1HZ1A

Ribonuclease t1 v16a mutant in complex with mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE T1
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus niger
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1hz1A00
3Q3FA 1BSBA 1LOWA 5GSPA 1TRQA 8RNTA 2F56A 1I70A 1B2XA 1MGWA 1BUJA 3KCHA 6GSPA 2AADA 4HOHA 1BSAA 1BNGA 1B2UA 3DH2A 1T2HA 1ZGXA 1DE3A 1B2ZA 1RN1A 1BNJA 1YNVX 1B2MA 4GSPA 1AY7A 3GSPA 1BU4A 1YVSA 1I2GA 1LNIA 1TRPA 1BRNL 1BOXA 4J5KA 1RNBA 3DGYA 1I3IA 1X1XA 3RNTA 1FUTA 1B2SA 1A2PA 1X1WA 2ZA4A 4BIRA 1BAOA 1FUSA 1HYFA 2SARA 3D5GA 1RCKA 2F4YA 1BRHA 2KAAA 1HZ1A 1I2FA 2F5WA 1RHLA 1RGGA 7GSPA 1MGRA 1CH0A 1LOYA 1BNEA 1JBTA 3AGNA 1GOVA 2KF5A 1I0VA 1JBSA 1I0XA 1C54A 2BU4A 1RLSA 1BNFA 1RN4A 1RGAA 2AAEA 1LRAA 1X1YA 1PYLA 4BU4A 1B3SA 1BSDA 1RGHA 1DETA 1BRGA 4GHOA 1RGLA 1BIRA 1R4YA 2KF6A 2BIRA 5HOHA 1LOVA 1RMSA 4HAAA 2RBIA 1BSEA 1UCLA 2HOHA 1GMRA 1RDSA 4J5GA 1PY3A 2RNTA 1BRIA 1RGKA 1G02A 3D5IA 2C4BA 6RNTA 1BNRA 1RTUA 1Q9EA 1BRKA 1T2IA 1UCJA 7RNTA 1GSPA 1UCIA 1RSNA 1GMQA 2GSPA 1BSCA 1B27A 1TTOA 1RGCA 3AGOA 3URPA 2F5MA 3A5EA 2KF3A 3WHOA 1BGSA 1FZUA 3HOHA 1B21A 1IYYA 5BU4A 1GMPA 1I2EA 1BNIA 3AHWA 1SARA 1UCKA 2KF4A 9RNTA 1YGWA 1JBRA 5RNTA 1FYSA 3WR2A 1RNTA 1GOYA 1I3FA 1RGFA 3BIRA 1RGEA 1B20A 1BNSA 3AHSA 1I8VA 3D4AA 1BANA 1AQZA 4RNTA 1GOUA 5BIRA 3BU4A 1BVIA 1X1UA 1FW7A 3SYUA 1RCLA 1BRJA 1BRSA
chains in the Genus database with same CATH superfamily
3B4OA 1LOWA 5EEOA 3NQYA 4EV2A 1LXEA 3NQZA 2IY2A 3IMAB 4JF8A 4HZBB 3I0YA 3LYGA 2AADA 1IU7A 4OK0A 6GSPA 1BSAA 2W56B 4JRFA 1IK3A 3BB9A 1VQ73 1A2VA 1M1K4 1B2UA 3SOAA 4WFOA 1ZGXA 3EHCA 3U97A 2MC8A 2W0QA 4HM7B 1VQO3 3NV0B 4HM1B 4RNZA 3BNEA 1OHPA 1AY7A 1QMAA 3WOEB 1W2B2 4CDLA 1DMMA 3G713 1BU4A 1GD4A 1K734 3G16A 1LVNA 1PU4A 4LSOA 5KP3A 1NU3A 2IUKA 3LT9A 1JV2B 1BOXA 1WNHA 3GAXA 4CPKA 5JBSA 4KVHA 3RNTA 1FA3A 1FUTA 4X2OA 1B2SA 5EVHA 2HMJB 1SQWA 2CX1A 2ZA4A 1TFOA 1IVXA 1NWWA 1VQQA 2CWUA 3V92A 2BO9B 1HYFA 3J7Yd 1RRLA 2SARA 1MWRA 1RCKA 2K0MA 2F4YA 2QEX3 4O02B 3LXUX 1HZ1A 1UUWB 2GU1A 4HM0B 3S28A 2YFJB 3GZRA 1YJN3 1DYUA 3DUKA 2RGQA 4FCZA 4MEIA 3CCU3 3Q90A 3AGNA 1IT8A 1GOVA 2CWTA 2H0IA 2KF5A 3CNXA 3N9HA 3CCV3 3KSED 1LRAA 1X1YA 1W6GA 2Z6BA 4MJDA 1RN7A 1BSDA 2W9PA 3GWRA 1CEWI 3GZYB 3K0ZA 3ZG5A 3MG2A 1NJI4 2QIYA 4HM8B 1BIRA 1A90A 2INXA 2CFLA 4EV5A 1RRHA 2OQEC 3LTCA 1OF5A 1IV7A 2P09A 2STDA 1SPUA 1O7NB 3ECFA 3MG3A 4J8TA 2GU3A 4O3VA 4BTWA 3G6E3 3D3LA 2JDIH 3E99A 3HIGA 2RSXA 4I4KA 1G02A 2C4BA 1Q814 1EUIC 1RTUA 1IVWA 5JPUA 1L5GB 4Q53A 1DVCA 2XR8B 3A76A 7RNTA 1OHSA 1UI8A 3NBJA 4X2HA 4KFDA 1N5PA 1GY6A 1HKXA 1OHOA 2CK3H 1CYVA 5G1KA 1D6YA 5AI1A 4XBTA 3JUNA 2KF3A 2C10A 3FF2A 4J9AA 1IQYA 3FZWA 1VQ43 1IYYA 3OWSA 5BU4A 1LNHA 1I2EA 1OCVA 1W5ZA 1WQLB 3DGOA 1TUHA 1UCKA 3PS8A 2Q07A 5AYRB 1W02A 1JBRA 5M18A 1US1A 3LT8A 2ML5A 4WHAA 1K9M4 4HM6B 2O3OA 5EQLA 3SLUA 3WR2A 2WO0A 1K8A4 3NUVA 2W6JH 1RNTA 1VQN3 2GXFA 3FH1A 2CG1A 1UGHI 3OW22 1ROVA 2P0XA 1RKYA 1RGEA 1Y4KA 1BNSA 3X41A 1BRNL 3TDGA 3PYJA 1OF5B 2W56A 4HM5B 1MNLA 1N5HA 1JB4A 5IEOA 3BU4A 1LQGC 4N3VA 2H0HA 1SJWA 1QVG2 3SYUA 1BRJA 2BMOB 1BRSA 1IVUA 1BSBA 2XH9A 2CFWA 2E2UA 5BXQA 4CCVA 1Q864 1JZDA 1TIJA 2CW9A 1TRQA 4BTYA 3MG1A 2F56A 2ZDJA 4WWUC 2BMRB 4I5QA 3NBBA 3CCM3 1O7GB 4KFFA 4R80A 1BNGA 5IF6A 5AEUB 3DH2A 1EG9B 1T2HA 1LQMB 1B2ZA 1OGZA 3IJEB 3KE7A 3X3ZA 3X40A 3EBTA 4CJNA 1EQKA 4ORLA 1STDA 3PCRA 1B2MA 3DY5A 4GSPA 1WMNA 2J8XB 1A2KA 3GSPA 3F7SA 2ML6A 2BNGA 3S29A 5AEWB 1I2GA 3OWYA 3LTBA 4LZIA 3CCR3 1TJDA 2F99A 4J5KA 3EQQB 1U5OA 4FMBA 4R9KA 5AYSC 5IEPA 1E97A 1NB3I 4BIRA 1FUWA 1K41A 2P05A 3D5GA 3EF8A 2C11A 3I553 4XBXA 2OOVA 2KAAA 3FG4A 2YX9A 3QRDA 3CU3A 4BTXA 1VQP3 1RGGA 2Z77A 4L8PA 7GSPA 3D79A 5A0OB 4NREA 1LOYA 1BNEA 1YVBI 3FG1A 3KIIA 3WODG 1U8CB 1JBTA 4NHFA 1O7PB 1UI7A 2HMKB 4HVNA 1ISKA 2IUJA 3LOYA 1I0XA 2CG0A 3F8XA 1RLSA 2W2CA 1BNFA 1RN4A 3F9SA 4XDWA 2JQ5A 2L4VA 3K5TA 3T0UA 1M9GA 4AKZA 1RGHA 1DETA 3UB1A 1QVF2 3LMLA 2W04A 3PGBA 5ELJA 2Y73A 1RGLA 4GHOA 3EX9A 2CKFB 2BIRA 5AIHA 1VQ53 1OUNA 4HAAA 3SX1A 3LTAA 1BSEA 2HOHA 3DGMA 1GMRA 2MF7A 2RCDA 3G0KA 1DMNA 1PY3A 2RNTA 4H3UA 1NB5I 2I9WA 2QA43 1FGTA 1A67A 1BNRA 3NHXA 5LC7A 1Q9EA 4K1VA 4MMYB 4GB5A 3WMDA 5FGOA 1QAFA 4H61A 1GSPA 4K90B 1KWIA 1N9EA 1IV9A 3H51A 4K61A 1YI23 3GZBA 2R4IA 1BSCA 1TTOA 2B1XB 1ULJB 1RGCA 3LZAA 5CF2A 5JPPA 1Q7Y4 2OOVC 1M1XB 1E3RA 5HGRA 1SIHA 4LMIA 1N8R4 1G0TA 4L7KA 1FZUA 3HOHA 1B21A 5G1LA 3STDA 1GY5A 3OWUA 1GMPA 1EEJA 4EC6A 3Q1CA 3V98A 4BL2A 3ZG0A 2R41A 2ZL8A 5D82A 3CC73 3WDGB 4EBGA 1NO3A 2WOHA 3S67A 1IT7A 3G4S3 1CYUA 4FMAA 1W2ZA 1RGFA 4GL6A 3X42A 3FCSB 2BMQB 2WGQA 2YFLB 1AQZA 1GOUA 3UNLA 3FKAA 1BVIA 5I97A 3MPHA 4EXRA 4U13A 1RCLA 1F8NA 2CFKA 1OPYA 1Z1SA 1V58A 2BHMA 3EJVA 3NM7A 5GSPA 1M904 4N6LA 5IG5A 3GZXB 3DGNA 7STDA 1I70A 4K1UA 3IPTA 5AIGA 1MGWA 1ULIB 4EW5A 1GD3A 1BUJA 3KCHA 4HM4B 4RZMA 3VF1A 1Q7HA 4HOHA 3MYTA 5BVBA 1HU9A 3L0RA 5ELUA 4FMCA 1DE3A 3CCQ3 4OUQA 5CK6A 5M19A 1T5YA 2HMLB 3T8NA 2OCTA 1FGRA 3HIIA 4N6OB 3HX8A 1DVDA 2GEYA 5CXOA 1LNIA 1NNVA 1TRPA 2FNQA 4OVMA 4PEJA 3B7CA 2RFRA 5M1AA 1X1XA 4ZM8A 3CC43 1J2BA 2GBWB 2CX0A 4N6MA 3S27A 3UL5A 1A2PA 1X1WA 4R1KA 2K3DA 3JUMA 3DMCA 4TX4A 1BAOA 1FUSA 4IPBA 1AVLA 1N9JA 1W6CA 3F14A 2Y74A 3OV4A 4HJLB 4KT3B 2F5WA 3KSPA 2M7OA 1W4NA 2YFIB 1ASKA 3JUPA 4HYZA 1CH0A 1JRQA 3HZPA 2CWVA 2UX0A 2SBLA 4N6V0 2CIUA 3JVCA 4WYKB 1N8QA 3X3YA 1I0VA 1TP6A 2CHCA 2XRXB 3CD63 1WTHA 2BU4A 1ZS7A 1RGAA 4LGQA 3Q2PA 2AAEA 1PYLA 4HKVB 4HBRA 3DXOA 1W7CA 1D6ZA 1B3SA 1YIJ3 1W6YA 2HMOB 3EC9A 3ZFZA 2CFGA 3PXMA 1OH0A 2A15A 5KP4A 1STFI 1IDPA 5HOHA 5FW5A 5IW9A 1RMSA 2L1SA 3JUQA 2RBIA 3K63A 2OWPA 1G96A 5D83A 3MKIA 3MHEA 5STDA 3WOFB 2D42A 3DZLA 5CF1A 1UW1A 4XDVA 3EB8A 1RGKA 3H3HA 3D5IA 6RNTA 1YGEA 2E2VA 3CMA3 1UCJA 1GS3A 1T2IA 1EKMA 3DM8A 3PZWA 1S5AA 2XFTA 1T3BA 2V1LA 3VGNA 5DRVA 1VQK3 2CH9A 3FGYA 1RSNA 3FSDA 1GMQA 4ILFA 1IQ8A 3AMOA 1B27A 3NX0A 5D81A 3URPA 1JNQA 1QAKA 3SEDA 3WHOA 1O7WB 2F98A 3CPW2 1S723 1NDOB 3SXXA 2IA7A 5IG0A 3GRDA 3T8UA 3WA2X 3JUOA 1BNIA 3PCSA 2UGIA 4G1MB 3RGRA 1YIT3 1FGMA 3EN1B 9RNTA 1YGWA 1VQ93 3FG3A 3SOYA 3CME3 1AV4A 1FYSA 2ZHXB 4R4KA 3B8LA 2OQEA 2CFDA 1WMPA 4R9LA 3ROBA 1VQM3 1GOYA 3I563 5IG3A 4STDA 1B20A 1ROAA 1CQSA 1W01A 5KP1A 3M8CA 1I8VA 1KC84 4HM3B 2FGTA 1VQL3 2KXGA 1JN5A 4RNTA 5BIRA 2LYXA 3BNBA 3CCE3 2IMJA 1JBSA 3UL6A 3CCS3 3Q3FA 4HM2B 3V99A 4FMDA 8RNTA 3CCL3 1MWSA 1B2XA 4N6TA 3D9RA 4FCMA 3SVAA 1GYBA 2WOFA 3MSOA 4LEHA 2GEXA 3K9MC 3AMOB 4XM4A 2P38A 2OTL3 4WP5A 4MMXB 1RN1A 5G2GA 1R4CA 2K54A 3MWZA 3RGAA 1BNJA 8CHOA 1YNVX 1KSIA 1UDII 3KN4A 1QALA 2UUGC 1UUGB 1ZO2A 2F86B 3F40A 1YVSA 3RDEA 1GY7A 1RNBA 1TFKA 3DGYA 5AIFA 1I3IA 1O7HB 2GBXB 1VQ63 3WA3A 3S5CA 2OTJ3 2Z76A 2KRTA 3DGLA 3EE1A 2XFSA 3FLJA 2XSOB 3F7XA 4KZ1A 4L8OA 4WYKA 2P0MA 4FCJA 3CC23 4MMZB 1FGQA 2PZVA 1YJ93 3KFQC 1BRHA 1OACA 2B24B 4BL3A 3CXC2 1I2FA 1RHLA 1JN5B 1W00A 3B4PA 5IERA 1MGRA 3CNMA 1BUQA 1MWUA 3CPOA 1KQS2 1RJOA 2KCDA 1YHQ3 3EN8A 1KD14 4O2HA 5TGNA 1Q40A 1AVKA 2XF3A 1C54A 1JKGA 3QK9A 3N8BA 2D1WA 4NPBA 4AKYA 1IQXA 3N54B 5LC6A 4KFEA 4XB5A 5AIIA 1LOXA 4BU4A 3BNDA 3O8YA 1BRGA 1JB5A 2W03A 1R4YA 2HMNB 2KF6A 1Q824 5CLKA 1LOVA 3LTDA 3NXJA 1MWTA 1UCLA 4RBNA 1JJ22 1RDSA 3NBRA 2O9UX 2H0GA 2BT3A 3F8HA 3KKGA 4HZ9B 4J5GA 4EYCA 1VZZA 4XBYA 3CCJ3 1BRIA 1V74A 2W9QA 3G8ZA 4O8SA 2XSHB 1JB2A 4QWTA 1BRKA 2Z7AA 2IYJA 1WMOA 2XGNA 3BNCA 3OX9A 1DMQA 3ER7A 3OXAA 5DREA 1E3VA 1TU5A 3VSYA 1K28A 1UCIA 1EA2A 2GSPA 4N6UA 3FF0A 3AGOA 5IENA 3HI7A 2F5MA 1AR0A 3A5EA 4FR9A 3NV0A 2CC3A 2PNCA 1BGSA 2QGUA 5IG4A 1D6UA 4LYLB 4RNYA 3NM2A 4IIAA 3AHWA 1SARA 1PFPA 3HK4A 1OGXA 1QJGA 1V57A 4IT7A 3K7CA 2KF4A 1ZX2A 2XEPA 4N6NB 1Q40B 5RNTA 1JKGB 2XGLA 1YJW3 2LQVA 3LH4A 1FGOA 1UUVB 3UJMA 2E2TA 4DKIA 1I3FA 3BIRA 1UGIA 1C7HA 1Q42A 3AHSA 6STDA 3X3XA 3U1WA 3D4AA 3BLZA 1BANA 2HMMB 2WGOA 1IVVA 1JZOA 3EBYA 4AEQA 1SIIA 3ALAA 1VQ83 1MOLA 3KZTA 1X1UA 1FW7A 2FXTA 1O7MB
chains in the Genus database with same CATH topology
3Q3FA 1BSBA 1LOWA 5GSPA 1TRQA 8RNTA 2F56A 1I70A 1B2XA 1MGWA 1BUJA 3KCHA 6GSPA 2AADA 4HOHA 1BSAA 1BNGA 1B2UA 3DH2A 1T2HA 1ZGXA 1DE3A 1B2ZA 1RN1A 1BNJA 1YNVX 1B2MA 4GSPA 1AY7A 3GSPA 1BU4A 1YVSA 1I2GA 1LNIA 1TRPA 1BRNL 1BOXA 4J5KA 1RNBA 3DGYA 1I3IA 1X1XA 3RNTA 1FUTA 1B2SA 1A2PA 1X1WA 2ZA4A 4BIRA 1BAOA 1FUSA 1HYFA 2SARA 3D5GA 1RCKA 2F4YA 1BRHA 2KAAA 1HZ1A 1I2FA 2F5WA 1RHLA 1RGGA 7GSPA 1MGRA 1CH0A 1LOYA 1BNEA 1JBTA 3AGNA 1GOVA 2KF5A 1I0VA 1JBSA 1I0XA 1C54A 2BU4A 1RLSA 1BNFA 1RN4A 1RGAA 2AAEA 1LRAA 1X1YA 1PYLA 4BU4A 1B3SA 1BSDA 1RGHA 1DETA 1BRGA 4GHOA 1RGLA 1BIRA 1R4YA 2KF6A 2BIRA 5HOHA 1LOVA 1RMSA 4HAAA 2RBIA 1BSEA 1UCLA 2HOHA 1GMRA 1RDSA 4J5GA 1PY3A 2RNTA 1BRIA 1RGKA 1G02A 3D5IA 2C4BA 6RNTA 1BNRA 1RTUA 1Q9EA 1BRKA 1T2IA 1UCJA 7RNTA 1GSPA 1UCIA 1RSNA 1GMQA 2GSPA 1BSCA 1B27A 1TTOA 1RGCA 3AGOA 3URPA 2F5MA 3A5EA 2KF3A 3WHOA 1BGSA 1FZUA 3HOHA 1B21A 1IYYA 5BU4A 1GMPA 1I2EA 1BNIA 3AHWA 1SARA 1UCKA 2KF4A 9RNTA 1YGWA 1JBRA 5RNTA 1FYSA 3WR2A 1RNTA 1GOYA 1I3FA 1RGFA 3BIRA 1RGEA 1B20A 1BNSA 3AHSA 1I8VA 3D4AA 1BANA 1AQZA 4RNTA 1GOUA 5BIRA 3BU4A 1BVIA 1X1UA 1FW7A 3SYUA 1RCLA 1BRJA 1BRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3F A;  1BSB A;  1LOW A;  5GSP A;  1TRQ A;  8RNT A;  2F56 A;  1I70 A;  1B2X A;  1MGW A;  1BUJ A;  3KCH A;  6GSP A;  2AAD A;  4HOH A;  1BSA A;  1BNG A;  1B2U A;  3DH2 A;  1T2H A;  1ZGX A;  1DE3 A;  1B2Z A;  1RN1 A;  1BNJ A;  1YNV X;  1B2M A;  4GSP A;  1AY7 A;  3GSP A;  1BU4 A;  1YVS A;  1I2G A;  1LNI A;  1TRP A;  1BRN L;  1BOX A;  4J5K A;  1RNB A;  3DGY A;  1I3I A;  1X1X A;  3RNT A;  1FUT A;  1B2S A;  1A2P A;  1X1W A;  2ZA4 A;  4BIR A;  1BAO A;  1FUS A;  1HYF A;  2SAR A;  3D5G A;  1RCK A;  2F4Y A;  1BRH A;  2KAA A;  1HZ1 A;  1I2F A;  2F5W A;  1RHL A;  1RGG A;  7GSP A;  1MGR A;  1CH0 A;  1LOY A;  1BNE A;  1JBT A;  3AGN A;  1GOV A;  2KF5 A;  1I0V A;  1JBS A;  1I0X A;  1C54 A;  2BU4 A;  1RLS A;  1BNF A;  1RN4 A;  1RGA A;  2AAE A;  1LRA A;  1X1Y A;  1PYL A;  4BU4 A;  1B3S A;  1BSD A;  1RGH A;  1DET A;  1BRG A;  4GHO A;  1RGL A;  1BIR A;  1R4Y A;  2KF6 A;  2BIR A;  5HOH A;  1LOV A;  1RMS A;  4HAA A;  2RBI A;  1BSE A;  1UCL A;  2HOH A;  1GMR A;  1RDS A;  4J5G A;  1PY3 A;  2RNT A;  1BRI A;  1RGK A;  1G02 A;  3D5I A;  2C4B A;  6RNT A;  1BNR A;  1RTU A;  1Q9E A;  1BRK A;  1T2I A;  1UCJ A;  7RNT A;  1GSP A;  1UCI A;  1RSN A;  1GMQ A;  2GSP A;  1BSC A;  1B27 A;  1TTO A;  1RGC A;  3AGO A;  3URP A;  2F5M A;  3A5E A;  2KF3 A;  3WHO A;  1BGS A;  1FZU A;  3HOH A;  1B21 A;  1IYY A;  5BU4 A;  1GMP A;  1I2E A;  1BNI A;  3AHW A;  1SAR A;  1UCK A;  2KF4 A;  9RNT A;  1YGW A;  1JBR A;  5RNT A;  1FYS A;  3WR2 A;  1RNT A;  1GOY A;  1I3F A;  1RGF A;  3BIR A;  1RGE A;  1B20 A;  1BNS A;  3AHS A;  1I8V A;  3D4A A;  1BAN A;  1AQZ A;  4RNT A;  1GOU A;  5BIR A;  3BU4 A;  1BVI A;  1X1U A;  1FW7 A;  3SYU A;  1RCL A;  1BRJ A;  1BRS A; 
#chains in the Genus database with same CATH topology
 3B4O A;  1LOW A;  5EEO A;  3NQY A;  4EV2 A;  1LXE A;  3NQZ A;  2IY2 A;  3IMA B;  4JF8 A;  4HZB B;  3I0Y A;  3LYG A;  2AAD A;  1IU7 A;  4OK0 A;  6GSP A;  1BSA A;  2W56 B;  4JRF A;  1IK3 A;  3BB9 A;  1VQ7 3;  1A2V A;  1M1K 4;  1B2U A;  3SOA A;  4WFO A;  1ZGX A;  3EHC A;  3U97 A;  2MC8 A;  2W0Q A;  4HM7 B;  1VQO 3;  3NV0 B;  4HM1 B;  4RNZ A;  3BNE A;  1OHP A;  1AY7 A;  1QMA A;  3WOE B;  1W2B 2;  4CDL A;  1DMM A;  3G71 3;  1BU4 A;  1GD4 A;  1K73 4;  3G16 A;  1LVN A;  1PU4 A;  4LSO A;  5KP3 A;  1NU3 A;  2IUK A;  3LT9 A;  1JV2 B;  1BOX A;  1WNH A;  3GAX A;  4CPK A;  5JBS A;  4KVH A;  3RNT A;  1FA3 A;  1FUT A;  4X2O A;  1B2S A;  5EVH A;  2HMJ B;  1SQW A;  2CX1 A;  2ZA4 A;  1TFO A;  1IVX A;  1NWW A;  1VQQ A;  2CWU A;  3V92 A;  2BO9 B;  1HYF A;  3J7Y d;  1RRL A;  2SAR A;  1MWR A;  1RCK A;  2K0M A;  2F4Y A;  2QEX 3;  4O02 B;  3LXU X;  1HZ1 A;  1UUW B;  2GU1 A;  4HM0 B;  3S28 A;  2YFJ B;  3GZR A;  1YJN 3;  1DYU A;  3DUK A;  2RGQ A;  4FCZ A;  4MEI A;  3CCU 3;  3Q90 A;  3AGN A;  1IT8 A;  1GOV A;  2CWT A;  2H0I A;  2KF5 A;  3CNX A;  3N9H A;  3CCV 3;  3KSE D;  1LRA A;  1X1Y A;  1W6G A;  2Z6B A;  4MJD A;  1RN7 A;  1BSD A;  2W9P A;  3GWR A;  1CEW I;  3GZY B;  3K0Z A;  3ZG5 A;  3MG2 A;  1NJI 4;  2QIY A;  4HM8 B;  1BIR A;  1A90 A;  2INX A;  2CFL A;  4EV5 A;  1RRH A;  2OQE C;  3LTC A;  1OF5 A;  1IV7 A;  2P09 A;  2STD A;  1SPU A;  1O7N B;  3ECF A;  3MG3 A;  4J8T A;  2GU3 A;  4O3V A;  4BTW A;  3G6E 3;  3D3L A;  2JDI H;  3E99 A;  3HIG A;  2RSX A;  4I4K A;  1G02 A;  2C4B A;  1Q81 4;  1EUI C;  1RTU A;  1IVW A;  5JPU A;  1L5G B;  4Q53 A;  1DVC A;  2XR8 B;  3A76 A;  7RNT A;  1OHS A;  1UI8 A;  3NBJ A;  4X2H A;  4KFD A;  1N5P A;  1GY6 A;  1HKX A;  1OHO A;  2CK3 H;  1CYV A;  5G1K A;  1D6Y A;  5AI1 A;  4XBT A;  3JUN A;  2KF3 A;  2C10 A;  3FF2 A;  4J9A A;  1IQY A;  3FZW A;  1VQ4 3;  1IYY A;  3OWS A;  5BU4 A;  1LNH A;  1I2E A;  1OCV A;  1W5Z A;  1WQL B;  3DGO A;  1TUH A;  1UCK A;  3PS8 A;  2Q07 A;  5AYR B;  1W02 A;  1JBR A;  5M18 A;  1US1 A;  3LT8 A;  2ML5 A;  4WHA A;  1K9M 4;  4HM6 B;  2O3O A;  5EQL A;  3SLU A;  3WR2 A;  2WO0 A;  1K8A 4;  3NUV A;  2W6J H;  1RNT A;  1VQN 3;  2GXF A;  3FH1 A;  2CG1 A;  1UGH I;  3OW2 2;  1ROV A;  2P0X A;  1RKY A;  1RGE A;  1Y4K A;  1BNS A;  3X41 A;  1BRN L;  3TDG A;  3PYJ A;  1OF5 B;  2W56 A;  4HM5 B;  1MNL A;  1N5H A;  1JB4 A;  5IEO A;  3BU4 A;  1LQG C;  4N3V A;  2H0H A;  1SJW A;  1QVG 2;  3SYU A;  1BRJ A;  2BMO B;  1BRS A;  1IVU A;  1BSB A;  2XH9 A;  2CFW A;  2E2U A;  5BXQ A;  4CCV A;  1Q86 4;  1JZD A;  1TIJ A;  2CW9 A;  1TRQ A;  4BTY A;  3MG1 A;  2F56 A;  2ZDJ A;  4WWU C;  2BMR B;  4I5Q A;  3NBB A;  3CCM 3;  1O7G B;  4KFF A;  4R80 A;  1BNG A;  5IF6 A;  5AEU B;  3DH2 A;  1EG9 B;  1T2H A;  1LQM B;  1B2Z A;  1OGZ A;  3IJE B;  3KE7 A;  3X3Z A;  3X40 A;  3EBT A;  4CJN A;  1EQK A;  4ORL A;  1STD A;  3PCR A;  1B2M A;  3DY5 A;  4GSP A;  1WMN A;  2J8X B;  1A2K A;  3GSP A;  3F7S A;  2ML6 A;  2BNG A;  3S29 A;  5AEW B;  1I2G A;  3OWY A;  3LTB A;  4LZI A;  3CCR 3;  1TJD A;  2F99 A;  4J5K A;  3EQQ B;  1U5O A;  4FMB A;  4R9K A;  5AYS C;  5IEP A;  1E97 A;  1NB3 I;  4BIR A;  1FUW A;  1K41 A;  2P05 A;  3D5G A;  3EF8 A;  2C11 A;  3I55 3;  4XBX A;  2OOV A;  2KAA A;  3FG4 A;  2YX9 A;  3QRD A;  3CU3 A;  4BTX A;  1VQP 3;  1RGG A;  2Z77 A;  4L8P A;  7GSP A;  3D79 A;  5A0O B;  4NRE A;  1LOY A;  1BNE A;  1YVB I;  3FG1 A;  3KII A;  3WOD G;  1U8C B;  1JBT A;  4NHF A;  1O7P B;  1UI7 A;  2HMK B;  4HVN A;  1ISK A;  2IUJ A;  3LOY A;  1I0X A;  2CG0 A;  3F8X A;  1RLS A;  2W2C A;  1BNF A;  1RN4 A;  3F9S A;  4XDW A;  2JQ5 A;  2L4V A;  3K5T A;  3T0U A;  1M9G A;  4AKZ A;  1RGH A;  1DET A;  3UB1 A;  1QVF 2;  3LML A;  2W04 A;  3PGB A;  5ELJ A;  2Y73 A;  1RGL A;  4GHO A;  3EX9 A;  2CKF B;  2BIR A;  5AIH A;  1VQ5 3;  1OUN A;  4HAA A;  3SX1 A;  3LTA A;  1BSE A;  2HOH A;  3DGM A;  1GMR A;  2MF7 A;  2RCD A;  3G0K A;  1DMN A;  1PY3 A;  2RNT A;  4H3U A;  1NB5 I;  2I9W A;  2QA4 3;  1FGT A;  1A67 A;  1BNR A;  3NHX A;  5LC7 A;  1Q9E A;  4K1V A;  4MMY B;  4GB5 A;  3WMD A;  5FGO A;  1QAF A;  4H61 A;  1GSP A;  4K90 B;  1KWI A;  1N9E A;  1IV9 A;  3H51 A;  4K61 A;  1YI2 3;  3GZB A;  2R4I A;  1BSC A;  1TTO A;  2B1X B;  1ULJ B;  1RGC A;  3LZA A;  5CF2 A;  5JPP A;  1Q7Y 4;  2OOV C;  1M1X B;  1E3R A;  5HGR A;  1SIH A;  4LMI A;  1N8R 4;  1G0T A;  4L7K A;  1FZU A;  3HOH A;  1B21 A;  5G1L A;  3STD A;  1GY5 A;  3OWU A;  1GMP A;  1EEJ A;  4EC6 A;  3Q1C A;  3V98 A;  4BL2 A;  3ZG0 A;  2R41 A;  2ZL8 A;  5D82 A;  3CC7 3;  3WDG B;  4EBG A;  1NO3 A;  2WOH A;  3S67 A;  1IT7 A;  3G4S 3;  1CYU A;  4FMA A;  1W2Z A;  1RGF A;  4GL6 A;  3X42 A;  3FCS B;  2BMQ B;  2WGQ A;  2YFL B;  1AQZ A;  1GOU A;  3UNL A;  3FKA A;  1BVI A;  5I97 A;  3MPH A;  4EXR A;  4U13 A;  1RCL A;  1F8N A;  2CFK A;  1OPY A;  1Z1S A;  1V58 A;  2BHM A;  3EJV A;  3NM7 A;  5GSP A;  1M90 4;  4N6L A;  5IG5 A;  3GZX B;  3DGN A;  7STD A;  1I70 A;  4K1U A;  3IPT A;  5AIG A;  1MGW A;  1ULI B;  4EW5 A;  1GD3 A;  1BUJ A;  3KCH A;  4HM4 B;  4RZM A;  3VF1 A;  1Q7H A;  4HOH A;  3MYT A;  5BVB A;  1HU9 A;  3L0R A;  5ELU A;  4FMC A;  1DE3 A;  3CCQ 3;  4OUQ A;  5CK6 A;  5M19 A;  1T5Y A;  2HML B;  3T8N A;  2OCT A;  1FGR A;  3HII A;  4N6O B;  3HX8 A;  1DVD A;  2GEY A;  5CXO A;  1LNI A;  1NNV A;  1TRP A;  2FNQ A;  4OVM A;  4PEJ A;  3B7C A;  2RFR A;  5M1A A;  1X1X A;  4ZM8 A;  3CC4 3;  1J2B A;  2GBW B;  2CX0 A;  4N6M A;  3S27 A;  3UL5 A;  1A2P A;  1X1W A;  4R1K A;  2K3D A;  3JUM A;  3DMC A;  4TX4 A;  1BAO A;  1FUS A;  4IPB A;  1AVL A;  1N9J A;  1W6C A;  3F14 A;  2Y74 A;  3OV4 A;  4HJL B;  4KT3 B;  2F5W A;  3KSP A;  2M7O A;  1W4N A;  2YFI B;  1ASK A;  3JUP A;  4HYZ A;  1CH0 A;  1JRQ A;  3HZP A;  2CWV A;  2UX0 A;  2SBL A;  4N6V 0;  2CIU A;  3JVC A;  4WYK B;  1N8Q A;  3X3Y A;  1I0V A;  1TP6 A;  2CHC A;  2XRX B;  3CD6 3;  1WTH A;  2BU4 A;  1ZS7 A;  1RGA A;  4LGQ A;  3Q2P A;  2AAE A;  1PYL A;  4HKV B;  4HBR A;  3DXO A;  1W7C A;  1D6Z A;  1B3S A;  1YIJ 3;  1W6Y A;  2HMO B;  3EC9 A;  3ZFZ A;  2CFG A;  3PXM A;  1OH0 A;  2A15 A;  5KP4 A;  1STF I;  1IDP A;  5HOH A;  5FW5 A;  5IW9 A;  1RMS A;  2L1S A;  3JUQ A;  2RBI A;  3K63 A;  2OWP A;  1G96 A;  5D83 A;  3MKI A;  3MHE A;  5STD A;  3WOF B;  2D42 A;  3DZL A;  5CF1 A;  1UW1 A;  4XDV A;  3EB8 A;  1RGK A;  3H3H A;  3D5I A;  6RNT A;  1YGE A;  2E2V A;  3CMA 3;  1UCJ A;  1GS3 A;  1T2I A;  1EKM A;  3DM8 A;  3PZW A;  1S5A A;  2XFT A;  1T3B A;  2V1L A;  3VGN A;  5DRV A;  1VQK 3;  2CH9 A;  3FGY A;  1RSN A;  3FSD A;  1GMQ A;  4ILF A;  1IQ8 A;  3AMO A;  1B27 A;  3NX0 A;  5D81 A;  3URP A;  1JNQ A;  1QAK A;  3SED A;  3WHO A;  1O7W B;  2F98 A;  3CPW 2;  1S72 3;  1NDO B;  3SXX A;  2IA7 A;  5IG0 A;  3GRD A;  3T8U A;  3WA2 X;  3JUO A;  1BNI A;  3PCS A;  2UGI A;  4G1M B;  3RGR A;  1YIT 3;  1FGM A;  3EN1 B;  9RNT A;  1YGW A;  1VQ9 3;  3FG3 A;  3SOY A;  3CME 3;  1AV4 A;  1FYS A;  2ZHX B;  4R4K A;  3B8L A;  2OQE A;  2CFD A;  1WMP A;  4R9L A;  3ROB A;  1VQM 3;  1GOY A;  3I56 3;  5IG3 A;  4STD A;  1B20 A;  1ROA A;  1CQS A;  1W01 A;  5KP1 A;  3M8C A;  1I8V A;  1KC8 4;  4HM3 B;  2FGT A;  1VQL 3;  2KXG A;  1JN5 A;  4RNT A;  5BIR A;  2LYX A;  3BNB A;  3CCE 3;  2IMJ A;  1JBS A;  3UL6 A;  3CCS 3;  3Q3F A;  4HM2 B;  3V99 A;  4FMD A;  8RNT A;  3CCL 3;  1MWS A;  1B2X A;  4N6T A;  3D9R A;  4FCM A;  3SVA A;  1GYB A;  2WOF A;  3MSO A;  4LEH A;  2GEX A;  3K9M C;  3AMO B;  4XM4 A;  2P38 A;  2OTL 3;  4WP5 A;  4MMX B;  1RN1 A;  5G2G A;  1R4C A;  2K54 A;  3MWZ A;  3RGA A;  1BNJ A;  8CHO A;  1YNV X;  1KSI A;  1UDI I;  3KN4 A;  1QAL A;  2UUG C;  1UUG B;  1ZO2 A;  2F86 B;  3F40 A;  1YVS A;  3RDE A;  1GY7 A;  1RNB A;  1TFK A;  3DGY A;  5AIF A;  1I3I A;  1O7H B;  2GBX B;  1VQ6 3;  3WA3 A;  3S5C A;  2OTJ 3;  2Z76 A;  2KRT A;  3DGL A;  3EE1 A;  2XFS A;  3FLJ A;  2XSO B;  3F7X A;  4KZ1 A;  4L8O A;  4WYK A;  2P0M A;  4FCJ A;  3CC2 3;  4MMZ B;  1FGQ A;  2PZV A;  1YJ9 3;  3KFQ C;  1BRH A;  1OAC A;  2B24 B;  4BL3 A;  3CXC 2;  1I2F A;  1RHL A;  1JN5 B;  1W00 A;  3B4P A;  5IER A;  1MGR A;  3CNM A;  1BUQ A;  1MWU A;  3CPO A;  1KQS 2;  1RJO A;  2KCD A;  1YHQ 3;  3EN8 A;  1KD1 4;  4O2H A;  5TGN A;  1Q40 A;  1AVK A;  2XF3 A;  1C54 A;  1JKG A;  3QK9 A;  3N8B A;  2D1W A;  4NPB A;  4AKY A;  1IQX A;  3N54 B;  5LC6 A;  4KFE A;  4XB5 A;  5AII A;  1LOX A;  4BU4 A;  3BND A;  3O8Y A;  1BRG A;  1JB5 A;  2W03 A;  1R4Y A;  2HMN B;  2KF6 A;  1Q82 4;  5CLK A;  1LOV A;  3LTD A;  3NXJ A;  1MWT A;  1UCL A;  4RBN A;  1JJ2 2;  1RDS A;  3NBR A;  2O9U X;  2H0G A;  2BT3 A;  3F8H A;  3KKG A;  4HZ9 B;  4J5G A;  4EYC A;  1VZZ A;  4XBY A;  3CCJ 3;  1BRI A;  1V74 A;  2W9Q A;  3G8Z A;  4O8S A;  2XSH B;  1JB2 A;  4QWT A;  1BRK A;  2Z7A A;  2IYJ A;  1WMO A;  2XGN A;  3BNC A;  3OX9 A;  1DMQ A;  3ER7 A;  3OXA A;  5DRE A;  1E3V A;  1TU5 A;  3VSY A;  1K28 A;  1UCI A;  1EA2 A;  2GSP A;  4N6U A;  3FF0 A;  3AGO A;  5IEN A;  3HI7 A;  2F5M A;  1AR0 A;  3A5E A;  4FR9 A;  3NV0 A;  2CC3 A;  2PNC A;  1BGS A;  2QGU A;  5IG4 A;  1D6U A;  4LYL B;  4RNY A;  3NM2 A;  4IIA A;  3AHW A;  1SAR A;  1PFP A;  3HK4 A;  1OGX A;  1QJG A;  1V57 A;  4IT7 A;  3K7C A;  2KF4 A;  1ZX2 A;  2XEP A;  4N6N B;  1Q40 B;  5RNT A;  1JKG B;  2XGL A;  1YJW 3;  2LQV A;  3LH4 A;  1FGO A;  1UUV B;  3UJM A;  2E2T A;  4DKI A;  1I3F A;  3BIR A;  1UGI A;  1C7H A;  1Q42 A;  3AHS A;  6STD A;  3X3X A;  3U1W A;  3D4A A;  3BLZ A;  1BAN A;  2HMM B;  2WGO A;  1IVV A;  1JZO A;  3EBY A;  4AEQ A;  1SII A;  3ALA A;  1VQ8 3;  1MOL A;  3KZT A;  1X1U A;  1FW7 A;  2FXT A;  1O7M B; 
#chains in the Genus database with same CATH homology
 3Q3F A;  1BSB A;  1LOW A;  5GSP A;  1TRQ A;  8RNT A;  2F56 A;  1I70 A;  1B2X A;  1MGW A;  1BUJ A;  3KCH A;  6GSP A;  2AAD A;  4HOH A;  1BSA A;  1BNG A;  1B2U A;  3DH2 A;  1T2H A;  1ZGX A;  1DE3 A;  1B2Z A;  1RN1 A;  1BNJ A;  1YNV X;  1B2M A;  4GSP A;  1AY7 A;  3GSP A;  1BU4 A;  1YVS A;  1I2G A;  1LNI A;  1TRP A;  1BRN L;  1BOX A;  4J5K A;  1RNB A;  3DGY A;  1I3I A;  1X1X A;  3RNT A;  1FUT A;  1B2S A;  1A2P A;  1X1W A;  2ZA4 A;  4BIR A;  1BAO A;  1FUS A;  1HYF A;  2SAR A;  3D5G A;  1RCK A;  2F4Y A;  1BRH A;  2KAA A;  1HZ1 A;  1I2F A;  2F5W A;  1RHL A;  1RGG A;  7GSP A;  1MGR A;  1CH0 A;  1LOY A;  1BNE A;  1JBT A;  3AGN A;  1GOV A;  2KF5 A;  1I0V A;  1JBS A;  1I0X A;  1C54 A;  2BU4 A;  1RLS A;  1BNF A;  1RN4 A;  1RGA A;  2AAE A;  1LRA A;  1X1Y A;  1PYL A;  4BU4 A;  1B3S A;  1BSD A;  1RGH A;  1DET A;  1BRG A;  4GHO A;  1RGL A;  1BIR A;  1R4Y A;  2KF6 A;  2BIR A;  5HOH A;  1LOV A;  1RMS A;  4HAA A;  2RBI A;  1BSE A;  1UCL A;  2HOH A;  1GMR A;  1RDS A;  4J5G A;  1PY3 A;  2RNT A;  1BRI A;  1RGK A;  1G02 A;  3D5I A;  2C4B A;  6RNT A;  1BNR A;  1RTU A;  1Q9E A;  1BRK A;  1T2I A;  1UCJ A;  7RNT A;  1GSP A;  1UCI A;  1RSN A;  1GMQ A;  2GSP A;  1BSC A;  1B27 A;  1TTO A;  1RGC A;  3AGO A;  3URP A;  2F5M A;  3A5E A;  2KF3 A;  3WHO A;  1BGS A;  1FZU A;  3HOH A;  1B21 A;  1IYY A;  5BU4 A;  1GMP A;  1I2E A;  1BNI A;  3AHW A;  1SAR A;  1UCK A;  2KF4 A;  9RNT A;  1YGW A;  1JBR A;  5RNT A;  1FYS A;  3WR2 A;  1RNT A;  1GOY A;  1I3F A;  1RGF A;  3BIR A;  1RGE A;  1B20 A;  1BNS A;  3AHS A;  1I8V A;  3D4A A;  1BAN A;  1AQZ A;  4RNT A;  1GOU A;  5BIR A;  3BU4 A;  1BVI A;  1X1U A;  1FW7 A;  3SYU A;  1RCL A;  1BRJ A;  1BRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...