 3F8XA 3GZRA 1N8R4 1ROAA 3RGRA 3NQZA 3ER7A 3JUMA 4I4KA 1IQYA 1VZZA 2Z6BA 5AIHA 3D9RA 3DZLA 1IVVA 1W00A 4O02B 5IW9A 4O2HA 1TU5A 3Q1CA 4K61A 1IT7A 4WYKB 5KP3A 2CFLA 4AKYA 4N6V0 2BNGA 1DYUA 1LVNA 5IEPA 1N9EA 5IENA 3WA2X 4HZBB 1Q864 1BUQA 4N6LA 4HM4B 2WOHA 5IEOA 1UW1A 4NREA 1VQ63 1WTHA 1A2KA 1VQ83 2XSOB 3OWUA 3G4S3 1IT8A 4KFDA 4WFOA 1FGMA 2F86B 3KSED 3X3XA 4KFEA 1IVWA 2CFWA 2W0QA 4XBXA 3X3YA 2OQEA 1Q814 5KP4A 1W01A 2MF7A 1W5ZA 4H3UA 4R9KA 5LC6A 2WOFA 4K1UA 3LXUX 2HMJB 4L8PA 3S5CA 3VSYA 2YFJB 3SOAA 1W2ZA 5AEWB 3JUNA 1RRLA 3LT9A 4J9AA 1AVLA 1EKMA 1VQ43 4KZ1A 3BB9A 2CWUA 2E2VA 3EN1B 4EYCA 3WA3A 2CG0A 1HKXA 1YJN3 1O7GB 3MSOA 2C11A 2YFIB 2P0MA 5IG3A 3V98A 3LTDA 3NBBA 4RNYA 2E2TA 1FGQA 3KSPA 3CPOA 3ALAA 3DGMA 2PZVA 5A0OB 5IERA 1US1A 4O8SA 1OCVA 3MWZA 4EV2A 1NB3I 2QA43 3LZAA 3EB8A 4HM6B 2D42A 1VQO3 3CCE3 3A76A 2HMNB 2STDA 1RJOA 3FZWA 3MKIA 1CYVA 2XRXB 3I0YA 1QAFA 3CNXA 1M1XB 2SBLA 2IUJA 3WOFB 4PEJA 3ROBA 1DVDA 1RKYA 1TFKA 4N6UA 1JJ22 3GRDA 3LTBA 1NB5I 1OHSA 3UNLA 3NXJA 1F8NA 3GZYB 3FH1A 5IG5A 5AIFA 2WO0A 1LNHA 3K5TA 2RGQA 2INXA 4FMAA 2W04A 1KQS2 2HMLB 3G16A 4XDWA 3X40A 3H51A 4ZM8A 3DXOA 3B8LA 1AR0A 3PZWA 2CIUA 3D3LA 2CFGA 2K0MA 2L4VA 3RGAA 3NM7A 2XF3A 3OXAA 3H3HA 3NV0A 1Q42A 3OV4A 3SXXA 2Y74A 3U97A 1OGXA 4HM1B 3K0ZA 1FGRA 1JNQA 2IA7A 5TGNA 3G0KA 5IG0A 5IF6A 1S723 3FSDA 2C10A 2W2CA 1VQ73 3UB1A 1FA3A 1QVG2 2P09A 3Q90A 3K9MC 1L5GB 4N6MA 3IPTA 2CHCA 1OF5A 1EA2A 1OPYA 4TX4A 4EC6A 2LYXA 1CYUA 3NUVA 2ZDJA 3J7Yd 2XFTA 4FCZA 4N6NB 3LYGA 5EVHA 2RFRA 1UUWB 3V92A 1Q40B 4O3VA 3CCR3 1N5HA 3V99A 1NDOB 2CWTA 3UJMA 1LOXA 2IUKA 3CC73 4FCMA 1LXEA 1K734 1YJ93 1KD14 2UX0A 2GU1A 2CKFB 5DREA 5JPUA 1IVXA 3SX1A 3CD63 3EX9A 4RNZA 2FNQA 1UI7A 4MMYB 1CQSA 5JPPA 3LH4A 2MC8A 3DGNA 1VQ53 2RSXA 2W9PA 2CG1A 3LT8A 3SOYA 3G713 5CK6A 1ZX2A 3F40A 2XR8B 4HM2B 1PFPA 4XM4A 2GEYA 4L8OA 1U8CB 2OQEC 1KWIA 1WQLB 2QGUA 4R9LA 4IIAA 1M1K4 1IDPA 4LGQA 3B4PA 1JKGB 4LMIA 3FF2A 2BT3A 4LEHA 1MOLA 3ECFA 1Q7Y4 2GU3A 3OW22 3OWSA 2Z7AA 4FR9A 3S28A 1AV4A 2V1LA 2GBWB 3NM2A 3OX9A 2W03A 3IMAB 1OH0A 1RN7A 2HMKB 4WP5A 4MMXB 4CDLA 2O9UX 1NU3A 1YJW3 2D1WA 1ISKA 1STDA 3S67A 3O8YA 4HZ9B 3PS8A 2FXTA 3T8NA 4EBGA 5DRVA 3AMOA 2KCDA 4XBYA 1FUWA 1Q824 1JRQA 5STDA 3N9HA 3CC23 3N54B 3MHEA 5EQLA 5D82A 2XEPA 3CMA3 1KC84 3BNEA 3NBRA 3X42A 2CK3H 4U13A 4G1MB 1E3VA 1W6CA 1GY6A 3WDGB 1YIT3 1VQL3 1JB5A 4Q53A 3EE1A 1O7HB 2CC3A 2OWPA 4GL6A 3GZXB 4L7KA 3CCV3 2CH9A 3LTAA 2HMMB 3T8UA 3EJVA 7STDA 3CCM3 3GZBA 2E2UA 3MG2A 2XFSA 1JN5A 4XBTA 3GAXA 3F7XA 1D6ZA 4QWTA 4WHAA 5AYSC 3EBYA 3CPW2 3LMLA 3MPHA 2M7OA 2WGQA 2JQ5A 3EQQB 4MMZB 3DY5A 1PU4A 1VQ93 1K28A 1JV2B 4HM5B 3FG3A 4EV5A 3I553 4IPBA 1FGOA 4HBRA 3KE7A 3KFQC 4XB5A 1U5OA 1K8A4 5ELUA 3MG3A 1TIJA 3GWRA 1O7WB 4MEIA 3NHXA 1GY5A 4WYKA 2OOVA 1A90A 5CF1A 1T5YA 1TFOA 4K1VA 2XGLA 2GBXB 1C7HA 3QK9A 1YHQ3 3FCSB 2KXGA 1W02A 3FG4A 2ML5A 1JB2A 3FF0A 4LSOA 1N5PA 2JDIH 4AKZA 4FMBA 2Q07A 1YIJ3 3OWYA 1Z1SA 5LC7A 2I9WA 3NX0A 1OACA 2P0XA 4MJDA 1V74A 3G8ZA 4FMDA 2OTJ3 3PXMA 1O7MB 3JUQA 3FGYA 3IJEB 4R1KA 4OUQA 2LQVA 3CCQ3 3X41A 3EC9A 1QJGA 4BTXA 4HM0B 1AVKA 2RCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BVB A;  4KVH A;  3M8C A;  1TUH A;  1JN5 B;  5HGR A;  3CU3 A;  3EBT A;  3K7C A;  3MG1 A;  3SED A;  5G2G A;  4XDV A;  2B24 B;  2BMO B;  1ULI B;  2QIY A;  5AII A;  1NWW A;  2A15 A;  2B1X B;  2Z77 A;  1UUV B;  3NV0 B;  3DMC A;  3MYT A;  2F98 A;  5BXQ A;  2BMQ B;  1DMN A;  1W6Y A;  3F7S A;  1OGZ A;  1OF5 B;  2R4I A;  1QMA A;  3HX8 A;  1ZO2 A;  5FW5 A;  3EHC A;  4HM8 B;  1JB4 A;  1TP6 A;  4OVM A;  3EN8 A;  3KKG A;  3KZT A;  8CHO A;  5AIG A;  1DMM A;  1OHO A;  5KP1 A;  4HM3 B;  1O7N B;  3CNM A;  3DM8 A;  5D81 A;  3F8H A;  1DMQ A;  5AEU B;  4HVN A;  5AI1 A;  3FKA A;  4N3V A;  3JUP A;  4WWU C;  1EG9 B;  4RZM A;  1GY7 A;  4X2H A;  4GB5 A;  1Q40 A;  2XSH B;  2K54 A;  5CXO A;  2YFL B;  2IMJ A;  1OHP A;  5D83 A;  2GEX A;  1GS3 A;  2HMO B;  1ULJ B;  3FLJ A;  3VGN A;  3BLZ A;  1E3R A;  6STD A;  3B4O A;  2F99 A;  3JUO A;  1E97 A;  1ASK A;  2GXF A;  3STD A;  3HZP A;  3B7C A;  4ORL A;  1JKG A;  5IG4 A;  3DUK A;  1S5A A;  5CLK A;  2BMR B;  1GYB A;  3E99 A;  1SJW A;  3HK4 A;  5CF2 A;  3EF8 A;  3F9S A;  3F14 A;  3WMD A;  4X2O A;  1OUN A;  4HM7 B;  4J8T A;  4HKV B;  1O7P B;  4FCJ A;  4HJL B;  1K41 A;  4STD A;  2Z76 A;  3F8X A;  3GZR A;  3RGR A;  3ER7 A;  3JUM A;  4I4K A;  1VZZ A;  5AIH A;  3D9R A;  3DZL A;  1W00 A;  4WYK B;  5KP3 A;  2BNG A;  5IEP A;  5IEN A;  4HZB B;  1BUQ A;  4HM4 B;  5IEO A;  1A2K A;  2XSO B;  3OWU A;  2F86 B;  4XBX A;  5KP4 A;  1W01 A;  4H3U A;  4R9K A;  4K1U A;  2HMJ B;  4L8P A;  3S5C A;  3VSY A;  2YFJ B;  3SOA A;  5AEW B;  3JUN A;  4J9A A;  3BB9 A;  3EN1 B;  1HKX A;  1O7G B;  3MSO A;  2YFI B;  5IG3 A;  3KSP A;  3CPO A;  5IER A;  2PZV A;  1OCV A;  3LZA A;  4HM6 B;  3A76 A;  2HMN B;  2STD A;  3FZW A;  3MKI A;  2XRX B;  3I0Y A;  3CNX A;  4PEJ A;  3ROB A;  3GRD A;  1OHS A;  3UNL A;  3NXJ A;  3GZY B;  3FH1 A;  5IG5 A;  5AIF A;  2RGQ A;  2INX A;  2HML B;  3G16 A;  4XDW A;  3H51 A;  3DXO A;  3B8L A;  1AR0 A;  3RGA A;  3OXA A;  3H3H A;  3NV0 A;  1Q42 A;  3OV4 A;  1OGX A;  4HM1 B;  3K0Z A;  5TGN A;  3G0K A;  5IG0 A;  5IF6 A;  3FSD A;  2W2C A;  3Q90 A;  3IPT A;  2CHC A;  1OF5 A;  1EA2 A;  1OPY A;  3NUV A;  3LYG A;  5EVH A;  2RFR A;  1UUW B;  1Q40 B;  1NDO B;  3UJM A;  4FCM A;  2UX0 A;  5DRE A;  2CKF B;  5JPU A;  3EX9 A;  5JPP A;  1CQS A;  3SOY A;  5CK6 A;  1ZX2 A;  3F40 A;  2XR8 B;  4HM2 B;  4XM4 A;  2GEY A;  4L8O A;  1WQL B;  2QGU A;  4R9L A;  4IIA A;  1IDP A;  4LGQ A;  3B4P A;  1JKG B;  4LMI A;  3FF2 A;  4LEH A;  3ECF A;  3OWS A;  2Z7A A;  2GBW B;  3NM2 A;  3OX9 A;  1OH0 A;  2HMK B;  4WP5 A;  4CDL A;  1NU3 A;  1ISK A;  1STD A;  4HZ9 B;  3T8N A;  5DRV A;  4XBY A;  5STD A;  3MHE A;  5D82 A;  3NBR A;  4U13 A;  1E3V A;  1GY6 A;  1JB5 A;  4Q53 A;  1O7H B;  2OWP A;  3GZX B;  4L7K A;  2HMM B;  3T8U A;  3EJV A;  7STD A;  3GZB A;  3MG2 A;  1JN5 A;  4XBT A;  3F7X A;  3EBY A;  2JQ5 A;  3EQQ B;  4HM5 B;  3KE7 A;  4XB5 A;  1U5O A;  3MG3 A;  3GWR A;  1O7W B;  3NHX A;  1GY5 A;  4WYK A;  5CF1 A;  4K1V A;  2GBX B;  1C7H A;  1W02 A;  1JB2 A;  3FF0 A;  3OWY A;  1Z1S A;  2I9W A;  4MJD A;  3G8Z A;  1O7M B;  3JUQ A;  3FGY A;  4R1K A;  4OUQ A;  3EC9 A;  1QJG A;  4HM0 B;  2RCD A; 
#chains in the Genus database with same CATH topology
 3CCJ 3;  5BVB A;  3U1W A;  1QAL A;  4KVH A;  1C54 A;  1SQW A;  1MNL A;  1RSN A;  2AAD A;  2O3O A;  3M8C A;  1VQK 3;  3CXC 2;  2BHM A;  1TUH A;  1NO3 A;  1CH0 A;  1JN5 B;  3BIR A;  5HGR A;  3I56 3;  1I2E A;  3CU3 A;  3KN4 A;  3EBT A;  1RMS A;  3VF1 A;  1Y4K A;  1FUS A;  3DH2 A;  1ZGX A;  3G6E 3;  4J5G A;  3K7C A;  1HZ1 A;  3MG1 A;  1BSA A;  3JVC A;  3SED A;  2W56 A;  4FMC A;  5I97 A;  4BTY A;  4R80 A;  1IV9 A;  5G2G A;  3NQY A;  4KT3 B;  3UL5 A;  1GOY A;  2B24 B;  2CW9 A;  4XDV A;  2BMO B;  8RNT A;  1RGG A;  1NJI 4;  1ULI B;  1RHL A;  2QIY A;  1WMN A;  4N6O B;  2RBI A;  3K63 A;  3CME 3;  3CCU 3;  1SII A;  2BO9 B;  5AII A;  1NWW A;  3CCS 3;  2A15 A;  9RNT A;  1GD4 A;  1K9M 4;  1A67 A;  1BU4 A;  2B1X B;  1T3B A;  1DET A;  1N9J A;  2ZL8 A;  2Z77 A;  1UUV B;  2Y73 A;  1ROV A;  3NV0 B;  1WMP A;  3DMC A;  3MYT A;  2YX9 A;  1IV7 A;  2F98 A;  4AEQ A;  4KFF A;  3AGN A;  2CFK A;  2W6J H;  3WOD G;  1YVB I;  2FGT A;  3X3Z A;  5BXQ A;  2BMQ B;  1BRN L;  1DMN A;  1W6Y A;  7RNT A;  3F7S A;  1OGZ A;  3CC4 3;  1LQG C;  3N8B A;  1RGL A;  1OF5 B;  1IK3 A;  2BIR A;  3CCL 3;  1FGT A;  1QMA A;  1SIH A;  2R4I A;  3AGO A;  3URP A;  1SAR A;  1X1W A;  3DGO A;  3HX8 A;  4BTW A;  3KII A;  1ZO2 A;  3DGL A;  5M18 A;  1CEW I;  5FW5 A;  2PNC A;  3Q3F A;  3EHC A;  1BNJ A;  6RNT A;  4HM8 B;  3SVA A;  1JB4 A;  5GSP A;  1TP6 A;  4NHF A;  2XGN A;  3EN8 A;  4OVM A;  3KKG A;  3KZT A;  5JBS A;  2F4Y A;  1IU7 A;  8CHO A;  1W2B 2;  5AIG A;  1DMM A;  5EEO A;  1OHO A;  5KP1 A;  2P05 A;  1DVC A;  4HM3 B;  4N6T A;  1JZO A;  1O7N B;  3CNM A;  1BGS A;  3DM8 A;  1A2V A;  3ZG0 A;  5RNT A;  5BIR A;  5D81 A;  3F8H A;  1DMQ A;  2WGO A;  5AEU B;  1IQX A;  2W9Q A;  3HIG A;  3UL6 A;  4HVN A;  5AI1 A;  2W56 B;  3FKA A;  1D6U A;  1B2Z A;  4OK0 A;  2QEX 3;  1YI2 3;  3QRD A;  1IYY A;  4N3V A;  2KF4 A;  3JUP A;  1UCK A;  4WWU C;  1EG9 B;  4RZM A;  2XH9 A;  1BSB A;  1RGC A;  1GY7 A;  1HU9 A;  5FGO A;  2F5W A;  1IVU A;  1LNI A;  2P38 A;  4X2H A;  4GB5 A;  1Q40 A;  2XSH B;  2SAR A;  2K54 A;  1LRA A;  3A5E A;  1RGA A;  2OOV C;  2CFD A;  3BND A;  5CXO A;  3KCH A;  3TDG A;  2YFL B;  1SPU A;  2IMJ A;  1OHP A;  4LZI A;  5D83 A;  5ELJ A;  2GEX A;  4R4K A;  5AYR B;  1GS3 A;  4IT7 A;  3T0U A;  3SLU A;  2HMO B;  3Q2P A;  1MWS A;  1ULJ B;  2ML6 A;  3NBJ A;  3PGB A;  2KRT A;  1BAN A;  3WMD A;  4CCV A;  2AAE A;  3FLJ A;  5HOH A;  4H61 A;  1VQN 3;  3VGN A;  4K90 B;  4EXR A;  1BAO A;  1E3R A;  2CWV A;  3BLZ A;  3B4O A;  3WOE B;  6STD A;  3LOY A;  2F99 A;  3JUO A;  1E97 A;  3AMO B;  1B20 A;  1ASK A;  1G96 A;  1B27 A;  1KSI A;  2HOH A;  1EQK A;  3LTC A;  1M90 4;  1QAK A;  2GXF A;  3STD A;  3HZP A;  1WNH A;  3PYJ A;  1N8Q A;  1V57 A;  3B7C A;  1QVF 2;  4BL2 A;  1J2B A;  1LOV A;  3BNC A;  3PCS A;  4ORL A;  1JKG A;  3BNB A;  3PCR A;  4HOH A;  3RDE A;  3S27 A;  5IG4 A;  1BUJ A;  2IY2 A;  4JRF A;  3FG1 A;  1W6G A;  3DUK A;  1PY3 A;  1RGK A;  1IQ8 A;  7GSP A;  2RNT A;  1D6Y A;  1UI8 A;  1S5A A;  2CX0 A;  2KF6 A;  2L1S A;  1G0T A;  5CLK A;  2BMR B;  1GYB A;  3E99 A;  1SJW A;  1BSC A;  2OCT A;  3HK4 A;  5CF2 A;  1VQP 3;  3HI7 A;  1W4N A;  1VQM 3;  3EF8 A;  4JF8 A;  4ILF A;  3F9S A;  1W7C A;  1M9G A;  1STF I;  3AHS A;  3F14 A;  1UDI I;  3L0R A;  1RDS A;  4X2O A;  3HOH A;  1OUN A;  1EUI C;  4HM7 B;  4HYZ A;  3S29 A;  1GD3 A;  1R4C A;  2OTL 3;  4J8T A;  1RRH A;  4HKV B;  1PYL A;  1MWR A;  1O7P B;  3HII A;  4FCJ A;  1WMO A;  1I2G A;  1YGE A;  1K41 A;  4HJL B;  4STD A;  2Z76 A;  3F8X A;  4RBN A;  3GZR A;  1MGR A;  1N8R 4;  1ROA A;  3RGR A;  3D4A A;  3NQZ A;  1FW7 A;  3ER7 A;  3JUM A;  4I4K A;  1IQY A;  5BU4 A;  1VZZ A;  2Z6B A;  5AIH A;  3D9R A;  2H0H A;  3DZL A;  1IVV A;  1W00 A;  4O02 B;  1JZD A;  2R41 A;  5IW9 A;  4EW5 A;  4O2H A;  1TU5 A;  3Q1C A;  4K61 A;  1IT7 A;  4WYK B;  5KP3 A;  2CFL A;  1JBR A;  4AKY A;  4N6V 0;  2BNG A;  1DYU A;  1LOY A;  1LVN A;  5IEP A;  1N9E A;  5IEN A;  1RTU A;  3WA2 X;  1X1U A;  1RGH A;  4HZB B;  1Q86 4;  1BUQ A;  4N6L A;  4HM4 B;  2WOH A;  5IEO A;  1UW1 A;  4NRE A;  1TJD A;  1VQ6 3;  1WTH A;  1A2K A;  1VQ8 3;  2XSO B;  3OWU A;  3G4S 3;  1IT8 A;  4KFD A;  4WFO A;  1FGM A;  2F86 B;  3KSE D;  4GHO A;  3X3X A;  4KFE A;  1IVW A;  2CFW A;  2W0Q A;  4XBX A;  3X3Y A;  2OQE A;  2UGI A;  1Q81 4;  1BNE A;  5KP4 A;  1W01 A;  2MF7 A;  1W5Z A;  4H3U A;  4R9K A;  5LC6 A;  1FYS A;  2WOF A;  4K1U A;  3LXU X;  2HMJ B;  3WHO A;  4L8P A;  3S5C A;  3VSY A;  1I2F A;  2YFJ B;  4I5Q A;  3SOA A;  2F5M A;  1W2Z A;  5AEW B;  1LQM B;  3JUN A;  1RRL A;  3LT9 A;  4J9A A;  2ZA4 A;  1AVL A;  1EKM A;  1VQ4 3;  4KZ1 A;  3BB9 A;  2CWU A;  1UCL A;  1X1X A;  2E2V A;  3EN1 B;  4EYC A;  3WA3 A;  1HYF A;  2CG0 A;  1HKX A;  6GSP A;  1MGW A;  1O7G B;  3MSO A;  1YJN 3;  2C11 A;  2YFI B;  2P0M A;  5IG3 A;  3V98 A;  2H0G A;  3LTD A;  3NBB A;  4RNY A;  2E2T A;  1BIR A;  1FGQ A;  3KSP A;  3CPO A;  3ALA A;  3DGM A;  2PZV A;  5A0O B;  5IER A;  1BNR A;  1US1 A;  4O8S A;  1OCV A;  3MWZ A;  4EV2 A;  2C4B A;  1BNF A;  1NB3 I;  2QA4 3;  3LZA A;  3EB8 A;  4HM6 B;  1RNT A;  2D42 A;  1VQO 3;  4RNT A;  3CCE 3;  3A76 A;  1BNI A;  2HMN B;  2STD A;  1RJO A;  3FZW A;  2J8X B;  3MKI A;  1CYV A;  1MWT A;  2XRX B;  3I0Y A;  1QAF A;  1TRP A;  3CNX A;  1M1X B;  2SBL A;  2IUJ A;  3WOF B;  4PEJ A;  3ROB A;  1DVD A;  1RKY A;  1TFK A;  1I3I A;  1ZS7 A;  4N6U A;  1JJ2 2;  3GRD A;  1AY7 A;  3LTB A;  1NB5 I;  1VQQ A;  1OHS A;  3UNL A;  3NXJ A;  1F8N A;  3GZY B;  3FH1 A;  4EC6 A;  5IG5 A;  5AIF A;  1BRS A;  2WO0 A;  1LNH A;  5G1L A;  4BIR A;  3K5T A;  1RGE A;  1RN1 A;  2RGQ A;  2INX A;  4FMA A;  2W04 A;  1KQS 2;  1T2H A;  1UGI A;  2HML B;  1Q9E A;  3G16 A;  4XDW A;  1GMR A;  3H51 A;  4J5K A;  3X40 A;  3DXO A;  4ZM8 A;  4BL3 A;  1B2S A;  3B8L A;  1AR0 A;  3PZW A;  2CIU A;  3D79 A;  3D3L A;  2CFG A;  2K0M A;  2L4V A;  2GSP A;  1GMQ A;  3RGA A;  3D5G A;  3NM7 A;  2XF3 A;  2UUG C;  3OXA A;  3H3H A;  3NV0 A;  1Q42 A;  3OV4 A;  3SXX A;  2Y74 A;  3BU4 A;  3U97 A;  1MWU A;  1OGX A;  4HM1 B;  3K0Z A;  1FGR A;  1JNQ A;  2IA7 A;  3DGY A;  3G0K A;  5IG0 A;  5TGN A;  5IF6 A;  3FSD A;  1S72 3;  2C10 A;  2W2C A;  1GOU A;  1VQ7 3;  3UB1 A;  1FA3 A;  3RNT A;  1A2P A;  2P09 A;  4BU4 A;  1QVG 2;  1JBT A;  1BRH A;  3Q90 A;  3K9M C;  1L5G B;  4N6M A;  3IPT A;  1G02 A;  1OF5 A;  1EA2 A;  1OPY A;  2CHC A;  4TX4 A;  2LYX A;  1CYU A;  3NUV A;  2ZDJ A;  3J7Y d;  2XFT A;  1I3F A;  3D5I A;  4FCZ A;  3LYG A;  4N6N B;  2RFR A;  1UUW B;  5EVH A;  1Q40 B;  4O3V A;  3V92 A;  3CCR 3;  1N5H A;  3V99 A;  1NDO B;  2CWT A;  1I8V A;  3UJM A;  1LOX A;  2CX1 A;  2IUK A;  3GSP A;  3CC7 3;  4FCM A;  1LXE A;  2F56 A;  1K73 4;  4CPK A;  1YJ9 3;  1KD1 4;  2UX0 A;  2GU1 A;  2CKF B;  5DRE A;  5JPU A;  1B2X A;  2KAA A;  1IVX A;  3SX1 A;  1GOV A;  3CD6 3;  3EX9 A;  3ZFZ A;  4RNZ A;  2FNQ A;  1UCJ A;  1UI7 A;  1RCL A;  1CQS A;  4MMY B;  1UCI A;  5JPP A;  3LH4 A;  2MC8 A;  4GSP A;  3DGN A;  1BNS A;  1JBS A;  1VQ5 3;  2RSX A;  1R4Y A;  2W9P A;  2CG1 A;  3LT8 A;  2KF3 A;  3SOY A;  3G71 3;  1YVS A;  5CK6 A;  1DE3 A;  1ZX2 A;  3F40 A;  2XR8 B;  4HM2 B;  1PFP A;  5M1A A;  4XM4 A;  2GEY A;  4L8O A;  1U8C B;  2OQE C;  1KWI A;  1WQL B;  1UGH I;  1BNG A;  2QGU A;  4R9L A;  4IIA A;  4NPB A;  1M1K 4;  1IDP A;  4LGQ A;  1RGF A;  1BRJ A;  3B4P A;  1JKG B;  4LMI A;  2H0I A;  3FF2 A;  2BT3 A;  1V58 A;  1RN4 A;  4LEH A;  1MOL A;  3ECF A;  1Q7Y 4;  2GU3 A;  3OW2 2;  3OWS A;  2ZHX B;  2Z7A A;  4FR9 A;  3S28 A;  1B2M A;  3WR2 A;  1AV4 A;  2V1L A;  4DKI A;  2GBW B;  3NM2 A;  3OX9 A;  2W03 A;  3IMA B;  1TRQ A;  1OH0 A;  1RN7 A;  2HMK B;  4WP5 A;  1BSD A;  4MMX B;  4CDL A;  2K3D A;  2O9U X;  1NU3 A;  1YJW 3;  2D1W A;  1B3S A;  1ISK A;  1STD A;  3AHW A;  1B21 A;  3S67 A;  4HAA A;  3O8Y A;  4HZ9 B;  3PS8 A;  2FXT A;  3T8N A;  4EBG A;  5DRV A;  3AMO A;  2KCD A;  4XBY A;  1FUW A;  1Q82 4;  1JRQ A;  5STD A;  3N9H A;  3CC2 3;  3N54 B;  1GMP A;  3MHE A;  5EQL A;  5D82 A;  1I0X A;  2XEP A;  3CMA 3;  1NNV A;  1BVI A;  2IYJ A;  1KC8 4;  3BNE A;  3NBR A;  3X42 A;  2KF5 A;  2CK3 H;  4U13 A;  1YGW A;  4G1M B;  1E3V A;  1W6C A;  1GY6 A;  3WDG B;  1YIT 3;  1VQL 3;  1JB5 A;  4Q53 A;  3EE1 A;  1O7H B;  2CC3 A;  1T2I A;  2OWP A;  4GL6 A;  4LYL B;  3GZX B;  1AQZ A;  4L7K A;  3CCV 3;  2CH9 A;  3LTA A;  1RNB A;  1GSP A;  2HMM B;  3T8U A;  3EJV A;  7STD A;  3CCM 3;  3GZB A;  2E2U A;  3MG2 A;  1FZU A;  2XFS A;  1JN5 A;  4XBT A;  3GAX A;  1Q7H A;  3F7X A;  1D6Z A;  1LOW A;  4QWT A;  4WHA A;  5AYS C;  3EBY A;  3CPW 2;  3LML A;  3MPH A;  1BSE A;  2M7O A;  2WGQ A;  1RLS A;  2JQ5 A;  3EQQ B;  1YNV X;  4MMZ B;  3ZG5 A;  3DY5 A;  1PU4 A;  1VQ9 3;  1I0V A;  1K28 A;  1JV2 B;  4HM5 B;  3FG3 A;  4EV5 A;  3I55 3;  4IPB A;  1FGO A;  4HBR A;  1BRK A;  1I70 A;  3KE7 A;  3KFQ C;  4XB5 A;  1U5O A;  1K8A 4;  5ELU A;  3MG3 A;  1TIJ A;  3GWR A;  1O7W B;  4MEI A;  3NHX A;  1GY5 A;  1B2U A;  4WYK A;  2OOV A;  1A90 A;  4CJN A;  5CF1 A;  1T5Y A;  1TFO A;  4K1V A;  2XGL A;  2GBX B;  1C7H A;  3QK9 A;  5G1K A;  1YHQ 3;  3FCS B;  2KXG A;  1BRI A;  1W02 A;  3FG4 A;  1RCK A;  2ML5 A;  1BOX A;  1JB2 A;  3FF0 A;  4LSO A;  1N5P A;  2JDI H;  4AKZ A;  4FMB A;  2Q07 A;  1YIJ 3;  3OWY A;  1UUG B;  1Z1S A;  5LC7 A;  1BRG A;  2I9W A;  3NX0 A;  1OAC A;  2P0X A;  4MJD A;  1V74 A;  3G8Z A;  4FMD A;  2OTJ 3;  3PXM A;  1O7M B;  3JUQ A;  3FGY A;  3IJE B;  4R1K A;  4OUQ A;  2LQV A;  3CCQ 3;  1FUT A;  1TTO A;  3X41 A;  1X1Y A;  3EC9 A;  1QJG A;  3SYU A;  4BTX A;  2BU4 A;  4HM0 B;  1EEJ A;  1AVK A;  2RCD A;  5M19 A; 
#chains in the Genus database with same CATH homology
 3CCJ 3;  5BVB A;  3U1W A;  1QAL A;  4KVH A;  1SQW A;  1MNL A;  3M8C A;  2O3O A;  1VQK 3;  3CXC 2;  2BHM A;  1TUH A;  1NO3 A;  1JN5 B;  3I56 3;  5HGR A;  3CU3 A;  3KN4 A;  3EBT A;  3VF1 A;  1Y4K A;  3G6E 3;  3K7C A;  3MG1 A;  3JVC A;  3SED A;  2W56 A;  4FMC A;  5I97 A;  4BTY A;  4R80 A;  1IV9 A;  5G2G A;  3NQY A;  3UL5 A;  4XDV A;  2B24 B;  2CW9 A;  1NJI 4;  2BMO B;  1ULI B;  2QIY A;  1WMN A;  4N6O B;  3K63 A;  3CME 3;  3CCU 3;  1SII A;  2BO9 B;  5AII A;  1NWW A;  3CCS 3;  2A15 A;  1GD4 A;  1K9M 4;  1A67 A;  2B1X B;  1N9J A;  2ZL8 A;  2Z77 A;  1UUV B;  2Y73 A;  1ROV A;  3NV0 B;  1WMP A;  3DMC A;  3MYT A;  2YX9 A;  1IV7 A;  2F98 A;  4AEQ A;  4KFF A;  2CFK A;  2W6J H;  3WOD G;  1YVB I;  2FGT A;  3X3Z A;  5BXQ A;  2BMQ B;  1DMN A;  1W6Y A;  3F7S A;  1OGZ A;  3CC4 3;  3N8B A;  1OF5 B;  1IK3 A;  3CCL 3;  1FGT A;  1QMA A;  1SIH A;  2R4I A;  3DGO A;  3HX8 A;  4BTW A;  3KII A;  1ZO2 A;  3DGL A;  1CEW I;  5FW5 A;  2PNC A;  3EHC A;  4HM8 B;  3SVA A;  1JB4 A;  1TP6 A;  4NHF A;  2XGN A;  3EN8 A;  4OVM A;  3KKG A;  3KZT A;  5JBS A;  1IU7 A;  8CHO A;  1W2B 2;  5AIG A;  1DMM A;  5EEO A;  1OHO A;  5KP1 A;  2P05 A;  1DVC A;  4HM3 B;  4N6T A;  1O7N B;  3CNM A;  3DM8 A;  1A2V A;  5D81 A;  3F8H A;  1DMQ A;  2WGO A;  5AEU B;  1IQX A;  2W9Q A;  3HIG A;  3UL6 A;  4HVN A;  5AI1 A;  2W56 B;  3FKA A;  1D6U A;  2QEX 3;  4OK0 A;  1YI2 3;  3QRD A;  4N3V A;  3JUP A;  4WWU C;  1EG9 B;  4RZM A;  2XH9 A;  1GY7 A;  1HU9 A;  5FGO A;  1IVU A;  2P38 A;  4X2H A;  4GB5 A;  1Q40 A;  2XSH B;  2K54 A;  2OOV C;  2CFD A;  3BND A;  5CXO A;  3TDG A;  2YFL B;  1SPU A;  2IMJ A;  1OHP A;  4LZI A;  5D83 A;  5ELJ A;  2GEX A;  4R4K A;  5AYR B;  1GS3 A;  4IT7 A;  3T0U A;  3SLU A;  2HMO B;  3Q2P A;  2ML6 A;  1ULJ B;  3NBJ A;  3PGB A;  2KRT A;  4CCV A;  3FLJ A;  4H61 A;  1VQN 3;  3VGN A;  4K90 B;  4EXR A;  2CWV A;  1E3R A;  3BLZ A;  6STD A;  3B4O A;  3WOE B;  3LOY A;  2F99 A;  3JUO A;  1E97 A;  3AMO B;  1ASK A;  1G96 A;  1KSI A;  1EQK A;  3LTC A;  1M90 4;  1QAK A;  2GXF A;  3STD A;  3HZP A;  1WNH A;  3PYJ A;  1N8Q A;  1QVF 2;  3B7C A;  1J2B A;  3BNC A;  3PCS A;  4ORL A;  1JKG A;  3BNB A;  3PCR A;  3RDE A;  3S27 A;  5IG4 A;  4JRF A;  3FG1 A;  1W6G A;  3DUK A;  1IQ8 A;  1D6Y A;  1UI8 A;  1S5A A;  5CLK A;  2BMR B;  1GYB A;  3E99 A;  1SJW A;  2OCT A;  3HK4 A;  5CF2 A;  1VQP 3;  3HI7 A;  1W4N A;  1VQM 3;  3EF8 A;  4JF8 A;  3F9S A;  1W7C A;  1M9G A;  1STF I;  3F14 A;  3L0R A;  3S29 A;  3WMD A;  4X2O A;  1OUN A;  4HM7 B;  4HYZ A;  1GD3 A;  1R4C A;  2OTL 3;  4J8T A;  1RRH A;  4HKV B;  1O7P B;  3HII A;  4FCJ A;  1WMO A;  1YGE A;  4HJL B;  1K41 A;  4STD A;  4RBN A;  2Z76 A;  3F8X A;  3GZR A;  1N8R 4;  1ROA A;  3RGR A;  3NQZ A;  3ER7 A;  3JUM A;  4I4K A;  1IQY A;  1VZZ A;  2Z6B A;  5AIH A;  3D9R A;  3DZL A;  1IVV A;  1W00 A;  4O02 B;  5IW9 A;  4O2H A;  1TU5 A;  3Q1C A;  4K61 A;  1IT7 A;  4WYK B;  5KP3 A;  2CFL A;  4AKY A;  4N6V 0;  2BNG A;  1DYU A;  1LVN A;  5IEP A;  1N9E A;  5IEN A;  3WA2 X;  4HZB B;  1Q86 4;  1BUQ A;  4N6L A;  4HM4 B;  2WOH A;  5IEO A;  1UW1 A;  4NRE A;  1VQ6 3;  1WTH A;  1A2K A;  1VQ8 3;  2XSO B;  3OWU A;  3G4S 3;  1IT8 A;  4KFD A;  4WFO A;  1FGM A;  2F86 B;  3KSE D;  3X3X A;  4KFE A;  1IVW A;  2CFW A;  2W0Q A;  4XBX A;  3X3Y A;  2OQE A;  1Q81 4;  5KP4 A;  1W01 A;  2MF7 A;  1W5Z A;  4H3U A;  4R9K A;  5LC6 A;  2WOF A;  4K1U A;  3LXU X;  2HMJ B;  4L8P A;  3S5C A;  3VSY A;  2YFJ B;  3SOA A;  1W2Z A;  5AEW B;  3JUN A;  1RRL A;  3LT9 A;  4J9A A;  1AVL A;  1EKM A;  1VQ4 3;  4KZ1 A;  3BB9 A;  2CWU A;  2E2V A;  3EN1 B;  4EYC A;  3WA3 A;  2CG0 A;  1HKX A;  1YJN 3;  1O7G B;  3MSO A;  2C11 A;  2YFI B;  2P0M A;  5IG3 A;  3V98 A;  3LTD A;  3NBB A;  4RNY A;  2E2T A;  1FGQ A;  3KSP A;  3CPO A;  3ALA A;  3DGM A;  2PZV A;  5A0O B;  5IER A;  1US1 A;  4O8S A;  1OCV A;  3MWZ A;  4EV2 A;  1NB3 I;  2QA4 3;  3LZA A;  3EB8 A;  4HM6 B;  2D42 A;  1VQO 3;  3CCE 3;  3A76 A;  2HMN B;  2STD A;  1RJO A;  3FZW A;  3MKI A;  1CYV A;  2XRX B;  3I0Y A;  1QAF A;  3CNX A;  1M1X B;  2SBL A;  2IUJ A;  3WOF B;  4PEJ A;  3ROB A;  1DVD A;  1RKY A;  1TFK A;  4N6U A;  1JJ2 2;  3GRD A;  3LTB A;  1NB5 I;  1OHS A;  3UNL A;  3NXJ A;  1F8N A;  3GZY B;  3FH1 A;  5IG5 A;  5AIF A;  2WO0 A;  1LNH A;  3K5T A;  2RGQ A;  2INX A;  4FMA A;  2W04 A;  1KQS 2;  2HML B;  3G16 A;  4XDW A;  3X40 A;  3H51 A;  4ZM8 A;  3DXO A;  3B8L A;  1AR0 A;  3PZW A;  2CIU A;  3D3L A;  2CFG A;  2K0M A;  2L4V A;  3RGA A;  3NM7 A;  2XF3 A;  3OXA A;  3H3H A;  3NV0 A;  1Q42 A;  3OV4 A;  3SXX A;  2Y74 A;  3U97 A;  1OGX A;  4HM1 B;  3K0Z A;  1FGR A;  1JNQ A;  2IA7 A;  5TGN A;  3G0K A;  5IG0 A;  5IF6 A;  1S72 3;  3FSD A;  2C10 A;  2W2C A;  1VQ7 3;  3UB1 A;  1FA3 A;  1QVG 2;  2P09 A;  3Q90 A;  3K9M C;  1L5G B;  4N6M A;  3IPT A;  2CHC A;  1OF5 A;  1EA2 A;  1OPY A;  4TX4 A;  4EC6 A;  2LYX A;  1CYU A;  3NUV A;  2ZDJ A;  3J7Y d;  2XFT A;  4FCZ A;  4N6N B;  3LYG A;  5EVH A;  2RFR A;  1UUW B;  3V92 A;  1Q40 B;  4O3V A;  3CCR 3;  1N5H A;  3V99 A;  1NDO B;  2CWT A;  3UJM A;  1LOX A;  2IUK A;  3CC7 3;  4FCM A;  1LXE A;  1K73 4;  1YJ9 3;  1KD1 4;  2UX0 A;  2GU1 A;  2CKF B;  5DRE A;  5JPU A;  1IVX A;  3SX1 A;  3CD6 3;  3EX9 A;  4RNZ A;  2FNQ A;  1UI7 A;  4MMY B;  1CQS A;  5JPP A;  3LH4 A;  2MC8 A;  3DGN A;  1VQ5 3;  2RSX A;  2W9P A;  2CG1 A;  3LT8 A;  3SOY A;  3G71 3;  5CK6 A;  1ZX2 A;  3F40 A;  2XR8 B;  4HM2 B;  1PFP A;  4XM4 A;  2GEY A;  4L8O A;  1U8C B;  2OQE C;  1KWI A;  1WQL B;  2QGU A;  4R9L A;  4IIA A;  1M1K 4;  1IDP A;  4LGQ A;  3B4P A;  1JKG B;  4LMI A;  3FF2 A;  2BT3 A;  4LEH A;  1MOL A;  3ECF A;  1Q7Y 4;  2GU3 A;  3OW2 2;  3OWS A;  2Z7A A;  4FR9 A;  3S28 A;  1AV4 A;  2V1L A;  2GBW B;  3NM2 A;  3OX9 A;  2W03 A;  3IMA B;  1OH0 A;  1RN7 A;  2HMK B;  4WP5 A;  4MMX B;  4CDL A;  2O9U X;  1NU3 A;  1YJW 3;  2D1W A;  1ISK A;  1STD A;  3S67 A;  3O8Y A;  4HZ9 B;  3PS8 A;  2FXT A;  3T8N A;  4EBG A;  5DRV A;  3AMO A;  2KCD A;  4XBY A;  1FUW A;  1Q82 4;  1JRQ A;  5STD A;  3N9H A;  3CC2 3;  3N54 B;  3MHE A;  5EQL A;  5D82 A;  2XEP A;  3CMA 3;  1KC8 4;  3BNE A;  3NBR A;  3X42 A;  2CK3 H;  4U13 A;  4G1M B;  1E3V A;  1W6C A;  1GY6 A;  3WDG B;  1YIT 3;  1VQL 3;  1JB5 A;  4Q53 A;  3EE1 A;  1O7H B;  2CC3 A;  2OWP A;  4GL6 A;  3GZX B;  4L7K A;  3CCV 3;  2CH9 A;  3LTA A;  2HMM B;  3T8U A;  3EJV A;  7STD A;  3CCM 3;  3GZB A;  2E2U A;  3MG2 A;  2XFS A;  1JN5 A;  4XBT A;  3GAX A;  3F7X A;  1D6Z A;  4QWT A;  4WHA A;  5AYS C;  3EBY A;  3CPW 2;  3LML A;  3MPH A;  2M7O A;  2WGQ A;  2JQ5 A;  3EQQ B;  4MMZ B;  3DY5 A;  1PU4 A;  1VQ9 3;  1K28 A;  1JV2 B;  4HM5 B;  3FG3 A;  4EV5 A;  3I55 3;  4IPB A;  1FGO A;  4HBR A;  3KE7 A;  3KFQ C;  4XB5 A;  1U5O A;  1K8A 4;  5ELU A;  3MG3 A;  1TIJ A;  3GWR A;  1O7W B;  4MEI A;  3NHX A;  1GY5 A;  4WYK A;  2OOV A;  1A90 A;  5CF1 A;  1T5Y A;  1TFO A;  4K1V A;  2XGL A;  2GBX B;  1C7H A;  3QK9 A;  1YHQ 3;  3FCS B;  2KXG A;  1W02 A;  3FG4 A;  2ML5 A;  1JB2 A;  3FF0 A;  4LSO A;  1N5P A;  2JDI H;  4AKZ A;  4FMB A;  2Q07 A;  1YIJ 3;  3OWY A;  1Z1S A;  5LC7 A;  2I9W A;  3NX0 A;  1OAC A;  2P0X A;  4MJD A;  1V74 A;  3G8Z A;  4FMD A;  2OTJ 3;  3PXM A;  1O7M B;  3JUQ A;  3FGY A;  3IJE B;  4R1K A;  4OUQ A;  2LQV A;  3CCQ 3;  3X41 A;  3EC9 A;  1QJG A;  4BTX A;  4HM0 B;  1AVK A;  2RCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...