1HZ1A

Ribonuclease t1 v16a mutant in complex with mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1hz1A00
3D4AA 1R4YA 1RNBA 1X1XA 1RLSA 3URPA 1UCLA 1HYFA 1I2FA 3RNTA 3WR2A 3AHSA 3SYUA 1I8VA 1TTOA 1A2PA 2BIRA 2KF5A 7RNTA 1B2ZA 1UCKA 1RNTA 1BNEA 1B21A 1MGWA 1UCIA 1BSDA 5BIRA 1RN1A 1GSPA 1BSAA 3GSPA 1JBSA 2F5WA 3AHWA 4BIRA 1B27A 1TRQA 2F4YA 1BGSA 2RBIA 1B2XA 1DETA 1UCJA 1BNJA 3AGNA 3D5IA 2AADA 1FW7A 5GSPA 1BANA 1PYLA 3KCHA 1C54A 1GMRA 2F5MA 1BRHA 1LNIA 3BIRA 1I0XA 1RGAA 1BOXA 1GOYA 2F56A 2RNTA 1IYYA 1BRKA 2ZA4A 1RMSA 4GHOA 5BU4A 1I3IA 3D5GA 4HOHA 2KF3A 1LOVA 1Q9EA 9RNTA 1SARA 1HZ1A 1ZGXA 4GSPA 1BSEA 1I3FA 1RCKA 1GOVA 1X1WA 1B3SA 1RDSA 1JBTA 1RGHA 1BUJA 4BU4A 1RN4A 1FYSA 1BNGA 1BIRA 2BU4A 1BRJA 1T2IA 1BSBA 1BRNL 1B2MA 3A5EA 3HOHA 4J5GA 1BRIA 2C4BA 1I0VA 2HOHA 2GSPA 2KAAA 1RGCA 3Q3FA 1DE3A 3DGYA 1PY3A 1YGWA 1BSCA 1B2UA 1RHLA 4RNTA 1BRGA 1RGLA 3WHOA 1I2EA 1RTUA 4HAAA 1AY7A 1RGFA 1BVIA 5HOHA 1BRSA 1I2GA 6GSPA 1I70A 1MGRA 1YVSA 5RNTA 1T2HA 2AAEA 1GMPA 1RCLA 2KF6A 8RNTA 7GSPA 1RGGA 1RSNA 1BNSA 1X1UA 1GOUA 1RGKA 3AGOA 3BU4A 1FZUA 1AQZA 1B2SA 6RNTA 1GMQA 1LRAA 4J5KA 1FUSA 1LOWA 1RGEA 1X1YA 1B20A 3DH2A 1LOYA 1BNRA 1FUTA 1G02A 1BNFA 1BU4A 2KF4A 1YNVX 1CH0A 1TRPA 1BNIA 1JBRA 2SARA 1BAOA
chains in the Genus database with same CATH superfamily
1E3RA 2XFTA 3KZTA 1GD3A 3DZLA 4WWUC 3UL5A 1R4YA 6STDA 1JB5A 1Z1SA 4OUQA 2R41A 5CF2A 5D83A 1W4NA 3EB8A 1UI8A 1OHSA 1TFKA 4X2OA 3MYTA 5EVHA 3AHSA 3FF0A 1W7CA 4XBYA 3SLUA 1TTOA 2Q07A 2YFJB 7RNTA 1UCKA 2ZL8A 2BMQB 1LOXA 3BNBA 1RNTA 5BXQA 3MG1A 4KT3B 4HM6B 1ROVA 1GY6A 2IUKA 1SQWA 2M7OA 4CCVA 3NM7A 3F8HA 5BIRA 5AEUB 3GSPA 1GS3A 4LMIA 3MKIA 1JBSA 4HM5B 1TRQA 2HMJB 3K9MC 2XGLA 4MJDA 3FH1A 1B2XA 1JKGB 2HMOB 1UCJA 1BNJA 2IY2A 3IMAB 1RJOA 3EQQB 4KZ1A 4O8SA 4EXRA 3CC23 2CHCA 2CWVA 2CC3A 1V58A 5IERA 2P05A 2L1SA 2UUGC 3MG2A 1CQSA 1BRHA 3S28A 1WMNA 4WYKA 1RGAA 1UDII 3WA2X 2RNTA 1UW1A 3EN8A 2P09A 1IVUA 3S67A 1GD4A 1RMSA 2CWUA 1IDPA 1UGIA 3KSPA 5BU4A 3NBBA 3N8BA 2QA43 1SIIA 2OQEA 3WOEB 2KF3A 9RNTA 3S27A 3JUMA 1ZGXA 5LC7A 4R1KA 3LT8A 3NHXA 1W6YA 1TJDA 2W0QA 3PCRA 1B3SA 2BMOB 1D6UA 3E99A 5JPUA 3GZRA 1S723 2W04A 1JN5B 5LC6A 1FYSA 3G0KA 4HM3B 4GL6A 1BRJA 3GWRA 5I97A 4LEHA 1DMQA 4HZ9B 5D81A 3A5EA 3HOHA 2I9WA 1I0VA 4L7KA 1MOLA 1W6CA 4N6OB 5AI1A 3BB9A 3K63A 2KAAA 3MHEA 1O7HB 3DGYA 4CPKA 1PY3A 2UGIA 1Q864 1BSCA 1DMNA 1G96A 2CFGA 3DMCA 3HI7A 4CDLA 1QAFA 1I2EA 3LOYA 1Q824 2YX9A 4HAAA 3CME3 1K734 1BVIA 1SPUA 4R80A 6GSPA 2Z76A 1MGRA 3CPOA 1T2HA 2W6JH 2AAEA 3PGBA 1OH0A 5M1AA 1LQMB 2FGTA 3FKAA 5CLKA 3N9HA 1GOUA 1AVKA 2UX0A 2BNGA 3B4OA 3CCQ3 2CX1A 4DKIA 1YIJ3 3DM8A 3VGNA 4X2HA 2LQVA 1AV4A 3FGYA 5G2GA 1E97A 3GZXB 1D6ZA 1US1A 4NPBA 1Q42A 3PZWA 3RGAA 2XFSA 1LNHA 1N9EA 1DVDA 4H3UA 4L8OA 2Z7AA 3LZAA 3ZFZA 1FA3A 4O3VA 1UUGB 1UUVB 1CYUA 3FZWA 1VQL3 5JPPA 3G4S3 3CCE3 2Y73A 3SVAA 4BTXA 1DMMA 2KXGA 4IT7A 3O8YA 1LQGC 4AKYA 2XGNA 3D4AA 3I553 2W9PA 3NBJA 5ELUA 3T0UA 3QRDA 5IG4A 3X42A 5IEPA 2L4VA 4EV5A 1QALA 1O7MB 1X1XA 3ZG5A 3V98A 1K28A 1M9GA 2YFIB 5AYSC 3MWZA 3N54B 5EQLA 3WA3A 1TP6A 3U97A 3WR2A 1A90A 1I8VA 2BMRB 2KF5A 3EN1B 3T8UA 1LXEA 1B2ZA 1N5HA 4N6MA 4WYKB 1JV2B 2CWTA 3LYGA 2ZDJA 1FGOA 2Z6BA 3LTBA 2MC8A 1KWIA 1MGWA 5CK6A 4KFFA 2XR8B 1IT8A 1OCVA 2YFLB 3WMDA 4BTYA 3CPW2 4FR9A 2F5WA 1O7NB 4BIRA 1WMOA 1B27A 4EBGA 3ALAA 1O7PB 1NO3A 3D5IA 3EBYA 1ZO2A 2HMLB 4LSOA 1NWWA 4IIAA 1J2BA 3JVCA 1U8CB 3QK9A 3FCSB 4R9LA 2OTJ3 3GZYB 3CC43 3S29A 4HJLB 2OOVC 2SBLA 1YJW3 1BOXA 3NQZA 2GU3A 3CCV3 1GY7A 3KIIA 1BRKA 3NXJA 1EQKA 2ZA4A 4JF8A 1JB4A 1Q7HA 1YVBI 4RZMA 5KP1A 5CF1A 3I0YA 3LMLA 5IG3A 1IQYA 2INXA 1HZ1A 2CFKA 4HBRA 1I3FA 3OX9A 1W5ZA 1NJI4 5G1LA 3HK4A 1BUJA 4BU4A 1UUWB 2V1LA 1VQQA 1GY5A 1BNGA 1Q7Y4 3RGRA 2XF3A 2CFLA 1T3BA 2HMKB 1K41A 3HZPA 4N6LA 1BUQA 3LT9A 4HYZA 3S5CA 1N8R4 1IU7A 2PZVA 1VQP3 2HOHA 1R4CA 1IV9A 1W6GA 2GSPA 1RGCA 3Q3FA 4FMCA 1TU5A 1EEJA 2C11A 1YGEA 3OXAA 1RHLA 4RNTA 4HM0B 4PEJA 4N6UA 2P0XA 1AY7A 1RGFA 4ILFA 2QEX3 5ELJA 1VQ53 5D82A 1JZDA 1YVSA 5AIFA 1QMAA 3F40A 4MMYB 1IK3A 1RCLA 2IYJA 7GSPA 1RRLA 1BNSA 3HIIA 3LTDA 1NB3I 3B4PA 2K3DA 1RGKA 2RSXA 3AGOA 3BU4A 3PCSA 2A15A 4H61A 4HM4B 1VQ73 1QVG2 3U1WA 1EUIC 1B2SA 5TGNA 3DGMA 1LRAA 1OGXA 4G1MB 4J5KA 5FGOA 1LOWA 4N6TA 1VQ93 3DH2A 3X3ZA 1N5PA 4O2HA 3ZG0A 3AMOA 1JNQA 1W2B2 3D3LA 2D42A 3JUNA 3SOYA 4EC6A 1LOYA 5A0OB 1BNRA 2RCDA 3NM2A 1YHQ3 4HM8B 2P38A 2E2TA 3A76A 2W2CA 5IEOA 1G02A 5DRVA 2KF4A 1FGMA 1SJWA 3UJMA 4LZIA 2E2VA 2D1WA 5STDA 3WDGB 1KSIA 2GBXB 3CCU3 2K54A 1IV7A 2F98A 1WNHA 1MNLA 3SEDA 3EF8A 3CCS3 1CYVA 1RNBA 4OVMA 5IENA 2WO0A 3OWYA 4HVNA 3URPA 1I2FA 1HKXA 2XSOB 3FLJA 3FF2A 2GXFA 1A2PA 3G8ZA 1AR0A 3G6E3 3FG1A 2WGQA 4N6V0 4FCZA 1OHOA 1L5GB 1D6YA 2CK3H 1UI7A 2LYXA 3UL6A 1RN1A 1M904 1BSAA 3PXMA 2H0GA 3STDA 1RRHA 3LTCA 2F4YA 3CCJ3 1BGSA 3IPTA 3Q1CA 2STDA 1DETA 3CNXA 5GSPA 4EV2A 2Y74A 4LYLB 3NV0A 1DVCA 5BVBA 1N9JA 4U13A 1IQXA 1GMRA 2J8XB 4IPBA 2F5MA 3NQYA 4I4KA 4WP5A 4XBTA 4XDWA 4EW5A 1LNIA 2OOVA 3BIRA 2FXTA 3UNLA 1SIHA 1GOYA 2CFDA 1NDOB 3KSED 1IYYA 4NREA 4TX4A 1Y4KA 5G1KA 3FSDA 1W00A 4CJNA 3F7XA 2HMNB 3I563 3CD63 2QIYA 3M8CA 2F99A 4O02B 3JUOA 1TUHA 4GB5A 1LOVA 1Q9EA 3HX8A 1SARA 4R9KA 4BTWA 2OTL3 1TFOA 3BNDA 3ER7A 2ML5A 4KVHA 4KFEA 1ISKA 2RGQA 1FGRA 1X1WA 1A2KA 3K7CA 1RN7A 2BHMA 3LH4A 3H51A 4HKVB 1ASKA 1C7HA 1T5YA 3X40A 1BIRA 2B1XB 2BU4A 3DUKA 1IVVA 1JZOA 1B2MA 4L8PA 2JQ5A 1PFPA 3KKGA 3B8LA 4J5GA 4WFOA 7STDA 4J9AA 1JB2A 1OF5A 1NU3A 1A2VA 3WOFB 5AIHA 4MMZB 3L0RA 1K9M4 5IW9A 1B2UA 2ZHXB 3ECFA 1IQ8A 2KRTA 2OWPA 1RGLA 2R4IA 3AMOB 2IA7A 2XSHB 1AVLA 4KFDA 3WHOA 4K90B 3NBRA 3KFQC 3WODG 1YJ93 1RTUA 5HOHA 3HIGA 3JUQA 1I70A 1GMPA 2E2UA 3OWUA 3X41A 3KN4A 1RSNA 4JRFA 1U5OA 1QVF2 1WQLB 2MF7A 4RBNA 2CG1A 3BNCA 1F8NA 2C10A 3GRDA 3PYJA 1IT7A 4R4KA 4I5QA 2O9UX 4RNYA 1FZUA 4BL3A 1AQZA 2XRXB 1STFI 3MG3A 2B24B 3BNEA 3K5TA 3LTAA 3K0ZA 1FUSA 3EX9A 1B20A 1MWUA 1S5AA 2CKFB 2W56A 3H3HA 1STDA 3F8XA 3CNMA 2H0HA 8CHOA 3G713 2CIUA 4HM2B 1BNFA 3BLZA 4FMDA 3B7CA 4N3VA 1FGQA 2CH9A 1O7GB 2GU1A 5IG0A 3DY5A 1Q814 2SARA 1BAOA 1VQ83 1JBRA 2CW9A 4XDVA 3CCL3 2XEPA 4ZM8A 1RKYA 3T8NA 1KD14 3EE1A 3ROBA 1RLSA 4K61A 1DYUA 1VQ63 2W9QA 1UCLA 1HYFA 3NV0B 4FMBA 1VQO3 1OGZA 3LXUX 1MWTA 3EBTA 3NX0A 3RNTA 3V99A 3CMA3 1IVWA 3F7SA 3SYUA 3Q90A 1ROAA 3GAXA 1A67A 2BIRA 3SX1A 4WHAA 2GEYA 3RDEA 4XB5A 1OPYA 2CX0A 5CXOA 3DGNA 5DREA 1K8A4 1BNEA 3CU3A 3D79A 3KE7A 1PU4A 2W03A 1FUWA 3VSYA 1GYBA 1B21A 1M1XB 1UCIA 3OWSA 3OW22 1VQM3 1BSDA 1W02A 4QWTA 1Q40A 4N6NB 3TDGA 1GSPA 1OUNA 2WOFA 5AYRB 1NB5I 3Q2PA 1NNVA 1QJGA 3AHWA 2CG0A 1CEWI 2HMMB 2BT3A 2P0MA 4BL2A 3FG4A 2RBIA 2WOHA 3DGLA 2K0MA 3AGNA 3MSOA 4J8TA 1QAKA 3VF1A 3X3XA 2AADA 4FMAA 1FW7A 2OCTA 1BANA 1PYLA 1HU9A 3KCHA 1N8QA 1C54A 2Z77A 3JUPA 5M19A 4HZBB 2GEXA 4FCJA 5AIIA 1MWSA 5IF6A 1I0XA 4HM1B 4K1VA 3SOAA 2F56A 2RFRA 2WGOA 2XH9A 3UB1A 1EG9B 4ORLA 1OF5B 5IG5A 4GHOA 1W01A 3MPHA 4STDA 3X3YA 1I3IA 1O7WB 2CFWA 3D5GA 2OQEC 4HOHA 5JBSA 3D9RA 1FGTA 4GSPA 3EJVA 4OK0A 1JKGA 1BSEA 1RCKA 1ULIB 1GOVA 4MEIA 4RNZA 1M1K4 1RDSA 3J7Yd 1JBTA 1RGHA 3DGOA 1V74A 3IJEB 1RN4A 1WTHA 1YIT3 3GZBA 5FW5A 4LGQA 3SXXA 4NHFA 1T2IA 1BSBA 4XM4A 3FG3A 3CC73 4AKZA 1BRNL 3F14A 2ML6A 3EHCA 1BRIA 2C4BA 2IUJA 1YI23 4HM7B 1W2ZA 1G0TA 1WMPA 1YJN3 1DE3A 2QGUA 2W56B 5KP3A 1YGWA 1MWRA 4Q53A 1OACA 1BRGA 2F86B 3CXC2 1JRQA 2GBWB 2O3OA 4K1UA 1BRSA 1I2GA 2FNQA 1E3VA 5RNTA 1VQN3 1JN5A 2KF6A 8RNTA 1RGGA 3EC9A 1X1UA 1TIJA 1EA2A 3V92A 1KQS2 1IVXA 5AIGA 1LVNA 6RNTA 3CCM3 3CCR3 1GMQA 1X1YA 1RGEA 5KP4A 5HGRA 1ZX2A 1VQ43 1OHPA 4XBXA 2JDIH 4MMXB 4AEQA 1FUTA 1UGHI 3F9SA 5M18A 3NUVA 2PNCA 1VZZA 5EEOA 1KC84 1ULJB 4FCMA 1V57A 2KCDA 1VQK3 1JJ22 1BU4A 1EKMA 1YNVX 3PS8A 1CH0A 2IMJA 5AEWB 4EYCA 1TRPA 1BNIA 1Q40B 2BO9B 1ZS7A 3DXOA 3OV4A 3G16A 2H0IA
chains in the Genus database with same CATH topology
3D4AA 1R4YA 1RNBA 1X1XA 1RLSA 3URPA 1UCLA 1HYFA 1I2FA 3RNTA 3WR2A 3AHSA 3SYUA 1I8VA 1TTOA 1A2PA 2BIRA 2KF5A 7RNTA 1B2ZA 1UCKA 1RNTA 1BNEA 1B21A 1MGWA 1UCIA 1BSDA 5BIRA 1RN1A 1GSPA 1BSAA 3GSPA 1JBSA 2F5WA 3AHWA 4BIRA 1B27A 1TRQA 2F4YA 1BGSA 2RBIA 1B2XA 1DETA 1UCJA 1BNJA 3AGNA 3D5IA 2AADA 1FW7A 5GSPA 1BANA 1PYLA 3KCHA 1C54A 1GMRA 2F5MA 1BRHA 1LNIA 3BIRA 1I0XA 1RGAA 1BOXA 1GOYA 2F56A 2RNTA 1IYYA 1BRKA 2ZA4A 1RMSA 4GHOA 5BU4A 1I3IA 3D5GA 4HOHA 2KF3A 1LOVA 1Q9EA 9RNTA 1SARA 1HZ1A 1ZGXA 4GSPA 1BSEA 1I3FA 1RCKA 1GOVA 1X1WA 1B3SA 1RDSA 1JBTA 1RGHA 1BUJA 4BU4A 1RN4A 1FYSA 1BNGA 1BIRA 2BU4A 1BRJA 1T2IA 1BSBA 1BRNL 1B2MA 3A5EA 3HOHA 4J5GA 1BRIA 2C4BA 1I0VA 2HOHA 2GSPA 2KAAA 1RGCA 3Q3FA 1DE3A 3DGYA 1PY3A 1YGWA 1BSCA 1B2UA 1RHLA 4RNTA 1BRGA 1RGLA 3WHOA 1I2EA 1RTUA 4HAAA 1AY7A 1RGFA 1BVIA 5HOHA 1BRSA 1I2GA 6GSPA 1I70A 1MGRA 1YVSA 5RNTA 1T2HA 2AAEA 1GMPA 1RCLA 2KF6A 8RNTA 7GSPA 1RGGA 1RSNA 1BNSA 1X1UA 1GOUA 1RGKA 3AGOA 3BU4A 1FZUA 1AQZA 1B2SA 6RNTA 1GMQA 1LRAA 4J5KA 1FUSA 1LOWA 1RGEA 1X1YA 1B20A 3DH2A 1LOYA 1BNRA 1FUTA 1G02A 1BNFA 1BU4A 2KF4A 1YNVX 1CH0A 1TRPA 1BNIA 1JBRA 2SARA 1BAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4A A;  1R4Y A;  1RNB A;  1X1X A;  1RLS A;  3URP A;  1UCL A;  1HYF A;  1I2F A;  3RNT A;  3WR2 A;  3AHS A;  3SYU A;  1I8V A;  1TTO A;  1A2P A;  2BIR A;  2KF5 A;  7RNT A;  1B2Z A;  1UCK A;  1RNT A;  1BNE A;  1B21 A;  1MGW A;  1UCI A;  1BSD A;  5BIR A;  1RN1 A;  1GSP A;  1BSA A;  3GSP A;  1JBS A;  2F5W A;  3AHW A;  4BIR A;  1B27 A;  1TRQ A;  2F4Y A;  1BGS A;  2RBI A;  1B2X A;  1DET A;  1UCJ A;  1BNJ A;  3AGN A;  3D5I A;  2AAD A;  1FW7 A;  5GSP A;  1BAN A;  1PYL A;  3KCH A;  1C54 A;  1GMR A;  2F5M A;  1BRH A;  1LNI A;  3BIR A;  1I0X A;  1RGA A;  1BOX A;  1GOY A;  2F56 A;  2RNT A;  1IYY A;  1BRK A;  2ZA4 A;  1RMS A;  4GHO A;  5BU4 A;  1I3I A;  3D5G A;  4HOH A;  2KF3 A;  1LOV A;  1Q9E A;  9RNT A;  1SAR A;  1HZ1 A;  1ZGX A;  4GSP A;  1BSE A;  1I3F A;  1RCK A;  1GOV A;  1X1W A;  1B3S A;  1RDS A;  1JBT A;  1RGH A;  1BUJ A;  4BU4 A;  1RN4 A;  1FYS A;  1BNG A;  1BIR A;  2BU4 A;  1BRJ A;  1T2I A;  1BSB A;  1BRN L;  1B2M A;  3A5E A;  3HOH A;  4J5G A;  1BRI A;  2C4B A;  1I0V A;  2HOH A;  2GSP A;  2KAA A;  1RGC A;  3Q3F A;  1DE3 A;  3DGY A;  1PY3 A;  1YGW A;  1BSC A;  1B2U A;  1RHL A;  4RNT A;  1BRG A;  1RGL A;  3WHO A;  1I2E A;  1RTU A;  4HAA A;  1AY7 A;  1RGF A;  1BVI A;  5HOH A;  1BRS A;  1I2G A;  6GSP A;  1I70 A;  1MGR A;  1YVS A;  5RNT A;  1T2H A;  2AAE A;  1GMP A;  1RCL A;  2KF6 A;  8RNT A;  7GSP A;  1RGG A;  1RSN A;  1BNS A;  1X1U A;  1GOU A;  1RGK A;  3AGO A;  3BU4 A;  1FZU A;  1AQZ A;  1B2S A;  6RNT A;  1GMQ A;  1LRA A;  4J5K A;  1FUS A;  1LOW A;  1RGE A;  1X1Y A;  1B20 A;  3DH2 A;  1LOY A;  1BNR A;  1FUT A;  1G02 A;  1BNF A;  1BU4 A;  2KF4 A;  1YNV X;  1CH0 A;  1TRP A;  1BNI A;  1JBR A;  2SAR A;  1BAO A; 
#chains in the Genus database with same CATH topology
 1E3R A;  2XFT A;  3KZT A;  1GD3 A;  3DZL A;  4WWU C;  3UL5 A;  1R4Y A;  6STD A;  1JB5 A;  1Z1S A;  4OUQ A;  2R41 A;  5CF2 A;  5D83 A;  1W4N A;  3EB8 A;  1UI8 A;  1OHS A;  1TFK A;  4X2O A;  3MYT A;  5EVH A;  3AHS A;  3FF0 A;  1W7C A;  4XBY A;  3SLU A;  1TTO A;  2Q07 A;  2YFJ B;  7RNT A;  1UCK A;  2ZL8 A;  2BMQ B;  1LOX A;  3BNB A;  1RNT A;  5BXQ A;  3MG1 A;  4KT3 B;  4HM6 B;  1ROV A;  1GY6 A;  2IUK A;  1SQW A;  2M7O A;  4CCV A;  3NM7 A;  3F8H A;  5BIR A;  5AEU B;  3GSP A;  1GS3 A;  4LMI A;  3MKI A;  1JBS A;  4HM5 B;  1TRQ A;  2HMJ B;  3K9M C;  2XGL A;  4MJD A;  3FH1 A;  1B2X A;  1JKG B;  2HMO B;  1UCJ A;  1BNJ A;  2IY2 A;  3IMA B;  1RJO A;  3EQQ B;  4KZ1 A;  4O8S A;  4EXR A;  3CC2 3;  2CHC A;  2CWV A;  2CC3 A;  1V58 A;  5IER A;  2P05 A;  2L1S A;  2UUG C;  3MG2 A;  1CQS A;  1BRH A;  3S28 A;  1WMN A;  4WYK A;  1RGA A;  1UDI I;  3WA2 X;  2RNT A;  1UW1 A;  3EN8 A;  2P09 A;  1IVU A;  3S67 A;  1GD4 A;  1RMS A;  2CWU A;  1IDP A;  1UGI A;  3KSP A;  5BU4 A;  3NBB A;  3N8B A;  2QA4 3;  1SII A;  2OQE A;  3WOE B;  2KF3 A;  9RNT A;  3S27 A;  3JUM A;  1ZGX A;  5LC7 A;  4R1K A;  3LT8 A;  3NHX A;  1W6Y A;  1TJD A;  2W0Q A;  3PCR A;  1B3S A;  2BMO B;  1D6U A;  3E99 A;  5JPU A;  3GZR A;  1S72 3;  2W04 A;  1JN5 B;  5LC6 A;  1FYS A;  3G0K A;  4HM3 B;  4GL6 A;  1BRJ A;  3GWR A;  5I97 A;  4LEH A;  1DMQ A;  4HZ9 B;  5D81 A;  3A5E A;  3HOH A;  2I9W A;  1I0V A;  4L7K A;  1MOL A;  1W6C A;  4N6O B;  5AI1 A;  3BB9 A;  3K63 A;  2KAA A;  3MHE A;  1O7H B;  3DGY A;  4CPK A;  1PY3 A;  2UGI A;  1Q86 4;  1BSC A;  1DMN A;  1G96 A;  2CFG A;  3DMC A;  3HI7 A;  4CDL A;  1QAF A;  1I2E A;  3LOY A;  1Q82 4;  2YX9 A;  4HAA A;  3CME 3;  1K73 4;  1BVI A;  1SPU A;  4R80 A;  6GSP A;  2Z76 A;  1MGR A;  3CPO A;  1T2H A;  2W6J H;  2AAE A;  3PGB A;  1OH0 A;  5M1A A;  1LQM B;  2FGT A;  3FKA A;  5CLK A;  3N9H A;  1GOU A;  1AVK A;  2UX0 A;  2BNG A;  3B4O A;  3CCQ 3;  2CX1 A;  4DKI A;  1YIJ 3;  3DM8 A;  3VGN A;  4X2H A;  2LQV A;  1AV4 A;  3FGY A;  5G2G A;  1E97 A;  3GZX B;  1D6Z A;  1US1 A;  4NPB A;  1Q42 A;  3PZW A;  3RGA A;  2XFS A;  1LNH A;  1N9E A;  1DVD A;  4H3U A;  4L8O A;  2Z7A A;  3LZA A;  3ZFZ A;  1FA3 A;  4O3V A;  1UUG B;  1UUV B;  1CYU A;  3FZW A;  1VQL 3;  5JPP A;  3G4S 3;  3CCE 3;  2Y73 A;  3SVA A;  4BTX A;  1DMM A;  2KXG A;  4IT7 A;  3O8Y A;  1LQG C;  4AKY A;  2XGN A;  3D4A A;  3I55 3;  2W9P A;  3NBJ A;  5ELU A;  3T0U A;  3QRD A;  5IG4 A;  3X42 A;  5IEP A;  2L4V A;  4EV5 A;  1QAL A;  1O7M B;  1X1X A;  3ZG5 A;  3V98 A;  1K28 A;  1M9G A;  2YFI B;  5AYS C;  3MWZ A;  3N54 B;  5EQL A;  3WA3 A;  1TP6 A;  3U97 A;  3WR2 A;  1A90 A;  1I8V A;  2BMR B;  2KF5 A;  3EN1 B;  3T8U A;  1LXE A;  1B2Z A;  1N5H A;  4N6M A;  4WYK B;  1JV2 B;  2CWT A;  3LYG A;  2ZDJ A;  1FGO A;  2Z6B A;  3LTB A;  2MC8 A;  1KWI A;  1MGW A;  5CK6 A;  4KFF A;  2XR8 B;  1IT8 A;  1OCV A;  2YFL B;  3WMD A;  4BTY A;  3CPW 2;  4FR9 A;  2F5W A;  1O7N B;  4BIR A;  1WMO A;  1B27 A;  4EBG A;  3ALA A;  1O7P B;  1NO3 A;  3D5I A;  3EBY A;  1ZO2 A;  2HML B;  4LSO A;  1NWW A;  4IIA A;  1J2B A;  3JVC A;  1U8C B;  3QK9 A;  3FCS B;  4R9L A;  2OTJ 3;  3GZY B;  3CC4 3;  3S29 A;  4HJL B;  2OOV C;  2SBL A;  1YJW 3;  1BOX A;  3NQZ A;  2GU3 A;  3CCV 3;  1GY7 A;  3KII A;  1BRK A;  3NXJ A;  1EQK A;  2ZA4 A;  4JF8 A;  1JB4 A;  1Q7H A;  1YVB I;  4RZM A;  5KP1 A;  5CF1 A;  3I0Y A;  3LML A;  5IG3 A;  1IQY A;  2INX A;  1HZ1 A;  2CFK A;  4HBR A;  1I3F A;  3OX9 A;  1W5Z A;  1NJI 4;  5G1L A;  3HK4 A;  1BUJ A;  4BU4 A;  1UUW B;  2V1L A;  1VQQ A;  1GY5 A;  1BNG A;  1Q7Y 4;  3RGR A;  2XF3 A;  2CFL A;  1T3B A;  2HMK B;  1K41 A;  3HZP A;  4N6L A;  1BUQ A;  3LT9 A;  4HYZ A;  3S5C A;  1N8R 4;  1IU7 A;  2PZV A;  1VQP 3;  2HOH A;  1R4C A;  1IV9 A;  1W6G A;  2GSP A;  1RGC A;  3Q3F A;  4FMC A;  1TU5 A;  1EEJ A;  2C11 A;  1YGE A;  3OXA A;  1RHL A;  4RNT A;  4HM0 B;  4PEJ A;  4N6U A;  2P0X A;  1AY7 A;  1RGF A;  4ILF A;  2QEX 3;  5ELJ A;  1VQ5 3;  5D82 A;  1JZD A;  1YVS A;  5AIF A;  1QMA A;  3F40 A;  4MMY B;  1IK3 A;  1RCL A;  2IYJ A;  7GSP A;  1RRL A;  1BNS A;  3HII A;  3LTD A;  1NB3 I;  3B4P A;  2K3D A;  1RGK A;  2RSX A;  3AGO A;  3BU4 A;  3PCS A;  2A15 A;  4H61 A;  4HM4 B;  1VQ7 3;  1QVG 2;  3U1W A;  1EUI C;  1B2S A;  5TGN A;  3DGM A;  1LRA A;  1OGX A;  4G1M B;  4J5K A;  5FGO A;  1LOW A;  4N6T A;  1VQ9 3;  3DH2 A;  3X3Z A;  1N5P A;  4O2H A;  3ZG0 A;  3AMO A;  1JNQ A;  1W2B 2;  3D3L A;  2D42 A;  3JUN A;  3SOY A;  4EC6 A;  1LOY A;  5A0O B;  1BNR A;  2RCD A;  3NM2 A;  1YHQ 3;  4HM8 B;  2P38 A;  2E2T A;  3A76 A;  2W2C A;  5IEO A;  1G02 A;  5DRV A;  2KF4 A;  1FGM A;  1SJW A;  3UJM A;  4LZI A;  2E2V A;  2D1W A;  5STD A;  3WDG B;  1KSI A;  2GBX B;  3CCU 3;  2K54 A;  1IV7 A;  2F98 A;  1WNH A;  1MNL A;  3SED A;  3EF8 A;  3CCS 3;  1CYV A;  1RNB A;  4OVM A;  5IEN A;  2WO0 A;  3OWY A;  4HVN A;  3URP A;  1I2F A;  1HKX A;  2XSO B;  3FLJ A;  3FF2 A;  2GXF A;  1A2P A;  3G8Z A;  1AR0 A;  3G6E 3;  3FG1 A;  2WGQ A;  4N6V 0;  4FCZ A;  1OHO A;  1L5G B;  1D6Y A;  2CK3 H;  1UI7 A;  2LYX A;  3UL6 A;  1RN1 A;  1M90 4;  1BSA A;  3PXM A;  2H0G A;  3STD A;  1RRH A;  3LTC A;  2F4Y A;  3CCJ 3;  1BGS A;  3IPT A;  3Q1C A;  2STD A;  1DET A;  3CNX A;  5GSP A;  4EV2 A;  2Y74 A;  4LYL B;  3NV0 A;  1DVC A;  5BVB A;  1N9J A;  4U13 A;  1IQX A;  1GMR A;  2J8X B;  4IPB A;  2F5M A;  3NQY A;  4I4K A;  4WP5 A;  4XBT A;  4XDW A;  4EW5 A;  1LNI A;  2OOV A;  3BIR A;  2FXT A;  3UNL A;  1SIH A;  1GOY A;  2CFD A;  1NDO B;  3KSE D;  1IYY A;  4NRE A;  4TX4 A;  1Y4K A;  5G1K A;  3FSD A;  1W00 A;  4CJN A;  3F7X A;  2HMN B;  3I56 3;  3CD6 3;  2QIY A;  3M8C A;  2F99 A;  4O02 B;  3JUO A;  1TUH A;  4GB5 A;  1LOV A;  1Q9E A;  3HX8 A;  1SAR A;  4R9K A;  4BTW A;  2OTL 3;  1TFO A;  3BND A;  3ER7 A;  2ML5 A;  4KVH A;  4KFE A;  1ISK A;  2RGQ A;  1FGR A;  1X1W A;  1A2K A;  3K7C A;  1RN7 A;  2BHM A;  3LH4 A;  3H51 A;  4HKV B;  1ASK A;  1C7H A;  1T5Y A;  3X40 A;  1BIR A;  2B1X B;  2BU4 A;  3DUK A;  1IVV A;  1JZO A;  1B2M A;  4L8P A;  2JQ5 A;  1PFP A;  3KKG A;  3B8L A;  4J5G A;  4WFO A;  7STD A;  4J9A A;  1JB2 A;  1OF5 A;  1NU3 A;  1A2V A;  3WOF B;  5AIH A;  4MMZ B;  3L0R A;  1K9M 4;  5IW9 A;  1B2U A;  2ZHX B;  3ECF A;  1IQ8 A;  2KRT A;  2OWP A;  1RGL A;  2R4I A;  3AMO B;  2IA7 A;  2XSH B;  1AVL A;  4KFD A;  3WHO A;  4K90 B;  3NBR A;  3KFQ C;  3WOD G;  1YJ9 3;  1RTU A;  5HOH A;  3HIG A;  3JUQ A;  1I70 A;  1GMP A;  2E2U A;  3OWU A;  3X41 A;  3KN4 A;  1RSN A;  4JRF A;  1U5O A;  1QVF 2;  1WQL B;  2MF7 A;  4RBN A;  2CG1 A;  3BNC A;  1F8N A;  2C10 A;  3GRD A;  3PYJ A;  1IT7 A;  4R4K A;  4I5Q A;  2O9U X;  4RNY A;  1FZU A;  4BL3 A;  1AQZ A;  2XRX B;  1STF I;  3MG3 A;  2B24 B;  3BNE A;  3K5T A;  3LTA A;  3K0Z A;  1FUS A;  3EX9 A;  1B20 A;  1MWU A;  1S5A A;  2CKF B;  2W56 A;  3H3H A;  1STD A;  3F8X A;  3CNM A;  2H0H A;  8CHO A;  3G71 3;  2CIU A;  4HM2 B;  1BNF A;  3BLZ A;  4FMD A;  3B7C A;  4N3V A;  1FGQ A;  2CH9 A;  1O7G B;  2GU1 A;  5IG0 A;  3DY5 A;  1Q81 4;  2SAR A;  1BAO A;  1VQ8 3;  1JBR A;  2CW9 A;  4XDV A;  3CCL 3;  2XEP A;  4ZM8 A;  1RKY A;  3T8N A;  1KD1 4;  3EE1 A;  3ROB A;  1RLS A;  4K61 A;  1DYU A;  1VQ6 3;  2W9Q A;  1UCL A;  1HYF A;  3NV0 B;  4FMB A;  1VQO 3;  1OGZ A;  3LXU X;  1MWT A;  3EBT A;  3NX0 A;  3RNT A;  3V99 A;  3CMA 3;  1IVW A;  3F7S A;  3SYU A;  3Q90 A;  1ROA A;  3GAX A;  1A67 A;  2BIR A;  3SX1 A;  4WHA A;  2GEY A;  3RDE A;  4XB5 A;  1OPY A;  2CX0 A;  5CXO A;  3DGN A;  5DRE A;  1K8A 4;  1BNE A;  3CU3 A;  3D79 A;  3KE7 A;  1PU4 A;  2W03 A;  1FUW A;  3VSY A;  1GYB A;  1B21 A;  1M1X B;  1UCI A;  3OWS A;  3OW2 2;  1VQM 3;  1BSD A;  1W02 A;  4QWT A;  1Q40 A;  4N6N B;  3TDG A;  1GSP A;  1OUN A;  2WOF A;  5AYR B;  1NB5 I;  3Q2P A;  1NNV A;  1QJG A;  3AHW A;  2CG0 A;  1CEW I;  2HMM B;  2BT3 A;  2P0M A;  4BL2 A;  3FG4 A;  2RBI A;  2WOH A;  3DGL A;  2K0M A;  3AGN A;  3MSO A;  4J8T A;  1QAK A;  3VF1 A;  3X3X A;  2AAD A;  4FMA A;  1FW7 A;  2OCT A;  1BAN A;  1PYL A;  1HU9 A;  3KCH A;  1N8Q A;  1C54 A;  2Z77 A;  3JUP A;  5M19 A;  4HZB B;  2GEX A;  4FCJ A;  5AII A;  1MWS A;  5IF6 A;  1I0X A;  4HM1 B;  4K1V A;  3SOA A;  2F56 A;  2RFR A;  2WGO A;  2XH9 A;  3UB1 A;  1EG9 B;  4ORL A;  1OF5 B;  5IG5 A;  4GHO A;  1W01 A;  3MPH A;  4STD A;  3X3Y A;  1I3I A;  1O7W B;  2CFW A;  3D5G A;  2OQE C;  4HOH A;  5JBS A;  3D9R A;  1FGT A;  4GSP A;  3EJV A;  4OK0 A;  1JKG A;  1BSE A;  1RCK A;  1ULI B;  1GOV A;  4MEI A;  4RNZ A;  1M1K 4;  1RDS A;  3J7Y d;  1JBT A;  1RGH A;  3DGO A;  1V74 A;  3IJE B;  1RN4 A;  1WTH A;  1YIT 3;  3GZB A;  5FW5 A;  4LGQ A;  3SXX A;  4NHF A;  1T2I A;  1BSB A;  4XM4 A;  3FG3 A;  3CC7 3;  4AKZ A;  1BRN L;  3F14 A;  2ML6 A;  3EHC A;  1BRI A;  2C4B A;  2IUJ A;  1YI2 3;  4HM7 B;  1W2Z A;  1G0T A;  1WMP A;  1YJN 3;  1DE3 A;  2QGU A;  2W56 B;  5KP3 A;  1YGW A;  1MWR A;  4Q53 A;  1OAC A;  1BRG A;  2F86 B;  3CXC 2;  1JRQ A;  2GBW B;  2O3O A;  4K1U A;  1BRS A;  1I2G A;  2FNQ A;  1E3V A;  5RNT A;  1VQN 3;  1JN5 A;  2KF6 A;  8RNT A;  1RGG A;  3EC9 A;  1X1U A;  1TIJ A;  1EA2 A;  3V92 A;  1KQS 2;  1IVX A;  5AIG A;  1LVN A;  6RNT A;  3CCM 3;  3CCR 3;  1GMQ A;  1X1Y A;  1RGE A;  5KP4 A;  5HGR A;  1ZX2 A;  1VQ4 3;  1OHP A;  4XBX A;  2JDI H;  4MMX B;  4AEQ A;  1FUT A;  1UGH I;  3F9S A;  5M18 A;  3NUV A;  2PNC A;  1VZZ A;  5EEO A;  1KC8 4;  1ULJ B;  4FCM A;  1V57 A;  2KCD A;  1VQK 3;  1JJ2 2;  1BU4 A;  1EKM A;  1YNV X;  3PS8 A;  1CH0 A;  2IMJ A;  5AEW B;  4EYC A;  1TRP A;  1BNI A;  1Q40 B;  2BO9 B;  1ZS7 A;  3DXO A;  3OV4 A;  3G16 A;  2H0I A; 
#chains in the Genus database with same CATH homology
 3D4A A;  1R4Y A;  1RNB A;  1X1X A;  1RLS A;  3URP A;  1UCL A;  1HYF A;  1I2F A;  3RNT A;  3WR2 A;  3AHS A;  3SYU A;  1I8V A;  1TTO A;  1A2P A;  2BIR A;  2KF5 A;  7RNT A;  1B2Z A;  1UCK A;  1RNT A;  1BNE A;  1B21 A;  1MGW A;  1UCI A;  1BSD A;  5BIR A;  1RN1 A;  1GSP A;  1BSA A;  3GSP A;  1JBS A;  2F5W A;  3AHW A;  4BIR A;  1B27 A;  1TRQ A;  2F4Y A;  1BGS A;  2RBI A;  1B2X A;  1DET A;  1UCJ A;  1BNJ A;  3AGN A;  3D5I A;  2AAD A;  1FW7 A;  5GSP A;  1BAN A;  1PYL A;  3KCH A;  1C54 A;  1GMR A;  2F5M A;  1BRH A;  1LNI A;  3BIR A;  1I0X A;  1RGA A;  1BOX A;  1GOY A;  2F56 A;  2RNT A;  1IYY A;  1BRK A;  2ZA4 A;  1RMS A;  4GHO A;  5BU4 A;  1I3I A;  3D5G A;  4HOH A;  2KF3 A;  1LOV A;  1Q9E A;  9RNT A;  1SAR A;  1HZ1 A;  1ZGX A;  4GSP A;  1BSE A;  1I3F A;  1RCK A;  1GOV A;  1X1W A;  1B3S A;  1RDS A;  1JBT A;  1RGH A;  1BUJ A;  4BU4 A;  1RN4 A;  1FYS A;  1BNG A;  1BIR A;  2BU4 A;  1BRJ A;  1T2I A;  1BSB A;  1BRN L;  1B2M A;  3A5E A;  3HOH A;  4J5G A;  1BRI A;  2C4B A;  1I0V A;  2HOH A;  2GSP A;  2KAA A;  1RGC A;  3Q3F A;  1DE3 A;  3DGY A;  1PY3 A;  1YGW A;  1BSC A;  1B2U A;  1RHL A;  4RNT A;  1BRG A;  1RGL A;  3WHO A;  1I2E A;  1RTU A;  4HAA A;  1AY7 A;  1RGF A;  1BVI A;  5HOH A;  1BRS A;  1I2G A;  6GSP A;  1I70 A;  1MGR A;  1YVS A;  5RNT A;  1T2H A;  2AAE A;  1GMP A;  1RCL A;  2KF6 A;  8RNT A;  7GSP A;  1RGG A;  1RSN A;  1BNS A;  1X1U A;  1GOU A;  1RGK A;  3AGO A;  3BU4 A;  1FZU A;  1AQZ A;  1B2S A;  6RNT A;  1GMQ A;  1LRA A;  4J5K A;  1FUS A;  1LOW A;  1RGE A;  1X1Y A;  1B20 A;  3DH2 A;  1LOY A;  1BNR A;  1FUT A;  1G02 A;  1BNF A;  1BU4 A;  2KF4 A;  1YNV X;  1CH0 A;  1TRP A;  1BNI A;  1JBR A;  2SAR A;  1BAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...