1HZ1A

Ribonuclease t1 v16a mutant in complex with mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords RIBONUCLEASE T1
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1hz1A00
1BUJA 5BU4A 2KF4A 1RGAA 1RNBA 1BU4A 1BRGA 1GSPA 1RSNA 1I70A 1CH0A 1FYSA 1RCKA 1JBSA 1C54A 3RNTA 6GSPA 1LOWA 1B2MA 1BRNL 1BNEA 1AY7A 1GOYA 1A2PA 1T2HA 1I2FA 3AGNA 9RNTA 3D5GA 1GMPA 2C4BA 3AHWA 1ZGXA 3AGOA 4HOHA 1RN1A 1RMSA 1B21A 3HOHA 1BNRA 1X1XA 1BOXA 2BU4A 1BRKA 1B2UA 1IYYA 1JBTA 1RLSA 3GSPA 5HOHA 1BSEA 1GMQA 2BIRA 1FUTA 2KF6A 1I8VA 1LOYA 1FW7A 1BRHA 1PYLA 2RBIA 3A5EA 5GSPA 2GSPA 2SARA 3DH2A 1I3FA 1G02A 1AQZA 1FUSA 1RTUA 6RNTA 1YGWA 1BNGA 1RN4A 1I2GA 1RGEA 1BIRA 1BNSA 3DGYA 1LOVA 1BVIA 1RGCA 1BRIA 1BANA 3URPA 1TRPA 1SARA 7GSPA 1BNFA 1RGKA 1LRAA 1BSAA 3KCHA 3Q3FA 1RGFA 2F5WA 1B2ZA 1R4YA 1B20A 1GOUA 2KF5A 3AHSA 3BIRA 1B27A 1TTOA 2KF3A 1X1YA 4BIRA 3BU4A 2AAEA 5BIRA 1X1WA 1UCIA 1YVSA 1LNIA 1MGRA 1RHLA 4HAAA 1UCKA 1TRQA 1GOVA 1B2SA 3D4AA 1BNIA 4J5KA 1I0XA 3WR2A 4GSPA 2RNTA 1MGWA 4GHOA 1RDSA 2KAAA 1FZUA 1RGHA 1BGSA 1T2IA 2F5MA 3D5IA 1BSCA 2HOHA 3WHOA 1BSBA 1RGGA 4J5GA 2ZA4A 1HYFA 1YNVX 2F4YA 1RCLA 1RGLA 1BRJA 2F56A 1BRSA 1B2XA 1PY3A 1UCLA 5RNTA 8RNTA 7RNTA 1I3IA 1DE3A 1HZ1A 1X1UA 1BAOA 2AADA 4RNTA 1RNTA 1GMRA 1DETA 3SYUA 1B3SA 1BNJA 1BSDA 1I0VA 1Q9EA 1JBRA 1I2EA 1UCJA 4BU4A
chains in the Genus database with same CATH superfamily
1LVNA 5BU4A 1RNBA 4EC6A 2D42A 1BU4A 1FYSA 1W00A 1VQK3 1JBSA 1WMPA 1M1XB 3K7CA 1NU3A 4FCJA 4KT3B 1Y4KA 1S5AA 4HZ9B 4LZIA 3MYTA 3LTBA 4STDA 3CNMA 2CWVA 5ELUA 1SIHA 3LTAA 1G0TA 3N8BA 3ECFA 5AIHA 2XH9A 9RNTA 1VQN3 2CIUA 5LC6A 4RZMA 2J8XB 1RN7A 3KFQC 2W9PA 3AGOA 1JZDA 2LQVA 1MWTA 5AIIA 3K63A 4HOHA 4N6V0 1Q7Y4 1RMSA 4I4KA 2XSHB 3HK4A 3K9MC 2Q07A 3O8YA 1VQ43 3NUVA 1KWIA 5CK6A 5CLKA 1WMNA 2YFLB 5CXOA 4J9AA 1VQO3 3QRDA 3HI7A 4K1UA 2WOHA 3PYJA 1TP6A 2W56A 3X3YA 4LGQA 1VQQA 4HM4B 5AIGA 5AYSC 3F7SA 1EUIC 4G1MB 1NNVA 1JKGA 4WP5A 1BRHA 5EEOA 2GSPA 3RGRA 3I563 2F98A 1LQMB 1QAKA 3OW22 2IUJA 6RNTA 1IQYA 1BNGA 5KP4A 3JUQA 1RN4A 2RCDA 4JRFA 3Q2PA 4HZBB 2CW9A 1RRLA 5IEPA 1BIRA 3NXJA 3WMDA 1IU7A 3WA3A 2PZVA 1MNLA 1OF5B 4GL6A 5IG5A 4EV2A 4FMAA 4IIAA 4K90B 1KQS2 2RFRA 4FMDA 3PS8A 3LTCA 3CCL3 2KCDA 1TTOA 4FMCA 5AIFA 2XGNA 3STDA 5AI1A 3BNCA 4K61A 1ROVA 1X1WA 3V92A 1IVWA 1V58A 3DGOA 5IG0A 3V99A 3CD63 1TRQA 2WOFA 1GOVA 1Q40A 2HMMB 3D4AA 1TUHA 4BL3A 2QGUA 2CG1A 3UL5A 3FGYA 3WR2A 2XRXB 1GS3A 1HU9A 1MGWA 3JVCA 1FUWA 3UB1A 3FF2A 1NDOB 1FZUA 2CFDA 2XSOB 3HZPA 1WQLB 1K28A 3G16A 4WWUC 4EXRA 1UGHI 3DZLA 3KIIA 4J5GA 1GY6A 4N6MA 3WHOA 1VQ93 2Z6BA 1UUGB 1UDII 1AV4A 1TJDA 1YNVX 2LYXA 1S723 2BMOB 1BRJA 1OACA 1TIJA 5ELJA 3X3ZA 1BRSA 3G713 3HIIA 1A90A 1PY3A 4XB5A 1DMMA 1QMAA 1VZZA 3EN8A 3WOEB 5RNTA 4LMIA 4DKIA 2W04A 2YX9A 4HBRA 4XBTA 1WMOA 3GRDA 3NBRA 5DREA 1K734 1US1A 1K9M4 1VQ63 3MHEA 4CJNA 3GAXA 3MG3A 3CCQ3 3SXXA 2CH9A 1HZ1A 3OXAA 1AVKA 4HYZA 3UL6A 3LT9A 3LZAA 1DETA 1JN5B 1G96A 1I0VA 1JN5A 1Q9EA 2P0MA 1PU4A 3CPW2 2OTL3 3LXUX 1RKYA 1UCJA 1ZO2A 4HM0B 4XBYA 5G1KA 2OOVC 2GU3A 3OWSA 3RDEA 1R4CA 4L8OA 2KF4A 3UNLA 3K5TA 1W2B2 4FMBA 4WFOA 1GSPA 4H61A 1VQ83 2BMQB 1N8QA 2SBLA 2XFTA 5DRVA 1YIJ3 1IV9A 4L8PA 3J7Yd 3FG4A 6GSPA 1GYBA 3TDGA 1OGXA 1CYVA 3LOYA 2HMJB 3BNBA 4HKVB 1AY7A 1V74A 3H51A 4N6TA 3GZRA 1JNQA 3FG1A 1E3VA 4OVMA 1W5ZA 1GMPA 1FGMA 4NREA 2O9UX 5BVBA 1ZGXA 4HM1B 2YFJB 3AMOA 1JB2A 2CFLA 2IMJA 3S28A 1O7GB 1ZX2A 2STDA 1GD4A 2CG0A 1BOXA 1W7CA 2INXA 2KRTA 1BRKA 3DUKA 4R9LA 1B2UA 1W02A 3ROBA 5I97A 2C11A 1JBTA 3GSPA 1N9JA 2GBWB 5HOHA 3G8ZA 2CC3A 3T8UA 2W6JH 5KP3A 2KXGA 3NV0A 1JJ22 3DGMA 1FUTA 4GB5A 3Q90A 1I8VA 1LOYA 1FW7A 1CYUA 1DMNA 3EBTA 3EN1B 2D1WA 1DVCA 2RBIA 2OOVA 1IK3A 4MJDA 3SX1A 1N9EA 1IV7A 1N5HA 2P38A 3KSED 3WA2X 1I3FA 3I553 2OTJ3 1AQZA 4HM7B 5JPUA 3FZWA 1T5YA 3VGNA 2CX0A 3EX9A 3MWZA 1OHSA 4KZ1A 2XFSA 4N6OB 1BNSA 3B7CA 2JQ5A 3B4PA 1RGCA 5D81A 2OQEC 1BANA 3RGAA 1TRPA 3G6E3 2UX0A 4LYLB 1BNFA 2P09A 3V98A 3S5CA 3KCHA 3Q3FA 1RGFA 3NBBA 1B2ZA 4FCZA 1B20A 2KF5A 3BNEA 1D6YA 1E3RA 1X1YA 2XF3A 4OK0A 2AAEA 2IUKA 4RBNA 5CF1A 4TX4A 1Q824 1NB3I 4MEIA 3F7XA 4HAAA 1V57A 2CWTA 1BNIA 2Z77A 3CCJ3 3PCSA 3FKAA 3LYGA 3NBJA 1YVBI 2BMRB 5IG4A 3KN4A 4GSPA 1W6CA 4GHOA 1AVLA 2B1XB 2HMLB 1RDSA 1STFI 2ML5A 3S67A 4EBGA 1BGSA 1RGHA 2CHCA 1IVXA 3DGLA 1YI23 1SPUA 2F5MA 4L7KA 4J8TA 2E2UA 4QWTA 1BSCA 3JUMA 3D3LA 2O3OA 3EHCA 3LTDA 4ZM8A 2W56B 2ZA4A 5M1AA 4HM3B 4U13A 5M18A 2P05A 4MMXB 3Q1CA 1TFOA 2F56A 1B2XA 1L5GB 2CKFB 1W6YA 3CXC2 2GU1A 2IYJA 1GY5A 3I0YA 1OCVA 2R41A 1U5OA 3BNDA 5EQLA 4AKYA 1U8CB 7RNTA 7STDA 3NHXA 8RNTA 4N6LA 1I3IA 1IQXA 3CNXA 2GBXB 2AADA 1ASKA 2A15A 4HM8B 3CCE3 3NM7A 1B3SA 1BSDA 1GY7A 3FG3A 4KFEA 1TFKA 3ZG0A 1I2EA 1WNHA 1M1K4 2W03A 1QVG2 3EC9A 1BUJA 3HX8A 3MG1A 1MOLA 3B8LA 3KSPA 2BHMA 3N54B 1BRGA 1NJI4 1RCKA 4O8SA 5AEUB 3EF8A 3SLUA 1F8NA 1LQGC 2Z76A 3LH4A 3KKGA 1K41A 2ZL8A 4JF8A 1FGQA 1BUQA 4OUQA 1Q7HA 3E99A 1FGRA 3AGNA 3X41A 3D5GA 3PGBA 3G0KA 2W2CA 2C10A 3WOFB 3AHWA 2H0IA 1YIT3 3DXOA 4BTXA 1ULJB 1JV2B 1RN1A 2CX1A 1EEJA 5CF2A 1B21A 3HOHA 1O7HB 2E2TA 2XGLA 4KFFA 5G1LA 1BNRA 1JRQA 2BU4A 3JUNA 2Z7AA 4O02B 1OH0A 4O3VA 1EG9B 1JB5A 1RLSA 1GD3A 4H3UA 2RGQA 1GMQA 4LSOA 3NX0A 3X40A 4AEQA 3OX9A 5A0OB 2IY2A 1YJW3 3DY5A 2KF6A 1IT7A 4HVNA 5M19A 2W0QA 2L4VA 3K0ZA 3GZXB 3HIGA 2E2VA 2HMKB 1QAFA 1PYLA 2K0MA 3A5EA 3PZWA 4LEHA 4X2OA 5GSPA 3EE1A 4CDLA 1FUSA 5TGNA 1YGWA 3LT8A 4WYKA 2GEYA 1MWUA 1MWSA 6STDA 1Q864 1UW1A 2PNCA 3DGYA 1BVIA 4HM2B 1BRIA 3URPA 3MKIA 1QJGA 1SARA 1VQL3 3S29A 4FCMA 3NQZA 4KVHA 1LRAA 2K54A 1BSAA 5FGOA 5BXQA 1FGOA 3DMCA 1IQ8A 2F5WA 1GOUA 5G2GA 4HJLB 4BTYA 1A2KA 1B27A 4AKZA 4BIRA 2OCTA 1UUVB 2CK3H 2M7OA 3BU4A 1KD14 1LXEA 3CC43 3SVAA 1IVVA 1YVSA 3PCRA 3CCS3 1OHPA 1IDPA 1MGRA 4N6NB 5LC7A 4EW5A 3CC73 1M904 2FGTA 1PFPA 2Y73A 3F9SA 1B2SA 1NB5I 1VQ53 3GZYB 3IMAB 4J5KA 1OGZA 3U1WA 1I0XA 4HM5B 3CCR3 1TU5A 2JDIH 3FSDA 4EYCA 4CPKA 5IG3A 2RNTA 1ISKA 2KAAA 4O2HA 4R1KA 1CQSA 3T0UA 3F40A 5IW9A 1A67A 3G4S3 3CMA3 4ORLA 4MMYB 3D5IA 1STDA 4MMZB 1N5PA 2HOHA 3F8HA 3CME3 2CFGA 1W2ZA 1RCLA 3CCV3 4HM6B 2ML6A 3NV0B 5D82A 3X3XA 1FGTA 3KE7A 1W01A 3GWRA 1JKGB 5IF6A 3OWYA 3N9HA 1O7PB 1OHOA 1DE3A 4BL2A 3SEDA 1X1UA 1E97A 1BAOA 1KSIA 1ULIB 3FLJA 8CHOA 5KP1A 4RNTA 2F99A 3JUPA 4NHFA 1GMRA 2CFWA 1EA2A 3EQQB 1ZS7A 1UI8A 1BNJA 4IT7A 4NPBA 3SYUA 1QVF2 2ZHXB 5EVHA 3CC23 2B24B 4BU4A 3U97A 3FF0A 5JBSA 3EJVA 2I9WA 4EV5A 1RGAA 1LOXA 1OF5A 4R4KA 2XEPA 1EQKA 1O7WB 1RSNA 5HGRA 2RSXA 1I70A 1UI7A 1CH0A 1MWRA 1VQP3 1YJN3 1C54A 3LMLA 3RNTA 2W9QA 1LOWA 1RRHA 1SQWA 3IJEB 2IA7A 1B2MA 1IT8A 1BRNL 2WO0A 3BB9A 1BNEA 1VQM3 1GOYA 1YGEA 1A2PA 1T3BA 1T2HA 1I2FA 1Q40B 5STDA 2WGQA 1JZOA 1HKXA 3D79A 3OV4A 3GZBA 2C4BA 2UUGC 4XDWA 3NQYA 4BTWA 1LNHA 5IENA 1IVUA 3SOYA 2UGIA 3FCSB 1OUNA 3KZTA 1UUWB 1X1XA 3PXMA 3CCM3 5AYRB 3ER7A 2BNGA 1IYYA 3A76A 1Q814 1DMQA 3DM8A 1M9GA 2YFIB 1BSEA 3VF1A 1N8R4 2BIRA 3EBYA 4WYKB 4CCVA 3L0RA 1W6GA 2OWPA 1A2VA 4FR9A 1NO3A 1JB4A 2SARA 3B4OA 1DVDA 2R4IA 3DH2A 2QA43 1G02A 3WODG 1RTUA 1KC84 1SJWA 2H0HA 5FW5A 1I2GA 1DYUA 1D6UA 3S27A 2L1SA 3JUOA 3MG2A 1RGEA 1AR0A 2MF7A 3F8XA 3F14A 2QIYA 1LOVA 3M8CA 3T8NA 1CEWI 3UJMA 4N3VA 4R9KA 7GSPA 1RGKA 4I5QA 2MC8A 1WTHA 1Q42A 2CFKA 1R4YA 1K8A4 3AHSA 3BIRA 1UGIA 1D6ZA 2KF3A 3OWUA 4PEJA 4XBXA 2F86B 3AMOB 5BIRA 3QK9A 1UCIA 4RNZA 2HMOB 2BO9B 1LNIA 1RHLA 2H0GA 1UCKA 3IPTA 2GXFA 1EKMA 5AEWB 3WDGB 2V1LA 2HMNB 3BLZA 3D9RA 4X2HA 5IEOA 1Z1SA 4N6UA 4XDVA 3X42A 1FA3A 1T2IA 2Y74A 4K1VA 5IERA 1OPYA 4ILFA 1O7MB 1BSBA 1RGGA 2WGOA 2ZDJA 1RJOA 1HYFA 2BT3A 5D83A 2F4YA 1RGLA 2FNQA 4XM4A 4Q53A 1O7NB 4R80A 2FXTA 4RNYA 3ALAA 3EB8A 2K3DA 1UCLA 3ZFZA 3CCU3 3DGNA 1NWWA 1QALA 1SIIA 2CWUA 3MPHA 2OQEA 3CPOA 2XR8B 3CU3A 1C7HA 2GEXA 3H3HA 1J2BA 1YJ93 2QEX3 1VQ73 2P0XA 3SOAA 1RNTA 3FH1A 4WHAA 3VSYA 4IPBA 5JPPA 1YHQ3 1ROAA 1JBRA 3ZG5A 3NM2A 3MSOA 1W4NA 4KFDA
chains in the Genus database with same CATH topology
1BUJA 5BU4A 2KF4A 1RGAA 1RNBA 1BU4A 1BRGA 1GSPA 1RSNA 1I70A 1CH0A 1FYSA 1RCKA 1JBSA 1C54A 3RNTA 6GSPA 1LOWA 1B2MA 1BRNL 1BNEA 1AY7A 1GOYA 1A2PA 1T2HA 1I2FA 3AGNA 9RNTA 3D5GA 1GMPA 2C4BA 3AHWA 1ZGXA 3AGOA 4HOHA 1RN1A 1RMSA 1B21A 3HOHA 1BNRA 1X1XA 1BOXA 2BU4A 1BRKA 1B2UA 1IYYA 1JBTA 1RLSA 3GSPA 5HOHA 1BSEA 1GMQA 2BIRA 1FUTA 2KF6A 1I8VA 1LOYA 1FW7A 1BRHA 1PYLA 2RBIA 3A5EA 5GSPA 2GSPA 2SARA 3DH2A 1I3FA 1G02A 1AQZA 1FUSA 1RTUA 6RNTA 1YGWA 1BNGA 1RN4A 1I2GA 1RGEA 1BIRA 1BNSA 3DGYA 1LOVA 1BVIA 1RGCA 1BRIA 1BANA 3URPA 1TRPA 1SARA 7GSPA 1BNFA 1RGKA 1LRAA 1BSAA 3KCHA 3Q3FA 1RGFA 2F5WA 1B2ZA 1R4YA 1B20A 1GOUA 2KF5A 3AHSA 3BIRA 1B27A 1TTOA 2KF3A 1X1YA 4BIRA 3BU4A 2AAEA 5BIRA 1X1WA 1UCIA 1YVSA 1LNIA 1MGRA 1RHLA 4HAAA 1UCKA 1TRQA 1GOVA 1B2SA 3D4AA 1BNIA 4J5KA 1I0XA 3WR2A 4GSPA 2RNTA 1MGWA 4GHOA 1RDSA 2KAAA 1FZUA 1RGHA 1BGSA 1T2IA 2F5MA 3D5IA 1BSCA 2HOHA 3WHOA 1BSBA 1RGGA 4J5GA 2ZA4A 1HYFA 1YNVX 2F4YA 1RCLA 1RGLA 1BRJA 2F56A 1BRSA 1B2XA 1PY3A 1UCLA 5RNTA 8RNTA 7RNTA 1I3IA 1DE3A 1HZ1A 1X1UA 1BAOA 2AADA 4RNTA 1RNTA 1GMRA 1DETA 3SYUA 1B3SA 1BNJA 1BSDA 1I0VA 1Q9EA 1JBRA 1I2EA 1UCJA 4BU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUJ A;  5BU4 A;  2KF4 A;  1RGA A;  1RNB A;  1BU4 A;  1BRG A;  1GSP A;  1RSN A;  1I70 A;  1CH0 A;  1FYS A;  1RCK A;  1JBS A;  1C54 A;  3RNT A;  6GSP A;  1LOW A;  1B2M A;  1BRN L;  1BNE A;  1AY7 A;  1GOY A;  1A2P A;  1T2H A;  1I2F A;  3AGN A;  9RNT A;  3D5G A;  1GMP A;  2C4B A;  3AHW A;  1ZGX A;  3AGO A;  4HOH A;  1RN1 A;  1RMS A;  1B21 A;  3HOH A;  1BNR A;  1X1X A;  1BOX A;  2BU4 A;  1BRK A;  1B2U A;  1IYY A;  1JBT A;  1RLS A;  3GSP A;  5HOH A;  1BSE A;  1GMQ A;  2BIR A;  1FUT A;  2KF6 A;  1I8V A;  1LOY A;  1FW7 A;  1BRH A;  1PYL A;  2RBI A;  3A5E A;  5GSP A;  2GSP A;  2SAR A;  3DH2 A;  1I3F A;  1G02 A;  1AQZ A;  1FUS A;  1RTU A;  6RNT A;  1YGW A;  1BNG A;  1RN4 A;  1I2G A;  1RGE A;  1BIR A;  1BNS A;  3DGY A;  1LOV A;  1BVI A;  1RGC A;  1BRI A;  1BAN A;  3URP A;  1TRP A;  1SAR A;  7GSP A;  1BNF A;  1RGK A;  1LRA A;  1BSA A;  3KCH A;  3Q3F A;  1RGF A;  2F5W A;  1B2Z A;  1R4Y A;  1B20 A;  1GOU A;  2KF5 A;  3AHS A;  3BIR A;  1B27 A;  1TTO A;  2KF3 A;  1X1Y A;  4BIR A;  3BU4 A;  2AAE A;  5BIR A;  1X1W A;  1UCI A;  1YVS A;  1LNI A;  1MGR A;  1RHL A;  4HAA A;  1UCK A;  1TRQ A;  1GOV A;  1B2S A;  3D4A A;  1BNI A;  4J5K A;  1I0X A;  3WR2 A;  4GSP A;  2RNT A;  1MGW A;  4GHO A;  1RDS A;  2KAA A;  1FZU A;  1RGH A;  1BGS A;  1T2I A;  2F5M A;  3D5I A;  1BSC A;  2HOH A;  3WHO A;  1BSB A;  1RGG A;  4J5G A;  2ZA4 A;  1HYF A;  1YNV X;  2F4Y A;  1RCL A;  1RGL A;  1BRJ A;  2F56 A;  1BRS A;  1B2X A;  1PY3 A;  1UCL A;  5RNT A;  8RNT A;  7RNT A;  1I3I A;  1DE3 A;  1HZ1 A;  1X1U A;  1BAO A;  2AAD A;  4RNT A;  1RNT A;  1GMR A;  1DET A;  3SYU A;  1B3S A;  1BNJ A;  1BSD A;  1I0V A;  1Q9E A;  1JBR A;  1I2E A;  1UCJ A;  4BU4 A; 
#chains in the Genus database with same CATH topology
 1LVN A;  5BU4 A;  1RNB A;  4EC6 A;  2D42 A;  1BU4 A;  1FYS A;  1W00 A;  1VQK 3;  1JBS A;  1WMP A;  1M1X B;  3K7C A;  1NU3 A;  4FCJ A;  4KT3 B;  1Y4K A;  1S5A A;  4HZ9 B;  4LZI A;  3MYT A;  3LTB A;  4STD A;  3CNM A;  2CWV A;  5ELU A;  1SIH A;  3LTA A;  1G0T A;  3N8B A;  3ECF A;  5AIH A;  2XH9 A;  9RNT A;  1VQN 3;  2CIU A;  5LC6 A;  4RZM A;  2J8X B;  1RN7 A;  3KFQ C;  2W9P A;  3AGO A;  1JZD A;  2LQV A;  1MWT A;  5AII A;  3K63 A;  4HOH A;  4N6V 0;  1Q7Y 4;  1RMS A;  4I4K A;  2XSH B;  3HK4 A;  3K9M C;  2Q07 A;  3O8Y A;  1VQ4 3;  3NUV A;  1KWI A;  5CK6 A;  5CLK A;  1WMN A;  2YFL B;  5CXO A;  4J9A A;  1VQO 3;  3QRD A;  3HI7 A;  4K1U A;  2WOH A;  3PYJ A;  1TP6 A;  2W56 A;  3X3Y A;  4LGQ A;  1VQQ A;  4HM4 B;  5AIG A;  5AYS C;  3F7S A;  1EUI C;  4G1M B;  1NNV A;  1JKG A;  4WP5 A;  1BRH A;  5EEO A;  2GSP A;  3RGR A;  3I56 3;  2F98 A;  1LQM B;  1QAK A;  3OW2 2;  2IUJ A;  6RNT A;  1IQY A;  1BNG A;  5KP4 A;  3JUQ A;  1RN4 A;  2RCD A;  4JRF A;  3Q2P A;  4HZB B;  2CW9 A;  1RRL A;  5IEP A;  1BIR A;  3NXJ A;  3WMD A;  1IU7 A;  3WA3 A;  2PZV A;  1MNL A;  1OF5 B;  4GL6 A;  5IG5 A;  4EV2 A;  4FMA A;  4IIA A;  4K90 B;  1KQS 2;  2RFR A;  4FMD A;  3PS8 A;  3LTC A;  3CCL 3;  2KCD A;  1TTO A;  4FMC A;  5AIF A;  2XGN A;  3STD A;  5AI1 A;  3BNC A;  4K61 A;  1ROV A;  1X1W A;  3V92 A;  1IVW A;  1V58 A;  3DGO A;  5IG0 A;  3V99 A;  3CD6 3;  1TRQ A;  2WOF A;  1GOV A;  1Q40 A;  2HMM B;  3D4A A;  1TUH A;  4BL3 A;  2QGU A;  2CG1 A;  3UL5 A;  3FGY A;  3WR2 A;  2XRX B;  1GS3 A;  1HU9 A;  1MGW A;  3JVC A;  1FUW A;  3UB1 A;  3FF2 A;  1NDO B;  1FZU A;  2CFD A;  2XSO B;  3HZP A;  1WQL B;  1K28 A;  3G16 A;  4WWU C;  4EXR A;  1UGH I;  3DZL A;  3KII A;  4J5G A;  1GY6 A;  4N6M A;  3WHO A;  1VQ9 3;  2Z6B A;  1UUG B;  1UDI I;  1AV4 A;  1TJD A;  1YNV X;  2LYX A;  1S72 3;  2BMO B;  1BRJ A;  1OAC A;  1TIJ A;  5ELJ A;  3X3Z A;  1BRS A;  3G71 3;  3HII A;  1A90 A;  1PY3 A;  4XB5 A;  1DMM A;  1QMA A;  1VZZ A;  3EN8 A;  3WOE B;  5RNT A;  4LMI A;  4DKI A;  2W04 A;  2YX9 A;  4HBR A;  4XBT A;  1WMO A;  3GRD A;  3NBR A;  5DRE A;  1K73 4;  1US1 A;  1K9M 4;  1VQ6 3;  3MHE A;  4CJN A;  3GAX A;  3MG3 A;  3CCQ 3;  3SXX A;  2CH9 A;  1HZ1 A;  3OXA A;  1AVK A;  4HYZ A;  3UL6 A;  3LT9 A;  3LZA A;  1DET A;  1JN5 B;  1G96 A;  1I0V A;  1JN5 A;  1Q9E A;  2P0M A;  1PU4 A;  3CPW 2;  2OTL 3;  3LXU X;  1RKY A;  1UCJ A;  1ZO2 A;  4HM0 B;  4XBY A;  5G1K A;  2OOV C;  2GU3 A;  3OWS A;  3RDE A;  1R4C A;  4L8O A;  2KF4 A;  3UNL A;  3K5T A;  1W2B 2;  4FMB A;  4WFO A;  1GSP A;  4H61 A;  1VQ8 3;  2BMQ B;  1N8Q A;  2SBL A;  2XFT A;  5DRV A;  1YIJ 3;  1IV9 A;  4L8P A;  3J7Y d;  3FG4 A;  6GSP A;  1GYB A;  3TDG A;  1OGX A;  1CYV A;  3LOY A;  2HMJ B;  3BNB A;  4HKV B;  1AY7 A;  1V74 A;  3H51 A;  4N6T A;  3GZR A;  1JNQ A;  3FG1 A;  1E3V A;  4OVM A;  1W5Z A;  1GMP A;  1FGM A;  4NRE A;  2O9U X;  5BVB A;  1ZGX A;  4HM1 B;  2YFJ B;  3AMO A;  1JB2 A;  2CFL A;  2IMJ A;  3S28 A;  1O7G B;  1ZX2 A;  2STD A;  1GD4 A;  2CG0 A;  1BOX A;  1W7C A;  2INX A;  2KRT A;  1BRK A;  3DUK A;  4R9L A;  1B2U A;  1W02 A;  3ROB A;  5I97 A;  2C11 A;  1JBT A;  3GSP A;  1N9J A;  2GBW B;  5HOH A;  3G8Z A;  2CC3 A;  3T8U A;  2W6J H;  5KP3 A;  2KXG A;  3NV0 A;  1JJ2 2;  3DGM A;  1FUT A;  4GB5 A;  3Q90 A;  1I8V A;  1LOY A;  1FW7 A;  1CYU A;  1DMN A;  3EBT A;  3EN1 B;  2D1W A;  1DVC A;  2RBI A;  2OOV A;  1IK3 A;  4MJD A;  3SX1 A;  1N9E A;  1IV7 A;  1N5H A;  2P38 A;  3KSE D;  3WA2 X;  1I3F A;  3I55 3;  2OTJ 3;  1AQZ A;  4HM7 B;  5JPU A;  3FZW A;  1T5Y A;  3VGN A;  2CX0 A;  3EX9 A;  3MWZ A;  1OHS A;  4KZ1 A;  2XFS A;  4N6O B;  1BNS A;  3B7C A;  2JQ5 A;  3B4P A;  1RGC A;  5D81 A;  2OQE C;  1BAN A;  3RGA A;  1TRP A;  3G6E 3;  2UX0 A;  4LYL B;  1BNF A;  2P09 A;  3V98 A;  3S5C A;  3KCH A;  3Q3F A;  1RGF A;  3NBB A;  1B2Z A;  4FCZ A;  1B20 A;  2KF5 A;  3BNE A;  1D6Y A;  1E3R A;  1X1Y A;  2XF3 A;  4OK0 A;  2AAE A;  2IUK A;  4RBN A;  5CF1 A;  4TX4 A;  1Q82 4;  1NB3 I;  4MEI A;  3F7X A;  4HAA A;  1V57 A;  2CWT A;  1BNI A;  2Z77 A;  3CCJ 3;  3PCS A;  3FKA A;  3LYG A;  3NBJ A;  1YVB I;  2BMR B;  5IG4 A;  3KN4 A;  4GSP A;  1W6C A;  4GHO A;  1AVL A;  2B1X B;  2HML B;  1RDS A;  1STF I;  2ML5 A;  3S67 A;  4EBG A;  1BGS A;  1RGH A;  2CHC A;  1IVX A;  3DGL A;  1YI2 3;  1SPU A;  2F5M A;  4L7K A;  4J8T A;  2E2U A;  4QWT A;  1BSC A;  3JUM A;  3D3L A;  2O3O A;  3EHC A;  3LTD A;  4ZM8 A;  2W56 B;  2ZA4 A;  5M1A A;  4HM3 B;  4U13 A;  5M18 A;  2P05 A;  4MMX B;  3Q1C A;  1TFO A;  2F56 A;  1B2X A;  1L5G B;  2CKF B;  1W6Y A;  3CXC 2;  2GU1 A;  2IYJ A;  1GY5 A;  3I0Y A;  1OCV A;  2R41 A;  1U5O A;  3BND A;  5EQL A;  4AKY A;  1U8C B;  7RNT A;  7STD A;  3NHX A;  8RNT A;  4N6L A;  1I3I A;  1IQX A;  3CNX A;  2GBX B;  2AAD A;  1ASK A;  2A15 A;  4HM8 B;  3CCE 3;  3NM7 A;  1B3S A;  1BSD A;  1GY7 A;  3FG3 A;  4KFE A;  1TFK A;  3ZG0 A;  1I2E A;  1WNH A;  1M1K 4;  2W03 A;  1QVG 2;  3EC9 A;  1BUJ A;  3HX8 A;  3MG1 A;  1MOL A;  3B8L A;  3KSP A;  2BHM A;  3N54 B;  1BRG A;  1NJI 4;  1RCK A;  4O8S A;  5AEU B;  3EF8 A;  3SLU A;  1F8N A;  1LQG C;  2Z76 A;  3LH4 A;  3KKG A;  1K41 A;  2ZL8 A;  4JF8 A;  1FGQ A;  1BUQ A;  4OUQ A;  1Q7H A;  3E99 A;  1FGR A;  3AGN A;  3X41 A;  3D5G A;  3PGB A;  3G0K A;  2W2C A;  2C10 A;  3WOF B;  3AHW A;  2H0I A;  1YIT 3;  3DXO A;  4BTX A;  1ULJ B;  1JV2 B;  1RN1 A;  2CX1 A;  1EEJ A;  5CF2 A;  1B21 A;  3HOH A;  1O7H B;  2E2T A;  2XGL A;  4KFF A;  5G1L A;  1BNR A;  1JRQ A;  2BU4 A;  3JUN A;  2Z7A A;  4O02 B;  1OH0 A;  4O3V A;  1EG9 B;  1JB5 A;  1RLS A;  1GD3 A;  4H3U A;  2RGQ A;  1GMQ A;  4LSO A;  3NX0 A;  3X40 A;  4AEQ A;  3OX9 A;  5A0O B;  2IY2 A;  1YJW 3;  3DY5 A;  2KF6 A;  1IT7 A;  4HVN A;  5M19 A;  2W0Q A;  2L4V A;  3K0Z A;  3GZX B;  3HIG A;  2E2V A;  2HMK B;  1QAF A;  1PYL A;  2K0M A;  3A5E A;  3PZW A;  4LEH A;  4X2O A;  5GSP A;  3EE1 A;  4CDL A;  1FUS A;  5TGN A;  1YGW A;  3LT8 A;  4WYK A;  2GEY A;  1MWU A;  1MWS A;  6STD A;  1Q86 4;  1UW1 A;  2PNC A;  3DGY A;  1BVI A;  4HM2 B;  1BRI A;  3URP A;  3MKI A;  1QJG A;  1SAR A;  1VQL 3;  3S29 A;  4FCM A;  3NQZ A;  4KVH A;  1LRA A;  2K54 A;  1BSA A;  5FGO A;  5BXQ A;  1FGO A;  3DMC A;  1IQ8 A;  2F5W A;  1GOU A;  5G2G A;  4HJL B;  4BTY A;  1A2K A;  1B27 A;  4AKZ A;  4BIR A;  2OCT A;  1UUV B;  2CK3 H;  2M7O A;  3BU4 A;  1KD1 4;  1LXE A;  3CC4 3;  3SVA A;  1IVV A;  1YVS A;  3PCR A;  3CCS 3;  1OHP A;  1IDP A;  1MGR A;  4N6N B;  5LC7 A;  4EW5 A;  3CC7 3;  1M90 4;  2FGT A;  1PFP A;  2Y73 A;  3F9S A;  1B2S A;  1NB5 I;  1VQ5 3;  3GZY B;  3IMA B;  4J5K A;  1OGZ A;  3U1W A;  1I0X A;  4HM5 B;  3CCR 3;  1TU5 A;  2JDI H;  3FSD A;  4EYC A;  4CPK A;  5IG3 A;  2RNT A;  1ISK A;  2KAA A;  4O2H A;  4R1K A;  1CQS A;  3T0U A;  3F40 A;  5IW9 A;  1A67 A;  3G4S 3;  3CMA 3;  4ORL A;  4MMY B;  3D5I A;  1STD A;  4MMZ B;  1N5P A;  2HOH A;  3F8H A;  3CME 3;  2CFG A;  1W2Z A;  1RCL A;  3CCV 3;  4HM6 B;  2ML6 A;  3NV0 B;  5D82 A;  3X3X A;  1FGT A;  3KE7 A;  1W01 A;  3GWR A;  1JKG B;  5IF6 A;  3OWY A;  3N9H A;  1O7P B;  1OHO A;  1DE3 A;  4BL2 A;  3SED A;  1X1U A;  1E97 A;  1BAO A;  1KSI A;  1ULI B;  3FLJ A;  8CHO A;  5KP1 A;  4RNT A;  2F99 A;  3JUP A;  4NHF A;  1GMR A;  2CFW A;  1EA2 A;  3EQQ B;  1ZS7 A;  1UI8 A;  1BNJ A;  4IT7 A;  4NPB A;  3SYU A;  1QVF 2;  2ZHX B;  5EVH A;  3CC2 3;  2B24 B;  4BU4 A;  3U97 A;  3FF0 A;  5JBS A;  3EJV A;  2I9W A;  4EV5 A;  1RGA A;  1LOX A;  1OF5 A;  4R4K A;  2XEP A;  1EQK A;  1O7W B;  1RSN A;  5HGR A;  2RSX A;  1I70 A;  1UI7 A;  1CH0 A;  1MWR A;  1VQP 3;  1YJN 3;  1C54 A;  3LML A;  3RNT A;  2W9Q A;  1LOW A;  1RRH A;  1SQW A;  3IJE B;  2IA7 A;  1B2M A;  1IT8 A;  1BRN L;  2WO0 A;  3BB9 A;  1BNE A;  1VQM 3;  1GOY A;  1YGE A;  1A2P A;  1T3B A;  1T2H A;  1I2F A;  1Q40 B;  5STD A;  2WGQ A;  1JZO A;  1HKX A;  3D79 A;  3OV4 A;  3GZB A;  2C4B A;  2UUG C;  4XDW A;  3NQY A;  4BTW A;  1LNH A;  5IEN A;  1IVU A;  3SOY A;  2UGI A;  3FCS B;  1OUN A;  3KZT A;  1UUW B;  1X1X A;  3PXM A;  3CCM 3;  5AYR B;  3ER7 A;  2BNG A;  1IYY A;  3A76 A;  1Q81 4;  1DMQ A;  3DM8 A;  1M9G A;  2YFI B;  1BSE A;  3VF1 A;  1N8R 4;  2BIR A;  3EBY A;  4WYK B;  4CCV A;  3L0R A;  1W6G A;  2OWP A;  1A2V A;  4FR9 A;  1NO3 A;  1JB4 A;  2SAR A;  3B4O A;  1DVD A;  2R4I A;  3DH2 A;  2QA4 3;  1G02 A;  3WOD G;  1RTU A;  1KC8 4;  1SJW A;  2H0H A;  5FW5 A;  1I2G A;  1DYU A;  1D6U A;  3S27 A;  2L1S A;  3JUO A;  3MG2 A;  1RGE A;  1AR0 A;  2MF7 A;  3F8X A;  3F14 A;  2QIY A;  1LOV A;  3M8C A;  3T8N A;  1CEW I;  3UJM A;  4N3V A;  4R9K A;  7GSP A;  1RGK A;  4I5Q A;  2MC8 A;  1WTH A;  1Q42 A;  2CFK A;  1R4Y A;  1K8A 4;  3AHS A;  3BIR A;  1UGI A;  1D6Z A;  2KF3 A;  3OWU A;  4PEJ A;  4XBX A;  2F86 B;  3AMO B;  5BIR A;  3QK9 A;  1UCI A;  4RNZ A;  2HMO B;  2BO9 B;  1LNI A;  1RHL A;  2H0G A;  1UCK A;  3IPT A;  2GXF A;  1EKM A;  5AEW B;  3WDG B;  2V1L A;  2HMN B;  3BLZ A;  3D9R A;  4X2H A;  5IEO A;  1Z1S A;  4N6U A;  4XDV A;  3X42 A;  1FA3 A;  1T2I A;  2Y74 A;  4K1V A;  5IER A;  1OPY A;  4ILF A;  1O7M B;  1BSB A;  1RGG A;  2WGO A;  2ZDJ A;  1RJO A;  1HYF A;  2BT3 A;  5D83 A;  2F4Y A;  1RGL A;  2FNQ A;  4XM4 A;  4Q53 A;  1O7N B;  4R80 A;  2FXT A;  4RNY A;  3ALA A;  3EB8 A;  2K3D A;  1UCL A;  3ZFZ A;  3CCU 3;  3DGN A;  1NWW A;  1QAL A;  1SII A;  2CWU A;  3MPH A;  2OQE A;  3CPO A;  2XR8 B;  3CU3 A;  1C7H A;  2GEX A;  3H3H A;  1J2B A;  1YJ9 3;  2QEX 3;  1VQ7 3;  2P0X A;  3SOA A;  1RNT A;  3FH1 A;  4WHA A;  3VSY A;  4IPB A;  5JPP A;  1YHQ 3;  1ROA A;  1JBR A;  3ZG5 A;  3NM2 A;  3MSO A;  1W4N A;  4KFD A; 
#chains in the Genus database with same CATH homology
 1BUJ A;  5BU4 A;  2KF4 A;  1RGA A;  1RNB A;  1BU4 A;  1BRG A;  1GSP A;  1RSN A;  1I70 A;  1CH0 A;  1FYS A;  1RCK A;  1JBS A;  1C54 A;  3RNT A;  6GSP A;  1LOW A;  1B2M A;  1BRN L;  1BNE A;  1AY7 A;  1GOY A;  1A2P A;  1T2H A;  1I2F A;  3AGN A;  9RNT A;  3D5G A;  1GMP A;  2C4B A;  3AHW A;  1ZGX A;  3AGO A;  4HOH A;  1RN1 A;  1RMS A;  1B21 A;  3HOH A;  1BNR A;  1X1X A;  1BOX A;  2BU4 A;  1BRK A;  1B2U A;  1IYY A;  1JBT A;  1RLS A;  3GSP A;  5HOH A;  1BSE A;  1GMQ A;  2BIR A;  1FUT A;  2KF6 A;  1I8V A;  1LOY A;  1FW7 A;  1BRH A;  1PYL A;  2RBI A;  3A5E A;  5GSP A;  2GSP A;  2SAR A;  3DH2 A;  1I3F A;  1G02 A;  1AQZ A;  1FUS A;  1RTU A;  6RNT A;  1YGW A;  1BNG A;  1RN4 A;  1I2G A;  1RGE A;  1BIR A;  1BNS A;  3DGY A;  1LOV A;  1BVI A;  1RGC A;  1BRI A;  1BAN A;  3URP A;  1TRP A;  1SAR A;  7GSP A;  1BNF A;  1RGK A;  1LRA A;  1BSA A;  3KCH A;  3Q3F A;  1RGF A;  2F5W A;  1B2Z A;  1R4Y A;  1B20 A;  1GOU A;  2KF5 A;  3AHS A;  3BIR A;  1B27 A;  1TTO A;  2KF3 A;  1X1Y A;  4BIR A;  3BU4 A;  2AAE A;  5BIR A;  1X1W A;  1UCI A;  1YVS A;  1LNI A;  1MGR A;  1RHL A;  4HAA A;  1UCK A;  1TRQ A;  1GOV A;  1B2S A;  3D4A A;  1BNI A;  4J5K A;  1I0X A;  3WR2 A;  4GSP A;  2RNT A;  1MGW A;  4GHO A;  1RDS A;  2KAA A;  1FZU A;  1RGH A;  1BGS A;  1T2I A;  2F5M A;  3D5I A;  1BSC A;  2HOH A;  3WHO A;  1BSB A;  1RGG A;  4J5G A;  2ZA4 A;  1HYF A;  1YNV X;  2F4Y A;  1RCL A;  1RGL A;  1BRJ A;  2F56 A;  1BRS A;  1B2X A;  1PY3 A;  1UCL A;  5RNT A;  8RNT A;  7RNT A;  1I3I A;  1DE3 A;  1HZ1 A;  1X1U A;  1BAO A;  2AAD A;  4RNT A;  1RNT A;  1GMR A;  1DET A;  3SYU A;  1B3S A;  1BNJ A;  1BSD A;  1I0V A;  1Q9E A;  1JBR A;  1I2E A;  1UCJ A;  4BU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...