1HZ1A

Ribonuclease t1 v16a mutant in complex with mg2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords RIBONUCLEASE T1
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1hz1A00
1B2XA 1GMQA 6GSPA 1RCLA 3D5IA 1A2PA 1I3FA 1RGAA 1B21A 2KF3A 2ZA4A 1DE3A 1UCIA 3AHSA 1B2UA 3BIRA 1BAOA 1GOYA 1LRAA 1CH0A 1BNRA 1UCJA 1FYSA 1BNSA 1I2GA 1LNIA 3A5EA 3D5GA 1Q9EA 1UCLA 7RNTA 2BIRA 1BNIA 2BU4A 2KF4A 1B2MA 1DETA 3AGOA 1FUSA 1RSNA 1T2HA 5HOHA 2RBIA 1FW7A 3WHOA 4J5GA 1BRNL 1I70A 1RGKA 1RN4A 6RNTA 1YNVX 1X1XA 1X1YA 3D4AA 4HAAA 4GHOA 1GSPA 1B2ZA 3HOHA 1FUTA 1BRJA 3WR2A 1BSEA 1TTOA 1T2IA 1RGLA 1RNBA 1BSCA 3AHWA 1JBTA 1BNFA 1C54A 3SYUA 1X1WA 1RDSA 1BSAA 1I0VA 4RNTA 1BRSA 1RLSA 9RNTA 1BU4A 1I0XA 1RN1A 1B20A 1HYFA 1JBSA 3AGNA 2KAAA 1HZ1A 1AY7A 1JBRA 1BRHA 1BNGA 1BUJA 1PY3A 1RHLA 1GMRA 5BIRA 5BU4A 1RGEA 1ZGXA 3GSPA 1GOVA 4HOHA 2SARA 1BANA 1LOVA 1RCKA 1BOXA 1RNTA 1YVSA 3RNTA 1G02A 1I3IA 3Q3FA 2F5MA 1MGRA 1B3SA 2KF6A 1X1UA 1BNJA 5GSPA 2AAEA 1GOUA 1RTUA 1LOWA 8RNTA 1PYLA 1BGSA 1UCKA 1TRPA 2F4YA 2GSPA 1BRIA 2HOHA 2RNTA 3BU4A 1MGWA 1R4YA 1I8VA 3DH2A 1RGHA 1SARA 5RNTA 1AQZA 1BSDA 2C4BA 1BIRA 1LOYA 3KCHA 7GSPA 1IYYA 1BSBA 4GSPA 1B2SA 1RGGA 1TRQA 1BRGA 3URPA 1I2FA 1BVIA 4J5KA 1RMSA 1B27A 1YGWA 1RGFA 1BNEA 1FZUA 1I2EA 4BU4A 2AADA 1BRKA 1GMPA 2KF5A 2F5WA 2F56A 1RGCA 3DGYA 4BIRA
chains in the Genus database with same CATH superfamily
1Q814 1B2XA 1OHOA 4R4KA 1CYUA 2Z77A 1QMAA 3PXMA 3I563 3BNCA 1OH0A 5IG4A 1IVUA 1TFOA 4CPKA 3VGNA 3HK4A 3S67A 2KXGA 2QGUA 3CCR3 4KVHA 3H3HA 4XM4A 4EV5A 1GY6A 2L1SA 5CF1A 5ELJA 3EBYA 4WP5A 2E2UA 7RNTA 2WGQA 1GD4A 3MKIA 1UCLA 5AEUB 2BIRA 2KF4A 3F14A 4OUQA 1JZDA 4HM5B 2OQEA 1IT7A 3AGOA 3OV4A 1FUSA 1FGQA 2HMJB 3KN4A 1UW1A 3G8ZA 4HM1B 1NWWA 1EEJA 1K28A 3DY5A 1X1YA 3GAXA 1L5GB 4O02B 4HAAA 2XFTA 2XR8B 3MYTA 1IQYA 1YJ93 1B2ZA 1RRLA 2XH9A 4FMDA 3HIGA 3OX9A 1BRJA 4XDVA 1KQS2 4HM8B 3ALAA 1BSEA 2CFKA 1EKMA 1W2B2 1T2IA 2O3OA 1GY5A 3CCE3 1BSCA 1N8QA 1RNBA 3OWSA 2PNCA 3G0KA 3SVAA 3FLJA 2PZVA 3NM7A 4K1VA 3KSED 2LYXA 1I0VA 4MMXB 4N6NB 1RLSA 3TDGA 1I0XA 1LQGC 1B20A 1RN1A 3B7CA 1OGZA 5CXOA 4H61A 3AMOA 1EUIC 2W6JH 2XFSA 3BLZA 3S29A 3UB1A 2GEYA 1HZ1A 1FUWA 4HM7B 1IVXA 1MWUA 1JBRA 1TIJA 1WMOA 1YHQ3 1RHLA 1GMRA 3PZWA 5BIRA 1RGEA 1DMNA 3KE7A 1OCVA 1GOVA 3BNDA 1JZOA 2ZHXB 3DXOA 2M7OA 3FG3A 3LZAA 1RNTA 1BOXA 1TFKA 3BNEA 1JB5A 1G02A 3EHCA 1UUVB 1JB4A 1I3IA 1HU9A 2CH9A 2OOVC 3F7SA 1B3SA 1ZS7A 2MF7A 1BNJA 3N8BA 2W56B 1G96A 1PYLA 1Q7Y4 1UCKA 1LXEA 3ECFA 3GZYB 2RNTA 1NU3A 3LT8A 3Q2PA 1FGRA 3CCL3 2P38A 3DMCA 1W6YA 3ZG5A 2CX1A 2C4BA 3X3ZA 2UX0A 3DGMA 3WMDA 4HM3B 3ROBA 3T0UA 4STDA 4AKYA 2CFGA 1K9M4 2D42A 3IMAB 2STDA 5IEOA 4R9KA 1VQ53 1BRGA 3WA2X 3G16A 3JUPA 3D79A 3RGAA 2O9UX 3L0RA 1ZO2A 2P0XA 2H0GA 3RDEA 5G1LA 3DUKA 4G1MB 5AI1A 1I2EA 3MPHA 2P05A 3HZPA 1D6YA 4BU4A 2W03A 1BRKA 2W56A 2UGIA 2KF5A 4O3VA 1WNHA 2F5WA 3B4PA 3CMA3 1JV2B 1WTHA 2C10A 2HMLB 3PS8A 1GD3A 4R80A 1UGIA 3DGYA 4NREA 4U13A 1JB2A 4BTYA 1YIT3 3X3XA 3OWYA 2W04A 5A0OB 1K41A 3PCSA 2K54A 1Q864 6GSPA 1GY7A 3FH1A 4EV2A 1VQ43 1RGAA 3B8LA 1V57A 4OK0A 1W7CA 1B21A 4CDLA 1QVG2 1VQ83 1DE3A 4WYKA 3BIRA 1S723 1O7WB 1LRAA 2YFLB 4XBTA 1BNRA 1YIJ3 2UUGC 3DZLA 1UCJA 5JBSA 1AVLA 3WDGB 4N6MA 1FYSA 3NX0A 1Q9EA 3STDA 2BU4A 1S5AA 1RRHA 1DMMA 2CK3H 2CX0A 3JUOA 4HVNA 4RNYA 1O7HB 5CF2A 2WOHA 3D3LA 3CPW2 4N3VA 4WHAA 5JPUA 4FMBA 2V1LA 2Y73A 1BRNL 1IVVA 3NM2A 3V99A 1Y4KA 6RNTA 1X1XA 1K8A4 1SIHA 5FW5A 1E3VA 2GU3A 3D4AA 2A15A 1NB3I 4KZ1A 4GHOA 1CQSA 2F99A 5M1AA 4HYZA 3WODG 1RJOA 3RGRA 1EA2A 4MMYB 1VQN3 1OACA 2FGTA 3HOHA 4FCJA 4LYLB 5HGRA 4I5QA 3G4S3 1CYVA 3X41A 1IQ8A 1RGLA 2XEPA 1U8CB 1JBTA 5IENA 1EQKA 4AKZA 3EF8A 3SYUA 1X1WA 2R4IA 1BSAA 1YJN3 2Y74A 3GZBA 3GWRA 1JBSA 3NQZA 5EQLA 1HYFA 1FGTA 4FCZA 1N9EA 3X42A 5IG5A 2YX9A 1Z1SA 3EQQB 1D6UA 4IIAA 1U5OA 2KAAA 2H0HA 3CCU3 5ELUA 1KSIA 1BUQA 1NO3A 3CCS3 4HBRA 3CCM3 3SLUA 5IEPA 3GRDA 3MG2A 1FGMA 1GYBA 2IA7A 3M8CA 3GZRA 4Q53A 4HM2B 3FKAA 3Q90A 1IDPA 4HZ9B 1TJDA 3F8XA 2IUJA 1RCKA 2CWVA 1A67A 1VQP3 4IT7A 3UNLA 4EXRA 1SJWA 2F5MA 2ML6A 4XBYA 4N6UA 1MWSA 2YFJB 2AAEA 1GOUA 4DKIA 4EBGA 3FSDA 1VQ73 1TRPA 1ISKA 1N5PA 3KFQC 2BHMA 5LC7A 2GSPA 1BRIA 2E2VA 2HOHA 3BU4A 4WYKB 3IJEB 1MGWA 3EE1A 2CG0A 5EEOA 1IT8A 1R4YA 2FNQA 1I8VA 2B24B 5D81A 3VF1A 1AQZA 3PGBA 3NUVA 4HKVB 3I553 1LOYA 1OF5A 4OVMA 3LMLA 5DRVA 4XB5A 3V98A 1IYYA 1RGGA 1TRQA 1STDA 1DVCA 3FG4A 3URPA 1MNLA 1C7HA 1I2FA 1W00A 1BVIA 2J8XB 3FF2A 3MHEA 4FCMA 1SPUA 3K63A 4LZIA 3LOYA 4KT3B 1RMSA 5G2GA 3KSPA 1YGWA 1ZX2A 4K61A 4N6TA 3U97A 1BNEA 4AEQA 3KIIA 1V74A 2CWUA 2Q07A 4X2HA 2XSHB 3CC43 1ROAA 2F56A 3K0ZA 1LOXA 2Z76A 2I9WA 2JQ5A 1O7GB 2HMKB 2W0QA 1JN5B 3N54B 1RCLA 4JRFA 1N8R4 2BNGA 1OGXA 5IERA 1LNHA 3D5IA 1A2PA 1E3RA 2BMOB 4BL3A 2HMMB 2RGQA 1A2VA 1T5YA 1M1K4 3MG1A 3NQYA 2KF3A 1UCIA 1BAOA 2Z7AA 4J9AA 2IUKA 1I2GA 2OOVA 2RFRA 3CNMA 2IY2A 1EG9B 2FXTA 4LMIA 5IF6A 1DETA 3NXJA 1YJW3 2W2CA 1T2HA 3CNXA 5HOHA 1Q40A 4J5GA 3S28A 3SOAA 1IK3A 1VQ63 5AYSC 1RGKA 1RN4A 3EC9A 3KKGA 1IV7A 1STFI 4NHFA 1Q42A 5M19A 4N6V0 5STDA 1JN5A 1UI7A 1QJGA 4EYCA 1DMQA 2K0MA 1VQK3 3NV0A 1KD14 3EX9A 1FUTA 3F9SA 3F8HA 1R4CA 2QIYA 5D82A 3WR2A 2XGNA 1TTOA 4FR9A 1W02A 2WOFA 3O8YA 3AHWA 1NNVA 2ZDJA 3CME3 1QVF2 4L7KA 2W9PA 3SOYA 4K90B 3S5CA 3N9HA 7STDA 5BXQA 1K734 5KP4A 4RNTA 1OF5B 5M18A 3H51A 3SXXA 2RCDA 1JJ22 3V92A 4CCVA 3CCV3 4HM4B 1Q40B 4LEHA 1NB5I 2CWTA 2RSXA 3LTAA 1M1XB 2F98A 1QALA 3WA3A 4JF8A 2YFIB 1VQM3 1BRHA 2JDIH 3DM8A 1PU4A 2XRXB 5IG0A 1BUJA 1OUNA 2Z6BA 1N9JA 3F40A 1VQQA 2CC3A 3UL6A 5BU4A 2BO9B 3NV0B 3GSPA 2QEX3 1IVWA 2OWPA 4L8PA 4HOHA 1TP6A 2SARA 3HIIA 1VQL3 1YVSA 1Q7HA 3NBBA 4CJNA 1D6ZA 4FMCA 3SX1A 3G713 4ZM8A 3Q3FA 2K3DA 1MGRA 2E2TA 2KF6A 1AV4A 2KRTA 1O7MB 3IPTA 5GSPA 1UGHI 3DGLA 4HM0B 1QAKA 3BNBA 1TUHA 4R9LA 1GS3A 1RKYA 2F4YA 2OTL3 3EBTA 4KFEA 3T8NA 3DH2A 1RGHA 1CEWI 3QK9A 5IG3A 4QWTA 3FGYA 5LC6A 3PYJA 4GL6A 5BVBA 1UUGB 1DYUA 1MOLA 2BMQB 3KCHA 3CCQ3 1PFPA 1M904 4RBNA 4GSPA 4N6OB 1B2SA 3HI7A 3HX8A 1F8NA 1NDOB 3OXAA 1G0TA 2KCDA 3PCRA 3CC23 1IV9A 5KP3A 2OCTA 4J5KA 1IQXA 1SIIA 1W6CA 1WQLB 2CFDA 4HZBB 3DGNA 2GBWB 4KFDA 4O2HA 3WOFB 1FZUA 4FMAA 2AADA 1ROVA 1T3BA 4LGQA 4XBXA 2L4VA 5CLKA 3CCJ3 3X3YA 1RN7A 4LSOA 2HMOB 4EW5A 3QRDA 5AYRB 3VSYA 4BTWA 1GMQA 1W4NA 3CPOA 5AEWB 4R1KA 3CD63 4ILFA 2GBXB 1MWTA 2CFLA 1I3FA 2WO0A 2XGLA 3X40A 2ZA4A 1M9GA 3AHSA 3CU3A 1AR0A 1B2UA 2C11A 3D9RA 5FGOA 1GOYA 1CH0A 1OHPA 4O8SA 3E99A 2D1WA 1BNSA 1LNIA 3A5EA 3D5GA 1BNIA 1B2MA 1LQMB 3JVCA 2IMJA 3G6E3 3ZG0A 3LT9A 1J2BA 1RSNA 3DGOA 1W2ZA 2RBIA 1FW7A 3WHOA 1QAFA 1YVBI 1LVNA 1I70A 3FF0A 1Q824 1YNVX 4MMZB 1WMNA 3LYGA 3A76A 2IYJA 1JNQA 1OPYA 1ULIB 2OQEC 3ER7A 3JUNA 1GSPA 3EN1B 5JPPA 1FGOA 2BMRB 2F86B 2GU1A 4MJDA 5I97A 4HJLB 3T8UA 3FCSB 4ORLA 1JKGA 5EVHA 1TU5A 3WOEB 1NJI4 3ZFZA 1BNFA 3OW22 1C54A 1RDSA 3K9MC 3NBRA 2ZL8A 4WFOA 1BRSA 1W6GA 4HM6B 9RNTA 1WMPA 1BU4A 3LTDA 4H3UA 2CG1A 1VZZA 4L8OA 3U1WA 5DREA 3MG3A 3JUMA 3LTBA 1UDII 3AGNA 4KFFA 4TX4A 1AY7A 3K7CA 2QA43 1VQO3 3EN8A 3OWUA 5G1KA 1BNGA 1ASKA 1SQWA 3I0YA 1PY3A 4RNZA 1UUWB 4RZMA 4X2OA 5CK6A 4XDWA 5D83A 3UL5A 3CXC2 5TGNA 1FA3A 1ZGXA 3F7XA 1A90A 2WGOA 1DVDA 4K1UA 1IU7A 2H0IA 1MWRA 2R41A 3K5TA 3JUQA 6STDA 1BANA 1LOVA 1N5HA 2CKFB 1ULJB 1O7NB 2XF3A 3RNTA 2GXFA 4BL2A 2CW9A 2OTJ3 3LTCA 4MEIA 3EB8A 2CFWA 1X1UA 1YGEA 2BT3A 4N6LA 1RTUA 1LOWA 8RNTA 3LXUX 2XSOB 4EC6A 3SEDA 1V58A 1BGSA 5IW9A 4BTXA 1E97A 2HMNB 2ML5A 3NBJA 3BB9A 2P0MA 8CHOA 4IPBA 1O7PB 5AIIA 1SARA 1AVKA 3S27A 2B1XB 2CIUA 4J8TA 2GEXA 4PEJA 1BSDA 5RNTA 1BIRA 4WWUC 3CC73 4NPBA 4I4KA 1KC84 2W9QA 3KZTA 7GSPA 5AIGA 1BSBA 1W01A 1US1A 3AMOB 2LQVA 3B4OA 3FZWA 5AIFA 3UJMA 3MWZA 1HKXA 1OHSA 1VQ93 1B27A 2CHCA 3GZXB 1UI8A 1JRQA 1RGFA 5KP1A 4GB5A 2MC8A 3FG1A 1GMPA 1A2KA 2SBLA 1W5ZA 2INXA 3Q1CA 3LH4A 1RGCA 5AIHA 3J7Yd 2P09A 3EJVA 3MSOA 1YI23 3NHXA 1KWIA 1JKGB 4BIRA
chains in the Genus database with same CATH topology
1B2XA 1GMQA 6GSPA 1RCLA 3D5IA 1A2PA 1I3FA 1RGAA 1B21A 2KF3A 2ZA4A 1DE3A 1UCIA 3AHSA 1B2UA 3BIRA 1BAOA 1GOYA 1LRAA 1CH0A 1BNRA 1UCJA 1FYSA 1BNSA 1I2GA 1LNIA 3A5EA 3D5GA 1Q9EA 1UCLA 7RNTA 2BIRA 1BNIA 2BU4A 2KF4A 1B2MA 1DETA 3AGOA 1FUSA 1RSNA 1T2HA 5HOHA 2RBIA 1FW7A 3WHOA 4J5GA 1BRNL 1I70A 1RGKA 1RN4A 6RNTA 1YNVX 1X1XA 1X1YA 3D4AA 4HAAA 4GHOA 1GSPA 1B2ZA 3HOHA 1FUTA 1BRJA 3WR2A 1BSEA 1TTOA 1T2IA 1RGLA 1RNBA 1BSCA 3AHWA 1JBTA 1BNFA 1C54A 3SYUA 1X1WA 1RDSA 1BSAA 1I0VA 4RNTA 1BRSA 1RLSA 9RNTA 1BU4A 1I0XA 1RN1A 1B20A 1HYFA 1JBSA 3AGNA 2KAAA 1HZ1A 1AY7A 1JBRA 1BRHA 1BNGA 1BUJA 1PY3A 1RHLA 1GMRA 5BIRA 5BU4A 1RGEA 1ZGXA 3GSPA 1GOVA 4HOHA 2SARA 1BANA 1LOVA 1RCKA 1BOXA 1RNTA 1YVSA 3RNTA 1G02A 1I3IA 3Q3FA 2F5MA 1MGRA 1B3SA 2KF6A 1X1UA 1BNJA 5GSPA 2AAEA 1GOUA 1RTUA 1LOWA 8RNTA 1PYLA 1BGSA 1UCKA 1TRPA 2F4YA 2GSPA 1BRIA 2HOHA 2RNTA 3BU4A 1MGWA 1R4YA 1I8VA 3DH2A 1RGHA 1SARA 5RNTA 1AQZA 1BSDA 2C4BA 1BIRA 1LOYA 3KCHA 7GSPA 1IYYA 1BSBA 4GSPA 1B2SA 1RGGA 1TRQA 1BRGA 3URPA 1I2FA 1BVIA 4J5KA 1RMSA 1B27A 1YGWA 1RGFA 1BNEA 1FZUA 1I2EA 4BU4A 2AADA 1BRKA 1GMPA 2KF5A 2F5WA 2F56A 1RGCA 3DGYA 4BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2X A;  1GMQ A;  6GSP A;  1RCL A;  3D5I A;  1A2P A;  1I3F A;  1RGA A;  1B21 A;  2KF3 A;  2ZA4 A;  1DE3 A;  1UCI A;  3AHS A;  1B2U A;  3BIR A;  1BAO A;  1GOY A;  1LRA A;  1CH0 A;  1BNR A;  1UCJ A;  1FYS A;  1BNS A;  1I2G A;  1LNI A;  3A5E A;  3D5G A;  1Q9E A;  1UCL A;  7RNT A;  2BIR A;  1BNI A;  2BU4 A;  2KF4 A;  1B2M A;  1DET A;  3AGO A;  1FUS A;  1RSN A;  1T2H A;  5HOH A;  2RBI A;  1FW7 A;  3WHO A;  4J5G A;  1BRN L;  1I70 A;  1RGK A;  1RN4 A;  6RNT A;  1YNV X;  1X1X A;  1X1Y A;  3D4A A;  4HAA A;  4GHO A;  1GSP A;  1B2Z A;  3HOH A;  1FUT A;  1BRJ A;  3WR2 A;  1BSE A;  1TTO A;  1T2I A;  1RGL A;  1RNB A;  1BSC A;  3AHW A;  1JBT A;  1BNF A;  1C54 A;  3SYU A;  1X1W A;  1RDS A;  1BSA A;  1I0V A;  4RNT A;  1BRS A;  1RLS A;  9RNT A;  1BU4 A;  1I0X A;  1RN1 A;  1B20 A;  1HYF A;  1JBS A;  3AGN A;  2KAA A;  1HZ1 A;  1AY7 A;  1JBR A;  1BRH A;  1BNG A;  1BUJ A;  1PY3 A;  1RHL A;  1GMR A;  5BIR A;  5BU4 A;  1RGE A;  1ZGX A;  3GSP A;  1GOV A;  4HOH A;  2SAR A;  1BAN A;  1LOV A;  1RCK A;  1BOX A;  1RNT A;  1YVS A;  3RNT A;  1G02 A;  1I3I A;  3Q3F A;  2F5M A;  1MGR A;  1B3S A;  2KF6 A;  1X1U A;  1BNJ A;  5GSP A;  2AAE A;  1GOU A;  1RTU A;  1LOW A;  8RNT A;  1PYL A;  1BGS A;  1UCK A;  1TRP A;  2F4Y A;  2GSP A;  1BRI A;  2HOH A;  2RNT A;  3BU4 A;  1MGW A;  1R4Y A;  1I8V A;  3DH2 A;  1RGH A;  1SAR A;  5RNT A;  1AQZ A;  1BSD A;  2C4B A;  1BIR A;  1LOY A;  3KCH A;  7GSP A;  1IYY A;  1BSB A;  4GSP A;  1B2S A;  1RGG A;  1TRQ A;  1BRG A;  3URP A;  1I2F A;  1BVI A;  4J5K A;  1RMS A;  1B27 A;  1YGW A;  1RGF A;  1BNE A;  1FZU A;  1I2E A;  4BU4 A;  2AAD A;  1BRK A;  1GMP A;  2KF5 A;  2F5W A;  2F56 A;  1RGC A;  3DGY A;  4BIR A; 
#chains in the Genus database with same CATH topology
 1Q81 4;  1B2X A;  1OHO A;  4R4K A;  1CYU A;  2Z77 A;  1QMA A;  3PXM A;  3I56 3;  3BNC A;  1OH0 A;  5IG4 A;  1IVU A;  1TFO A;  4CPK A;  3VGN A;  3HK4 A;  3S67 A;  2KXG A;  2QGU A;  3CCR 3;  4KVH A;  3H3H A;  4XM4 A;  4EV5 A;  1GY6 A;  2L1S A;  5CF1 A;  5ELJ A;  3EBY A;  4WP5 A;  2E2U A;  7RNT A;  2WGQ A;  1GD4 A;  3MKI A;  1UCL A;  5AEU B;  2BIR A;  2KF4 A;  3F14 A;  4OUQ A;  1JZD A;  4HM5 B;  2OQE A;  1IT7 A;  3AGO A;  3OV4 A;  1FUS A;  1FGQ A;  2HMJ B;  3KN4 A;  1UW1 A;  3G8Z A;  4HM1 B;  1NWW A;  1EEJ A;  1K28 A;  3DY5 A;  1X1Y A;  3GAX A;  1L5G B;  4O02 B;  4HAA A;  2XFT A;  2XR8 B;  3MYT A;  1IQY A;  1YJ9 3;  1B2Z A;  1RRL A;  2XH9 A;  4FMD A;  3HIG A;  3OX9 A;  1BRJ A;  4XDV A;  1KQS 2;  4HM8 B;  3ALA A;  1BSE A;  2CFK A;  1EKM A;  1W2B 2;  1T2I A;  2O3O A;  1GY5 A;  3CCE 3;  1BSC A;  1N8Q A;  1RNB A;  3OWS A;  2PNC A;  3G0K A;  3SVA A;  3FLJ A;  2PZV A;  3NM7 A;  4K1V A;  3KSE D;  2LYX A;  1I0V A;  4MMX B;  4N6N B;  1RLS A;  3TDG A;  1I0X A;  1LQG C;  1B20 A;  1RN1 A;  3B7C A;  1OGZ A;  5CXO A;  4H61 A;  3AMO A;  1EUI C;  2W6J H;  2XFS A;  3BLZ A;  3S29 A;  3UB1 A;  2GEY A;  1HZ1 A;  1FUW A;  4HM7 B;  1IVX A;  1MWU A;  1JBR A;  1TIJ A;  1WMO A;  1YHQ 3;  1RHL A;  1GMR A;  3PZW A;  5BIR A;  1RGE A;  1DMN A;  3KE7 A;  1OCV A;  1GOV A;  3BND A;  1JZO A;  2ZHX B;  3DXO A;  2M7O A;  3FG3 A;  3LZA A;  1RNT A;  1BOX A;  1TFK A;  3BNE A;  1JB5 A;  1G02 A;  3EHC A;  1UUV B;  1JB4 A;  1I3I A;  1HU9 A;  2CH9 A;  2OOV C;  3F7S A;  1B3S A;  1ZS7 A;  2MF7 A;  1BNJ A;  3N8B A;  2W56 B;  1G96 A;  1PYL A;  1Q7Y 4;  1UCK A;  1LXE A;  3ECF A;  3GZY B;  2RNT A;  1NU3 A;  3LT8 A;  3Q2P A;  1FGR A;  3CCL 3;  2P38 A;  3DMC A;  1W6Y A;  3ZG5 A;  2CX1 A;  2C4B A;  3X3Z A;  2UX0 A;  3DGM A;  3WMD A;  4HM3 B;  3ROB A;  3T0U A;  4STD A;  4AKY A;  2CFG A;  1K9M 4;  2D42 A;  3IMA B;  2STD A;  5IEO A;  4R9K A;  1VQ5 3;  1BRG A;  3WA2 X;  3G16 A;  3JUP A;  3D79 A;  3RGA A;  2O9U X;  3L0R A;  1ZO2 A;  2P0X A;  2H0G A;  3RDE A;  5G1L A;  3DUK A;  4G1M B;  5AI1 A;  1I2E A;  3MPH A;  2P05 A;  3HZP A;  1D6Y A;  4BU4 A;  2W03 A;  1BRK A;  2W56 A;  2UGI A;  2KF5 A;  4O3V A;  1WNH A;  2F5W A;  3B4P A;  3CMA 3;  1JV2 B;  1WTH A;  2C10 A;  2HML B;  3PS8 A;  1GD3 A;  4R80 A;  1UGI A;  3DGY A;  4NRE A;  4U13 A;  1JB2 A;  4BTY A;  1YIT 3;  3X3X A;  3OWY A;  2W04 A;  5A0O B;  1K41 A;  3PCS A;  2K54 A;  1Q86 4;  6GSP A;  1GY7 A;  3FH1 A;  4EV2 A;  1VQ4 3;  1RGA A;  3B8L A;  1V57 A;  4OK0 A;  1W7C A;  1B21 A;  4CDL A;  1QVG 2;  1VQ8 3;  1DE3 A;  4WYK A;  3BIR A;  1S72 3;  1O7W B;  1LRA A;  2YFL B;  4XBT A;  1BNR A;  1YIJ 3;  2UUG C;  3DZL A;  1UCJ A;  5JBS A;  1AVL A;  3WDG B;  4N6M A;  1FYS A;  3NX0 A;  1Q9E A;  3STD A;  2BU4 A;  1S5A A;  1RRH A;  1DMM A;  2CK3 H;  2CX0 A;  3JUO A;  4HVN A;  4RNY A;  1O7H B;  5CF2 A;  2WOH A;  3D3L A;  3CPW 2;  4N3V A;  4WHA A;  5JPU A;  4FMB A;  2V1L A;  2Y73 A;  1BRN L;  1IVV A;  3NM2 A;  3V99 A;  1Y4K A;  6RNT A;  1X1X A;  1K8A 4;  1SIH A;  5FW5 A;  1E3V A;  2GU3 A;  3D4A A;  2A15 A;  1NB3 I;  4KZ1 A;  4GHO A;  1CQS A;  2F99 A;  5M1A A;  4HYZ A;  3WOD G;  1RJO A;  3RGR A;  1EA2 A;  4MMY B;  1VQN 3;  1OAC A;  2FGT A;  3HOH A;  4FCJ A;  4LYL B;  5HGR A;  4I5Q A;  3G4S 3;  1CYV A;  3X41 A;  1IQ8 A;  1RGL A;  2XEP A;  1U8C B;  1JBT A;  5IEN A;  1EQK A;  4AKZ A;  3EF8 A;  3SYU A;  1X1W A;  2R4I A;  1BSA A;  1YJN 3;  2Y74 A;  3GZB A;  3GWR A;  1JBS A;  3NQZ A;  5EQL A;  1HYF A;  1FGT A;  4FCZ A;  1N9E A;  3X42 A;  5IG5 A;  2YX9 A;  1Z1S A;  3EQQ B;  1D6U A;  4IIA A;  1U5O A;  2KAA A;  2H0H A;  3CCU 3;  5ELU A;  1KSI A;  1BUQ A;  1NO3 A;  3CCS 3;  4HBR A;  3CCM 3;  3SLU A;  5IEP A;  3GRD A;  3MG2 A;  1FGM A;  1GYB A;  2IA7 A;  3M8C A;  3GZR A;  4Q53 A;  4HM2 B;  3FKA A;  3Q90 A;  1IDP A;  4HZ9 B;  1TJD A;  3F8X A;  2IUJ A;  1RCK A;  2CWV A;  1A67 A;  1VQP 3;  4IT7 A;  3UNL A;  4EXR A;  1SJW A;  2F5M A;  2ML6 A;  4XBY A;  4N6U A;  1MWS A;  2YFJ B;  2AAE A;  1GOU A;  4DKI A;  4EBG A;  3FSD A;  1VQ7 3;  1TRP A;  1ISK A;  1N5P A;  3KFQ C;  2BHM A;  5LC7 A;  2GSP A;  1BRI A;  2E2V A;  2HOH A;  3BU4 A;  4WYK B;  3IJE B;  1MGW A;  3EE1 A;  2CG0 A;  5EEO A;  1IT8 A;  1R4Y A;  2FNQ A;  1I8V A;  2B24 B;  5D81 A;  3VF1 A;  1AQZ A;  3PGB A;  3NUV A;  4HKV B;  3I55 3;  1LOY A;  1OF5 A;  4OVM A;  3LML A;  5DRV A;  4XB5 A;  3V98 A;  1IYY A;  1RGG A;  1TRQ A;  1STD A;  1DVC A;  3FG4 A;  3URP A;  1MNL A;  1C7H A;  1I2F A;  1W00 A;  1BVI A;  2J8X B;  3FF2 A;  3MHE A;  4FCM A;  1SPU A;  3K63 A;  4LZI A;  3LOY A;  4KT3 B;  1RMS A;  5G2G A;  3KSP A;  1YGW A;  1ZX2 A;  4K61 A;  4N6T A;  3U97 A;  1BNE A;  4AEQ A;  3KII A;  1V74 A;  2CWU A;  2Q07 A;  4X2H A;  2XSH B;  3CC4 3;  1ROA A;  2F56 A;  3K0Z A;  1LOX A;  2Z76 A;  2I9W A;  2JQ5 A;  1O7G B;  2HMK B;  2W0Q A;  1JN5 B;  3N54 B;  1RCL A;  4JRF A;  1N8R 4;  2BNG A;  1OGX A;  5IER A;  1LNH A;  3D5I A;  1A2P A;  1E3R A;  2BMO B;  4BL3 A;  2HMM B;  2RGQ A;  1A2V A;  1T5Y A;  1M1K 4;  3MG1 A;  3NQY A;  2KF3 A;  1UCI A;  1BAO A;  2Z7A A;  4J9A A;  2IUK A;  1I2G A;  2OOV A;  2RFR A;  3CNM A;  2IY2 A;  1EG9 B;  2FXT A;  4LMI A;  5IF6 A;  1DET A;  3NXJ A;  1YJW 3;  2W2C A;  1T2H A;  3CNX A;  5HOH A;  1Q40 A;  4J5G A;  3S28 A;  3SOA A;  1IK3 A;  1VQ6 3;  5AYS C;  1RGK A;  1RN4 A;  3EC9 A;  3KKG A;  1IV7 A;  1STF I;  4NHF A;  1Q42 A;  5M19 A;  4N6V 0;  5STD A;  1JN5 A;  1UI7 A;  1QJG A;  4EYC A;  1DMQ A;  2K0M A;  1VQK 3;  3NV0 A;  1KD1 4;  3EX9 A;  1FUT A;  3F9S A;  3F8H A;  1R4C A;  2QIY A;  5D82 A;  3WR2 A;  2XGN A;  1TTO A;  4FR9 A;  1W02 A;  2WOF A;  3O8Y A;  3AHW A;  1NNV A;  2ZDJ A;  3CME 3;  1QVF 2;  4L7K A;  2W9P A;  3SOY A;  4K90 B;  3S5C A;  3N9H A;  7STD A;  5BXQ A;  1K73 4;  5KP4 A;  4RNT A;  1OF5 B;  5M18 A;  3H51 A;  3SXX A;  2RCD A;  1JJ2 2;  3V92 A;  4CCV A;  3CCV 3;  4HM4 B;  1Q40 B;  4LEH A;  1NB5 I;  2CWT A;  2RSX A;  3LTA A;  1M1X B;  2F98 A;  1QAL A;  3WA3 A;  4JF8 A;  2YFI B;  1VQM 3;  1BRH A;  2JDI H;  3DM8 A;  1PU4 A;  2XRX B;  5IG0 A;  1BUJ A;  1OUN A;  2Z6B A;  1N9J A;  3F40 A;  1VQQ A;  2CC3 A;  3UL6 A;  5BU4 A;  2BO9 B;  3NV0 B;  3GSP A;  2QEX 3;  1IVW A;  2OWP A;  4L8P A;  4HOH A;  1TP6 A;  2SAR A;  3HII A;  1VQL 3;  1YVS A;  1Q7H A;  3NBB A;  4CJN A;  1D6Z A;  4FMC A;  3SX1 A;  3G71 3;  4ZM8 A;  3Q3F A;  2K3D A;  1MGR A;  2E2T A;  2KF6 A;  1AV4 A;  2KRT A;  1O7M B;  3IPT A;  5GSP A;  1UGH I;  3DGL A;  4HM0 B;  1QAK A;  3BNB A;  1TUH A;  4R9L A;  1GS3 A;  1RKY A;  2F4Y A;  2OTL 3;  3EBT A;  4KFE A;  3T8N A;  3DH2 A;  1RGH A;  1CEW I;  3QK9 A;  5IG3 A;  4QWT A;  3FGY A;  5LC6 A;  3PYJ A;  4GL6 A;  5BVB A;  1UUG B;  1DYU A;  1MOL A;  2BMQ B;  3KCH A;  3CCQ 3;  1PFP A;  1M90 4;  4RBN A;  4GSP A;  4N6O B;  1B2S A;  3HI7 A;  3HX8 A;  1F8N A;  1NDO B;  3OXA A;  1G0T A;  2KCD A;  3PCR A;  3CC2 3;  1IV9 A;  5KP3 A;  2OCT A;  4J5K A;  1IQX A;  1SII A;  1W6C A;  1WQL B;  2CFD A;  4HZB B;  3DGN A;  2GBW B;  4KFD A;  4O2H A;  3WOF B;  1FZU A;  4FMA A;  2AAD A;  1ROV A;  1T3B A;  4LGQ A;  4XBX A;  2L4V A;  5CLK A;  3CCJ 3;  3X3Y A;  1RN7 A;  4LSO A;  2HMO B;  4EW5 A;  3QRD A;  5AYR B;  3VSY A;  4BTW A;  1GMQ A;  1W4N A;  3CPO A;  5AEW B;  4R1K A;  3CD6 3;  4ILF A;  2GBX B;  1MWT A;  2CFL A;  1I3F A;  2WO0 A;  2XGL A;  3X40 A;  2ZA4 A;  1M9G A;  3AHS A;  3CU3 A;  1AR0 A;  1B2U A;  2C11 A;  3D9R A;  5FGO A;  1GOY A;  1CH0 A;  1OHP A;  4O8S A;  3E99 A;  2D1W A;  1BNS A;  1LNI A;  3A5E A;  3D5G A;  1BNI A;  1B2M A;  1LQM B;  3JVC A;  2IMJ A;  3G6E 3;  3ZG0 A;  3LT9 A;  1J2B A;  1RSN A;  3DGO A;  1W2Z A;  2RBI A;  1FW7 A;  3WHO A;  1QAF A;  1YVB I;  1LVN A;  1I70 A;  3FF0 A;  1Q82 4;  1YNV X;  4MMZ B;  1WMN A;  3LYG A;  3A76 A;  2IYJ A;  1JNQ A;  1OPY A;  1ULI B;  2OQE C;  3ER7 A;  3JUN A;  1GSP A;  3EN1 B;  5JPP A;  1FGO A;  2BMR B;  2F86 B;  2GU1 A;  4MJD A;  5I97 A;  4HJL B;  3T8U A;  3FCS B;  4ORL A;  1JKG A;  5EVH A;  1TU5 A;  3WOE B;  1NJI 4;  3ZFZ A;  1BNF A;  3OW2 2;  1C54 A;  1RDS A;  3K9M C;  3NBR A;  2ZL8 A;  4WFO A;  1BRS A;  1W6G A;  4HM6 B;  9RNT A;  1WMP A;  1BU4 A;  3LTD A;  4H3U A;  2CG1 A;  1VZZ A;  4L8O A;  3U1W A;  5DRE A;  3MG3 A;  3JUM A;  3LTB A;  1UDI I;  3AGN A;  4KFF A;  4TX4 A;  1AY7 A;  3K7C A;  2QA4 3;  1VQO 3;  3EN8 A;  3OWU A;  5G1K A;  1BNG A;  1ASK A;  1SQW A;  3I0Y A;  1PY3 A;  4RNZ A;  1UUW B;  4RZM A;  4X2O A;  5CK6 A;  4XDW A;  5D83 A;  3UL5 A;  3CXC 2;  5TGN A;  1FA3 A;  1ZGX A;  3F7X A;  1A90 A;  2WGO A;  1DVD A;  4K1U A;  1IU7 A;  2H0I A;  1MWR A;  2R41 A;  3K5T A;  3JUQ A;  6STD A;  1BAN A;  1LOV A;  1N5H A;  2CKF B;  1ULJ B;  1O7N B;  2XF3 A;  3RNT A;  2GXF A;  4BL2 A;  2CW9 A;  2OTJ 3;  3LTC A;  4MEI A;  3EB8 A;  2CFW A;  1X1U A;  1YGE A;  2BT3 A;  4N6L A;  1RTU A;  1LOW A;  8RNT A;  3LXU X;  2XSO B;  4EC6 A;  3SED A;  1V58 A;  1BGS A;  5IW9 A;  4BTX A;  1E97 A;  2HMN B;  2ML5 A;  3NBJ A;  3BB9 A;  2P0M A;  8CHO A;  4IPB A;  1O7P B;  5AII A;  1SAR A;  1AVK A;  3S27 A;  2B1X B;  2CIU A;  4J8T A;  2GEX A;  4PEJ A;  1BSD A;  5RNT A;  1BIR A;  4WWU C;  3CC7 3;  4NPB A;  4I4K A;  1KC8 4;  2W9Q A;  3KZT A;  7GSP A;  5AIG A;  1BSB A;  1W01 A;  1US1 A;  3AMO B;  2LQV A;  3B4O A;  3FZW A;  5AIF A;  3UJM A;  3MWZ A;  1HKX A;  1OHS A;  1VQ9 3;  1B27 A;  2CHC A;  3GZX B;  1UI8 A;  1JRQ A;  1RGF A;  5KP1 A;  4GB5 A;  2MC8 A;  3FG1 A;  1GMP A;  1A2K A;  2SBL A;  1W5Z A;  2INX A;  3Q1C A;  3LH4 A;  1RGC A;  5AIH A;  3J7Y d;  2P09 A;  3EJV A;  3MSO A;  1YI2 3;  3NHX A;  1KWI A;  1JKG B;  4BIR A; 
#chains in the Genus database with same CATH homology
 1B2X A;  1GMQ A;  6GSP A;  1RCL A;  3D5I A;  1A2P A;  1I3F A;  1RGA A;  1B21 A;  2KF3 A;  2ZA4 A;  1DE3 A;  1UCI A;  3AHS A;  1B2U A;  3BIR A;  1BAO A;  1GOY A;  1LRA A;  1CH0 A;  1BNR A;  1UCJ A;  1FYS A;  1BNS A;  1I2G A;  1LNI A;  3A5E A;  3D5G A;  1Q9E A;  1UCL A;  7RNT A;  2BIR A;  1BNI A;  2BU4 A;  2KF4 A;  1B2M A;  1DET A;  3AGO A;  1FUS A;  1RSN A;  1T2H A;  5HOH A;  2RBI A;  1FW7 A;  3WHO A;  4J5G A;  1BRN L;  1I70 A;  1RGK A;  1RN4 A;  6RNT A;  1YNV X;  1X1X A;  1X1Y A;  3D4A A;  4HAA A;  4GHO A;  1GSP A;  1B2Z A;  3HOH A;  1FUT A;  1BRJ A;  3WR2 A;  1BSE A;  1TTO A;  1T2I A;  1RGL A;  1RNB A;  1BSC A;  3AHW A;  1JBT A;  1BNF A;  1C54 A;  3SYU A;  1X1W A;  1RDS A;  1BSA A;  1I0V A;  4RNT A;  1BRS A;  1RLS A;  9RNT A;  1BU4 A;  1I0X A;  1RN1 A;  1B20 A;  1HYF A;  1JBS A;  3AGN A;  2KAA A;  1HZ1 A;  1AY7 A;  1JBR A;  1BRH A;  1BNG A;  1BUJ A;  1PY3 A;  1RHL A;  1GMR A;  5BIR A;  5BU4 A;  1RGE A;  1ZGX A;  3GSP A;  1GOV A;  4HOH A;  2SAR A;  1BAN A;  1LOV A;  1RCK A;  1BOX A;  1RNT A;  1YVS A;  3RNT A;  1G02 A;  1I3I A;  3Q3F A;  2F5M A;  1MGR A;  1B3S A;  2KF6 A;  1X1U A;  1BNJ A;  5GSP A;  2AAE A;  1GOU A;  1RTU A;  1LOW A;  8RNT A;  1PYL A;  1BGS A;  1UCK A;  1TRP A;  2F4Y A;  2GSP A;  1BRI A;  2HOH A;  2RNT A;  3BU4 A;  1MGW A;  1R4Y A;  1I8V A;  3DH2 A;  1RGH A;  1SAR A;  5RNT A;  1AQZ A;  1BSD A;  2C4B A;  1BIR A;  1LOY A;  3KCH A;  7GSP A;  1IYY A;  1BSB A;  4GSP A;  1B2S A;  1RGG A;  1TRQ A;  1BRG A;  3URP A;  1I2F A;  1BVI A;  4J5K A;  1RMS A;  1B27 A;  1YGW A;  1RGF A;  1BNE A;  1FZU A;  1I2E A;  4BU4 A;  2AAD A;  1BRK A;  1GMP A;  2KF5 A;  2F5W A;  2F56 A;  1RGC A;  3DGY A;  4BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...