1HZ1A

Ribonuclease t1 v16a mutant in complex with mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1hz1A00
1RNBA 1LRAA 1RGEA 1AY7A 1CH0A 1DETA 1LOYA 4BU4A 6GSPA 5HOHA 1BNGA 1ZGXA 4RNTA 1RCKA 1G02A 3Q3FA 3RNTA 1RCLA 1X1WA 1BAOA 1T2IA 3BIRA 1I2FA 4HAAA 3AGOA 1GMRA 1R4YA 1BSEA 2KF5A 1MGWA 1IYYA 1Q9EA 1FUTA 1BRNL 3DGYA 5RNTA 1B3SA 1HYFA 1I0VA 1RSNA 1RNTA 4J5GA 1BNEA 1FYSA 1LOVA 1YVSA 2RBIA 3D4AA 3GSPA 1B2XA 1YNVX 1BRGA 1RHLA 1T2HA 2F4YA 1RGGA 1BNFA 1SARA 1BNIA 1RGKA 2BU4A 9RNTA 2GSPA 3SYUA 1I8VA 1RGCA 1UCKA 1I3IA 1TTOA 1BSAA 2KF3A 4BIRA 2AAEA 4GHOA 2KF4A 1BSDA 1BRJA 2F5MA 4HOHA 3WHOA 1BANA 1FZUA 3HOHA 1UCLA 1UCIA 1MGRA 1X1XA 1BRKA 1JBSA 1I70A 2RNTA 1LNIA 2F56A 2C4BA 2BIRA 1BNSA 2HOHA 3WR2A 1BU4A 1X1YA 1BRIA 1TRPA 1RGFA 2SARA 1RDSA 1I2EA 2KF6A 3AHWA 5BIRA 2F5WA 1B27A 1C54A 1BNJA 1GMQA 1FW7A 1B20A 1B21A 1RTUA 1YGWA 1TRQA 1RGLA 1RGAA 1AQZA 1FUSA 5GSPA 1PYLA 3D5GA 3AGNA 1BIRA 1B2MA 3BU4A 2ZA4A 1BRSA 1GOVA 2AADA 4GSPA 5BU4A 1BVIA 1I2GA 1B2SA 1RMSA 4J5KA 1HZ1A 1B2ZA 6RNTA 3DH2A 1GMPA 3A5EA 3KCHA 1JBRA 3URPA 8RNTA 3AHSA 1LOWA 7RNTA 1RN1A 1I3FA 1BOXA 1GOYA 7GSPA 2KAAA 1BNRA 1RGHA 1BSBA 1BUJA 1RN4A 1A2PA 1BGSA 1UCJA 1GOUA 1BRHA 3D5IA 1X1UA 1DE3A 1I0XA 1JBTA 1GSPA 1BSCA 1RLSA 1B2UA 1PY3A
chains in the Genus database with same CATH superfamily
1MWSA 2JQ5A 3KFQC 1RNBA 1WNHA 3H51A 4N6MA 1K28A 3N54B 3H3HA 4HM4B 1IDPA 3BNCA 1NWWA 3NQZA 5TGNA 6GSPA 1NNVA 5G1KA 3CCE3 1OGZA 4L8PA 3CD63 2XFTA 1VQ93 4FCMA 4IIAA 1RCLA 1X1WA 1JB4A 1BAOA 3CNMA 1JKGA 2FNQA 2Z77A 1US1A 1MOLA 2C11A 2OOVC 3BIRA 2D42A 1CQSA 1IVVA 2CFWA 3AGOA 4R9KA 4HM7B 5IG0A 4EV2A 5IENA 1BSEA 4FMCA 1YIJ3 3MG3A 5IERA 5AEUB 4BTXA 5BVBA 4HVNA 5RNTA 1B3SA 1D6UA 3ROBA 4EXRA 1YHQ3 3LTAA 1L5GB 1M1K4 1RNTA 4HZBB 2W9PA 4XDWA 1LQGC 1JNQA 3K9MC 1YVSA 1B2XA 2P0MA 1T2HA 3PYJA 1JN5A 3OWYA 3EBTA 2BU4A 6STDA 3PCSA 2OOVA 4K1UA 1I3IA 2HMNB 3S5CA 1TTOA 2KCDA 2E2UA 3IMAB 4BIRA 1OACA 4XBYA 1BSDA 2F5MA 1VQ63 5LC6A 4XDVA 2QGUA 4XM4A 3L0RA 3LTBA 4EC6A 4LMIA 4HM3B 2M7OA 2GEYA 3Q2PA 4I4KA 3TDGA 3B4PA 3FG3A 3LXUX 3X3ZA 3HOHA 1UCIA 1X1XA 1W00A 2W2CA 1AR0A 2FGTA 1M9GA 1BU4A 4BL3A 1IVWA 3LTDA 1RGFA 5DREA 3T0UA 2SARA 5STDA 3NV0B 2V1LA 2KF6A 3MG2A 3MHEA 1W01A 3PS8A 4U13A 1B27A 1BNJA 1K41A 1W6GA 5EEOA 3BLZA 1YGWA 1IT7A 3S67A 2CX1A 2XEPA 1FUSA 5GSPA 4EV5A 4CPKA 1MWRA 1W6CA 3F7SA 1NB5I 3NBRA 3JUMA 1BRSA 1GOVA 1UGIA 2A15A 2IYJA 2STDA 4GSPA 3G8ZA 3EN8A 3FH1A 1PU4A 3S29A 2Q07A 3CPOA 2CX0A 1HZ1A 2BMOB 1YVBI 2W6JH 5ELJA 5KP1A 3FF2A 3SEDA 3WMDA 3D9RA 3GWRA 5IEOA 3U97A 3VSYA 2F99A 5IG3A 4O2HA 3KN4A 1ZO2A 3GRDA 1GOYA 1BNRA 4FMAA 3PCRA 2D1WA 2OWPA 4L8OA 3LTCA 2W9QA 4CCVA 3GZYB 3FG1A 3JUNA 4KFFA 1JRQA 4KFDA 4FR9A 4OVMA 3OXAA 4HM2B 5G1LA 3OW22 1BRHA 4ORLA 2ZDJA 5ELUA 1LQMB 3WA3A 2UX0A 1VQM3 4MJDA 2BNGA 4N3VA 3OWSA 4N6OB 1GSPA 3EJVA 1ISKA 2LQVA 4X2OA 2O3OA 3JUQA 1LOXA 2F98A 3B4OA 2CFDA 4HM8B 1IQYA 1TFOA 3MYTA 4KVHA 1AY7A 1DETA 1HKXA 1LOYA 3K63A 5KP3A 3I553 1W2B2 1O7GB 1UDII 2P05A 3BNDA 1A67A 1G02A 5A0OB 2OTL3 3G0KA 5IEPA 1W4NA 1VQL3 1Q864 2E2TA 1EUIC 2CWUA 1R4YA 2KF5A 1IV9A 1TIJA 4JRFA 1LNHA 4HM5B 1MGWA 2Z6BA 1UI7A 1Q9EA 4X2HA 1FUTA 1Q40A 1IQXA 1N5HA 3QRDA 5DRVA 2R4IA 3I0YA 4N6LA 1HYFA 3X40A 1IT8A 2Y74A 3HZPA 3KSPA 2PZVA 3DM8A 5JPUA 2E2VA 3GSPA 1Y4KA 1BRGA 1RHLA 2OQEA 3CCQ3 3ZG0A 1BNFA 3A76A 3F9SA 2XSOB 3IPTA 1S5AA 2IUJA 9RNTA 1M1XB 3MPHA 3CPW2 3SYUA 4FMDA 4HM1B 4R1KA 3U1WA 1QMAA 4BTYA 2Z7AA 1UGHI 1UW1A 3NV0A 3V98A 1KWIA 2HMJB 1O7NB 3KE7A 1IU7A 3KIIA 3OX9A 4WFOA 2CHCA 3SXXA 1J2BA 3GZRA 1VQ83 3LT9A 3JVCA 1BANA 1UCLA 2B1XB 4WP5A 4NHFA 3K7CA 1K734 2ZHXB 1JBSA 1OGXA 4WYKA 4MMXB 2IY2A 3J7Yd 2BIRA 1WQLB 3CC73 1X1YA 2WGQA 4BTWA 1SJWA 5CK6A 1JV2B 3AHWA 1OF5B 2F5WA 1E3RA 1FW7A 1B20A 3SVAA 3EE1A 1Q7Y4 1RTUA 4KT3B 1GS3A 4AEQA 1U5OA 3FLJA 3V92A 2XGNA 2ML5A 4MMZB 1D6YA 1GD4A 4RZMA 3G16A 1B2MA 1SQWA 2AADA 4TX4A 5BU4A 4CDLA 3RGAA 2CG0A 2HMLB 2K3DA 3BNBA 4H3UA 1MWUA 1B2ZA 4K61A 2J8XB 3HIGA 4NPBA 4EW5A 3A5EA 2SBLA 5AI1A 1Q824 2UUGC 2F86B 2ZL8A 3F8XA 8RNTA 1Q7HA 4HKVB 5AIHA 1YJW3 1AV4A 3EX9A 1RN1A 4Q53A 5JPPA 3UNLA 2FXTA 4NREA 5CLKA 3NBBA 5AIFA 1BOXA 4XB5A 2XGLA 4O02B 5I97A 1N8QA 4J8TA 1RGHA 1BSBA 4WHAA 1BUJA 2P38A 1RN4A 1NDOB 3F7XA 3B8LA 1SIIA 1GOUA 2CFKA 2H0IA 3VGNA 1NB3I 1U8CB 3D5IA 1X1UA 5EVHA 1PFPA 1DE3A 1I0XA 4HYZA 5IF6A 1O7HB 4R80A 5CF2A 1UUVB 1F8NA 1YGEA 2GBXB 2OCTA 2H0HA 3MSOA 1GYBA 3M8CA 4JF8A 2L4VA 1B2UA 1TP6A 1O7MB 3FKAA 4BL2A 2QEX3 1QVF2 2OTJ3 1LRAA 2BMRB 1C7HA 1AVKA 4EBGA 1IK3A 1JKGB 3GZXB 1YI23 4BU4A 3Q90A 5HOHA 1OHOA 3GAXA 1BNGA 3WOFB 2B24B 1ZGXA 1OH0A 3Q3FA 4HJLB 4LYLB 5AEWB 2CW9A 4HZ9B 4LSOA 3WDGB 1T5YA 1GMRA 2XSHB 2HMMB 1G0TA 2WOFA 3ALAA 3DXOA 1EKMA 3EQQB 3LMLA 1UUWB 3STDA 1IYYA 1BRNL 3FGYA 1JJ22 1LVNA 2WGOA 3KKGA 3NQYA 5IW9A 1I0VA 2CG1A 1QALA 1RSNA 1N9JA 1DYUA 2W04A 3NM7A 5KP4A 1FYSA 2RBIA 3D4AA 2YFIB 3HI7A 3NBJA 1FGMA 4L7KA 3EB8A 1EEJA 3OWUA 5FGOA 4MMYB 1RGGA 2MC8A 1VQK3 1SARA 1V58A 1BNIA 1RGKA 3N8BA 2UGIA 3SLUA 1CYVA 2GSPA 3CMA3 1A90A 4XBTA 1EA2A 5JBSA 2LYXA 2HMOB 1KC84 4OUQA 4HM6B 3X3YA 2XH9A 1BSAA 1OHSA 1CYUA 1OF5A 4H61A 1DMQA 1EG9B 7STDA 4GHOA 2KF4A 4R4KA 1BRJA 3LH4A 2Z76A 2WO0A 3LZAA 1JZDA 3OV4A 2GBWB 2CWTA 2PNCA 3FSDA 2GU3A 3X41A 3NHXA 1MGRA 3CME3 3CNXA 1I70A 3T8UA 2F56A 1S723 2C4BA 5AYSC 1K8A4 2HOHA 3KSED 4N6UA 1AVLA 3MG1A 1BRIA 1TRPA 4OK0A 3IJEB 5M1AA 1OPYA 5EQLA 5BIRA 3UL6A 1GMQA 1EQKA 1FGRA 1ULJB 4I5QA 2W03A 1FGTA 3WOEB 1TRQA 3I563 1ROAA 1WMOA 1QAKA 2XF3A 3AMOB 5AIGA 1W2ZA 1FUWA 2IA7A 1IVXA 3CCV3 4G1MB 1NJI4 4RNZA 1MNLA 1BVIA 1W5ZA 4IT7A 1B2SA 2MF7A 1CEWI 2C10A 3CXC2 4J5KA 6RNTA 1FGOA 3DGNA 1IV7A 1KSIA 2BT3A 3DH2A 3NM2A 1GMPA 2K0MA 1W6YA 3EHCA 3KCHA 1R4CA 5AIIA 4RNYA 3URPA 1ZX2A 3UJMA 1YJN3 1LOWA 1QAFA 2K54A 1BUQA 3K0ZA 5G2GA 3CCM3 1GY6A 2RGQA 3F8HA 1YJ93 3UB1A 2KAAA 2RFRA 3DGMA 3WA2X 3ZFZA 5M18A 3CCJ3 3HIIA 3WODG 4HM0B 1VZZA 5CXOA 4HBRA 4O8SA 1NU3A 5FW5A 5IG4A 1UCJA 3NUVA 2CC3A 1WMNA 2R41A 1MWTA 3CCU3 2P09A 2XR8B 2CFLA 1Q814 3MWZA 2H0GA 4LZIA 3SOYA 1DVDA 3MKIA 2W0QA 1BSCA 3E99A 1VQN3 4FCZA 3DMCA 1PY3A 3DZLA 1VQ73 2IUKA 2W56B 3O8YA 2JDIH 3HK4A 1RGEA 1RJOA 1CH0A 3BB9A 5CF1A 1LXEA 3ER7A 5BXQA 3CC43 3K5TA 3LOYA 1RCKA 1Z1SA 4RNTA 1IVUA 2WOHA 3RNTA 1YIT3 3F40A 1N8R4 3JUPA 1Q40B 4KFEA 1T2IA 2XFSA 1I2FA 4HAAA 1VQ43 1STFI 4ZM8A 4EYCA 1SPUA 1ASKA 4K90B 3X42A 3EBYA 3SOAA 1O7PB 3LYGA 3DGYA 1K9M4 4IPBA 2CWVA 2IMJA 4N6TA 3GZBA 4O3VA 3Q1CA 1ROVA 1DMMA 1WTHA 2Y73A 1BNEA 2XRXB 1LOVA 3D79A 4J5GA 1YNVX 3NX0A 2YX9A 1TJDA 2CKFB 3SX1A 2F4YA 3LT8A 1O7WB 3JUOA 4FCJA 1UI8A 4XBXA 2HMKB 1FA3A 4QWTA 1I8VA 1W7CA 1N9EA 1RGCA 1UCKA 2CH9A 3B7CA 1RN7A 1A2KA 2GU1A 4LEHA 1RRLA 3EC9A 3FF0A 2CK3H 5AYRB 1VQO3 2KF3A 2AAEA 2CFGA 1OCVA 2O9UX 3ZG5A 5M19A 1JB2A 4WYKB 4AKZA 3G4S3 3CCR3 1RRHA 3V99A 4J9AA 4HOHA 3AMOA 2GXFA 1ZS7A 3WHOA 3G6E3 1FZUA 4MEIA 3T8NA 1JN5B 1BRKA 1GD3A 4PEJA 2RNTA 4ILFA 4AKYA 4DKIA 1RKYA 1LNIA 1V74A 4RBNA 1GY7A 1G96A 5D82A 1BNSA 2KXGA 1M904 1OUNA 3WR2A 1W02A 5D83A 3FZWA 1T3BA 2RCDA 2P0XA 1RDSA 1I2EA 2I9WA 5D81A 3RDEA 4WWUC 3DY5A 1C54A 1QJGA 2INXA 1QVG2 2RSXA 1B21A 1NO3A 3PGBA 2GEXA 3X3XA 3N9HA 1RGLA 4STDA 1RGAA 1AQZA 3EF8A 2BHMA 1PYLA 1KQS2 1HU9A 1SIHA 4GB5A 2YFLB 3CCS3 3D5GA 3AGNA 1BIRA 3BU4A 3CU3A 2ZA4A 1WMPA 4GL6A 4K1VA 2YFJB 3ECFA 1I2GA 1RMSA 2CIUA 1KD14 3FCSB 3CCL3 3VF1A 4R9LA 4CJNA 1IQ8A 1TU5A 3D3LA 1JBRA 3S27A 3AHSA 1OHPA 4N6NB 5IG5A 1V57A 3QK9A 7RNTA 5HGRA 1VQ53 2OQEC 3RGRA 1I3FA 1N5PA 2QA43 2KRTA 3EN1B 3KZTA 2BO9B 7GSPA 1A2VA 2W56A 2ML6A 3G713 1JB5A 2L1SA 1TFKA 3HX8A 1UUGB 1E97A 2BMQB 3CC23 3NXJA 8CHOA 3PZWA 1STDA 3BNEA 3S28A 1A2PA 1BGSA 3UL5A 1Q42A 4LGQA 3DGLA 1VQQA 3DGOA 1GY5A 3PXMA 1ULIB 4KZ1A 1D6ZA 1FGQA 1JBTA 1VQP3 1DMNA 1TUHA 2QIYA 1JZOA 4FMBA 4N6V0 1RLSA 3FG4A 3F14A 1E3VA 5LC7A 1DVCA 3DUKA
chains in the Genus database with same CATH topology
1RNBA 1LRAA 1RGEA 1AY7A 1CH0A 1DETA 1LOYA 4BU4A 6GSPA 5HOHA 1BNGA 1ZGXA 4RNTA 1RCKA 1G02A 3Q3FA 3RNTA 1RCLA 1X1WA 1BAOA 1T2IA 3BIRA 1I2FA 4HAAA 3AGOA 1GMRA 1R4YA 1BSEA 2KF5A 1MGWA 1IYYA 1Q9EA 1FUTA 1BRNL 3DGYA 5RNTA 1B3SA 1HYFA 1I0VA 1RSNA 1RNTA 4J5GA 1BNEA 1FYSA 1LOVA 1YVSA 2RBIA 3D4AA 3GSPA 1B2XA 1YNVX 1BRGA 1RHLA 1T2HA 2F4YA 1RGGA 1BNFA 1SARA 1BNIA 1RGKA 2BU4A 9RNTA 2GSPA 3SYUA 1I8VA 1RGCA 1UCKA 1I3IA 1TTOA 1BSAA 2KF3A 4BIRA 2AAEA 4GHOA 2KF4A 1BSDA 1BRJA 2F5MA 4HOHA 3WHOA 1BANA 1FZUA 3HOHA 1UCLA 1UCIA 1MGRA 1X1XA 1BRKA 1JBSA 1I70A 2RNTA 1LNIA 2F56A 2C4BA 2BIRA 1BNSA 2HOHA 3WR2A 1BU4A 1X1YA 1BRIA 1TRPA 1RGFA 2SARA 1RDSA 1I2EA 2KF6A 3AHWA 5BIRA 2F5WA 1B27A 1C54A 1BNJA 1GMQA 1FW7A 1B20A 1B21A 1RTUA 1YGWA 1TRQA 1RGLA 1RGAA 1AQZA 1FUSA 5GSPA 1PYLA 3D5GA 3AGNA 1BIRA 1B2MA 3BU4A 2ZA4A 1BRSA 1GOVA 2AADA 4GSPA 5BU4A 1BVIA 1I2GA 1B2SA 1RMSA 4J5KA 1HZ1A 1B2ZA 6RNTA 3DH2A 1GMPA 3A5EA 3KCHA 1JBRA 3URPA 8RNTA 3AHSA 1LOWA 7RNTA 1RN1A 1I3FA 1BOXA 1GOYA 7GSPA 2KAAA 1BNRA 1RGHA 1BSBA 1BUJA 1RN4A 1A2PA 1BGSA 1UCJA 1GOUA 1BRHA 3D5IA 1X1UA 1DE3A 1I0XA 1JBTA 1GSPA 1BSCA 1RLSA 1B2UA 1PY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNB A;  1LRA A;  1RGE A;  1AY7 A;  1CH0 A;  1DET A;  1LOY A;  4BU4 A;  6GSP A;  5HOH A;  1BNG A;  1ZGX A;  4RNT A;  1RCK A;  1G02 A;  3Q3F A;  3RNT A;  1RCL A;  1X1W A;  1BAO A;  1T2I A;  3BIR A;  1I2F A;  4HAA A;  3AGO A;  1GMR A;  1R4Y A;  1BSE A;  2KF5 A;  1MGW A;  1IYY A;  1Q9E A;  1FUT A;  1BRN L;  3DGY A;  5RNT A;  1B3S A;  1HYF A;  1I0V A;  1RSN A;  1RNT A;  4J5G A;  1BNE A;  1FYS A;  1LOV A;  1YVS A;  2RBI A;  3D4A A;  3GSP A;  1B2X A;  1YNV X;  1BRG A;  1RHL A;  1T2H A;  2F4Y A;  1RGG A;  1BNF A;  1SAR A;  1BNI A;  1RGK A;  2BU4 A;  9RNT A;  2GSP A;  3SYU A;  1I8V A;  1RGC A;  1UCK A;  1I3I A;  1TTO A;  1BSA A;  2KF3 A;  4BIR A;  2AAE A;  4GHO A;  2KF4 A;  1BSD A;  1BRJ A;  2F5M A;  4HOH A;  3WHO A;  1BAN A;  1FZU A;  3HOH A;  1UCL A;  1UCI A;  1MGR A;  1X1X A;  1BRK A;  1JBS A;  1I70 A;  2RNT A;  1LNI A;  2F56 A;  2C4B A;  2BIR A;  1BNS A;  2HOH A;  3WR2 A;  1BU4 A;  1X1Y A;  1BRI A;  1TRP A;  1RGF A;  2SAR A;  1RDS A;  1I2E A;  2KF6 A;  3AHW A;  5BIR A;  2F5W A;  1B27 A;  1C54 A;  1BNJ A;  1GMQ A;  1FW7 A;  1B20 A;  1B21 A;  1RTU A;  1YGW A;  1TRQ A;  1RGL A;  1RGA A;  1AQZ A;  1FUS A;  5GSP A;  1PYL A;  3D5G A;  3AGN A;  1BIR A;  1B2M A;  3BU4 A;  2ZA4 A;  1BRS A;  1GOV A;  2AAD A;  4GSP A;  5BU4 A;  1BVI A;  1I2G A;  1B2S A;  1RMS A;  4J5K A;  1HZ1 A;  1B2Z A;  6RNT A;  3DH2 A;  1GMP A;  3A5E A;  3KCH A;  1JBR A;  3URP A;  8RNT A;  3AHS A;  1LOW A;  7RNT A;  1RN1 A;  1I3F A;  1BOX A;  1GOY A;  7GSP A;  2KAA A;  1BNR A;  1RGH A;  1BSB A;  1BUJ A;  1RN4 A;  1A2P A;  1BGS A;  1UCJ A;  1GOU A;  1BRH A;  3D5I A;  1X1U A;  1DE3 A;  1I0X A;  1JBT A;  1GSP A;  1BSC A;  1RLS A;  1B2U A;  1PY3 A; 
#chains in the Genus database with same CATH topology
 1MWS A;  2JQ5 A;  3KFQ C;  1RNB A;  1WNH A;  3H51 A;  4N6M A;  1K28 A;  3N54 B;  3H3H A;  4HM4 B;  1IDP A;  3BNC A;  1NWW A;  3NQZ A;  5TGN A;  6GSP A;  1NNV A;  5G1K A;  3CCE 3;  1OGZ A;  4L8P A;  3CD6 3;  2XFT A;  1VQ9 3;  4FCM A;  4IIA A;  1RCL A;  1X1W A;  1JB4 A;  1BAO A;  3CNM A;  1JKG A;  2FNQ A;  2Z77 A;  1US1 A;  1MOL A;  2C11 A;  2OOV C;  3BIR A;  2D42 A;  1CQS A;  1IVV A;  2CFW A;  3AGO A;  4R9K A;  4HM7 B;  5IG0 A;  4EV2 A;  5IEN A;  1BSE A;  4FMC A;  1YIJ 3;  3MG3 A;  5IER A;  5AEU B;  4BTX A;  5BVB A;  4HVN A;  5RNT A;  1B3S A;  1D6U A;  3ROB A;  4EXR A;  1YHQ 3;  3LTA A;  1L5G B;  1M1K 4;  1RNT A;  4HZB B;  2W9P A;  4XDW A;  1LQG C;  1JNQ A;  3K9M C;  1YVS A;  1B2X A;  2P0M A;  1T2H A;  3PYJ A;  1JN5 A;  3OWY A;  3EBT A;  2BU4 A;  6STD A;  3PCS A;  2OOV A;  4K1U A;  1I3I A;  2HMN B;  3S5C A;  1TTO A;  2KCD A;  2E2U A;  3IMA B;  4BIR A;  1OAC A;  4XBY A;  1BSD A;  2F5M A;  1VQ6 3;  5LC6 A;  4XDV A;  2QGU A;  4XM4 A;  3L0R A;  3LTB A;  4EC6 A;  4LMI A;  4HM3 B;  2M7O A;  2GEY A;  3Q2P A;  4I4K A;  3TDG A;  3B4P A;  3FG3 A;  3LXU X;  3X3Z A;  3HOH A;  1UCI A;  1X1X A;  1W00 A;  2W2C A;  1AR0 A;  2FGT A;  1M9G A;  1BU4 A;  4BL3 A;  1IVW A;  3LTD A;  1RGF A;  5DRE A;  3T0U A;  2SAR A;  5STD A;  3NV0 B;  2V1L A;  2KF6 A;  3MG2 A;  3MHE A;  1W01 A;  3PS8 A;  4U13 A;  1B27 A;  1BNJ A;  1K41 A;  1W6G A;  5EEO A;  3BLZ A;  1YGW A;  1IT7 A;  3S67 A;  2CX1 A;  2XEP A;  1FUS A;  5GSP A;  4EV5 A;  4CPK A;  1MWR A;  1W6C A;  3F7S A;  1NB5 I;  3NBR A;  3JUM A;  1BRS A;  1GOV A;  1UGI A;  2A15 A;  2IYJ A;  2STD A;  4GSP A;  3G8Z A;  3EN8 A;  3FH1 A;  1PU4 A;  3S29 A;  2Q07 A;  3CPO A;  2CX0 A;  1HZ1 A;  2BMO B;  1YVB I;  2W6J H;  5ELJ A;  5KP1 A;  3FF2 A;  3SED A;  3WMD A;  3D9R A;  3GWR A;  5IEO A;  3U97 A;  3VSY A;  2F99 A;  5IG3 A;  4O2H A;  3KN4 A;  1ZO2 A;  3GRD A;  1GOY A;  1BNR A;  4FMA A;  3PCR A;  2D1W A;  2OWP A;  4L8O A;  3LTC A;  2W9Q A;  4CCV A;  3GZY B;  3FG1 A;  3JUN A;  4KFF A;  1JRQ A;  4KFD A;  4FR9 A;  4OVM A;  3OXA A;  4HM2 B;  5G1L A;  3OW2 2;  1BRH A;  4ORL A;  2ZDJ A;  5ELU A;  1LQM B;  3WA3 A;  2UX0 A;  1VQM 3;  4MJD A;  2BNG A;  4N3V A;  3OWS A;  4N6O B;  1GSP A;  3EJV A;  1ISK A;  2LQV A;  4X2O A;  2O3O A;  3JUQ A;  1LOX A;  2F98 A;  3B4O A;  2CFD A;  4HM8 B;  1IQY A;  1TFO A;  3MYT A;  4KVH A;  1AY7 A;  1DET A;  1HKX A;  1LOY A;  3K63 A;  5KP3 A;  3I55 3;  1W2B 2;  1O7G B;  1UDI I;  2P05 A;  3BND A;  1A67 A;  1G02 A;  5A0O B;  2OTL 3;  3G0K A;  5IEP A;  1W4N A;  1VQL 3;  1Q86 4;  2E2T A;  1EUI C;  2CWU A;  1R4Y A;  2KF5 A;  1IV9 A;  1TIJ A;  4JRF A;  1LNH A;  4HM5 B;  1MGW A;  2Z6B A;  1UI7 A;  1Q9E A;  4X2H A;  1FUT A;  1Q40 A;  1IQX A;  1N5H A;  3QRD A;  5DRV A;  2R4I A;  3I0Y A;  4N6L A;  1HYF A;  3X40 A;  1IT8 A;  2Y74 A;  3HZP A;  3KSP A;  2PZV A;  3DM8 A;  5JPU A;  2E2V A;  3GSP A;  1Y4K A;  1BRG A;  1RHL A;  2OQE A;  3CCQ 3;  3ZG0 A;  1BNF A;  3A76 A;  3F9S A;  2XSO B;  3IPT A;  1S5A A;  2IUJ A;  9RNT A;  1M1X B;  3MPH A;  3CPW 2;  3SYU A;  4FMD A;  4HM1 B;  4R1K A;  3U1W A;  1QMA A;  4BTY A;  2Z7A A;  1UGH I;  1UW1 A;  3NV0 A;  3V98 A;  1KWI A;  2HMJ B;  1O7N B;  3KE7 A;  1IU7 A;  3KII A;  3OX9 A;  4WFO A;  2CHC A;  3SXX A;  1J2B A;  3GZR A;  1VQ8 3;  3LT9 A;  3JVC A;  1BAN A;  1UCL A;  2B1X B;  4WP5 A;  4NHF A;  3K7C A;  1K73 4;  2ZHX B;  1JBS A;  1OGX A;  4WYK A;  4MMX B;  2IY2 A;  3J7Y d;  2BIR A;  1WQL B;  3CC7 3;  1X1Y A;  2WGQ A;  4BTW A;  1SJW A;  5CK6 A;  1JV2 B;  3AHW A;  1OF5 B;  2F5W A;  1E3R A;  1FW7 A;  1B20 A;  3SVA A;  3EE1 A;  1Q7Y 4;  1RTU A;  4KT3 B;  1GS3 A;  4AEQ A;  1U5O A;  3FLJ A;  3V92 A;  2XGN A;  2ML5 A;  4MMZ B;  1D6Y A;  1GD4 A;  4RZM A;  3G16 A;  1B2M A;  1SQW A;  2AAD A;  4TX4 A;  5BU4 A;  4CDL A;  3RGA A;  2CG0 A;  2HML B;  2K3D A;  3BNB A;  4H3U A;  1MWU A;  1B2Z A;  4K61 A;  2J8X B;  3HIG A;  4NPB A;  4EW5 A;  3A5E A;  2SBL A;  5AI1 A;  1Q82 4;  2UUG C;  2F86 B;  2ZL8 A;  3F8X A;  8RNT A;  1Q7H A;  4HKV B;  5AIH A;  1YJW 3;  1AV4 A;  3EX9 A;  1RN1 A;  4Q53 A;  5JPP A;  3UNL A;  2FXT A;  4NRE A;  5CLK A;  3NBB A;  5AIF A;  1BOX A;  4XB5 A;  2XGL A;  4O02 B;  5I97 A;  1N8Q A;  4J8T A;  1RGH A;  1BSB A;  4WHA A;  1BUJ A;  2P38 A;  1RN4 A;  1NDO B;  3F7X A;  3B8L A;  1SII A;  1GOU A;  2CFK A;  2H0I A;  3VGN A;  1NB3 I;  1U8C B;  3D5I A;  1X1U A;  5EVH A;  1PFP A;  1DE3 A;  1I0X A;  4HYZ A;  5IF6 A;  1O7H B;  4R80 A;  5CF2 A;  1UUV B;  1F8N A;  1YGE A;  2GBX B;  2OCT A;  2H0H A;  3MSO A;  1GYB A;  3M8C A;  4JF8 A;  2L4V A;  1B2U A;  1TP6 A;  1O7M B;  3FKA A;  4BL2 A;  2QEX 3;  1QVF 2;  2OTJ 3;  1LRA A;  2BMR B;  1C7H A;  1AVK A;  4EBG A;  1IK3 A;  1JKG B;  3GZX B;  1YI2 3;  4BU4 A;  3Q90 A;  5HOH A;  1OHO A;  3GAX A;  1BNG A;  3WOF B;  2B24 B;  1ZGX A;  1OH0 A;  3Q3F A;  4HJL B;  4LYL B;  5AEW B;  2CW9 A;  4HZ9 B;  4LSO A;  3WDG B;  1T5Y A;  1GMR A;  2XSH B;  2HMM B;  1G0T A;  2WOF A;  3ALA A;  3DXO A;  1EKM A;  3EQQ B;  3LML A;  1UUW B;  3STD A;  1IYY A;  1BRN L;  3FGY A;  1JJ2 2;  1LVN A;  2WGO A;  3KKG A;  3NQY A;  5IW9 A;  1I0V A;  2CG1 A;  1QAL A;  1RSN A;  1N9J A;  1DYU A;  2W04 A;  3NM7 A;  5KP4 A;  1FYS A;  2RBI A;  3D4A A;  2YFI B;  3HI7 A;  3NBJ A;  1FGM A;  4L7K A;  3EB8 A;  1EEJ A;  3OWU A;  5FGO A;  4MMY B;  1RGG A;  2MC8 A;  1VQK 3;  1SAR A;  1V58 A;  1BNI A;  1RGK A;  3N8B A;  2UGI A;  3SLU A;  1CYV A;  2GSP A;  3CMA 3;  1A90 A;  4XBT A;  1EA2 A;  5JBS A;  2LYX A;  2HMO B;  1KC8 4;  4OUQ A;  4HM6 B;  3X3Y A;  2XH9 A;  1BSA A;  1OHS A;  1CYU A;  1OF5 A;  4H61 A;  1DMQ A;  1EG9 B;  7STD A;  4GHO A;  2KF4 A;  4R4K A;  1BRJ A;  3LH4 A;  2Z76 A;  2WO0 A;  3LZA A;  1JZD A;  3OV4 A;  2GBW B;  2CWT A;  2PNC A;  3FSD A;  2GU3 A;  3X41 A;  3NHX A;  1MGR A;  3CME 3;  3CNX A;  1I70 A;  3T8U A;  2F56 A;  1S72 3;  2C4B A;  5AYS C;  1K8A 4;  2HOH A;  3KSE D;  4N6U A;  1AVL A;  3MG1 A;  1BRI A;  1TRP A;  4OK0 A;  3IJE B;  5M1A A;  1OPY A;  5EQL A;  5BIR A;  3UL6 A;  1GMQ A;  1EQK A;  1FGR A;  1ULJ B;  4I5Q A;  2W03 A;  1FGT A;  3WOE B;  1TRQ A;  3I56 3;  1ROA A;  1WMO A;  1QAK A;  2XF3 A;  3AMO B;  5AIG A;  1W2Z A;  1FUW A;  2IA7 A;  1IVX A;  3CCV 3;  4G1M B;  1NJI 4;  4RNZ A;  1MNL A;  1BVI A;  1W5Z A;  4IT7 A;  1B2S A;  2MF7 A;  1CEW I;  2C10 A;  3CXC 2;  4J5K A;  6RNT A;  1FGO A;  3DGN A;  1IV7 A;  1KSI A;  2BT3 A;  3DH2 A;  3NM2 A;  1GMP A;  2K0M A;  1W6Y A;  3EHC A;  3KCH A;  1R4C A;  5AII A;  4RNY A;  3URP A;  1ZX2 A;  3UJM A;  1YJN 3;  1LOW A;  1QAF A;  2K54 A;  1BUQ A;  3K0Z A;  5G2G A;  3CCM 3;  1GY6 A;  2RGQ A;  3F8H A;  1YJ9 3;  3UB1 A;  2KAA A;  2RFR A;  3DGM A;  3WA2 X;  3ZFZ A;  5M18 A;  3CCJ 3;  3HII A;  3WOD G;  4HM0 B;  1VZZ A;  5CXO A;  4HBR A;  4O8S A;  1NU3 A;  5FW5 A;  5IG4 A;  1UCJ A;  3NUV A;  2CC3 A;  1WMN A;  2R41 A;  1MWT A;  3CCU 3;  2P09 A;  2XR8 B;  2CFL A;  1Q81 4;  3MWZ A;  2H0G A;  4LZI A;  3SOY A;  1DVD A;  3MKI A;  2W0Q A;  1BSC A;  3E99 A;  1VQN 3;  4FCZ A;  3DMC A;  1PY3 A;  3DZL A;  1VQ7 3;  2IUK A;  2W56 B;  3O8Y A;  2JDI H;  3HK4 A;  1RGE A;  1RJO A;  1CH0 A;  3BB9 A;  5CF1 A;  1LXE A;  3ER7 A;  5BXQ A;  3CC4 3;  3K5T A;  3LOY A;  1RCK A;  1Z1S A;  4RNT A;  1IVU A;  2WOH A;  3RNT A;  1YIT 3;  3F40 A;  1N8R 4;  3JUP A;  1Q40 B;  4KFE A;  1T2I A;  2XFS A;  1I2F A;  4HAA A;  1VQ4 3;  1STF I;  4ZM8 A;  4EYC A;  1SPU A;  1ASK A;  4K90 B;  3X42 A;  3EBY A;  3SOA A;  1O7P B;  3LYG A;  3DGY A;  1K9M 4;  4IPB A;  2CWV A;  2IMJ A;  4N6T A;  3GZB A;  4O3V A;  3Q1C A;  1ROV A;  1DMM A;  1WTH A;  2Y73 A;  1BNE A;  2XRX B;  1LOV A;  3D79 A;  4J5G A;  1YNV X;  3NX0 A;  2YX9 A;  1TJD A;  2CKF B;  3SX1 A;  2F4Y A;  3LT8 A;  1O7W B;  3JUO A;  4FCJ A;  1UI8 A;  4XBX A;  2HMK B;  1FA3 A;  4QWT A;  1I8V A;  1W7C A;  1N9E A;  1RGC A;  1UCK A;  2CH9 A;  3B7C A;  1RN7 A;  1A2K A;  2GU1 A;  4LEH A;  1RRL A;  3EC9 A;  3FF0 A;  2CK3 H;  5AYR B;  1VQO 3;  2KF3 A;  2AAE A;  2CFG A;  1OCV A;  2O9U X;  3ZG5 A;  5M19 A;  1JB2 A;  4WYK B;  4AKZ A;  3G4S 3;  3CCR 3;  1RRH A;  3V99 A;  4J9A A;  4HOH A;  3AMO A;  2GXF A;  1ZS7 A;  3WHO A;  3G6E 3;  1FZU A;  4MEI A;  3T8N A;  1JN5 B;  1BRK A;  1GD3 A;  4PEJ A;  2RNT A;  4ILF A;  4AKY A;  4DKI A;  1RKY A;  1LNI A;  1V74 A;  4RBN A;  1GY7 A;  1G96 A;  5D82 A;  1BNS A;  2KXG A;  1M90 4;  1OUN A;  3WR2 A;  1W02 A;  5D83 A;  3FZW A;  1T3B A;  2RCD A;  2P0X A;  1RDS A;  1I2E A;  2I9W A;  5D81 A;  3RDE A;  4WWU C;  3DY5 A;  1C54 A;  1QJG A;  2INX A;  1QVG 2;  2RSX A;  1B21 A;  1NO3 A;  3PGB A;  2GEX A;  3X3X A;  3N9H A;  1RGL A;  4STD A;  1RGA A;  1AQZ A;  3EF8 A;  2BHM A;  1PYL A;  1KQS 2;  1HU9 A;  1SIH A;  4GB5 A;  2YFL B;  3CCS 3;  3D5G A;  3AGN A;  1BIR A;  3BU4 A;  3CU3 A;  2ZA4 A;  1WMP A;  4GL6 A;  4K1V A;  2YFJ B;  3ECF A;  1I2G A;  1RMS A;  2CIU A;  1KD1 4;  3FCS B;  3CCL 3;  3VF1 A;  4R9L A;  4CJN A;  1IQ8 A;  1TU5 A;  3D3L A;  1JBR A;  3S27 A;  3AHS A;  1OHP A;  4N6N B;  5IG5 A;  1V57 A;  3QK9 A;  7RNT A;  5HGR A;  1VQ5 3;  2OQE C;  3RGR A;  1I3F A;  1N5P A;  2QA4 3;  2KRT A;  3EN1 B;  3KZT A;  2BO9 B;  7GSP A;  1A2V A;  2W56 A;  2ML6 A;  3G71 3;  1JB5 A;  2L1S A;  1TFK A;  3HX8 A;  1UUG B;  1E97 A;  2BMQ B;  3CC2 3;  3NXJ A;  8CHO A;  3PZW A;  1STD A;  3BNE A;  3S28 A;  1A2P A;  1BGS A;  3UL5 A;  1Q42 A;  4LGQ A;  3DGL A;  1VQQ A;  3DGO A;  1GY5 A;  3PXM A;  1ULI B;  4KZ1 A;  1D6Z A;  1FGQ A;  1JBT A;  1VQP 3;  1DMN A;  1TUH A;  2QIY A;  1JZO A;  4FMB A;  4N6V 0;  1RLS A;  3FG4 A;  3F14 A;  1E3V A;  5LC7 A;  1DVC A;  3DUK A; 
#chains in the Genus database with same CATH homology
 1RNB A;  1LRA A;  1RGE A;  1AY7 A;  1CH0 A;  1DET A;  1LOY A;  4BU4 A;  6GSP A;  5HOH A;  1BNG A;  1ZGX A;  4RNT A;  1RCK A;  1G02 A;  3Q3F A;  3RNT A;  1RCL A;  1X1W A;  1BAO A;  1T2I A;  3BIR A;  1I2F A;  4HAA A;  3AGO A;  1GMR A;  1R4Y A;  1BSE A;  2KF5 A;  1MGW A;  1IYY A;  1Q9E A;  1FUT A;  1BRN L;  3DGY A;  5RNT A;  1B3S A;  1HYF A;  1I0V A;  1RSN A;  1RNT A;  4J5G A;  1BNE A;  1FYS A;  1LOV A;  1YVS A;  2RBI A;  3D4A A;  3GSP A;  1B2X A;  1YNV X;  1BRG A;  1RHL A;  1T2H A;  2F4Y A;  1RGG A;  1BNF A;  1SAR A;  1BNI A;  1RGK A;  2BU4 A;  9RNT A;  2GSP A;  3SYU A;  1I8V A;  1RGC A;  1UCK A;  1I3I A;  1TTO A;  1BSA A;  2KF3 A;  4BIR A;  2AAE A;  4GHO A;  2KF4 A;  1BSD A;  1BRJ A;  2F5M A;  4HOH A;  3WHO A;  1BAN A;  1FZU A;  3HOH A;  1UCL A;  1UCI A;  1MGR A;  1X1X A;  1BRK A;  1JBS A;  1I70 A;  2RNT A;  1LNI A;  2F56 A;  2C4B A;  2BIR A;  1BNS A;  2HOH A;  3WR2 A;  1BU4 A;  1X1Y A;  1BRI A;  1TRP A;  1RGF A;  2SAR A;  1RDS A;  1I2E A;  2KF6 A;  3AHW A;  5BIR A;  2F5W A;  1B27 A;  1C54 A;  1BNJ A;  1GMQ A;  1FW7 A;  1B20 A;  1B21 A;  1RTU A;  1YGW A;  1TRQ A;  1RGL A;  1RGA A;  1AQZ A;  1FUS A;  5GSP A;  1PYL A;  3D5G A;  3AGN A;  1BIR A;  1B2M A;  3BU4 A;  2ZA4 A;  1BRS A;  1GOV A;  2AAD A;  4GSP A;  5BU4 A;  1BVI A;  1I2G A;  1B2S A;  1RMS A;  4J5K A;  1HZ1 A;  1B2Z A;  6RNT A;  3DH2 A;  1GMP A;  3A5E A;  3KCH A;  1JBR A;  3URP A;  8RNT A;  3AHS A;  1LOW A;  7RNT A;  1RN1 A;  1I3F A;  1BOX A;  1GOY A;  7GSP A;  2KAA A;  1BNR A;  1RGH A;  1BSB A;  1BUJ A;  1RN4 A;  1A2P A;  1BGS A;  1UCJ A;  1GOU A;  1BRH A;  3D5I A;  1X1U A;  1DE3 A;  1I0X A;  1JBT A;  1GSP A;  1BSC A;  1RLS A;  1B2U A;  1PY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...