3DMCA

Crystal structure of a ntf2-like protein (ava_2261) from anabaena variabilis atcc 29413 at 1.65 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
GMMTHYSDNTLKVAHQGFEFFTQGLATGEWQKFLDMLTEDFTFWFPMGEFHGLNVGKERAKEFFTYVSESFHTGIQISSLDRVTSNETTVVFEFRDEGLFLGKPYKNRVAVSFDVRGDKICSYREYFGSDGKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a NTF2-like Protein (YP_322774.1) from ANABAENA VARIABILIS ATCC 29413 at 1.65 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Unknown function
molecule keywords NTF2-like Protein
total genus 34
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dmcA00
1O7GB 3CNXA 3EJVA 1UUVB 3JUOA 5STDA 1CQSA 1NDOB 3MYTA 4HKVB 5AIGA 3NBRA 3VSYA 3KKGA 5BVBA 1O7HB 5JPUA 2RCDA 4HZBB 1STDA 4R9LA 5AIHA 2HMJB 1JB2A 5FW5A 1JB4A 3UNLA 3M8CA 1GY5A 1OGZA 2BMRB 4HM5B 1C7HA 3K0ZA 4HM2B 4OUQA 4WYKB 1OHOA 1DMMA 1W6YA 1ISKA 1OCVA 3NV0A 3G0KA 4XM4A 2HMKB 3CNMA 3F8XA 3CU3A 4X2HA 3OXAA 1O7NB 1ZO2A 2YFLB 3EF8A 5AIFA 4L8OA 1SJWA 3GZYB 3MKIA 4FCMA 2OWPA 3SEDA 2B24B 3STDA 1JB5A 3FH1A 3IPTA 3EN1B 1GS3A 2GXFA 2F86B 2GBXB 1O7PB 2HMMB 2GEXA 1NU3A 3OV4A 3SOAA 2K54A 5DRVA 1O7MB 2BMOB 1U5OA 3E99A 3Q90A 5IEPA 3GRDA 5CF1A 1DMNA 2QGUA 3NHXA 4STDA 1GY6A 3UJMA 5CXOA 2W2CA 2BMQB 2STDA 5CK6A 1W01A 1E97A 1Q40A 4HM0B 2IMJA 1TP6A 5TGNA 2JQ5A 5IG3A 2XSOB 4ORLA 2INXA 3HK4A 3LYGA 5IF6A 5D83A 5AIIA 3KZTA 4OVMA 4R9KA 3ROBA 5CLKA 1Q42A 1W02A 1ASKA 2HMOB 4WP5A 2QIYA 2XSHB 1ULJB 1OPYA 3DM8A 1O7WB 3EN8A 3MHEA 4I4KA 4WWUC 4WYKA 5IG0A 5IG4A 1JKGB 1JN5A 1OF5B 3NV0B 3MG3A 4KVHA 4X2OA 3NM2A 4IIAA 2UX0A 4LGQA 3T8UA 3FZWA 3G16A 4XBYA 4HVNA 3B4OA 5IEOA 3D9RA 2R4IA 2HMNB 1A2KA 4HM1B 7STDA 3OWUA 4HZ9B 2RFRA 5KP1A 3FF0A 1WQLB 3JUQA 4FCJA 4L7KA 3MG2A 1W00A 1EG9B 2Z7AA 3H3HA 3DXOA 3OWSA 4HM3B 4XDWA 1UUWB 6STDA 2CKFB 1QMAA 2XRXB 3EX9A 4J8TA 3DZLA 3FGYA 3GZBA 3GZRA 3F7XA 4K1UA 4J9AA 2A15A 5IERA 3B8LA 2GBWB 3EBTA 3LZAA 5JPPA 1OH0A 2PZVA 3VGNA 4CDLA 4XBXA 4XBTA 4XB5A 2HMLB 4MJDA 3SOYA 3F14A 2CHCA 1JN5B 1JKGA 1OF5A 5HGRA 1Q40B 1OUNA 3DUKA 1QJGA 5D82A 5DREA 1HKXA 5G2GA 3OX9A 3GZXB 3BB9A 5IG5A 3G8ZA 3HX8A 3F40A 4K1VA 3B7CA 1OGXA 3FF2A 3ER7A 3ECFA 3K7CA 3A76A 3EHCA 3KE7A 4HM7B 1OHPA 3EQQB 1ULIB 1OHSA 3EC9A 3EBYA 1DMQA 3H51A 5AI1A 5IENA 1EA2A 1S5AA 2F99A 4HJLB 3T8NA 1AR0A 4LMIA 3RGRA 5CF2A 1TUHA 1ZX2A 3GWRA 4N3VA 4LEHA 5EVHA 1GY7A 3WMDA 4U13A 1BUQA 3JUMA 1K41A 3F9SA 3JUPA 4L8PA 2I9WA 5KP4A 2XR8B 3CPOA 3OWYA 2BNGA 3MSOA 2Z76A 1Z1SA 1NWWA 3BLZA 3HZPA 4R1KA 5KP3A 2B1XB 4PEJA 3NUVA 4XDVA 3I0YA 4HM4B 4Q53A 5D81A 3MG1A 2RGQA 1VZZA 4RZMA 1GYBA 5AEUB 3FLJA 3RGAA 8CHOA 1E3RA 2Z77A 3KSPA 5AEWB 3F7SA 3FKAA 4HM8B 1E3VA 3S5CA 2F98A 3F8HA 3FSDA 2YFJB 3DMCA 2YFIB 3JUNA 3NXJA 5BXQA 2GEYA 3B4PA 4GB5A 1IDPA 4H3UA 4HM6B
chains in the Genus database with same CATH superfamily
3EJVA 3KSED 1RCKA 3JUOA 4O02B 1CQSA 1NDOB 2GU1A 4HKVB 4K90B 5HOHA 2UUGC 3AGOA 3KKGA 2RCDA 4R9LA 5AIHA 1GOUA 1TTOA 1JB4A 4KT3B 1RGHA 1A2PA 1DVCA 4HM5B 4LYLB 4OUQA 4NPBA 2OTJ3 1Q7Y4 1OHOA 1I70A 4EV5A 3CPW2 1FUWA 1YVSA 3SLUA 3NV0A 2CFLA 1VQ53 3CNMA 2P38A 2XEPA 4H61A 2F5MA 4IPBA 2E2TA 1O7NB 1ZO2A 3EF8A 3NM7A 3Q1CA 4X2HA 5AIFA 1K734 1SJWA 3ZG5A 2GSPA 1LNHA 1JB5A 1SARA 3AMOA 3LTAA 1WMOA 1GS3A 3EN1B 1O7PB 2HMMB 2P05A 2K54A 5DRVA 1U5OA 5IEPA 1Q814 3UL5A 1K8A4 1TIJA 1JBTA 3SVAA 2BMQB 2STDA 2ZDJA 2L4VA 3ALAA 1IYYA 1W01A 1Q40A 4HM0B 1MOLA 4AKZA 2IMJA 1LOXA 1PYLA 4O8SA 3ZG0A 3L0RA 1Q824 2H0GA 2XSOB 1RHLA 1WMPA 3WDGB 5IF6A 5D83A 1T3BA 2FXTA 5AIIA 3DH2A 2O3OA 1W02A 3VF1A 4I4KA 3U1WA 5BIRA 1G02A 1BRKA 2LYXA 3KN4A 2AADA 3MG3A 1DE3A 4X2OA 4IIAA 4R80A 1VQ63 6RNTA 3T8UA 1CEWI 1UUGB 4XBYA 4BL2A 1QVG2 3B4OA 1YHQ3 4HM1B 1BU4A 3OWUA 1IK3A 2RFRA 4HBRA 3X3YA 1YNVX 2BT3A 5KP1A 8RNTA 1IQYA 1WQLB 1W7CA 3CCS3 2QA43 1PFPA 2UGIA 3OWSA 4XDWA 2IY2A 1BNSA 3SX1A 6STDA 2XRXB 1QALA 4J8TA 5BVBA 3GZBA 4GHOA 1YJN3 4CCVA 5JPPA 2PZVA 3VGNA 1BNGA 4ILFA 2W9PA 2CFDA 5EQLA 3SOYA 1B3SA 1I0VA 1BOXA 1JKGA 5HGRA 3CC43 4N6V0 1OUNA 5G1LA 3LXUX 1JV2B 3BB9A 2FGTA 2KAAA 1NNVA 1STFI 1KQS2 1BIRA 1LRAA 3FF2A 3ER7A 1N5HA 3K7CA 4FMBA 1MWUA 1BRIA 3A76A 3LTDA 1OHSA 2HOHA 3H51A 5AI1A 1I3FA 1EA2A 1RMSA 3T8NA 2F99A 1AR0A 4LMIA 5CF2A 3CCU3 1TUHA 4LEHA 5GSPA 1GY7A 5I97A 1PY3A 3F9SA 5M18A 2I9WA 2XR8B 1YGWA 4CPKA 1RJOA 1VQK3 2XGNA 2Y73A 1GSPA 4XDVA 2W04A 3AHSA 1RCLA 1LVNA 3PGBA 3WHOA 1FYSA 4FCZA 4R4KA 1BSCA 1JBRA 1TRPA 2XH9A 1A2VA 4N6TA 2WOFA 1GYBA 1IT7A 3FLJA 2D42A 1BNFA 4J5KA 2F98A 1Q9EA 2YFIB 1A67A 2GEYA 2KRTA 4H3UA 3LT9A 1YVBI 3WOFB 1UUVB 2W56A 5STDA 1Q7HA 5AIGA 1IQXA 4HZBB 2W9QA 4N6OB 1STDA 3A5EA 2HMJB 1IVXA 3UNLA 1GY5A 3DY5A 1FGTA 2YX9A 1NO3A 1I8VA 1LXEA 1ISKA 1AQZA 1YIT3 3S29A 1K28A 2XGLA 3HOHA 1L5GB 1ZGXA 2ML5A 3G0KA 2HMKB 3HIIA 1BANA 2KF5A 3DGNA 4HOHA 5M19A 2KXGA 3BNBA 3EE1A 3LTCA 4L8OA 3I563 1BSBA 3G4S3 1JNQA 1BGSA 3IPTA 2R41A 2GXFA 1D6ZA 2GEXA 2IA7A 3SOAA 2ZL8A 5LC6A 4N6NB 2QGUA 3DGOA 3UJMA 3CCV3 1SQWA 1B2XA 4KFFA 3WA2X 1RGLA 1UDII 1LOYA 2CG0A 5LC7A 3CCM3 1BRNL 5TGNA 3FG1A 2JQ5A 5IG3A 1TFKA 1WTHA 1S723 3SXXA 2RBIA 1GOVA 2K3DA 1DYUA 4OVMA 5CLKA 1VQ83 1IVVA 1CYVA 3CCJ3 1NB5I 2QIYA 2XSHB 1EKMA 1U8CB 3DM8A 4WWUC 5IG4A 1JZDA 1N5PA 2BHMA 1JKGB 4CJNA 2CFWA 3NM2A 2CIUA 4JRFA 4BIRA 4LGQA 3KIIA 2CFGA 3S67A 1US1A 2R4IA 7STDA 4RNYA 2BIRA 2QEX3 1RLSA 1FGRA 2CFKA 2Q07A 2ZHXB 3FF0A 4FMDA 1B2ZA 4LZIA 1W00A 1EG9B 1UW1A 1LQMB 2ML6A 4HM3B 4NHFA 4ZM8A 3NBJA 2CWUA 4K1UA 1J2BA 2XFSA 1M9GA 4RNZA 4J9AA 2A15A 5IW9A 1AVLA 1IV9A 4CDLA 1RRHA 3CCE3 3O8YA 4XBXA 4MJDA 2E2VA 2CHCA 1UCIA 1BSDA 1T5YA 3DUKA 1QJGA 1Y4KA 3V92A 1CYUA 5G2GA 3BNEA 3OX9A 1X1WA 1RN4A 3GZXB 3K63A 3G8ZA 3V99A 5IG5A 3B7CA 1BRGA 1LNIA 1WNHA 2IUKA 1C54A 1AY7A 2F4YA 1B2UA 4HM7B 4LSOA 3HI7A 3EQQB 2JDIH 3EC9A 5IENA 1IU7A 4I5QA 4J5GA 2ZA4A 3D4AA 3OW22 2FNQA 1FW7A 1V74A 2WO0A 1RKYA 1IT8A 1K41A 3S28A 3JUPA 3NQZA 5KP4A 1RGAA 1QVF2 3CXC2 3OWYA 3MSOA 3PZWA 4EXRA 5BU4A 4HYZA 1Z1SA 5KP3A 3IJEB 2B1XB 3NX0A 3AMOB 3Q2PA 3LH4A 3PXMA 2AAEA 2KF3A 3DGYA 4Q53A 1VZZA 1A90A 1X1YA 1FGOA 1UI8A 3BNCA 1LOVA 1QAFA 3JVCA 1E3VA 1JRQA 3FSDA 2WGQA 3FCSB 1BRHA 4AEQA 2IUJA 2E2UA 3TDGA 3URPA 1O7GB 5ELUA 2H0HA 3MYTA 3VSYA 1O7HB 3LTBA 5JPUA 3QK9A 1VQ43 1ROAA 3M8CA 1OGZA 2BMRB 1C7HA 3K0ZA 2SBLA 1VQO3 3Q3FA 5FGOA 3CU3A 1RNTA 2YFLB 2L1SA 1G0TA 3GZYB 4FCMA 2OWPA 2PNCA 2B24B 4KFEA 3CME3 1UI7A 1GD3A 3QRDA 1DETA 2F86B 3OV4A 3KCHA 1W6CA 4NREA 3U97A 3X40A 1OACA 3GRDA 1GMPA 3GAXA 3X3ZA 1MWTA 3KFQC 3CC73 1DMNA 1FZUA 1VQM3 4STDA 1GY6A 5CXOA 1RGEA 1RTUA 2W2CA 1KWIA 1R4YA 2P09A 4O2HA 3X3XA 4K61A 2D1WA 1TP6A 3G713 4ORLA 3LMLA 2INXA 3HK4A 3LYGA 1I0XA 3FG3A 3UL6A 1BNIA 3ROBA 3RDEA 1RNBA 1D6UA 1Q42A 1RDSA 3ZFZA 1ASKA 4WP5A 4EYCA 1FA3A 1FGMA 1RRLA 1ULJB 3EN8A 1B2SA 1O7WB 1UCLA 4GSPA 4WYKA 1LOWA 3CC23 1PU4A 4MMXB 4G1MB 1TFOA 1MWRA 3FZWA 1GD4A 7GSPA 3D5GA 5IEOA 3UB1A 1I2GA 1A2KA 2C11A 2OCTA 3N54B 3WODG 1M1K4 2RSXA 1T2HA 3G6E3 3JUQA 4FCJA 1DVDA 3MG2A 2K0MA 2Z7AA 3H3HA 3DXOA 4HAAA 3WOEB 1W2B2 1UUWB 2CWTA 4AKYA 3EX9A 4FR9A 3FGYA 2W0QA 3GZRA 3F7XA 5IERA 1I2FA 1KSIA 2CK3H 3EBTA 3LZAA 3MPHA 1OH0A 4BTYA 3D5IA 2IYJA 1VQN3 4XB5A 3CCR3 1JN5B 1OF5A 3J7Yd 1M904 1Q40B 3D79A 1NJI4 1X1XA 1VQ93 1HKXA 2MF7A 3CMA3 4EC6A 1YJ93 2MC8A 4BTWA 3HX8A 3F40A 4K1VA 2M7OA 4BL3A 3HIGA 4EV2A 1W2ZA 1W5ZA 2Z6BA 3MWZA 3EBYA 1DMQA 1JBSA 1EQKA 1S5AA 1VQL3 3BNDA 1ZX2A 3GWRA 1FUTA 3WMDA 5RNTA 1HZ1A 3WR2A 1BUQA 3JUMA 1N8R4 2CH9A 3CPOA 3T0UA 1LQGC 1UGHI 1UCKA 2KF4A 2Z76A 4R1KA 3BLZA 3HZPA 2OOVC 2KCDA 4PEJA 1RN1A 1IVWA 5M1AA 1ROVA 3CCQ3 1TU5A 3I0YA 4JF8A 3MG1A 1B2MA 2RGQA 3N9HA 4RZMA 1RGFA 5AEUB 1MWSA 3RGAA 8CHOA 2Z77A 5AEWB 3FKAA 1AVKA 1FGQA 1FUSA 3K9MC 1JJ22 1N9JA 2C4BA 2YFJB 3DMCA 1YI23 1TRQA 5BXQA 2O9UX 3B4PA 1TJDA 1MGRA 1X1UA 1IDPA 3CNXA 1BUJA 1BSAA 2OTL3 3NBRA 1ZS7A 3N8BA 1SPUA 2Y74A 4MMZB 9RNTA 1JB2A 1AV4A 4GL6A 5FW5A 2XF3A 1BNJA 2BO9B 1B20A 1BVIA 1M1XB 4HM2B 4BTXA 3IMAB 4WYKB 1DMMA 1W6YA 3SYUA 1OCVA 1BRJA 3CD63 4XM4A 2CWVA 3F8XA 1UGIA 4OK0A 3OXAA 2CX0A 2P0MA 4EW5A 3MKIA 3BU4A 3SEDA 3STDA 3FH1A 2OQEA 2BU4A 1GOYA 2GBXB 1HYFA 1NU3A 1RGCA 1HU9A 3FG4A 3DGLA 1O7MB 2BMOB 2OOVA 3Q90A 3E99A 4IT7A 3PCSA 4WFOA 5CF1A 4KFDA 3NHXA 2H0IA 4WHAA 7RNTA 3PYJA 4KZ1A 1B27A 5CK6A 1BNEA 1E97A 1YIJ3 1GMQA 4TX4A 1RGGA 1SIHA 4N6MA 4FMAA 1W6GA 2C10A 3KZTA 4R9KA 1IVUA 4DKIA 2F56A 2HMOB 1I2EA 1OPYA 1BAOA 3EB8A 3MHEA 1KD14 1D6YA 5IG0A 1JN5A 1OF5B 3NV0B 3PS8A 3GSPA 4KVHA 1KC84 2UX0A 1CH0A 3G16A 1W4NA 2W6JH 4HVNA 1NB3I 3D9RA 2WGOA 1UCJA 2HMNB 3X42A 2KF6A 4HZ9B 1RSNA 4FMCA 3CCL3 1GMRA 4L7KA 3LT8A 1EUIC 3RNTA 4MMYB 1RGKA 1IQ8A 1QAKA 1V58A 2CKFB 1QMAA 4RNTA 5AYSC 1VQP3 3DZLA 3X41A 3B8LA 2GBWB 1BRSA 4XBTA 2HMLB 3K5TA 3I553 2WOHA 3F14A 2OQEC 1YJW3 5D82A 5DREA 2P0XA 1BNRA 4N6LA 3NBBA 2V1LA 1SIIA 3BIRA 1OGXA 1MNLA 3D3LA 2SARA 3AGNA 3ECFA 1MGWA 3EHCA 3KE7A 1OHPA 1ULIB 4RBNA 1N9EA 1IV7A 4HJLB 3RGRA 5G1KA 2CC3A 5EVHA 4EBGA 4N3VA 1BSEA 1T2IA 4U13A 4QWTA 4L8PA 5ELJA 1JZOA 1Q864 1B21A 2BNGA 1VQ73 1NWWA 5JBSA 1K9M4 1I3IA 5AYRB 1N8QA 3NUVA 3V98A 2W56B 3LOYA 6GSPA 1F8NA 2LQVA 2W03A 5A0OB 3PCRA 4HM4B 5D81A 2F5WA 4MEIA 1YGEA 1WMNA 1VQQA 4O3VA 2CX1A 2CW9A 3S27A 3DGMA 5EEOA 4N6UA 1E3RA 1EEJA 1G96A 3AHWA 3F7SA 3KSPA 2GU3A 2XFTA 3NQYA 4HM8B 3S5CA 3WA3A 2J8XB 3F8HA 2RNTA 3JUNA 3NXJA 4BU4A 4GB5A 2CG1A 1V57A 1R4CA 1RN7A 4HM6B
chains in the Genus database with same CATH topology
3EJVA 3KSED 3JUOA 4O02B 1CQSA 1NDOB 2GU1A 4HKVB 4K90B 3KKGA 2RCDA 4R9LA 5AIHA 1JB4A 1DVCA 4HM5B 4OUQA 2OTJ3 1Q7Y4 1OHOA 4EV5A 3CPW2 1FUWA 3SLUA 3NV0A 2CFLA 1VQ53 3CNMA 2P38A 2XEPA 4H61A 4IPBA 4X2HA 2E2TA 1O7NB 1ZO2A 3EF8A 3NM7A 3Q1CA 5AIFA 1K734 1SJWA 1LNHA 1JB5A 3AMOA 3LTAA 1WMOA 1GS3A 3EN1B 1O7PB 2HMMB 2P05A 2K54A 5DRVA 1U5OA 5IEPA 1Q814 3UL5A 1K8A4 1TIJA 3SVAA 2BMQB 2STDA 2ZDJA 2L4VA 3ALAA 1W01A 1Q40A 4HM0B 1MOLA 4AKZA 2IMJA 1LOXA 4O8SA 1Q824 3L0RA 2XSOB 3WDGB 1WMPA 5IF6A 5D83A 2FXTA 5AIIA 2O3OA 1W02A 3VF1A 4I4KA 3U1WA 2LYXA 3KN4A 3MG3A 4X2OA 4IIAA 4R80A 1VQ63 3T8UA 1CEWI 4XBYA 1QVG2 3B4OA 1YHQ3 4HM1B 3OWUA 1IK3A 2RFRA 4HBRA 3X3YA 2BT3A 5KP1A 2QA43 1IQYA 1WQLB 1W7CA 3CCS3 1PFPA 3OWSA 4XDWA 3SX1A 6STDA 2XRXB 1QALA 4J8TA 5BVBA 3GZBA 1YJN3 4CCVA 5JPPA 2PZVA 3VGNA 2W9PA 2CFDA 5EQLA 3SOYA 1JKGA 5HGRA 3CC43 4N6V0 1OUNA 3LXUX 1JV2B 3BB9A 2FGTA 1STFI 1KQS2 3FF2A 3ER7A 1N5HA 3K7CA 4FMBA 3A76A 3LTDA 1OHSA 3H51A 5AI1A 1EA2A 3T8NA 2F99A 1AR0A 4LMIA 5CF2A 3CCU3 1TUHA 4LEHA 1GY7A 5I97A 3F9SA 2I9WA 2XR8B 1RJOA 1VQK3 2XGNA 2Y73A 4XDVA 2W04A 1LVNA 3PGBA 4FCZA 4R4KA 2XH9A 1A2VA 4N6TA 2WOFA 1GYBA 1IT7A 3FLJA 2D42A 2F98A 2YFIB 1A67A 2GEYA 2KRTA 4H3UA 3LT9A 1YVBI 3WOFB 1UUVB 2W56A 5STDA 5AIGA 1IQXA 4HZBB 2W9QA 4N6OB 1STDA 2HMJB 1IVXA 3UNLA 1GY5A 3DY5A 1FGTA 2YX9A 1NO3A 1LXEA 1ISKA 1YIT3 3S29A 1K28A 2XGLA 1L5GB 2ML5A 3G0KA 2HMKB 3HIIA 3DGNA 2KXGA 3BNBA 3EE1A 3LTCA 4L8OA 3I563 3G4S3 1JNQA 3IPTA 2GXFA 1D6ZA 2GEXA 2IA7A 3SOAA 2ZL8A 5LC6A 4N6NB 2QGUA 3DGOA 3UJMA 3CCV3 1SQWA 4KFFA 3WA2X 2CG0A 5LC7A 3CCM3 5TGNA 3FG1A 2JQ5A 5IG3A 1TFKA 1WTHA 1S723 3SXXA 1DYUA 4OVMA 5CLKA 1VQ83 1IVVA 1CYVA 3CCJ3 1NB5I 2QIYA 2XSHB 1EKMA 1U8CB 3DM8A 4WWUC 5IG4A 1N5PA 2BHMA 1JKGB 2CFWA 3NM2A 2CIUA 4JRFA 4LGQA 3KIIA 2CFGA 3S67A 1US1A 2R4IA 7STDA 4RNYA 2QEX3 1FGRA 2CFKA 2Q07A 3FF0A 4FMDA 4LZIA 1W00A 1EG9B 1UW1A 4HM3B 2ML6A 4ZM8A 4NHFA 3NBJA 2CWUA 4K1UA 1J2BA 2XFSA 1M9GA 4RNZA 4J9AA 2A15A 5IW9A 1AVLA 1IV9A 4CDLA 1RRHA 3CCE3 3O8YA 4XBXA 4MJDA 2E2VA 2CHCA 1T5YA 3DUKA 1QJGA 1Y4KA 3V92A 1CYUA 5G2GA 3BNEA 3OX9A 3GZXB 5IG5A 3K63A 3G8ZA 3B7CA 1WNHA 2IUKA 4HM7B 4LSOA 3HI7A 3EQQB 2JDIH 3EC9A 5IENA 1IU7A 3OW22 2FNQA 1V74A 2WO0A 1RKYA 1IT8A 1K41A 3S28A 3JUPA 3NQZA 5KP4A 1QVF2 3CXC2 3OWYA 3MSOA 3PZWA 4EXRA 4HYZA 1Z1SA 5KP3A 3IJEB 2B1XB 3NX0A 3AMOB 3Q2PA 3LH4A 3PXMA 4Q53A 1VZZA 1A90A 1FGOA 1UI8A 3BNCA 1QAFA 3JVCA 1E3VA 1JRQA 3FSDA 2WGQA 3FCSB 4AEQA 2IUJA 2E2UA 3TDGA 1O7GB 5ELUA 3MYTA 3VSYA 1O7HB 3LTBA 5JPUA 3QK9A 1VQ43 1ROAA 3M8CA 1OGZA 2BMRB 1C7HA 3K0ZA 2SBLA 1VQO3 5FGOA 3CU3A 2YFLB 3GZYB 4FCMA 2OWPA 2PNCA 2B24B 4KFEA 3CME3 1UI7A 1GD3A 3QRDA 2F86B 3OV4A 1W6CA 4NREA 3U97A 3X40A 1OACA 3GRDA 3X3ZA 3GAXA 1VQM3 3CC73 3KFQC 1DMNA 4STDA 1GY6A 5CXOA 2W2CA 1KWIA 4O2HA 2P09A 3X3XA 4K61A 2D1WA 1TP6A 3G713 4ORLA 3LMLA 2INXA 3HK4A 3LYGA 3FG3A 3UL6A 3ROBA 3RDEA 1D6UA 1Q42A 1FA3A 1ASKA 4WP5A 4EYCA 1FGMA 1RRLA 1ULJB 3EN8A 1O7WB 3CC23 4WYKA 1PU4A 4MMXB 4G1MB 1TFOA 3FZWA 1GD4A 5IEOA 3UB1A 1A2KA 2C11A 2OCTA 3N54B 3WODG 1M1K4 2RSXA 3G6E3 3JUQA 4FCJA 1DVDA 3MG2A 2K0MA 2Z7AA 3H3HA 3DXOA 3WOEB 1W2B2 1UUWB 2CWTA 4AKYA 3EX9A 4FR9A 3FGYA 2W0QA 3GZRA 3F7XA 5IERA 1KSIA 2CK3H 3EBTA 3MPHA 3LZAA 1OH0A 4BTYA 1VQN3 4XB5A 3CCR3 1JN5B 1OF5A 3J7Yd 1M904 1Q40B 1NJI4 1VQ93 1HKXA 2MF7A 3CMA3 4EC6A 1YJ93 2MC8A 4BTWA 3HX8A 3F40A 4K1VA 2M7OA 3HIGA 4EV2A 1W2ZA 1W5ZA 2Z6BA 3MWZA 3EBYA 1DMQA 1EQKA 1S5AA 1VQL3 3BNDA 1ZX2A 3GWRA 3WMDA 1BUQA 3JUMA 1N8R4 2CH9A 3CPOA 3T0UA 2Z76A 4R1KA 3BLZA 3HZPA 2OOVC 2KCDA 4PEJA 1IVWA 1ROVA 3CCQ3 1TU5A 3I0YA 4JF8A 3MG1A 2RGQA 3N9HA 4RZMA 5AEUB 3RGAA 8CHOA 2Z77A 5AEWB 3FKAA 1AVKA 1FGQA 3K9MC 1JJ22 1N9JA 2YFJB 3DMCA 1YI23 5BXQA 2O9UX 3B4PA 1IDPA 3CNXA 2OTL3 3NBRA 3N8BA 1SPUA 2Y74A 4MMZB 1JB2A 1AV4A 4GL6A 5FW5A 2XF3A 2BO9B 1M1XB 4HM2B 4BTXA 3IMAB 4WYKB 1DMMA 1W6YA 1OCVA 3CD63 4XM4A 2CWVA 3F8XA 4OK0A 3OXAA 2P0MA 3MKIA 3SEDA 3STDA 3FH1A 2OQEA 2GBXB 1NU3A 1HU9A 3FG4A 3DGLA 1O7MB 2BMOB 2OOVA 3Q90A 3E99A 4IT7A 3PCSA 4WFOA 5CF1A 4KFDA 3NHXA 4WHAA 3PYJA 4KZ1A 5CK6A 1E97A 1YIJ3 4TX4A 1SIHA 4N6MA 4FMAA 1W6GA 2C10A 3KZTA 4R9KA 1IVUA 2HMOB 1OPYA 3EB8A 3MHEA 1KD14 1D6YA 5IG0A 1JN5A 1OF5B 3NV0B 3PS8A 4KVHA 1KC84 2UX0A 3G16A 1W4NA 2W6JH 4HVNA 1NB3I 3D9RA 2WGOA 2HMNB 3X42A 4HZ9B 4FMCA 3CCL3 4L7KA 3LT8A 4MMYB 1IQ8A 1QAKA 2CKFB 1QMAA 5AYSC 1VQP3 3DZLA 3X41A 3B8LA 2GBWB 4XBTA 2HMLB 3K5TA 3I553 2WOHA 3F14A 2OQEC 1YJW3 5D82A 5DREA 2P0XA 4N6LA 3NBBA 2V1LA 1SIIA 1OGXA 1MNLA 3D3LA 3ECFA 3EHCA 3KE7A 1OHPA 1ULIB 4RBNA 1N9EA 1IV7A 4HJLB 3RGRA 2CC3A 5EVHA 4EBGA 4N3VA 4U13A 4QWTA 4L8PA 5ELJA 1Q864 1VQ73 2BNGA 1NWWA 5JBSA 1K9M4 5AYRB 1N8QA 3NUVA 3V98A 2W56B 3LOYA 1F8NA 2LQVA 2W03A 5A0OB 3PCRA 4HM4B 5D81A 4MEIA 1YGEA 1WMNA 4O3VA 2CW9A 3S27A 3DGMA 5EEOA 4N6UA 1E3RA 3KSPA 1G96A 3NQYA 3F7SA 2GU3A 2XFTA 4HM8B 3S5CA 3WA3A 3F8HA 3JUNA 3NXJA 4GB5A 2CG1A 3V99A 1R4CA 1RN7A 4HM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7G B;  3CNX A;  3EJV A;  1UUV B;  3JUO A;  5STD A;  1CQS A;  1NDO B;  3MYT A;  4HKV B;  5AIG A;  3NBR A;  3VSY A;  3KKG A;  5BVB A;  1O7H B;  5JPU A;  2RCD A;  4HZB B;  1STD A;  4R9L A;  5AIH A;  2HMJ B;  1JB2 A;  5FW5 A;  1JB4 A;  3UNL A;  3M8C A;  1GY5 A;  1OGZ A;  2BMR B;  4HM5 B;  1C7H A;  3K0Z A;  4HM2 B;  4OUQ A;  4WYK B;  1OHO A;  1DMM A;  1W6Y A;  1ISK A;  1OCV A;  3NV0 A;  3G0K A;  4XM4 A;  2HMK B;  3CNM A;  3F8X A;  3CU3 A;  4X2H A;  3OXA A;  1O7N B;  1ZO2 A;  2YFL B;  3EF8 A;  5AIF A;  4L8O A;  1SJW A;  3GZY B;  3MKI A;  4FCM A;  2OWP A;  3SED A;  2B24 B;  3STD A;  1JB5 A;  3FH1 A;  3IPT A;  3EN1 B;  1GS3 A;  2GXF A;  2F86 B;  2GBX B;  1O7P B;  2HMM B;  2GEX A;  1NU3 A;  3OV4 A;  3SOA A;  2K54 A;  5DRV A;  1O7M B;  2BMO B;  1U5O A;  3E99 A;  3Q90 A;  5IEP A;  3GRD A;  5CF1 A;  1DMN A;  2QGU A;  3NHX A;  4STD A;  1GY6 A;  3UJM A;  5CXO A;  2W2C A;  2BMQ B;  2STD A;  5CK6 A;  1W01 A;  1E97 A;  1Q40 A;  4HM0 B;  2IMJ A;  1TP6 A;  5TGN A;  2JQ5 A;  5IG3 A;  2XSO B;  4ORL A;  2INX A;  3HK4 A;  3LYG A;  5IF6 A;  5D83 A;  5AII A;  3KZT A;  4OVM A;  4R9K A;  3ROB A;  5CLK A;  1Q42 A;  1W02 A;  1ASK A;  2HMO B;  4WP5 A;  2QIY A;  2XSH B;  1ULJ B;  1OPY A;  3DM8 A;  1O7W B;  3EN8 A;  3MHE A;  4I4K A;  4WWU C;  4WYK A;  5IG0 A;  5IG4 A;  1JKG B;  1JN5 A;  1OF5 B;  3NV0 B;  3MG3 A;  4KVH A;  4X2O A;  3NM2 A;  4IIA A;  2UX0 A;  4LGQ A;  3T8U A;  3FZW A;  3G16 A;  4XBY A;  4HVN A;  3B4O A;  5IEO A;  3D9R A;  2R4I A;  2HMN B;  1A2K A;  4HM1 B;  7STD A;  3OWU A;  4HZ9 B;  2RFR A;  5KP1 A;  3FF0 A;  1WQL B;  3JUQ A;  4FCJ A;  4L7K A;  3MG2 A;  1W00 A;  1EG9 B;  2Z7A A;  3H3H A;  3DXO A;  3OWS A;  4HM3 B;  4XDW A;  1UUW B;  6STD A;  2CKF B;  1QMA A;  2XRX B;  3EX9 A;  4J8T A;  3DZL A;  3FGY A;  3GZB A;  3GZR A;  3F7X A;  4K1U A;  4J9A A;  2A15 A;  5IER A;  3B8L A;  2GBW B;  3EBT A;  3LZA A;  5JPP A;  1OH0 A;  2PZV A;  3VGN A;  4CDL A;  4XBX A;  4XBT A;  4XB5 A;  2HML B;  4MJD A;  3SOY A;  3F14 A;  2CHC A;  1JN5 B;  1JKG A;  1OF5 A;  5HGR A;  1Q40 B;  1OUN A;  3DUK A;  1QJG A;  5D82 A;  5DRE A;  1HKX A;  5G2G A;  3OX9 A;  3GZX B;  3BB9 A;  5IG5 A;  3G8Z A;  3HX8 A;  3F40 A;  4K1V A;  3B7C A;  1OGX A;  3FF2 A;  3ER7 A;  3ECF A;  3K7C A;  3A76 A;  3EHC A;  3KE7 A;  4HM7 B;  1OHP A;  3EQQ B;  1ULI B;  1OHS A;  3EC9 A;  3EBY A;  1DMQ A;  3H51 A;  5AI1 A;  5IEN A;  1EA2 A;  1S5A A;  2F99 A;  4HJL B;  3T8N A;  1AR0 A;  4LMI A;  3RGR A;  5CF2 A;  1TUH A;  1ZX2 A;  3GWR A;  4N3V A;  4LEH A;  5EVH A;  1GY7 A;  3WMD A;  4U13 A;  1BUQ A;  3JUM A;  1K41 A;  3F9S A;  3JUP A;  4L8P A;  2I9W A;  5KP4 A;  2XR8 B;  3CPO A;  3OWY A;  2BNG A;  3MSO A;  2Z76 A;  1Z1S A;  1NWW A;  3BLZ A;  3HZP A;  4R1K A;  5KP3 A;  2B1X B;  4PEJ A;  3NUV A;  4XDV A;  3I0Y A;  4HM4 B;  4Q53 A;  5D81 A;  3MG1 A;  2RGQ A;  1VZZ A;  4RZM A;  1GYB A;  5AEU B;  3FLJ A;  3RGA A;  8CHO A;  1E3R A;  2Z77 A;  3KSP A;  5AEW B;  3F7S A;  3FKA A;  4HM8 B;  1E3V A;  3S5C A;  2F98 A;  3F8H A;  3FSD A;  2YFJ B;  3DMC A;  2YFI B;  3JUN A;  3NXJ A;  5BXQ A;  2GEY A;  3B4P A;  4GB5 A;  1IDP A;  4H3U A;  4HM6 B; 
#chains in the Genus database with same CATH topology
 3EJV A;  3KSE D;  1RCK A;  3JUO A;  4O02 B;  1CQS A;  1NDO B;  2GU1 A;  4HKV B;  4K90 B;  5HOH A;  2UUG C;  3AGO A;  3KKG A;  2RCD A;  4R9L A;  5AIH A;  1GOU A;  1TTO A;  1JB4 A;  4KT3 B;  1RGH A;  1A2P A;  1DVC A;  4HM5 B;  4LYL B;  4OUQ A;  4NPB A;  2OTJ 3;  1Q7Y 4;  1OHO A;  1I70 A;  4EV5 A;  3CPW 2;  1FUW A;  1YVS A;  3SLU A;  3NV0 A;  2CFL A;  1VQ5 3;  3CNM A;  2P38 A;  2XEP A;  4H61 A;  2F5M A;  4IPB A;  2E2T A;  1O7N B;  1ZO2 A;  3EF8 A;  3NM7 A;  3Q1C A;  4X2H A;  5AIF A;  1K73 4;  1SJW A;  3ZG5 A;  2GSP A;  1LNH A;  1JB5 A;  1SAR A;  3AMO A;  3LTA A;  1WMO A;  1GS3 A;  3EN1 B;  1O7P B;  2HMM B;  2P05 A;  2K54 A;  5DRV A;  1U5O A;  5IEP A;  1Q81 4;  3UL5 A;  1K8A 4;  1TIJ A;  1JBT A;  3SVA A;  2BMQ B;  2STD A;  2ZDJ A;  2L4V A;  3ALA A;  1IYY A;  1W01 A;  1Q40 A;  4HM0 B;  1MOL A;  4AKZ A;  2IMJ A;  1LOX A;  1PYL A;  4O8S A;  3ZG0 A;  3L0R A;  1Q82 4;  2H0G A;  2XSO B;  1RHL A;  1WMP A;  3WDG B;  5IF6 A;  5D83 A;  1T3B A;  2FXT A;  5AII A;  3DH2 A;  2O3O A;  1W02 A;  3VF1 A;  4I4K A;  3U1W A;  5BIR A;  1G02 A;  1BRK A;  2LYX A;  3KN4 A;  2AAD A;  3MG3 A;  1DE3 A;  4X2O A;  4IIA A;  4R80 A;  1VQ6 3;  6RNT A;  3T8U A;  1CEW I;  1UUG B;  4XBY A;  4BL2 A;  1QVG 2;  3B4O A;  1YHQ 3;  4HM1 B;  1BU4 A;  3OWU A;  1IK3 A;  2RFR A;  4HBR A;  3X3Y A;  1YNV X;  2BT3 A;  5KP1 A;  8RNT A;  1IQY A;  1WQL B;  1W7C A;  3CCS 3;  2QA4 3;  1PFP A;  2UGI A;  3OWS A;  4XDW A;  2IY2 A;  1BNS A;  3SX1 A;  6STD A;  2XRX B;  1QAL A;  4J8T A;  5BVB A;  3GZB A;  4GHO A;  1YJN 3;  4CCV A;  5JPP A;  2PZV A;  3VGN A;  1BNG A;  4ILF A;  2W9P A;  2CFD A;  5EQL A;  3SOY A;  1B3S A;  1I0V A;  1BOX A;  1JKG A;  5HGR A;  3CC4 3;  4N6V 0;  1OUN A;  5G1L A;  3LXU X;  1JV2 B;  3BB9 A;  2FGT A;  2KAA A;  1NNV A;  1STF I;  1KQS 2;  1BIR A;  1LRA A;  3FF2 A;  3ER7 A;  1N5H A;  3K7C A;  4FMB A;  1MWU A;  1BRI A;  3A76 A;  3LTD A;  1OHS A;  2HOH A;  3H51 A;  5AI1 A;  1I3F A;  1EA2 A;  1RMS A;  3T8N A;  2F99 A;  1AR0 A;  4LMI A;  5CF2 A;  3CCU 3;  1TUH A;  4LEH A;  5GSP A;  1GY7 A;  5I97 A;  1PY3 A;  3F9S A;  5M18 A;  2I9W A;  2XR8 B;  1YGW A;  4CPK A;  1RJO A;  1VQK 3;  2XGN A;  2Y73 A;  1GSP A;  4XDV A;  2W04 A;  3AHS A;  1RCL A;  1LVN A;  3PGB A;  3WHO A;  1FYS A;  4FCZ A;  4R4K A;  1BSC A;  1JBR A;  1TRP A;  2XH9 A;  1A2V A;  4N6T A;  2WOF A;  1GYB A;  1IT7 A;  3FLJ A;  2D42 A;  1BNF A;  4J5K A;  2F98 A;  1Q9E A;  2YFI B;  1A67 A;  2GEY A;  2KRT A;  4H3U A;  3LT9 A;  1YVB I;  3WOF B;  1UUV B;  2W56 A;  5STD A;  1Q7H A;  5AIG A;  1IQX A;  4HZB B;  2W9Q A;  4N6O B;  1STD A;  3A5E A;  2HMJ B;  1IVX A;  3UNL A;  1GY5 A;  3DY5 A;  1FGT A;  2YX9 A;  1NO3 A;  1I8V A;  1LXE A;  1ISK A;  1AQZ A;  1YIT 3;  3S29 A;  1K28 A;  2XGL A;  3HOH A;  1L5G B;  1ZGX A;  2ML5 A;  3G0K A;  2HMK B;  3HII A;  1BAN A;  2KF5 A;  3DGN A;  4HOH A;  5M19 A;  2KXG A;  3BNB A;  3EE1 A;  3LTC A;  4L8O A;  3I56 3;  1BSB A;  3G4S 3;  1JNQ A;  1BGS A;  3IPT A;  2R41 A;  2GXF A;  1D6Z A;  2GEX A;  2IA7 A;  3SOA A;  2ZL8 A;  5LC6 A;  4N6N B;  2QGU A;  3DGO A;  3UJM A;  3CCV 3;  1SQW A;  1B2X A;  4KFF A;  3WA2 X;  1RGL A;  1UDI I;  1LOY A;  2CG0 A;  5LC7 A;  3CCM 3;  1BRN L;  5TGN A;  3FG1 A;  2JQ5 A;  5IG3 A;  1TFK A;  1WTH A;  1S72 3;  3SXX A;  2RBI A;  1GOV A;  2K3D A;  1DYU A;  4OVM A;  5CLK A;  1VQ8 3;  1IVV A;  1CYV A;  3CCJ 3;  1NB5 I;  2QIY A;  2XSH B;  1EKM A;  1U8C B;  3DM8 A;  4WWU C;  5IG4 A;  1JZD A;  1N5P A;  2BHM A;  1JKG B;  4CJN A;  2CFW A;  3NM2 A;  2CIU A;  4JRF A;  4BIR A;  4LGQ A;  3KII A;  2CFG A;  3S67 A;  1US1 A;  2R4I A;  7STD A;  4RNY A;  2BIR A;  2QEX 3;  1RLS A;  1FGR A;  2CFK A;  2Q07 A;  2ZHX B;  3FF0 A;  4FMD A;  1B2Z A;  4LZI A;  1W00 A;  1EG9 B;  1UW1 A;  1LQM B;  2ML6 A;  4HM3 B;  4NHF A;  4ZM8 A;  3NBJ A;  2CWU A;  4K1U A;  1J2B A;  2XFS A;  1M9G A;  4RNZ A;  4J9A A;  2A15 A;  5IW9 A;  1AVL A;  1IV9 A;  4CDL A;  1RRH A;  3CCE 3;  3O8Y A;  4XBX A;  4MJD A;  2E2V A;  2CHC A;  1UCI A;  1BSD A;  1T5Y A;  3DUK A;  1QJG A;  1Y4K A;  3V92 A;  1CYU A;  5G2G A;  3BNE A;  3OX9 A;  1X1W A;  1RN4 A;  3GZX B;  3K63 A;  3G8Z A;  3V99 A;  5IG5 A;  3B7C A;  1BRG A;  1LNI A;  1WNH A;  2IUK A;  1C54 A;  1AY7 A;  2F4Y A;  1B2U A;  4HM7 B;  4LSO A;  3HI7 A;  3EQQ B;  2JDI H;  3EC9 A;  5IEN A;  1IU7 A;  4I5Q A;  4J5G A;  2ZA4 A;  3D4A A;  3OW2 2;  2FNQ A;  1FW7 A;  1V74 A;  2WO0 A;  1RKY A;  1IT8 A;  1K41 A;  3S28 A;  3JUP A;  3NQZ A;  5KP4 A;  1RGA A;  1QVF 2;  3CXC 2;  3OWY A;  3MSO A;  3PZW A;  4EXR A;  5BU4 A;  4HYZ A;  1Z1S A;  5KP3 A;  3IJE B;  2B1X B;  3NX0 A;  3AMO B;  3Q2P A;  3LH4 A;  3PXM A;  2AAE A;  2KF3 A;  3DGY A;  4Q53 A;  1VZZ A;  1A90 A;  1X1Y A;  1FGO A;  1UI8 A;  3BNC A;  1LOV A;  1QAF A;  3JVC A;  1E3V A;  1JRQ A;  3FSD A;  2WGQ A;  3FCS B;  1BRH A;  4AEQ A;  2IUJ A;  2E2U A;  3TDG A;  3URP A;  1O7G B;  5ELU A;  2H0H A;  3MYT A;  3VSY A;  1O7H B;  3LTB A;  5JPU A;  3QK9 A;  1VQ4 3;  1ROA A;  3M8C A;  1OGZ A;  2BMR B;  1C7H A;  3K0Z A;  2SBL A;  1VQO 3;  3Q3F A;  5FGO A;  3CU3 A;  1RNT A;  2YFL B;  2L1S A;  1G0T A;  3GZY B;  4FCM A;  2OWP A;  2PNC A;  2B24 B;  4KFE A;  3CME 3;  1UI7 A;  1GD3 A;  3QRD A;  1DET A;  2F86 B;  3OV4 A;  3KCH A;  1W6C A;  4NRE A;  3U97 A;  3X40 A;  1OAC A;  3GRD A;  1GMP A;  3GAX A;  3X3Z A;  1MWT A;  3KFQ C;  3CC7 3;  1DMN A;  1FZU A;  1VQM 3;  4STD A;  1GY6 A;  5CXO A;  1RGE A;  1RTU A;  2W2C A;  1KWI A;  1R4Y A;  2P09 A;  4O2H A;  3X3X A;  4K61 A;  2D1W A;  1TP6 A;  3G71 3;  4ORL A;  3LML A;  2INX A;  3HK4 A;  3LYG A;  1I0X A;  3FG3 A;  3UL6 A;  1BNI A;  3ROB A;  3RDE A;  1RNB A;  1D6U A;  1Q42 A;  1RDS A;  3ZFZ A;  1ASK A;  4WP5 A;  4EYC A;  1FA3 A;  1FGM A;  1RRL A;  1ULJ B;  3EN8 A;  1B2S A;  1O7W B;  1UCL A;  4GSP A;  4WYK A;  1LOW A;  3CC2 3;  1PU4 A;  4MMX B;  4G1M B;  1TFO A;  1MWR A;  3FZW A;  1GD4 A;  7GSP A;  3D5G A;  5IEO A;  3UB1 A;  1I2G A;  1A2K A;  2C11 A;  2OCT A;  3N54 B;  3WOD G;  1M1K 4;  2RSX A;  1T2H A;  3G6E 3;  3JUQ A;  4FCJ A;  1DVD A;  3MG2 A;  2K0M A;  2Z7A A;  3H3H A;  3DXO A;  4HAA A;  3WOE B;  1W2B 2;  1UUW B;  2CWT A;  4AKY A;  3EX9 A;  4FR9 A;  3FGY A;  2W0Q A;  3GZR A;  3F7X A;  5IER A;  1I2F A;  1KSI A;  2CK3 H;  3EBT A;  3LZA A;  3MPH A;  1OH0 A;  4BTY A;  3D5I A;  2IYJ A;  1VQN 3;  4XB5 A;  3CCR 3;  1JN5 B;  1OF5 A;  3J7Y d;  1M90 4;  1Q40 B;  3D79 A;  1NJI 4;  1X1X A;  1VQ9 3;  1HKX A;  2MF7 A;  3CMA 3;  4EC6 A;  1YJ9 3;  2MC8 A;  4BTW A;  3HX8 A;  3F40 A;  4K1V A;  2M7O A;  4BL3 A;  3HIG A;  4EV2 A;  1W2Z A;  1W5Z A;  2Z6B A;  3MWZ A;  3EBY A;  1DMQ A;  1JBS A;  1EQK A;  1S5A A;  1VQL 3;  3BND A;  1ZX2 A;  3GWR A;  1FUT A;  3WMD A;  5RNT A;  1HZ1 A;  3WR2 A;  1BUQ A;  3JUM A;  1N8R 4;  2CH9 A;  3CPO A;  3T0U A;  1LQG C;  1UGH I;  1UCK A;  2KF4 A;  2Z76 A;  4R1K A;  3BLZ A;  3HZP A;  2OOV C;  2KCD A;  4PEJ A;  1RN1 A;  1IVW A;  5M1A A;  1ROV A;  3CCQ 3;  1TU5 A;  3I0Y A;  4JF8 A;  3MG1 A;  1B2M A;  2RGQ A;  3N9H A;  4RZM A;  1RGF A;  5AEU B;  1MWS A;  3RGA A;  8CHO A;  2Z77 A;  5AEW B;  3FKA A;  1AVK A;  1FGQ A;  1FUS A;  3K9M C;  1JJ2 2;  1N9J A;  2C4B A;  2YFJ B;  3DMC A;  1YI2 3;  1TRQ A;  5BXQ A;  2O9U X;  3B4P A;  1TJD A;  1MGR A;  1X1U A;  1IDP A;  3CNX A;  1BUJ A;  1BSA A;  2OTL 3;  3NBR A;  1ZS7 A;  3N8B A;  1SPU A;  2Y74 A;  4MMZ B;  9RNT A;  1JB2 A;  1AV4 A;  4GL6 A;  5FW5 A;  2XF3 A;  1BNJ A;  2BO9 B;  1B20 A;  1BVI A;  1M1X B;  4HM2 B;  4BTX A;  3IMA B;  4WYK B;  1DMM A;  1W6Y A;  3SYU A;  1OCV A;  1BRJ A;  3CD6 3;  4XM4 A;  2CWV A;  3F8X A;  1UGI A;  4OK0 A;  3OXA A;  2CX0 A;  2P0M A;  4EW5 A;  3MKI A;  3BU4 A;  3SED A;  3STD A;  3FH1 A;  2OQE A;  2BU4 A;  1GOY A;  2GBX B;  1HYF A;  1NU3 A;  1RGC A;  1HU9 A;  3FG4 A;  3DGL A;  1O7M B;  2BMO B;  2OOV A;  3Q90 A;  3E99 A;  4IT7 A;  3PCS A;  4WFO A;  5CF1 A;  4KFD A;  3NHX A;  2H0I A;  4WHA A;  7RNT A;  3PYJ A;  4KZ1 A;  1B27 A;  5CK6 A;  1BNE A;  1E97 A;  1YIJ 3;  1GMQ A;  4TX4 A;  1RGG A;  1SIH A;  4N6M A;  4FMA A;  1W6G A;  2C10 A;  3KZT A;  4R9K A;  1IVU A;  4DKI A;  2F56 A;  2HMO B;  1I2E A;  1OPY A;  1BAO A;  3EB8 A;  3MHE A;  1KD1 4;  1D6Y A;  5IG0 A;  1JN5 A;  1OF5 B;  3NV0 B;  3PS8 A;  3GSP A;  4KVH A;  1KC8 4;  2UX0 A;  1CH0 A;  3G16 A;  1W4N A;  2W6J H;  4HVN A;  1NB3 I;  3D9R A;  2WGO A;  1UCJ A;  2HMN B;  3X42 A;  2KF6 A;  4HZ9 B;  1RSN A;  4FMC A;  3CCL 3;  1GMR A;  4L7K A;  3LT8 A;  1EUI C;  3RNT A;  4MMY B;  1RGK A;  1IQ8 A;  1QAK A;  1V58 A;  2CKF B;  1QMA A;  4RNT A;  5AYS C;  1VQP 3;  3DZL A;  3X41 A;  3B8L A;  2GBW B;  1BRS A;  4XBT A;  2HML B;  3K5T A;  3I55 3;  2WOH A;  3F14 A;  2OQE C;  1YJW 3;  5D82 A;  5DRE A;  2P0X A;  1BNR A;  4N6L A;  3NBB A;  2V1L A;  1SII A;  3BIR A;  1OGX A;  1MNL A;  3D3L A;  2SAR A;  3AGN A;  3ECF A;  1MGW A;  3EHC A;  3KE7 A;  1OHP A;  1ULI B;  4RBN A;  1N9E A;  1IV7 A;  4HJL B;  3RGR A;  5G1K A;  2CC3 A;  5EVH A;  4EBG A;  4N3V A;  1BSE A;  1T2I A;  4U13 A;  4QWT A;  4L8P A;  5ELJ A;  1JZO A;  1Q86 4;  1B21 A;  2BNG A;  1VQ7 3;  1NWW A;  5JBS A;  1K9M 4;  1I3I A;  5AYR B;  1N8Q A;  3NUV A;  3V98 A;  2W56 B;  3LOY A;  6GSP A;  1F8N A;  2LQV A;  2W03 A;  5A0O B;  3PCR A;  4HM4 B;  5D81 A;  2F5W A;  4MEI A;  1YGE A;  1WMN A;  1VQQ A;  4O3V A;  2CX1 A;  2CW9 A;  3S27 A;  3DGM A;  5EEO A;  4N6U A;  1E3R A;  1EEJ A;  1G96 A;  3AHW A;  3F7S A;  3KSP A;  2GU3 A;  2XFT A;  3NQY A;  4HM8 B;  3S5C A;  3WA3 A;  2J8X B;  3F8H A;  2RNT A;  3JUN A;  3NXJ A;  4BU4 A;  4GB5 A;  2CG1 A;  1V57 A;  1R4C A;  1RN7 A;  4HM6 B; 
#chains in the Genus database with same CATH homology
 3EJV A;  3KSE D;  3JUO A;  4O02 B;  1CQS A;  1NDO B;  2GU1 A;  4HKV B;  4K90 B;  3KKG A;  2RCD A;  4R9L A;  5AIH A;  1JB4 A;  1DVC A;  4HM5 B;  4OUQ A;  2OTJ 3;  1Q7Y 4;  1OHO A;  4EV5 A;  3CPW 2;  1FUW A;  3SLU A;  3NV0 A;  2CFL A;  1VQ5 3;  3CNM A;  2P38 A;  2XEP A;  4H61 A;  4IPB A;  4X2H A;  2E2T A;  1O7N B;  1ZO2 A;  3EF8 A;  3NM7 A;  3Q1C A;  5AIF A;  1K73 4;  1SJW A;  1LNH A;  1JB5 A;  3AMO A;  3LTA A;  1WMO A;  1GS3 A;  3EN1 B;  1O7P B;  2HMM B;  2P05 A;  2K54 A;  5DRV A;  1U5O A;  5IEP A;  1Q81 4;  3UL5 A;  1K8A 4;  1TIJ A;  3SVA A;  2BMQ B;  2STD A;  2ZDJ A;  2L4V A;  3ALA A;  1W01 A;  1Q40 A;  4HM0 B;  1MOL A;  4AKZ A;  2IMJ A;  1LOX A;  4O8S A;  1Q82 4;  3L0R A;  2XSO B;  3WDG B;  1WMP A;  5IF6 A;  5D83 A;  2FXT A;  5AII A;  2O3O A;  1W02 A;  3VF1 A;  4I4K A;  3U1W A;  2LYX A;  3KN4 A;  3MG3 A;  4X2O A;  4IIA A;  4R80 A;  1VQ6 3;  3T8U A;  1CEW I;  4XBY A;  1QVG 2;  3B4O A;  1YHQ 3;  4HM1 B;  3OWU A;  1IK3 A;  2RFR A;  4HBR A;  3X3Y A;  2BT3 A;  5KP1 A;  2QA4 3;  1IQY A;  1WQL B;  1W7C A;  3CCS 3;  1PFP A;  3OWS A;  4XDW A;  3SX1 A;  6STD A;  2XRX B;  1QAL A;  4J8T A;  5BVB A;  3GZB A;  1YJN 3;  4CCV A;  5JPP A;  2PZV A;  3VGN A;  2W9P A;  2CFD A;  5EQL A;  3SOY A;  1JKG A;  5HGR A;  3CC4 3;  4N6V 0;  1OUN A;  3LXU X;  1JV2 B;  3BB9 A;  2FGT A;  1STF I;  1KQS 2;  3FF2 A;  3ER7 A;  1N5H A;  3K7C A;  4FMB A;  3A76 A;  3LTD A;  1OHS A;  3H51 A;  5AI1 A;  1EA2 A;  3T8N A;  2F99 A;  1AR0 A;  4LMI A;  5CF2 A;  3CCU 3;  1TUH A;  4LEH A;  1GY7 A;  5I97 A;  3F9S A;  2I9W A;  2XR8 B;  1RJO A;  1VQK 3;  2XGN A;  2Y73 A;  4XDV A;  2W04 A;  1LVN A;  3PGB A;  4FCZ A;  4R4K A;  2XH9 A;  1A2V A;  4N6T A;  2WOF A;  1GYB A;  1IT7 A;  3FLJ A;  2D42 A;  2F98 A;  2YFI B;  1A67 A;  2GEY A;  2KRT A;  4H3U A;  3LT9 A;  1YVB I;  3WOF B;  1UUV B;  2W56 A;  5STD A;  5AIG A;  1IQX A;  4HZB B;  2W9Q A;  4N6O B;  1STD A;  2HMJ B;  1IVX A;  3UNL A;  1GY5 A;  3DY5 A;  1FGT A;  2YX9 A;  1NO3 A;  1LXE A;  1ISK A;  1YIT 3;  3S29 A;  1K28 A;  2XGL A;  1L5G B;  2ML5 A;  3G0K A;  2HMK B;  3HII A;  3DGN A;  2KXG A;  3BNB A;  3EE1 A;  3LTC A;  4L8O A;  3I56 3;  3G4S 3;  1JNQ A;  3IPT A;  2GXF A;  1D6Z A;  2GEX A;  2IA7 A;  3SOA A;  2ZL8 A;  5LC6 A;  4N6N B;  2QGU A;  3DGO A;  3UJM A;  3CCV 3;  1SQW A;  4KFF A;  3WA2 X;  2CG0 A;  5LC7 A;  3CCM 3;  5TGN A;  3FG1 A;  2JQ5 A;  5IG3 A;  1TFK A;  1WTH A;  1S72 3;  3SXX A;  1DYU A;  4OVM A;  5CLK A;  1VQ8 3;  1IVV A;  1CYV A;  3CCJ 3;  1NB5 I;  2QIY A;  2XSH B;  1EKM A;  1U8C B;  3DM8 A;  4WWU C;  5IG4 A;  1N5P A;  2BHM A;  1JKG B;  2CFW A;  3NM2 A;  2CIU A;  4JRF A;  4LGQ A;  3KII A;  2CFG A;  3S67 A;  1US1 A;  2R4I A;  7STD A;  4RNY A;  2QEX 3;  1FGR A;  2CFK A;  2Q07 A;  3FF0 A;  4FMD A;  4LZI A;  1W00 A;  1EG9 B;  1UW1 A;  4HM3 B;  2ML6 A;  4ZM8 A;  4NHF A;  3NBJ A;  2CWU A;  4K1U A;  1J2B A;  2XFS A;  1M9G A;  4RNZ A;  4J9A A;  2A15 A;  5IW9 A;  1AVL A;  1IV9 A;  4CDL A;  1RRH A;  3CCE 3;  3O8Y A;  4XBX A;  4MJD A;  2E2V A;  2CHC A;  1T5Y A;  3DUK A;  1QJG A;  1Y4K A;  3V92 A;  1CYU A;  5G2G A;  3BNE A;  3OX9 A;  3GZX B;  5IG5 A;  3K63 A;  3G8Z A;  3B7C A;  1WNH A;  2IUK A;  4HM7 B;  4LSO A;  3HI7 A;  3EQQ B;  2JDI H;  3EC9 A;  5IEN A;  1IU7 A;  3OW2 2;  2FNQ A;  1V74 A;  2WO0 A;  1RKY A;  1IT8 A;  1K41 A;  3S28 A;  3JUP A;  3NQZ A;  5KP4 A;  1QVF 2;  3CXC 2;  3OWY A;  3MSO A;  3PZW A;  4EXR A;  4HYZ A;  1Z1S A;  5KP3 A;  3IJE B;  2B1X B;  3NX0 A;  3AMO B;  3Q2P A;  3LH4 A;  3PXM A;  4Q53 A;  1VZZ A;  1A90 A;  1FGO A;  1UI8 A;  3BNC A;  1QAF A;  3JVC A;  1E3V A;  1JRQ A;  3FSD A;  2WGQ A;  3FCS B;  4AEQ A;  2IUJ A;  2E2U A;  3TDG A;  1O7G B;  5ELU A;  3MYT A;  3VSY A;  1O7H B;  3LTB A;  5JPU A;  3QK9 A;  1VQ4 3;  1ROA A;  3M8C A;  1OGZ A;  2BMR B;  1C7H A;  3K0Z A;  2SBL A;  1VQO 3;  5FGO A;  3CU3 A;  2YFL B;  3GZY B;  4FCM A;  2OWP A;  2PNC A;  2B24 B;  4KFE A;  3CME 3;  1UI7 A;  1GD3 A;  3QRD A;  2F86 B;  3OV4 A;  1W6C A;  4NRE A;  3U97 A;  3X40 A;  1OAC A;  3GRD A;  3X3Z A;  3GAX A;  1VQM 3;  3CC7 3;  3KFQ C;  1DMN A;  4STD A;  1GY6 A;  5CXO A;  2W2C A;  1KWI A;  4O2H A;  2P09 A;  3X3X A;  4K61 A;  2D1W A;  1TP6 A;  3G71 3;  4ORL A;  3LML A;  2INX A;  3HK4 A;  3LYG A;  3FG3 A;  3UL6 A;  3ROB A;  3RDE A;  1D6U A;  1Q42 A;  1FA3 A;  1ASK A;  4WP5 A;  4EYC A;  1FGM A;  1RRL A;  1ULJ B;  3EN8 A;  1O7W B;  3CC2 3;  4WYK A;  1PU4 A;  4MMX B;  4G1M B;  1TFO A;  3FZW A;  1GD4 A;  5IEO A;  3UB1 A;  1A2K A;  2C11 A;  2OCT A;  3N54 B;  3WOD G;  1M1K 4;  2RSX A;  3G6E 3;  3JUQ A;  4FCJ A;  1DVD A;  3MG2 A;  2K0M A;  2Z7A A;  3H3H A;  3DXO A;  3WOE B;  1W2B 2;  1UUW B;  2CWT A;  4AKY A;  3EX9 A;  4FR9 A;  3FGY A;  2W0Q A;  3GZR A;  3F7X A;  5IER A;  1KSI A;  2CK3 H;  3EBT A;  3MPH A;  3LZA A;  1OH0 A;  4BTY A;  1VQN 3;  4XB5 A;  3CCR 3;  1JN5 B;  1OF5 A;  3J7Y d;  1M90 4;  1Q40 B;  1NJI 4;  1VQ9 3;  1HKX A;  2MF7 A;  3CMA 3;  4EC6 A;  1YJ9 3;  2MC8 A;  4BTW A;  3HX8 A;  3F40 A;  4K1V A;  2M7O A;  3HIG A;  4EV2 A;  1W2Z A;  1W5Z A;  2Z6B A;  3MWZ A;  3EBY A;  1DMQ A;  1EQK A;  1S5A A;  1VQL 3;  3BND A;  1ZX2 A;  3GWR A;  3WMD A;  1BUQ A;  3JUM A;  1N8R 4;  2CH9 A;  3CPO A;  3T0U A;  2Z76 A;  4R1K A;  3BLZ A;  3HZP A;  2OOV C;  2KCD A;  4PEJ A;  1IVW A;  1ROV A;  3CCQ 3;  1TU5 A;  3I0Y A;  4JF8 A;  3MG1 A;  2RGQ A;  3N9H A;  4RZM A;  5AEU B;  3RGA A;  8CHO A;  2Z77 A;  5AEW B;  3FKA A;  1AVK A;  1FGQ A;  3K9M C;  1JJ2 2;  1N9J A;  2YFJ B;  3DMC A;  1YI2 3;  5BXQ A;  2O9U X;  3B4P A;  1IDP A;  3CNX A;  2OTL 3;  3NBR A;  3N8B A;  1SPU A;  2Y74 A;  4MMZ B;  1JB2 A;  1AV4 A;  4GL6 A;  5FW5 A;  2XF3 A;  2BO9 B;  1M1X B;  4HM2 B;  4BTX A;  3IMA B;  4WYK B;  1DMM A;  1W6Y A;  1OCV A;  3CD6 3;  4XM4 A;  2CWV A;  3F8X A;  4OK0 A;  3OXA A;  2P0M A;  3MKI A;  3SED A;  3STD A;  3FH1 A;  2OQE A;  2GBX B;  1NU3 A;  1HU9 A;  3FG4 A;  3DGL A;  1O7M B;  2BMO B;  2OOV A;  3Q90 A;  3E99 A;  4IT7 A;  3PCS A;  4WFO A;  5CF1 A;  4KFD A;  3NHX A;  4WHA A;  3PYJ A;  4KZ1 A;  5CK6 A;  1E97 A;  1YIJ 3;  4TX4 A;  1SIH A;  4N6M A;  4FMA A;  1W6G A;  2C10 A;  3KZT A;  4R9K A;  1IVU A;  2HMO B;  1OPY A;  3EB8 A;  3MHE A;  1KD1 4;  1D6Y A;  5IG0 A;  1JN5 A;  1OF5 B;  3NV0 B;  3PS8 A;  4KVH A;  1KC8 4;  2UX0 A;  3G16 A;  1W4N A;  2W6J H;  4HVN A;  1NB3 I;  3D9R A;  2WGO A;  2HMN B;  3X42 A;  4HZ9 B;  4FMC A;  3CCL 3;  4L7K A;  3LT8 A;  4MMY B;  1IQ8 A;  1QAK A;  2CKF B;  1QMA A;  5AYS C;  1VQP 3;  3DZL A;  3X41 A;  3B8L A;  2GBW B;  4XBT A;  2HML B;  3K5T A;  3I55 3;  2WOH A;  3F14 A;  2OQE C;  1YJW 3;  5D82 A;  5DRE A;  2P0X A;  4N6L A;  3NBB A;  2V1L A;  1SII A;  1OGX A;  1MNL A;  3D3L A;  3ECF A;  3EHC A;  3KE7 A;  1OHP A;  1ULI B;  4RBN A;  1N9E A;  1IV7 A;  4HJL B;  3RGR A;  2CC3 A;  5EVH A;  4EBG A;  4N3V A;  4U13 A;  4QWT A;  4L8P A;  5ELJ A;  1Q86 4;  1VQ7 3;  2BNG A;  1NWW A;  5JBS A;  1K9M 4;  5AYR B;  1N8Q A;  3NUV A;  3V98 A;  2W56 B;  3LOY A;  1F8N A;  2LQV A;  2W03 A;  5A0O B;  3PCR A;  4HM4 B;  5D81 A;  4MEI A;  1YGE A;  1WMN A;  4O3V A;  2CW9 A;  3S27 A;  3DGM A;  5EEO A;  4N6U A;  1E3R A;  3KSP A;  1G96 A;  3NQY A;  3F7S A;  2GU3 A;  2XFT A;  4HM8 B;  3S5C A;  3WA3 A;  3F8H A;  3JUN A;  3NXJ A;  4GB5 A;  2CG1 A;  3V99 A;  1R4C A;  1RN7 A;  4HM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...