1HZ1A

Ribonuclease t1 v16a mutant in complex with mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
molecule keywords RIBONUCLEASE T1
source organism Aspergillus niger
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1hz1A00
4J5GA 1GMQA 1GMRA 1I70A 1I2EA 1UCLA 1JBTA 1FW7A 1RN1A 2C4BA 1B2UA 1B20A 1PYLA 1A2PA 7RNTA 2SARA 4HAAA 1X1WA 1BNSA 7GSPA 1T2HA 1JBRA 1GMPA 3URPA 1C54A 1BAOA 1RCLA 1B2MA 8RNTA 1G02A 9RNTA 5HOHA 1BUJA 3WHOA 1I2FA 3D5GA 2RBIA 1FUTA 1X1YA 3DH2A 3KCHA 1BSEA 2BIRA 1BNJA 1BNGA 1I2GA 3RNTA 1LOWA 1ZGXA 1LNIA 2BU4A 1BNFA 1FUSA 2F56A 1BNRA 1BOXA 3D4AA 3D5IA 5RNTA 1PY3A 2ZA4A 1RLSA 2AAEA 1TRPA 4BU4A 1RNTA 1BU4A 1AQZA 4J5KA 1HZ1A 4GHOA 1I0VA 1RGAA 4HOHA 3AHWA 2KF6A 3WR2A 2HOHA 1RTUA 1I3IA 1RCKA 3SYUA 3GSPA 2AADA 1RMSA 1BRHA 1RGHA 1TTOA 1AY7A 1IYYA 1MGWA 1BIRA 1BNIA 1RGLA 1UCJA 1I8VA 3DGYA 1LOYA 1FZUA 1RNBA 1BRSA 1BVIA 1BNEA 1BSDA 3HOHA 1R4YA 3AGOA 2F5MA 1RHLA 1GSPA 1T2IA 2KF5A 1BRJA 4RNTA 1BANA 1B2XA 1YVSA 1X1XA 1BRIA 3BIRA 1BSAA 1UCKA 1RGEA 1LRAA 1RDSA 1I3FA 3BU4A 1BSBA 1RN4A 1B21A 4BIRA 1UCIA 2RNTA 1RGGA 5GSPA 1BRGA 1BRNL 1BSCA 1LOVA 1B2SA 1B27A 1GOUA 2GSPA 1RGCA 1TRQA 2KAAA 3AHSA 5BIRA 1BGSA 1CH0A 1RGFA 2KF4A 3AGNA 2F4YA 1DE3A 1SARA 1B2ZA 4GSPA 1MGRA 1YGWA 3Q3FA 1X1UA 1YNVX 1DETA 6GSPA 1GOYA 2KF3A 6RNTA 1FYSA 1BRKA 5BU4A 1B3SA 1HYFA 1RGKA 1JBSA 3A5EA 1GOVA 1RSNA 2F5WA 1I0XA 1Q9EA
chains in the Genus database with same CATH superfamily
1V57A 1GMRA 1O7MB 1A2VA 1DYUA 2ML6A 1RN1A 4OK0A 2CH9A 2R41A 2E2VA 1B2UA 1PYLA 3PYJA 2Z77A 5G1KA 2CFGA 4XDVA 3CC73 2SARA 5CF1A 4K90B 1VQP3 1FGOA 1ZX2A 1SJWA 4G1MB 2D42A 2CG0A 1IQ8A 4ZM8A 2W6JH 4CDLA 5IG3A 1BAOA 3LTCA 1RCLA 4XM4A 3KSPA 1NB5I 1G02A 3WMDA 9RNTA 5HOHA 2RCDA 2GU1A 3WHOA 1US1A 3D5GA 4MMZB 6STDA 3DH2A 3MSOA 1N9JA 2Q07A 1BSEA 1GYBA 3DUKA 5LC6A 1BNGA 2F98A 2XF3A 1PU4A 1I2GA 4WP5A 1GY6A 3S5CA 2ML5A 3M8CA 3WA2X 2OCTA 5G1LA 4HVNA 4KFDA 1NWWA 2O3OA 3T0UA 1JRQA 1STFI 1Y4KA 2C11A 3CC43 5RNTA 2FGTA 5IG4A 3J7Yd 5KP1A 3F9SA 4EV5A 1PFPA 1RNTA 1BU4A 4CJNA 2CFDA 3FG3A 3OWYA 1I0VA 1RGAA 3LZAA 4FCJA 8CHOA 1JNQA 1SQWA 3AHWA 4HOHA 4N6UA 3WR2A 2CWUA 4DKIA 1DMMA 2B24B 1GS3A 1DMNA 1RTUA 4XBTA 3EHCA 1D6UA 2F86B 3LXUX 3SOAA 3UL5A 3GRDA 3GSPA 2WO0A 3GZXB 5STDA 1RMSA 2MF7A 2PZVA 5BVBA 1ROAA 1ROVA 2UX0A 2RSXA 3KKGA 3NXJA 3PCSA 1UUWB 1FZUA 3H3HA 4MMYB 1UW1A 5JPUA 1BVIA 1JN5B 3G713 2H0GA 1LNHA 1R4CA 3PCRA 3NUVA 3QK9A 1B2XA 1YVSA 1OCVA 1X1XA 1AR0A 3CPOA 3HIIA 3FGYA 1OHOA 2OOVA 3CCL3 1UCKA 1RGEA 4Q53A 1RDSA 1KC84 4HYZA 1I3FA 2W04A 3X40A 2A15A 1RN4A 1VQ73 1WMNA 3Q90A 3KN4A 3CCE3 3HI7A 2BMOB 3JUNA 3WOFB 5FW5A 1TJDA 1BRNL 1BSCA 4WFOA 3CCU3 1E97A 1AVLA 2P0XA 1RGCA 1U8CB 1TRQA 1VQK3 3AHSA 1KWIA 1RGFA 2F4YA 4HM2B 3OW22 3UB1A 1VQ83 3UNLA 1M1K4 1B2ZA 3LTAA 2W9PA 1DVCA 1U5OA 1YGWA 1JZOA 2GU3A 4JF8A 1FGQA 1M9GA 1W00A 3QRDA 1DETA 2GBXB 5I97A 3CME3 2P0MA 2KF3A 3IPTA 4PEJA 2JDIH 4NHFA 5BU4A 1B3SA 3JUQA 1VQ43 2CW9A 2GXFA 5D83A 1RGKA 3H51A 3LT8A 1JBSA 1IDPA 3PGBA 1Q814 4CCVA 2F5WA 3JVCA 4N3VA 4EV2A 1JBTA 1CYUA 4J5GA 1FW7A 1UCLA 1I70A 1WMOA 2YFJB 3LTDA 4H3UA 1D6YA 1QVG2 2C4BA 1K41A 2RFRA 4HM3B 3TDGA 1WMPA 3FKAA 2YFIB 4RBNA 3MHEA 5IEPA 1CEWI 2GEYA 1Q40B 3LH4A 2CWVA 1JV2B 1BNSA 2K3DA 3EN8A 1Q40A 5AEWB 1EQKA 1O7WB 1IVXA 1LQGC 1GMPA 1S5AA 2KXGA 2XSOB 1LVNA 1TIJA 3MG3A 2XR8B 3OV4A 4O3VA 2R4IA 1B2MA 1MNLA 4HM8B 1VQN3 3B4PA 4LMIA 2W9QA 4HM5B 4ILFA 3HX8A 1BUJA 5AIFA 2M7OA 1I2FA 3D79A 3K9MC 5CF2A 4QWTA 1V58A 3UJMA 3K0ZA 1X1YA 1C7HA 1GD4A 3LMLA 1BNJA 3BNBA 3BNDA 4NREA 1ZGXA 4N6LA 5JPPA 4HM4B 1RJOA 1BNFA 2F56A 2GEXA 3MWZA 4XBXA 1BNRA 1M904 1BOXA 3D4AA 3KZTA 4KFEA 1PY3A 1RLSA 2AAEA 1TRPA 2ZDJA 3FZWA 3T8UA 1FGRA 3A76A 3V99A 4BU4A 1UUGB 1VQ53 1LQMB 3NQYA 3S27A 7STDA 3L0RA 5A0OB 4J8TA 1TU5A 3MPHA 2C10A 1JB4A 3SYUA 3PXMA 3U97A 1STDA 1YJ93 2YFLB 3DXOA 3SX1A 3EB8A 2CC3A 2O9UX 3EC9A 4CPKA 3G8ZA 5EEOA 1AY7A 5CXOA 2IYJA 1BNIA 1UCJA 5M19A 3F8HA 1MOLA 1I8VA 1OACA 3N9HA 1JKGB 1LOYA 3G6E3 2H0IA 1KD14 4LEHA 1VQ93 1BNEA 1JKGA 1ISKA 2Z6BA 3AGOA 3SOYA 1JZDA 4R4KA 3I563 1GSPA 4XDWA 1WNHA 2KF5A 3F8XA 1UI7A 4KVHA 4I4KA 3KSED 2IUKA 1BANA 1M1XB 1BRIA 3ZG0A 1UDII 4AEQA 1BSAA 4GB5A 1L5GB 4HZ9B 1VQL3 2OQEC 2V1LA 3WA3A 3G16A 1EA2A 1N5HA 1O7HB 4XB5A 3JUMA 4BIRA 1UUVB 1VQO3 1UCIA 1UI8A 1RGGA 4FCZA 4FMAA 5FGOA 4IPBA 5GSPA 1BRGA 3IJEB 1OHPA 1W2ZA 2BT3A 1LOVA 4KT3B 1IK3A 1GOUA 2JQ5A 3WDGB 3FF0A 5BIRA 1BGSA 3NBJA 3HK4A 4H61A 1NB3I 4O8SA 1QMAA 1YGEA 4GSPA 4LZIA 3EF8A 3ER7A 3K63A 1WQLB 3Q3FA 4XBYA 1JN5A 5CLKA 1A90A 1O7PB 1QVF2 2FNQA 4HKVB 1YI23 3NBBA 1FYSA 3DMCA 1BRKA 2IA7A 3WODG 4AKZA 5IERA 1OGXA 1HYFA 2IMJA 2XSHB 4L7KA 1VQQA 2CFWA 1YVBI 1UGIA 1IVUA 1Q9EA 4FMCA 1ZS7A 4OUQA 1OH0A 4WYKB 1NJI4 1GMQA 1J2BA 1I2EA 3K5TA 3MYTA 3CCM3 1W4NA 4WYKA 1Q864 1QJGA 4HM1B 3ZFZA 1B20A 3B4OA 2CX1A 7RNTA 3B7CA 2F99A 3RDEA 2BO9B 2W0QA 4HAAA 4N6NB 2QGUA 7GSPA 1E3RA 1TP6A 5M1AA 1T2HA 3D3LA 3GZYB 3NBRA 3VGNA 3ALAA 2L4VA 5BXQA 2BNGA 4RZMA 1A2KA 3DGMA 1W6YA 3LTBA 3NM7A 3MKIA 3X3XA 1OPYA 8RNTA 1BUQA 2CFKA 3N54B 3WOEB 1JB5A 2LQVA 1Q824 5EVHA 3GZBA 4O2HA 1N5PA 5IENA 4LSOA 4STDA 5ELUA 2P05A 3Q1CA 2IUJA 3RGRA 3RNTA 1K28A 1LOWA 1RRLA 2UUGC 3U1WA 2E2UA 1UGHI 5KP4A 1FUSA 1CYVA 4HZBB 1Z1SA 1SPUA 1IT7A 3D5IA 1DVDA 3OWUA 5D82A 1YJW3 3EE1A 4J5KA 1AQZA 1HZ1A 1OGZA 3BNCA 2HMJB 1FUWA 2OWPA 3S67A 3NHXA 2HOHA 3F7XA 3CCQ3 1IVVA 4N6TA 3X3ZA 3X41A 4EBGA 3ZG5A 3N8BA 3FG1A 2HMLB 1NNVA 3D9RA 2WOHA 3EBTA 4ORLA 3ECFA 1YIJ3 4X2OA 4WHAA 3SLUA 1BRHA 1O7NB 1RGHA 4R9KA 1T5YA 3BB9A 1RKYA 1W2B2 3HZPA 3NX0A 1IQXA 1QAKA 1QAFA 2K0MA 1RGLA 2PNCA 1VQM3 1F8NA 1NU3A 3DGYA 2HMOB 3FCSB 5ELJA 5CK6A 5DRVA 3T8NA 5JBSA 3HOHA 1BSDA 4KFFA 3KIIA 5AIGA 2INXA 3CXC2 4L8PA 4BTWA 1S723 1SIIA 1Q7Y4 2H0HA 1RRHA 4NPBA 3NM2A 1T2IA 1VZZA 2Y74A 1D6ZA 3CNMA 1FGMA 1BRJA 3LT9A 3FG4A 4N6OB 4RNTA 3BIRA 4EC6A 3CCV3 5D81A 3CCJ3 2OOVC 2BHMA 4K1VA 4JRFA 4K61A 2B1XB 4LYLB 5AI1A 2BMRB 1B21A 1JJ22 3NV0B 3CCS3 1N8QA 3NV0A 3F40A 3HIGA 3LYGA 3OWSA 3BLZA 4HM6B 5IF6A 1O7GB 1B2SA 2XGNA 3S29A 3FH1A 1DMQA 2GSPA 1DE3A 3I0YA 2Z7AA 3V98A 1W01A 1N9EA 1IU7A 1GY5A 3NQZA 3DY5A 2WGQA 1YHQ3 1X1UA 4FMDA 2YX9A 3X42A 2WOFA 2MC8A 6RNTA 1TFKA 3E99A 3IMAB 3RGAA 1CQSA 4BL3A 3O8YA 1TUHA 3S28A 2CX0A 1K734 3CPW2 3BNEA 3DGNA 3DM8A 3PS8A 5AYSC 4O02B 3SXXA 4FR9A 4GL6A 4KZ1A 1QALA 1LOXA 2I9WA 1MWRA 4IIAA 2L1SA 1GY7A 2STDA 5AYRB 3MG1A 4MMXB 4L8OA 2IY2A 5AEUB 2XFSA 1G96A 3GWRA 4RNYA 3EBYA 1Q7HA 1A2PA 4K1UA 1NO3A 4X2HA 3AMOB 1EG9B 5AIIA 2J8XB 3F14A 1X1WA 1VQ63 3STDA 2CKFB 3AMOA 2BMQB 3DGLA 2XFTA 4TX4A 1JBRA 3URPA 3LOYA 2CG1A 3DZLA 4HM7B 3VSYA 4BL2A 2D1WA 1C54A 2CIUA 3JUPA 1FA3A 3B8LA 3CCR3 4AKYA 2UGIA 2XEPA 4EW5A 3I553 3G4S3 3K7CA 1IVWA 2RBIA 1FUTA 2HMKB 2Y73A 3KFQC 3EQQB 3KCHA 4J9AA 1ZO2A 2BIRA 2CWTA 5IEOA 5M18A 5LC7A 1IQYA 1MWTA 2XGLA 4EXRA 2XRXB 5IG5A 1LNIA 1AVKA 2GBWB 3FSDA 4I5QA 2BU4A 1MWUA 5IG0A 2SBLA 1SIHA 2OTJ3 5DREA 4IT7A 2ZA4A 3EN1B 1TFOA 2E2TA 3CU3A 4GHOA 2P09A 4OVMA 3G0KA 3CD63 2KF6A 4RNZA 3FLJA 1W6CA 4MJDA 4FMBA 1I3IA 2ZHXB 4LGQA 1OUNA 1RCKA 3GZRA 1EUIC 2HMNB 3CNXA 4BTXA 2AADA 4HBRA 3Q2PA 1TTOA 1OHSA 3OX9A 4WWUC 3V92A 3X3YA 1IYYA 1W02A 1G0TA 1MGWA 1N8R4 1KQS2 1BIRA 5IW9A 4HJLB 2W03A 1YJN3 4R9LA 2KCDA 1EEJA 2W56B 1HKXA 1ULIB 1NDOB 2K54A 1RNBA 2CHCA 1BRSA 1A67A 1MWSA 1W6GA 2W56A 4HM0B 1R4YA 1JB2A 2F5MA 3ROBA 1RHLA 2KRTA 2QIYA 3F7SA 2HMMB 2ZL8A 4FCMA 4N6V0 1AV4A 1OF5B 2OQEA 1LXEA 1LRAA 2CK3H 3FF2A 4N6MA 2W2CA 5G2GA 4U13A 3BU4A 1BSBA 1OF5A 2CFLA 2LYXA 3SVAA 1EKMA 1K9M4 3EX9A 2RNTA 2WGOA 3VF1A 4BTYA 1RN7A 3JUOA 2Z76A 1B27A 1ULJB 1WTHA 2QEX3 3CC23 4R80A 1Q42A 1IT8A 1HU9A 2FXTA 1ASKA 2KAAA 5KP3A 3CMA3 1CH0A 2KF4A 3AGNA 3KE7A 1T3BA 1SARA 1V74A 2RGQA 3OXAA 3GAXA 3PZWA 5AIHA 4MEIA 5EQLA 1K8A4 1MGRA 1YIT3 1IV9A 1YNVX 4R1KA 3SEDA 1E3VA 1W7CA 5HGRA 6GSPA 1GOYA 1FGTA 5TGNA 4EYCA 2XH9A 3UL6A 2OTL3 3MG2A 2P38A 1IV7A 1W5ZA 3A5EA 3DGOA 1GD3A 2QA43 1GOVA 1RSNA 1I0XA 1KSIA 3EJVA
chains in the Genus database with same CATH topology
4J5GA 1GMQA 1GMRA 1I70A 1I2EA 1UCLA 1JBTA 1FW7A 1RN1A 2C4BA 1B2UA 1B20A 1PYLA 1A2PA 7RNTA 2SARA 4HAAA 1X1WA 1BNSA 7GSPA 1T2HA 1JBRA 1GMPA 3URPA 1C54A 1BAOA 1RCLA 1B2MA 8RNTA 1G02A 9RNTA 5HOHA 1BUJA 3WHOA 1I2FA 3D5GA 2RBIA 1FUTA 1X1YA 3DH2A 3KCHA 1BSEA 2BIRA 1BNJA 1BNGA 1I2GA 3RNTA 1LOWA 1ZGXA 1LNIA 2BU4A 1BNFA 1FUSA 2F56A 1BNRA 1BOXA 3D4AA 3D5IA 5RNTA 1PY3A 2ZA4A 1RLSA 2AAEA 1TRPA 4BU4A 1RNTA 1BU4A 1AQZA 4J5KA 1HZ1A 4GHOA 1I0VA 1RGAA 4HOHA 3AHWA 2KF6A 3WR2A 2HOHA 1RTUA 1I3IA 1RCKA 3SYUA 3GSPA 2AADA 1RMSA 1BRHA 1RGHA 1TTOA 1AY7A 1IYYA 1MGWA 1BIRA 1BNIA 1RGLA 1UCJA 1I8VA 3DGYA 1LOYA 1FZUA 1RNBA 1BRSA 1BVIA 1BNEA 1BSDA 3HOHA 1R4YA 3AGOA 2F5MA 1RHLA 1GSPA 1T2IA 2KF5A 1BRJA 4RNTA 1BANA 1B2XA 1YVSA 1X1XA 1BRIA 3BIRA 1BSAA 1UCKA 1RGEA 1LRAA 1RDSA 1I3FA 3BU4A 1BSBA 1RN4A 1B21A 4BIRA 1UCIA 2RNTA 1RGGA 5GSPA 1BRGA 1BRNL 1BSCA 1LOVA 1B2SA 1B27A 1GOUA 2GSPA 1RGCA 1TRQA 2KAAA 3AHSA 5BIRA 1BGSA 1CH0A 1RGFA 2KF4A 3AGNA 2F4YA 1DE3A 1SARA 1B2ZA 4GSPA 1MGRA 1YGWA 3Q3FA 1X1UA 1YNVX 1DETA 6GSPA 1GOYA 2KF3A 6RNTA 1FYSA 1BRKA 5BU4A 1B3SA 1HYFA 1RGKA 1JBSA 3A5EA 1GOVA 1RSNA 2F5WA 1I0XA 1Q9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5G A;  1GMQ A;  1GMR A;  1I70 A;  1I2E A;  1UCL A;  1JBT A;  1FW7 A;  1RN1 A;  2C4B A;  1B2U A;  1B20 A;  1PYL A;  1A2P A;  7RNT A;  2SAR A;  4HAA A;  1X1W A;  1BNS A;  7GSP A;  1T2H A;  1JBR A;  1GMP A;  3URP A;  1C54 A;  1BAO A;  1RCL A;  1B2M A;  8RNT A;  1G02 A;  9RNT A;  5HOH A;  1BUJ A;  3WHO A;  1I2F A;  3D5G A;  2RBI A;  1FUT A;  1X1Y A;  3DH2 A;  3KCH A;  1BSE A;  2BIR A;  1BNJ A;  1BNG A;  1I2G A;  3RNT A;  1LOW A;  1ZGX A;  1LNI A;  2BU4 A;  1BNF A;  1FUS A;  2F56 A;  1BNR A;  1BOX A;  3D4A A;  3D5I A;  5RNT A;  1PY3 A;  2ZA4 A;  1RLS A;  2AAE A;  1TRP A;  4BU4 A;  1RNT A;  1BU4 A;  1AQZ A;  4J5K A;  1HZ1 A;  4GHO A;  1I0V A;  1RGA A;  4HOH A;  3AHW A;  2KF6 A;  3WR2 A;  2HOH A;  1RTU A;  1I3I A;  1RCK A;  3SYU A;  3GSP A;  2AAD A;  1RMS A;  1BRH A;  1RGH A;  1TTO A;  1AY7 A;  1IYY A;  1MGW A;  1BIR A;  1BNI A;  1RGL A;  1UCJ A;  1I8V A;  3DGY A;  1LOY A;  1FZU A;  1RNB A;  1BRS A;  1BVI A;  1BNE A;  1BSD A;  3HOH A;  1R4Y A;  3AGO A;  2F5M A;  1RHL A;  1GSP A;  1T2I A;  2KF5 A;  1BRJ A;  4RNT A;  1BAN A;  1B2X A;  1YVS A;  1X1X A;  1BRI A;  3BIR A;  1BSA A;  1UCK A;  1RGE A;  1LRA A;  1RDS A;  1I3F A;  3BU4 A;  1BSB A;  1RN4 A;  1B21 A;  4BIR A;  1UCI A;  2RNT A;  1RGG A;  5GSP A;  1BRG A;  1BRN L;  1BSC A;  1LOV A;  1B2S A;  1B27 A;  1GOU A;  2GSP A;  1RGC A;  1TRQ A;  2KAA A;  3AHS A;  5BIR A;  1BGS A;  1CH0 A;  1RGF A;  2KF4 A;  3AGN A;  2F4Y A;  1DE3 A;  1SAR A;  1B2Z A;  4GSP A;  1MGR A;  1YGW A;  3Q3F A;  1X1U A;  1YNV X;  1DET A;  6GSP A;  1GOY A;  2KF3 A;  6RNT A;  1FYS A;  1BRK A;  5BU4 A;  1B3S A;  1HYF A;  1RGK A;  1JBS A;  3A5E A;  1GOV A;  1RSN A;  2F5W A;  1I0X A;  1Q9E A; 
#chains in the Genus database with same CATH topology
 1V57 A;  1GMR A;  1O7M B;  1A2V A;  1DYU A;  2ML6 A;  1RN1 A;  4OK0 A;  2CH9 A;  2R41 A;  2E2V A;  1B2U A;  1PYL A;  3PYJ A;  2Z77 A;  5G1K A;  2CFG A;  4XDV A;  3CC7 3;  2SAR A;  5CF1 A;  4K90 B;  1VQP 3;  1FGO A;  1ZX2 A;  1SJW A;  4G1M B;  2D42 A;  2CG0 A;  1IQ8 A;  4ZM8 A;  2W6J H;  4CDL A;  5IG3 A;  1BAO A;  3LTC A;  1RCL A;  4XM4 A;  3KSP A;  1NB5 I;  1G02 A;  3WMD A;  9RNT A;  5HOH A;  2RCD A;  2GU1 A;  3WHO A;  1US1 A;  3D5G A;  4MMZ B;  6STD A;  3DH2 A;  3MSO A;  1N9J A;  2Q07 A;  1BSE A;  1GYB A;  3DUK A;  5LC6 A;  1BNG A;  2F98 A;  2XF3 A;  1PU4 A;  1I2G A;  4WP5 A;  1GY6 A;  3S5C A;  2ML5 A;  3M8C A;  3WA2 X;  2OCT A;  5G1L A;  4HVN A;  4KFD A;  1NWW A;  2O3O A;  3T0U A;  1JRQ A;  1STF I;  1Y4K A;  2C11 A;  3CC4 3;  5RNT A;  2FGT A;  5IG4 A;  3J7Y d;  5KP1 A;  3F9S A;  4EV5 A;  1PFP A;  1RNT A;  1BU4 A;  4CJN A;  2CFD A;  3FG3 A;  3OWY A;  1I0V A;  1RGA A;  3LZA A;  4FCJ A;  8CHO A;  1JNQ A;  1SQW A;  3AHW A;  4HOH A;  4N6U A;  3WR2 A;  2CWU A;  4DKI A;  1DMM A;  2B24 B;  1GS3 A;  1DMN A;  1RTU A;  4XBT A;  3EHC A;  1D6U A;  2F86 B;  3LXU X;  3SOA A;  3UL5 A;  3GRD A;  3GSP A;  2WO0 A;  3GZX B;  5STD A;  1RMS A;  2MF7 A;  2PZV A;  5BVB A;  1ROA A;  1ROV A;  2UX0 A;  2RSX A;  3KKG A;  3NXJ A;  3PCS A;  1UUW B;  1FZU A;  3H3H A;  4MMY B;  1UW1 A;  5JPU A;  1BVI A;  1JN5 B;  3G71 3;  2H0G A;  1LNH A;  1R4C A;  3PCR A;  3NUV A;  3QK9 A;  1B2X A;  1YVS A;  1OCV A;  1X1X A;  1AR0 A;  3CPO A;  3HII A;  3FGY A;  1OHO A;  2OOV A;  3CCL 3;  1UCK A;  1RGE A;  4Q53 A;  1RDS A;  1KC8 4;  4HYZ A;  1I3F A;  2W04 A;  3X40 A;  2A15 A;  1RN4 A;  1VQ7 3;  1WMN A;  3Q90 A;  3KN4 A;  3CCE 3;  3HI7 A;  2BMO B;  3JUN A;  3WOF B;  5FW5 A;  1TJD A;  1BRN L;  1BSC A;  4WFO A;  3CCU 3;  1E97 A;  1AVL A;  2P0X A;  1RGC A;  1U8C B;  1TRQ A;  1VQK 3;  3AHS A;  1KWI A;  1RGF A;  2F4Y A;  4HM2 B;  3OW2 2;  3UB1 A;  1VQ8 3;  3UNL A;  1M1K 4;  1B2Z A;  3LTA A;  2W9P A;  1DVC A;  1U5O A;  1YGW A;  1JZO A;  2GU3 A;  4JF8 A;  1FGQ A;  1M9G A;  1W00 A;  3QRD A;  1DET A;  2GBX B;  5I97 A;  3CME 3;  2P0M A;  2KF3 A;  3IPT A;  4PEJ A;  2JDI H;  4NHF A;  5BU4 A;  1B3S A;  3JUQ A;  1VQ4 3;  2CW9 A;  2GXF A;  5D83 A;  1RGK A;  3H51 A;  3LT8 A;  1JBS A;  1IDP A;  3PGB A;  1Q81 4;  4CCV A;  2F5W A;  3JVC A;  4N3V A;  4EV2 A;  1JBT A;  1CYU A;  4J5G A;  1FW7 A;  1UCL A;  1I70 A;  1WMO A;  2YFJ B;  3LTD A;  4H3U A;  1D6Y A;  1QVG 2;  2C4B A;  1K41 A;  2RFR A;  4HM3 B;  3TDG A;  1WMP A;  3FKA A;  2YFI B;  4RBN A;  3MHE A;  5IEP A;  1CEW I;  2GEY A;  1Q40 B;  3LH4 A;  2CWV A;  1JV2 B;  1BNS A;  2K3D A;  3EN8 A;  1Q40 A;  5AEW B;  1EQK A;  1O7W B;  1IVX A;  1LQG C;  1GMP A;  1S5A A;  2KXG A;  2XSO B;  1LVN A;  1TIJ A;  3MG3 A;  2XR8 B;  3OV4 A;  4O3V A;  2R4I A;  1B2M A;  1MNL A;  4HM8 B;  1VQN 3;  3B4P A;  4LMI A;  2W9Q A;  4HM5 B;  4ILF A;  3HX8 A;  1BUJ A;  5AIF A;  2M7O A;  1I2F A;  3D79 A;  3K9M C;  5CF2 A;  4QWT A;  1V58 A;  3UJM A;  3K0Z A;  1X1Y A;  1C7H A;  1GD4 A;  3LML A;  1BNJ A;  3BNB A;  3BND A;  4NRE A;  1ZGX A;  4N6L A;  5JPP A;  4HM4 B;  1RJO A;  1BNF A;  2F56 A;  2GEX A;  3MWZ A;  4XBX A;  1BNR A;  1M90 4;  1BOX A;  3D4A A;  3KZT A;  4KFE A;  1PY3 A;  1RLS A;  2AAE A;  1TRP A;  2ZDJ A;  3FZW A;  3T8U A;  1FGR A;  3A76 A;  3V99 A;  4BU4 A;  1UUG B;  1VQ5 3;  1LQM B;  3NQY A;  3S27 A;  7STD A;  3L0R A;  5A0O B;  4J8T A;  1TU5 A;  3MPH A;  2C10 A;  1JB4 A;  3SYU A;  3PXM A;  3U97 A;  1STD A;  1YJ9 3;  2YFL B;  3DXO A;  3SX1 A;  3EB8 A;  2CC3 A;  2O9U X;  3EC9 A;  4CPK A;  3G8Z A;  5EEO A;  1AY7 A;  5CXO A;  2IYJ A;  1BNI A;  1UCJ A;  5M19 A;  3F8H A;  1MOL A;  1I8V A;  1OAC A;  3N9H A;  1JKG B;  1LOY A;  3G6E 3;  2H0I A;  1KD1 4;  4LEH A;  1VQ9 3;  1BNE A;  1JKG A;  1ISK A;  2Z6B A;  3AGO A;  3SOY A;  1JZD A;  4R4K A;  3I56 3;  1GSP A;  4XDW A;  1WNH A;  2KF5 A;  3F8X A;  1UI7 A;  4KVH A;  4I4K A;  3KSE D;  2IUK A;  1BAN A;  1M1X B;  1BRI A;  3ZG0 A;  1UDI I;  4AEQ A;  1BSA A;  4GB5 A;  1L5G B;  4HZ9 B;  1VQL 3;  2OQE C;  2V1L A;  3WA3 A;  3G16 A;  1EA2 A;  1N5H A;  1O7H B;  4XB5 A;  3JUM A;  4BIR A;  1UUV B;  1VQO 3;  1UCI A;  1UI8 A;  1RGG A;  4FCZ A;  4FMA A;  5FGO A;  4IPB A;  5GSP A;  1BRG A;  3IJE B;  1OHP A;  1W2Z A;  2BT3 A;  1LOV A;  4KT3 B;  1IK3 A;  1GOU A;  2JQ5 A;  3WDG B;  3FF0 A;  5BIR A;  1BGS A;  3NBJ A;  3HK4 A;  4H61 A;  1NB3 I;  4O8S A;  1QMA A;  1YGE A;  4GSP A;  4LZI A;  3EF8 A;  3ER7 A;  3K63 A;  1WQL B;  3Q3F A;  4XBY A;  1JN5 A;  5CLK A;  1A90 A;  1O7P B;  1QVF 2;  2FNQ A;  4HKV B;  1YI2 3;  3NBB A;  1FYS A;  3DMC A;  1BRK A;  2IA7 A;  3WOD G;  4AKZ A;  5IER A;  1OGX A;  1HYF A;  2IMJ A;  2XSH B;  4L7K A;  1VQQ A;  2CFW A;  1YVB I;  1UGI A;  1IVU A;  1Q9E A;  4FMC A;  1ZS7 A;  4OUQ A;  1OH0 A;  4WYK B;  1NJI 4;  1GMQ A;  1J2B A;  1I2E A;  3K5T A;  3MYT A;  3CCM 3;  1W4N A;  4WYK A;  1Q86 4;  1QJG A;  4HM1 B;  3ZFZ A;  1B20 A;  3B4O A;  2CX1 A;  7RNT A;  3B7C A;  2F99 A;  3RDE A;  2BO9 B;  2W0Q A;  4HAA A;  4N6N B;  2QGU A;  7GSP A;  1E3R A;  1TP6 A;  5M1A A;  1T2H A;  3D3L A;  3GZY B;  3NBR A;  3VGN A;  3ALA A;  2L4V A;  5BXQ A;  2BNG A;  4RZM A;  1A2K A;  3DGM A;  1W6Y A;  3LTB A;  3NM7 A;  3MKI A;  3X3X A;  1OPY A;  8RNT A;  1BUQ A;  2CFK A;  3N54 B;  3WOE B;  1JB5 A;  2LQV A;  1Q82 4;  5EVH A;  3GZB A;  4O2H A;  1N5P A;  5IEN A;  4LSO A;  4STD A;  5ELU A;  2P05 A;  3Q1C A;  2IUJ A;  3RGR A;  3RNT A;  1K28 A;  1LOW A;  1RRL A;  2UUG C;  3U1W A;  2E2U A;  1UGH I;  5KP4 A;  1FUS A;  1CYV A;  4HZB B;  1Z1S A;  1SPU A;  1IT7 A;  3D5I A;  1DVD A;  3OWU A;  5D82 A;  1YJW 3;  3EE1 A;  4J5K A;  1AQZ A;  1HZ1 A;  1OGZ A;  3BNC A;  2HMJ B;  1FUW A;  2OWP A;  3S67 A;  3NHX A;  2HOH A;  3F7X A;  3CCQ 3;  1IVV A;  4N6T A;  3X3Z A;  3X41 A;  4EBG A;  3ZG5 A;  3N8B A;  3FG1 A;  2HML B;  1NNV A;  3D9R A;  2WOH A;  3EBT A;  4ORL A;  3ECF A;  1YIJ 3;  4X2O A;  4WHA A;  3SLU A;  1BRH A;  1O7N B;  1RGH A;  4R9K A;  1T5Y A;  3BB9 A;  1RKY A;  1W2B 2;  3HZP A;  3NX0 A;  1IQX A;  1QAK A;  1QAF A;  2K0M A;  1RGL A;  2PNC A;  1VQM 3;  1F8N A;  1NU3 A;  3DGY A;  2HMO B;  3FCS B;  5ELJ A;  5CK6 A;  5DRV A;  3T8N A;  5JBS A;  3HOH A;  1BSD A;  4KFF A;  3KII A;  5AIG A;  2INX A;  3CXC 2;  4L8P A;  4BTW A;  1S72 3;  1SII A;  1Q7Y 4;  2H0H A;  1RRH A;  4NPB A;  3NM2 A;  1T2I A;  1VZZ A;  2Y74 A;  1D6Z A;  3CNM A;  1FGM A;  1BRJ A;  3LT9 A;  3FG4 A;  4N6O B;  4RNT A;  3BIR A;  4EC6 A;  3CCV 3;  5D81 A;  3CCJ 3;  2OOV C;  2BHM A;  4K1V A;  4JRF A;  4K61 A;  2B1X B;  4LYL B;  5AI1 A;  2BMR B;  1B21 A;  1JJ2 2;  3NV0 B;  3CCS 3;  1N8Q A;  3NV0 A;  3F40 A;  3HIG A;  3LYG A;  3OWS A;  3BLZ A;  4HM6 B;  5IF6 A;  1O7G B;  1B2S A;  2XGN A;  3S29 A;  3FH1 A;  1DMQ A;  2GSP A;  1DE3 A;  3I0Y A;  2Z7A A;  3V98 A;  1W01 A;  1N9E A;  1IU7 A;  1GY5 A;  3NQZ A;  3DY5 A;  2WGQ A;  1YHQ 3;  1X1U A;  4FMD A;  2YX9 A;  3X42 A;  2WOF A;  2MC8 A;  6RNT A;  1TFK A;  3E99 A;  3IMA B;  3RGA A;  1CQS A;  4BL3 A;  3O8Y A;  1TUH A;  3S28 A;  2CX0 A;  1K73 4;  3CPW 2;  3BNE A;  3DGN A;  3DM8 A;  3PS8 A;  5AYS C;  4O02 B;  3SXX A;  4FR9 A;  4GL6 A;  4KZ1 A;  1QAL A;  1LOX A;  2I9W A;  1MWR A;  4IIA A;  2L1S A;  1GY7 A;  2STD A;  5AYR B;  3MG1 A;  4MMX B;  4L8O A;  2IY2 A;  5AEU B;  2XFS A;  1G96 A;  3GWR A;  4RNY A;  3EBY A;  1Q7H A;  1A2P A;  4K1U A;  1NO3 A;  4X2H A;  3AMO B;  1EG9 B;  5AII A;  2J8X B;  3F14 A;  1X1W A;  1VQ6 3;  3STD A;  2CKF B;  3AMO A;  2BMQ B;  3DGL A;  2XFT A;  4TX4 A;  1JBR A;  3URP A;  3LOY A;  2CG1 A;  3DZL A;  4HM7 B;  3VSY A;  4BL2 A;  2D1W A;  1C54 A;  2CIU A;  3JUP A;  1FA3 A;  3B8L A;  3CCR 3;  4AKY A;  2UGI A;  2XEP A;  4EW5 A;  3I55 3;  3G4S 3;  3K7C A;  1IVW A;  2RBI A;  1FUT A;  2HMK B;  2Y73 A;  3KFQ C;  3EQQ B;  3KCH A;  4J9A A;  1ZO2 A;  2BIR A;  2CWT A;  5IEO A;  5M18 A;  5LC7 A;  1IQY A;  1MWT A;  2XGL A;  4EXR A;  2XRX B;  5IG5 A;  1LNI A;  1AVK A;  2GBW B;  3FSD A;  4I5Q A;  2BU4 A;  1MWU A;  5IG0 A;  2SBL A;  1SIH A;  2OTJ 3;  5DRE A;  4IT7 A;  2ZA4 A;  3EN1 B;  1TFO A;  2E2T A;  3CU3 A;  4GHO A;  2P09 A;  4OVM A;  3G0K A;  3CD6 3;  2KF6 A;  4RNZ A;  3FLJ A;  1W6C A;  4MJD A;  4FMB A;  1I3I A;  2ZHX B;  4LGQ A;  1OUN A;  1RCK A;  3GZR A;  1EUI C;  2HMN B;  3CNX A;  4BTX A;  2AAD A;  4HBR A;  3Q2P A;  1TTO A;  1OHS A;  3OX9 A;  4WWU C;  3V92 A;  3X3Y A;  1IYY A;  1W02 A;  1G0T A;  1MGW A;  1N8R 4;  1KQS 2;  1BIR A;  5IW9 A;  4HJL B;  2W03 A;  1YJN 3;  4R9L A;  2KCD A;  1EEJ A;  2W56 B;  1HKX A;  1ULI B;  1NDO B;  2K54 A;  1RNB A;  2CHC A;  1BRS A;  1A67 A;  1MWS A;  1W6G A;  2W56 A;  4HM0 B;  1R4Y A;  1JB2 A;  2F5M A;  3ROB A;  1RHL A;  2KRT A;  2QIY A;  3F7S A;  2HMM B;  2ZL8 A;  4FCM A;  4N6V 0;  1AV4 A;  1OF5 B;  2OQE A;  1LXE A;  1LRA A;  2CK3 H;  3FF2 A;  4N6M A;  2W2C A;  5G2G A;  4U13 A;  3BU4 A;  1BSB A;  1OF5 A;  2CFL A;  2LYX A;  3SVA A;  1EKM A;  1K9M 4;  3EX9 A;  2RNT A;  2WGO A;  3VF1 A;  4BTY A;  1RN7 A;  3JUO A;  2Z76 A;  1B27 A;  1ULJ B;  1WTH A;  2QEX 3;  3CC2 3;  4R80 A;  1Q42 A;  1IT8 A;  1HU9 A;  2FXT A;  1ASK A;  2KAA A;  5KP3 A;  3CMA 3;  1CH0 A;  2KF4 A;  3AGN A;  3KE7 A;  1T3B A;  1SAR A;  1V74 A;  2RGQ A;  3OXA A;  3GAX A;  3PZW A;  5AIH A;  4MEI A;  5EQL A;  1K8A 4;  1MGR A;  1YIT 3;  1IV9 A;  1YNV X;  4R1K A;  3SED A;  1E3V A;  1W7C A;  5HGR A;  6GSP A;  1GOY A;  1FGT A;  5TGN A;  4EYC A;  2XH9 A;  3UL6 A;  2OTL 3;  3MG2 A;  2P38 A;  1IV7 A;  1W5Z A;  3A5E A;  3DGO A;  1GD3 A;  2QA4 3;  1GOV A;  1RSN A;  1I0X A;  1KSI A;  3EJV A; 
#chains in the Genus database with same CATH homology
 4J5G A;  1GMQ A;  1GMR A;  1I70 A;  1I2E A;  1UCL A;  1JBT A;  1FW7 A;  1RN1 A;  2C4B A;  1B2U A;  1B20 A;  1PYL A;  1A2P A;  7RNT A;  2SAR A;  4HAA A;  1X1W A;  1BNS A;  7GSP A;  1T2H A;  1JBR A;  1GMP A;  3URP A;  1C54 A;  1BAO A;  1RCL A;  1B2M A;  8RNT A;  1G02 A;  9RNT A;  5HOH A;  1BUJ A;  3WHO A;  1I2F A;  3D5G A;  2RBI A;  1FUT A;  1X1Y A;  3DH2 A;  3KCH A;  1BSE A;  2BIR A;  1BNJ A;  1BNG A;  1I2G A;  3RNT A;  1LOW A;  1ZGX A;  1LNI A;  2BU4 A;  1BNF A;  1FUS A;  2F56 A;  1BNR A;  1BOX A;  3D4A A;  3D5I A;  5RNT A;  1PY3 A;  2ZA4 A;  1RLS A;  2AAE A;  1TRP A;  4BU4 A;  1RNT A;  1BU4 A;  1AQZ A;  4J5K A;  1HZ1 A;  4GHO A;  1I0V A;  1RGA A;  4HOH A;  3AHW A;  2KF6 A;  3WR2 A;  2HOH A;  1RTU A;  1I3I A;  1RCK A;  3SYU A;  3GSP A;  2AAD A;  1RMS A;  1BRH A;  1RGH A;  1TTO A;  1AY7 A;  1IYY A;  1MGW A;  1BIR A;  1BNI A;  1RGL A;  1UCJ A;  1I8V A;  3DGY A;  1LOY A;  1FZU A;  1RNB A;  1BRS A;  1BVI A;  1BNE A;  1BSD A;  3HOH A;  1R4Y A;  3AGO A;  2F5M A;  1RHL A;  1GSP A;  1T2I A;  2KF5 A;  1BRJ A;  4RNT A;  1BAN A;  1B2X A;  1YVS A;  1X1X A;  1BRI A;  3BIR A;  1BSA A;  1UCK A;  1RGE A;  1LRA A;  1RDS A;  1I3F A;  3BU4 A;  1BSB A;  1RN4 A;  1B21 A;  4BIR A;  1UCI A;  2RNT A;  1RGG A;  5GSP A;  1BRG A;  1BRN L;  1BSC A;  1LOV A;  1B2S A;  1B27 A;  1GOU A;  2GSP A;  1RGC A;  1TRQ A;  2KAA A;  3AHS A;  5BIR A;  1BGS A;  1CH0 A;  1RGF A;  2KF4 A;  3AGN A;  2F4Y A;  1DE3 A;  1SAR A;  1B2Z A;  4GSP A;  1MGR A;  1YGW A;  3Q3F A;  1X1U A;  1YNV X;  1DET A;  6GSP A;  1GOY A;  2KF3 A;  6RNT A;  1FYS A;  1BRK A;  5BU4 A;  1B3S A;  1HYF A;  1RGK A;  1JBS A;  3A5E A;  1GOV A;  1RSN A;  2F5W A;  1I0X A;  1Q9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...