1BU4A

Ribonuclease 1 complex with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE T1
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bu4A00
3RNTA 1RTUA 4GHOA 3Q3FA 1BNRA 1BRJA 1RSNA 4GSPA 1RMSA 1PY3A 1RNTA 3AGOA 1RGLA 1LRAA 1T2HA 1G02A 1LOWA 6GSPA 3AHWA 1FZUA 1BNFA 4HAAA 1I3IA 1RLSA 5GSPA 1RN1A 1BSEA 1X1YA 1BNEA 1GMPA 3DGYA 1JBTA 1UCKA 6RNTA 1B20A 1I8VA 1I0XA 1BRGA 1RGEA 2ZA4A 1B2ZA 3AGNA 1BSAA 1YGWA 1BUJA 1B2XA 1BRKA 2GSPA 4BU4A 1BRNL 1BRHA 1SARA 3DH2A 1B21A 5BIRA 1BU4A 1AY7A 1RGAA 1BIRA 1B2SA 1RNBA 1X1WA 1RCKA 1RGFA 2KF5A 3SYUA 9RNTA 5HOHA 1JBRA 1BSBA 2AADA 3GSPA 2AAEA 1BANA 1A2PA 1PYLA 1UCLA 2KF4A 1X1XA 1FW7A 7RNTA 1RN4A 3WHOA 1YVSA 1LOYA 1R4YA 1BAOA 7GSPA 2KF6A 1T2IA 1LOVA 1BNIA 1GMRA 1GOUA 1HYFA 8RNTA 2BU4A 2HOHA 2BIRA 1GMQA 1BNGA 1TRQA 1TTOA 1YNVX 2F5WA 1I2GA 1GSPA 1FUTA 1RDSA 1ZGXA 4J5GA 2F5MA 1RGGA 1B2UA 1BSCA 1BVIA 4J5KA 1JBSA 1I0VA 3URPA 2KAAA 2RBIA 1B2MA 1BNSA 1CH0A 2F56A 1MGRA 1FYSA 4RNTA 1BRIA 2RNTA 1RGKA 1DE3A 1IYYA 1I70A 3WR2A 1RCLA 3BU4A 3AHSA 4HOHA 1C54A 1LNIA 1BNJA 1HZ1A 1AQZA 1RGCA 1UCJA 1I3FA 4BIRA 3D5IA 1I2EA 1B3SA 1I2FA 1Q9EA 3BIRA 3HOHA 5BU4A 1B27A 1GOVA 2KF3A 1X1UA 5RNTA 1DETA 1BSDA 1MGWA 1GOYA 1BOXA 2SARA 1RHLA 3D4AA 3KCHA 2C4BA 2F4YA 1RGHA 1TRPA 1BRSA 1FUSA 1UCIA 3A5EA 3D5GA 1BGSA
chains in the Genus database with same CATH superfamily
1BNRA 2UUGC 1BRJA 4HM3B 5KP3A 3N8BA 5I97A 3N54B 1RKYA 2KXGA 3G4S3 1O7NB 3NUVA 4GSPA 5D81A 2W04A 3JUNA 3PGBA 1N9EA 2WOFA 3AHWA 2C11A 3UL6A 1OGZA 1IV9A 1IV7A 3CPW2 1FUWA 3GRDA 1RLSA 3EJVA 1VQ63 1N8QA 5GSPA 3LT9A 4KFEA 3G6E3 1QVG2 1ISKA 1BSEA 3IJEB 1O7PB 3F8HA 1OUNA 6RNTA 2XF3A 1TIJA 3IMAB 5CF2A 1RGEA 5IEOA 3CNXA 1BUJA 1B2XA 1Q42A 1GY7A 5M19A 2XSOB 3CCU3 4BU4A 3K7CA 3OW22 1Z1SA 1A2KA 1BRNL 2Z77A 1E3VA 1IQXA 3Q90A 5M1AA 4XDVA 1VQ73 2GEXA 4DKIA 1B2SA 1NNVA 2CK3H 1NWWA 3D79A 3LOYA 1X1WA 3OWUA 1LNHA 4ILFA 5TGNA 2HMJB 1VQL3 1MNLA 3PYJA 2CIUA 1AR0A 3NQYA 3WA2X 1JBRA 1JZOA 3GSPA 3GZXB 4GL6A 3LTCA 1MWTA 3PZWA 3EN8A 3X3XA 2OTL3 1J2BA 3CCM3 3EN1B 4N6NB 2SBLA 2XSHB 4XDWA 1YVSA 3FCSB 1LOYA 3MPHA 1BAOA 2YX9A 2KF6A 1RRLA 6STDA 1O7HB 3EX9A 1O7MB 1N9JA 5DRVA 1GOUA 5EEOA 1EEJA 3EBYA 8RNTA 2CFKA 3FF2A 5FW5A 1QALA 5IERA 5IW9A 2JDIH 5JPUA 2ZDJA 5G2GA 4LEHA 5IG3A 3F8XA 4R1KA 2JQ5A 1OPYA 3FF0A 3B8LA 5AYSC 3MKIA 3CU3A 3LTAA 3I563 2CFWA 1D6UA 1K8A4 4WFOA 1IQYA 2LQVA 3NQZA 1FGMA 2CWUA 2CWVA 2P05A 2CG1A 1WMNA 2F5MA 1RGGA 3LMLA 5FGOA 3CCV3 1JNQA 1BVIA 4MMXB 4H61A 3URPA 2RBIA 1K41A 3ECFA 4HBRA 2F56A 1UW1A 1FYSA 1M1K4 4TX4A 4EC6A 3CXC2 2RNTA 1RGKA 4NREA 1IYYA 3JUQA 3SXXA 2GEYA 2WGOA 3RGAA 4KVHA 1JZDA 4R80A 4BTXA 2GBXB 1LNIA 3HIGA 4KT3B 1CQSA 1STDA 1GYBA 2XRXB 4XM4A 3OWYA 4OUQA 4IIAA 1UCJA 1EKMA 1OHSA 1VQQA 3H51A 3FGYA 3LTBA 3EB8A 2BNGA 3N9HA 1VQP3 1IVWA 5KP1A 3FSDA 3KFQC 5D83A 1EUIC 1IT7A 1GOVA 2HMOB 4STDA 4EV5A 1W01A 2XGNA 1DETA 4HYZA 3AMOA 1BSDA 3MSOA 1MGWA 2RGQA 1WMOA 3MWZA 1GOYA 4HM6B 1BOXA 2W03A 3VGNA 1NJI4 3BNEA 3S67A 4ZM8A 1QAFA 5IEPA 3D9RA 1EA2A 4MMZB 3Q1CA 2F4YA 3GZRA 1RGHA 5ELUA 1SIHA 4I4KA 5DREA 3U1WA 4JRFA 1BGSA 1DVDA 3RNTA 1AV4A 4BTYA 1G96A 1A67A 1JB2A 2OQEC 5AIGA 3ROBA 4IT7A 3DM8A 1UUVB 2I9WA 4RNZA 1RMSA 1PY3A 4MJDA 3LYGA 1RNTA 2WGQA 1Q7HA 3AGOA 3WODG 1LRAA 3MG2A 4HAAA 2CX1A 3B4OA 1LQGC 1I3IA 3BB9A 1KSIA 1YJW3 4FCJA 3CCE3 2HMLB 2H0GA 3G8ZA 1VQN3 1DMNA 3CCJ3 1UCKA 5AEUB 1JN5B 1I0XA 3DGLA 1B2ZA 1BSAA 2QGUA 3DUKA 5LC7A 1BRKA 3DXOA 2XGLA 3NV0A 2P0MA 3LT8A 1W6GA 2O3OA 1BU4A 1AY7A 1LXEA 3RGRA 4AEQA 1BIRA 2CWTA 1VQK3 3F9SA 4HM2B 3MYTA 4IPBA 1RNBA 1FGQA 2RSXA 2PNCA 4KFFA 3B7CA 2W0QA 4H3UA 1UGIA 3V98A 3KKGA 3NV0B 1BANA 2Z76A 1E3RA 2BMQB 1PYLA 4J9AA 2B24B 1YHQ3 1FW7A 1G0TA 1OF5A 3NBRA 3WHOA 1U8CB 1KQS2 3PXMA 3UB1A 1R4YA 3GWRA 1OACA 4N6OB 3V99A 3SEDA 3WA3A 2LYXA 3K63A 1BNIA 1W6YA 2XR8B 1JKGB 3ZG0A 3LTDA 3J7Yd 1DYUA 2HOHA 3ER7A 1BNGA 3LXUX 3OXAA 3G0KA 1OF5B 3K5TA 3EC9A 2F5WA 4FMCA 1GSPA 1ZGXA 1IT8A 3SOYA 1NB5I 1K734 3GAXA 1O7WB 2MC8A 2WOHA 4O3VA 4R4KA 1SIIA 1L5GB 1VQO3 5AI1A 3NHXA 3CC43 1Q40A 2IMJA 4CCVA 4LMIA 1I0VA 1JBSA 2KAAA 3FZWA 4BL3A 1CH0A 4OK0A 1EG9B 3F14A 3G16A 3JUMA 4FMBA 3S5CA 4CDLA 1KD14 1JJ22 1R4CA 1BRIA 2CFGA 2RFRA 3MG3A 1DE3A 2GXFA 2Q07A 3ZFZA 3BU4A 3AHSA 4J8TA 3CCS3 1C54A 1TFKA 1TFOA 5EQLA 4FCMA 1AQZA 1YIT3 1IVUA 4N6TA 1Q40B 4OVMA 3U97A 5ELJA 2STDA 3OV4A 1WNHA 5LC6A 5IG0A 1GY6A 3Q2PA 1I2EA 1KWIA 1YI23 3VF1A 2FXTA 2ZL8A 3NX0A 1Q814 1U5OA 4HKVB 5BU4A 3SOAA 4ORLA 1JB5A 4R9KA 3MG1A 5AIFA 2WO0A 4MMYB 1RHLA 2QIYA 1ASKA 1Q864 1W2ZA 1OHPA 1W4NA 3FLJA 4RBNA 1W5ZA 1W7CA 2F86B 4RNYA 3HX8A 1UCIA 4FR9A 1T3BA 5HOHA 3D5GA 1S723 1Q7Y4 4GHOA 4AKYA 1IVXA 3G713 2W9QA 3EBTA 1MWSA 1RSNA 2FNQA 3S27A 2A15A 1RJOA 2E2VA 1S5AA 2W2CA 2Z6BA 3EF8A 3S29A 1T2HA 2YFLB 1G02A 1LOWA 3I0YA 5EVHA 3S28A 3T0UA 6GSPA 3CMA3 1BNFA 4GB5A 1N5PA 3X41A 2L1SA 4NHFA 3SVAA 2P38A 1X1YA 3DGYA 1JBTA 2CKFB 3MHEA 1ULIB 1BRGA 1FGTA 2K54A 3BNDA 1VZZA 2IUKA 3AGNA 3LZAA 4HM5B 4WYKA 3CC23 2GSPA 4LGQA 4CPKA 1IK3A 1BRHA 1ZX2A 3WDGB 1B21A 1E97A 4HZ9B 5AEWB 1QJGA 3GZBA 2K0MA 2P0XA 1RRHA 4WHAA 2QA43 1C7HA 2Y74A 1JN5A 3UJMA 1HU9A 9RNTA 2W56B 2UGIA 3DMCA 1BSBA 3EE1A 3JUOA 4WYKB 1QMAA 4FMDA 1M1XB 2AAEA 3O8YA 1VQ43 1M9GA 1LQMB 1OHOA 1UCLA 3JUPA 4HVNA 4EXRA 1X1XA 3UNLA 1YIJ3 1M904 3FG3A 1RN4A 3FG4A 7RNTA 2YFIB 3ALAA 1D6YA 7GSPA 2Z7AA 1HKXA 1F8NA 3EHCA 2OOVA 1STFI 1JV2B 1PFPA 1WMPA 3F7SA 4HM0B 2INXA 4HM1B 4KZ1A 4X2OA 3X3YA 3NBJA 2IA7A 2CG0A 3BLZA 3LH4A 5KP4A 4L8OA 5IF6A 2B1XB 1DMQA 2H0IA 3CCR3 1TRQA 3A76A 1TTOA 2XFTA 1OH0A 1YNVX 4EBGA 1I2GA 2MF7A 1RDSA 1O7GB 1UI8A 3QRDA 1ZS7A 1VQ53 1W2B2 1SPUA 1GD3A 1JKGA 3DGMA 4XB5A 1YJN3 2CH9A 3GZYB 2IY2A 2RCDA 1B2UA 3H3HA 1Y4KA 1FGOA 1PU4A 5AIIA 2BT3A 3M8CA 1BNSA 4LZIA 5STDA 3SLUA 1MGRA 3WOFB 4Q53A 4RNTA 3I553 1SQWA 2CC3A 4NPBA 3PCSA 1GD4A 2HMMB 4I5QA 3KIIA 1RCLA 3WR2A 5JBSA 3KSPA 1A2VA 4HOHA 3KSED 1GS3A 2K3DA 5D82A 3DZLA 1EQKA 5CLKA 1VQM3 5IG4A 3F40A 3L0RA 1RGCA 3KN4A 3DGNA 1AVLA 2CX0A 4MEIA 4XBTA 3HIIA 3ZG5A 2C10A 1I2FA 3BIRA 3HOHA 5M18A 1B27A 2KF3A 1X1UA 2BMOB 3X42A 5RNTA 2ZHXB 1BUQA 2GU1A 3F7XA 2SARA 1UI7A 3D4AA 4PEJA 3UL5A 2C4BA 5G1KA 4WP5A 1A90A 3V92A 1WQLB 3FG1A 3HK4A 1GY5A 1BRSA 4RZMA 1FUSA 3A5EA 3CPOA 5CXOA 4CJNA 1FA3A 4KFDA 1RTUA 3Q3FA 2XH9A 4BTWA 1JRQA 2R41A 5IG5A 1YGEA 3PS8A 3WOEB 3K0ZA 4R9LA 1MWUA 1RGLA 4FCZA 3QK9A 1FZUA 2J8XB 4FMAA 3VSYA 2QEX3 1QVF2 1IDPA 2CW9A 1TJDA 3HI7A 4L8PA 2R4IA 1RN1A 1UUGB 3JVCA 1IVVA 1BNEA 1GMPA 3OWSA 1B20A 1I8VA 1LOXA 1YVBI 3BNCA 2E2UA 1QAKA 2ZA4A 2HMNB 1K28A 3BNBA 3KE7A 1KC84 1YGWA 2OCTA 4LSOA 3CC73 1VQ93 4BL2A 3B4PA 2L4VA 3KZTA 4HZBB 1V57A 4AKZA 5BVBA 1SARA 4K1UA 3DH2A 5BXQA 5BIRA 3CCL3 1JB4A 3EQQB 3NM7A 2IYJA 1ROAA 2UX0A 1RGAA 1YJ93 1RN7A 4X2HA 1RCKA 1RGFA 1TP6A 2KF5A 3SYUA 2KCDA 3NM2A 2F99A 2BO9B 2ML5A 2AADA 4JF8A 1UDII 4K90B 4N3VA 3T8NA 1A2PA 2KF4A 1N5HA 5CK6A 1NO3A 3CD63 1IU7A 3CME3 3DY5A 3RDEA 1AVKA 1T2IA 2O9UX 2GBWB 2W56A 1FGRA 3NXJA 1LOVA 1OCVA 1ULJB 1GMRA 5AYRB 1HYFA 1NU3A 2GU3A 7STDA 2BU4A 2XFSA 5AIHA 3SX1A 2BIRA 1GMQA 3K9MC 4XBYA 2W9PA 1K9M4 1Q824 1SJWA 3HZPA 2F98A 4WWUC 2Y73A 1FUTA 2CHCA 3STDA 3E99A 2YFJB 5HGRA 1TU5A 2OTJ3 1CEWI 1NB3I 1V58A 4O02B 2FGTA 2E2TA 4J5GA 4K61A 4U13A 1BSCA 3WMDA 1CYUA 1T5YA 4J5KA 4HM7B 4O2HA 1UUWB 3IPTA 1B2MA 3NBBA 3TDGA 2BHMA 1N8R4 2OOVC 4HM8B 4N6LA 2CFDA 1WTHA 4HJLB 8CHOA 5IENA 3DGOA 1I70A 3OX9A 1IQ8A 1NDOB 4QWTA 3CNMA 2HMKB 2W6JH 5G1LA 3CCQ3 5A0OB 2OQEA 1BNJA 3AMOB 1HZ1A 3FH1A 1TUHA 1W02A 2ML6A 1US1A 2PZVA 1W00A 4EYCA 2BMRB 1VQ83 4K1VA 1D6ZA 2D42A 4N6V0 1CYVA 4EV2A 1I3FA 1W6CA 4EW5A 4BIRA 3D5IA 1B3SA 4L7KA 1DMMA 1MWRA 1Q9EA 1UGHI 4XBXA 3X40A 1OGXA 5JPPA 3FKAA 3PCRA 2P09A 4HM4B 2IUJA 3X3ZA 4N6MA 1ROVA 5CF1A 2D1WA 2OWPA 3KCHA 1LVNA 2CFLA 2H0HA 2KRTA 4G1MB 4O8SA 1TRPA 4N6UA 1DVCA 1MOLA 1ZO2A 2V1LA 2XEPA 3D3LA 2M7OA 4LYLB 3T8UA 1V74A
chains in the Genus database with same CATH topology
3RNTA 1RTUA 4GHOA 3Q3FA 1BNRA 1BRJA 1RSNA 4GSPA 1RMSA 1PY3A 1RNTA 3AGOA 1RGLA 1LRAA 1T2HA 1G02A 1LOWA 6GSPA 3AHWA 1FZUA 1BNFA 4HAAA 1I3IA 1RLSA 5GSPA 1RN1A 1BSEA 1X1YA 1BNEA 1GMPA 3DGYA 1JBTA 1UCKA 6RNTA 1B20A 1I8VA 1I0XA 1BRGA 1RGEA 2ZA4A 1B2ZA 3AGNA 1BSAA 1YGWA 1BUJA 1B2XA 1BRKA 2GSPA 4BU4A 1BRNL 1BRHA 1SARA 3DH2A 1B21A 5BIRA 1BU4A 1AY7A 1RGAA 1BIRA 1B2SA 1RNBA 1X1WA 1RCKA 1RGFA 2KF5A 3SYUA 9RNTA 5HOHA 1JBRA 1BSBA 2AADA 3GSPA 2AAEA 1BANA 1A2PA 1PYLA 1UCLA 2KF4A 1X1XA 1FW7A 7RNTA 1RN4A 3WHOA 1YVSA 1LOYA 1R4YA 1BAOA 7GSPA 2KF6A 1T2IA 1LOVA 1BNIA 1GMRA 1GOUA 1HYFA 8RNTA 2BU4A 2HOHA 2BIRA 1GMQA 1BNGA 1TRQA 1TTOA 1YNVX 2F5WA 1I2GA 1GSPA 1FUTA 1RDSA 1ZGXA 4J5GA 2F5MA 1RGGA 1B2UA 1BSCA 1BVIA 4J5KA 1JBSA 1I0VA 3URPA 2KAAA 2RBIA 1B2MA 1BNSA 1CH0A 2F56A 1MGRA 1FYSA 4RNTA 1BRIA 2RNTA 1RGKA 1DE3A 1IYYA 1I70A 3WR2A 1RCLA 3BU4A 3AHSA 4HOHA 1C54A 1LNIA 1BNJA 1HZ1A 1AQZA 1RGCA 1UCJA 1I3FA 4BIRA 3D5IA 1I2EA 1B3SA 1I2FA 1Q9EA 3BIRA 3HOHA 5BU4A 1B27A 1GOVA 2KF3A 1X1UA 5RNTA 1DETA 1BSDA 1MGWA 1GOYA 1BOXA 2SARA 1RHLA 3D4AA 3KCHA 2C4BA 2F4YA 1RGHA 1TRPA 1BRSA 1FUSA 1UCIA 3A5EA 3D5GA 1BGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNT A;  1RTU A;  4GHO A;  3Q3F A;  1BNR A;  1BRJ A;  1RSN A;  4GSP A;  1RMS A;  1PY3 A;  1RNT A;  3AGO A;  1RGL A;  1LRA A;  1T2H A;  1G02 A;  1LOW A;  6GSP A;  3AHW A;  1FZU A;  1BNF A;  4HAA A;  1I3I A;  1RLS A;  5GSP A;  1RN1 A;  1BSE A;  1X1Y A;  1BNE A;  1GMP A;  3DGY A;  1JBT A;  1UCK A;  6RNT A;  1B20 A;  1I8V A;  1I0X A;  1BRG A;  1RGE A;  2ZA4 A;  1B2Z A;  3AGN A;  1BSA A;  1YGW A;  1BUJ A;  1B2X A;  1BRK A;  2GSP A;  4BU4 A;  1BRN L;  1BRH A;  1SAR A;  3DH2 A;  1B21 A;  5BIR A;  1BU4 A;  1AY7 A;  1RGA A;  1BIR A;  1B2S A;  1RNB A;  1X1W A;  1RCK A;  1RGF A;  2KF5 A;  3SYU A;  9RNT A;  5HOH A;  1JBR A;  1BSB A;  2AAD A;  3GSP A;  2AAE A;  1BAN A;  1A2P A;  1PYL A;  1UCL A;  2KF4 A;  1X1X A;  1FW7 A;  7RNT A;  1RN4 A;  3WHO A;  1YVS A;  1LOY A;  1R4Y A;  1BAO A;  7GSP A;  2KF6 A;  1T2I A;  1LOV A;  1BNI A;  1GMR A;  1GOU A;  1HYF A;  8RNT A;  2BU4 A;  2HOH A;  2BIR A;  1GMQ A;  1BNG A;  1TRQ A;  1TTO A;  1YNV X;  2F5W A;  1I2G A;  1GSP A;  1FUT A;  1RDS A;  1ZGX A;  4J5G A;  2F5M A;  1RGG A;  1B2U A;  1BSC A;  1BVI A;  4J5K A;  1JBS A;  1I0V A;  3URP A;  2KAA A;  2RBI A;  1B2M A;  1BNS A;  1CH0 A;  2F56 A;  1MGR A;  1FYS A;  4RNT A;  1BRI A;  2RNT A;  1RGK A;  1DE3 A;  1IYY A;  1I70 A;  3WR2 A;  1RCL A;  3BU4 A;  3AHS A;  4HOH A;  1C54 A;  1LNI A;  1BNJ A;  1HZ1 A;  1AQZ A;  1RGC A;  1UCJ A;  1I3F A;  4BIR A;  3D5I A;  1I2E A;  1B3S A;  1I2F A;  1Q9E A;  3BIR A;  3HOH A;  5BU4 A;  1B27 A;  1GOV A;  2KF3 A;  1X1U A;  5RNT A;  1DET A;  1BSD A;  1MGW A;  1GOY A;  1BOX A;  2SAR A;  1RHL A;  3D4A A;  3KCH A;  2C4B A;  2F4Y A;  1RGH A;  1TRP A;  1BRS A;  1FUS A;  1UCI A;  3A5E A;  3D5G A;  1BGS A; 
#chains in the Genus database with same CATH topology
 1BNR A;  2UUG C;  1BRJ A;  4HM3 B;  5KP3 A;  3N8B A;  5I97 A;  3N54 B;  1RKY A;  2KXG A;  3G4S 3;  1O7N B;  3NUV A;  4GSP A;  5D81 A;  2W04 A;  3JUN A;  3PGB A;  1N9E A;  2WOF A;  3AHW A;  2C11 A;  3UL6 A;  1OGZ A;  1IV9 A;  1IV7 A;  3CPW 2;  1FUW A;  3GRD A;  1RLS A;  3EJV A;  1VQ6 3;  1N8Q A;  5GSP A;  3LT9 A;  4KFE A;  3G6E 3;  1QVG 2;  1ISK A;  1BSE A;  3IJE B;  1O7P B;  3F8H A;  1OUN A;  6RNT A;  2XF3 A;  1TIJ A;  3IMA B;  5CF2 A;  1RGE A;  5IEO A;  3CNX A;  1BUJ A;  1B2X A;  1Q42 A;  1GY7 A;  5M19 A;  2XSO B;  3CCU 3;  4BU4 A;  3K7C A;  3OW2 2;  1Z1S A;  1A2K A;  1BRN L;  2Z77 A;  1E3V A;  1IQX A;  3Q90 A;  5M1A A;  4XDV A;  1VQ7 3;  2GEX A;  4DKI A;  1B2S A;  1NNV A;  2CK3 H;  1NWW A;  3D79 A;  3LOY A;  1X1W A;  3OWU A;  1LNH A;  4ILF A;  5TGN A;  2HMJ B;  1VQL 3;  1MNL A;  3PYJ A;  2CIU A;  1AR0 A;  3NQY A;  3WA2 X;  1JBR A;  1JZO A;  3GSP A;  3GZX B;  4GL6 A;  3LTC A;  1MWT A;  3PZW A;  3EN8 A;  3X3X A;  2OTL 3;  1J2B A;  3CCM 3;  3EN1 B;  4N6N B;  2SBL A;  2XSH B;  4XDW A;  1YVS A;  3FCS B;  1LOY A;  3MPH A;  1BAO A;  2YX9 A;  2KF6 A;  1RRL A;  6STD A;  1O7H B;  3EX9 A;  1O7M B;  1N9J A;  5DRV A;  1GOU A;  5EEO A;  1EEJ A;  3EBY A;  8RNT A;  2CFK A;  3FF2 A;  5FW5 A;  1QAL A;  5IER A;  5IW9 A;  2JDI H;  5JPU A;  2ZDJ A;  5G2G A;  4LEH A;  5IG3 A;  3F8X A;  4R1K A;  2JQ5 A;  1OPY A;  3FF0 A;  3B8L A;  5AYS C;  3MKI A;  3CU3 A;  3LTA A;  3I56 3;  2CFW A;  1D6U A;  1K8A 4;  4WFO A;  1IQY A;  2LQV A;  3NQZ A;  1FGM A;  2CWU A;  2CWV A;  2P05 A;  2CG1 A;  1WMN A;  2F5M A;  1RGG A;  3LML A;  5FGO A;  3CCV 3;  1JNQ A;  1BVI A;  4MMX B;  4H61 A;  3URP A;  2RBI A;  1K41 A;  3ECF A;  4HBR A;  2F56 A;  1UW1 A;  1FYS A;  1M1K 4;  4TX4 A;  4EC6 A;  3CXC 2;  2RNT A;  1RGK A;  4NRE A;  1IYY A;  3JUQ A;  3SXX A;  2GEY A;  2WGO A;  3RGA A;  4KVH A;  1JZD A;  4R80 A;  4BTX A;  2GBX B;  1LNI A;  3HIG A;  4KT3 B;  1CQS A;  1STD A;  1GYB A;  2XRX B;  4XM4 A;  3OWY A;  4OUQ A;  4IIA A;  1UCJ A;  1EKM A;  1OHS A;  1VQQ A;  3H51 A;  3FGY A;  3LTB A;  3EB8 A;  2BNG A;  3N9H A;  1VQP 3;  1IVW A;  5KP1 A;  3FSD A;  3KFQ C;  5D83 A;  1EUI C;  1IT7 A;  1GOV A;  2HMO B;  4STD A;  4EV5 A;  1W01 A;  2XGN A;  1DET A;  4HYZ A;  3AMO A;  1BSD A;  3MSO A;  1MGW A;  2RGQ A;  1WMO A;  3MWZ A;  1GOY A;  4HM6 B;  1BOX A;  2W03 A;  3VGN A;  1NJI 4;  3BNE A;  3S67 A;  4ZM8 A;  1QAF A;  5IEP A;  3D9R A;  1EA2 A;  4MMZ B;  3Q1C A;  2F4Y A;  3GZR A;  1RGH A;  5ELU A;  1SIH A;  4I4K A;  5DRE A;  3U1W A;  4JRF A;  1BGS A;  1DVD A;  3RNT A;  1AV4 A;  4BTY A;  1G96 A;  1A67 A;  1JB2 A;  2OQE C;  5AIG A;  3ROB A;  4IT7 A;  3DM8 A;  1UUV B;  2I9W A;  4RNZ A;  1RMS A;  1PY3 A;  4MJD A;  3LYG A;  1RNT A;  2WGQ A;  1Q7H A;  3AGO A;  3WOD G;  1LRA A;  3MG2 A;  4HAA A;  2CX1 A;  3B4O A;  1LQG C;  1I3I A;  3BB9 A;  1KSI A;  1YJW 3;  4FCJ A;  3CCE 3;  2HML B;  2H0G A;  3G8Z A;  1VQN 3;  1DMN A;  3CCJ 3;  1UCK A;  5AEU B;  1JN5 B;  1I0X A;  3DGL A;  1B2Z A;  1BSA A;  2QGU A;  3DUK A;  5LC7 A;  1BRK A;  3DXO A;  2XGL A;  3NV0 A;  2P0M A;  3LT8 A;  1W6G A;  2O3O A;  1BU4 A;  1AY7 A;  1LXE A;  3RGR A;  4AEQ A;  1BIR A;  2CWT A;  1VQK 3;  3F9S A;  4HM2 B;  3MYT A;  4IPB A;  1RNB A;  1FGQ A;  2RSX A;  2PNC A;  4KFF A;  3B7C A;  2W0Q A;  4H3U A;  1UGI A;  3V98 A;  3KKG A;  3NV0 B;  1BAN A;  2Z76 A;  1E3R A;  2BMQ B;  1PYL A;  4J9A A;  2B24 B;  1YHQ 3;  1FW7 A;  1G0T A;  1OF5 A;  3NBR A;  3WHO A;  1U8C B;  1KQS 2;  3PXM A;  3UB1 A;  1R4Y A;  3GWR A;  1OAC A;  4N6O B;  3V99 A;  3SED A;  3WA3 A;  2LYX A;  3K63 A;  1BNI A;  1W6Y A;  2XR8 B;  1JKG B;  3ZG0 A;  3LTD A;  3J7Y d;  1DYU A;  2HOH A;  3ER7 A;  1BNG A;  3LXU X;  3OXA A;  3G0K A;  1OF5 B;  3K5T A;  3EC9 A;  2F5W A;  4FMC A;  1GSP A;  1ZGX A;  1IT8 A;  3SOY A;  1NB5 I;  1K73 4;  3GAX A;  1O7W B;  2MC8 A;  2WOH A;  4O3V A;  4R4K A;  1SII A;  1L5G B;  1VQO 3;  5AI1 A;  3NHX A;  3CC4 3;  1Q40 A;  2IMJ A;  4CCV A;  4LMI A;  1I0V A;  1JBS A;  2KAA A;  3FZW A;  4BL3 A;  1CH0 A;  4OK0 A;  1EG9 B;  3F14 A;  3G16 A;  3JUM A;  4FMB A;  3S5C A;  4CDL A;  1KD1 4;  1JJ2 2;  1R4C A;  1BRI A;  2CFG A;  2RFR A;  3MG3 A;  1DE3 A;  2GXF A;  2Q07 A;  3ZFZ A;  3BU4 A;  3AHS A;  4J8T A;  3CCS 3;  1C54 A;  1TFK A;  1TFO A;  5EQL A;  4FCM A;  1AQZ A;  1YIT 3;  1IVU A;  4N6T A;  1Q40 B;  4OVM A;  3U97 A;  5ELJ A;  2STD A;  3OV4 A;  1WNH A;  5LC6 A;  5IG0 A;  1GY6 A;  3Q2P A;  1I2E A;  1KWI A;  1YI2 3;  3VF1 A;  2FXT A;  2ZL8 A;  3NX0 A;  1Q81 4;  1U5O A;  4HKV B;  5BU4 A;  3SOA A;  4ORL A;  1JB5 A;  4R9K A;  3MG1 A;  5AIF A;  2WO0 A;  4MMY B;  1RHL A;  2QIY A;  1ASK A;  1Q86 4;  1W2Z A;  1OHP A;  1W4N A;  3FLJ A;  4RBN A;  1W5Z A;  1W7C A;  2F86 B;  4RNY A;  3HX8 A;  1UCI A;  4FR9 A;  1T3B A;  5HOH A;  3D5G A;  1S72 3;  1Q7Y 4;  4GHO A;  4AKY A;  1IVX A;  3G71 3;  2W9Q A;  3EBT A;  1MWS A;  1RSN A;  2FNQ A;  3S27 A;  2A15 A;  1RJO A;  2E2V A;  1S5A A;  2W2C A;  2Z6B A;  3EF8 A;  3S29 A;  1T2H A;  2YFL B;  1G02 A;  1LOW A;  3I0Y A;  5EVH A;  3S28 A;  3T0U A;  6GSP A;  3CMA 3;  1BNF A;  4GB5 A;  1N5P A;  3X41 A;  2L1S A;  4NHF A;  3SVA A;  2P38 A;  1X1Y A;  3DGY A;  1JBT A;  2CKF B;  3MHE A;  1ULI B;  1BRG A;  1FGT A;  2K54 A;  3BND A;  1VZZ A;  2IUK A;  3AGN A;  3LZA A;  4HM5 B;  4WYK A;  3CC2 3;  2GSP A;  4LGQ A;  4CPK A;  1IK3 A;  1BRH A;  1ZX2 A;  3WDG B;  1B21 A;  1E97 A;  4HZ9 B;  5AEW B;  1QJG A;  3GZB A;  2K0M A;  2P0X A;  1RRH A;  4WHA A;  2QA4 3;  1C7H A;  2Y74 A;  1JN5 A;  3UJM A;  1HU9 A;  9RNT A;  2W56 B;  2UGI A;  3DMC A;  1BSB A;  3EE1 A;  3JUO A;  4WYK B;  1QMA A;  4FMD A;  1M1X B;  2AAE A;  3O8Y A;  1VQ4 3;  1M9G A;  1LQM B;  1OHO A;  1UCL A;  3JUP A;  4HVN A;  4EXR A;  1X1X A;  3UNL A;  1YIJ 3;  1M90 4;  3FG3 A;  1RN4 A;  3FG4 A;  7RNT A;  2YFI B;  3ALA A;  1D6Y A;  7GSP A;  2Z7A A;  1HKX A;  1F8N A;  3EHC A;  2OOV A;  1STF I;  1JV2 B;  1PFP A;  1WMP A;  3F7S A;  4HM0 B;  2INX A;  4HM1 B;  4KZ1 A;  4X2O A;  3X3Y A;  3NBJ A;  2IA7 A;  2CG0 A;  3BLZ A;  3LH4 A;  5KP4 A;  4L8O A;  5IF6 A;  2B1X B;  1DMQ A;  2H0I A;  3CCR 3;  1TRQ A;  3A76 A;  1TTO A;  2XFT A;  1OH0 A;  1YNV X;  4EBG A;  1I2G A;  2MF7 A;  1RDS A;  1O7G B;  1UI8 A;  3QRD A;  1ZS7 A;  1VQ5 3;  1W2B 2;  1SPU A;  1GD3 A;  1JKG A;  3DGM A;  4XB5 A;  1YJN 3;  2CH9 A;  3GZY B;  2IY2 A;  2RCD A;  1B2U A;  3H3H A;  1Y4K A;  1FGO A;  1PU4 A;  5AII A;  2BT3 A;  3M8C A;  1BNS A;  4LZI A;  5STD A;  3SLU A;  1MGR A;  3WOF B;  4Q53 A;  4RNT A;  3I55 3;  1SQW A;  2CC3 A;  4NPB A;  3PCS A;  1GD4 A;  2HMM B;  4I5Q A;  3KII A;  1RCL A;  3WR2 A;  5JBS A;  3KSP A;  1A2V A;  4HOH A;  3KSE D;  1GS3 A;  2K3D A;  5D82 A;  3DZL A;  1EQK A;  5CLK A;  1VQM 3;  5IG4 A;  3F40 A;  3L0R A;  1RGC A;  3KN4 A;  3DGN A;  1AVL A;  2CX0 A;  4MEI A;  4XBT A;  3HII A;  3ZG5 A;  2C10 A;  1I2F A;  3BIR A;  3HOH A;  5M18 A;  1B27 A;  2KF3 A;  1X1U A;  2BMO B;  3X42 A;  5RNT A;  2ZHX B;  1BUQ A;  2GU1 A;  3F7X A;  2SAR A;  1UI7 A;  3D4A A;  4PEJ A;  3UL5 A;  2C4B A;  5G1K A;  4WP5 A;  1A90 A;  3V92 A;  1WQL B;  3FG1 A;  3HK4 A;  1GY5 A;  1BRS A;  4RZM A;  1FUS A;  3A5E A;  3CPO A;  5CXO A;  4CJN A;  1FA3 A;  4KFD A;  1RTU A;  3Q3F A;  2XH9 A;  4BTW A;  1JRQ A;  2R41 A;  5IG5 A;  1YGE A;  3PS8 A;  3WOE B;  3K0Z A;  4R9L A;  1MWU A;  1RGL A;  4FCZ A;  3QK9 A;  1FZU A;  2J8X B;  4FMA A;  3VSY A;  2QEX 3;  1QVF 2;  1IDP A;  2CW9 A;  1TJD A;  3HI7 A;  4L8P A;  2R4I A;  1RN1 A;  1UUG B;  3JVC A;  1IVV A;  1BNE A;  1GMP A;  3OWS A;  1B20 A;  1I8V A;  1LOX A;  1YVB I;  3BNC A;  2E2U A;  1QAK A;  2ZA4 A;  2HMN B;  1K28 A;  3BNB A;  3KE7 A;  1KC8 4;  1YGW A;  2OCT A;  4LSO A;  3CC7 3;  1VQ9 3;  4BL2 A;  3B4P A;  2L4V A;  3KZT A;  4HZB B;  1V57 A;  4AKZ A;  5BVB A;  1SAR A;  4K1U A;  3DH2 A;  5BXQ A;  5BIR A;  3CCL 3;  1JB4 A;  3EQQ B;  3NM7 A;  2IYJ A;  1ROA A;  2UX0 A;  1RGA A;  1YJ9 3;  1RN7 A;  4X2H A;  1RCK A;  1RGF A;  1TP6 A;  2KF5 A;  3SYU A;  2KCD A;  3NM2 A;  2F99 A;  2BO9 B;  2ML5 A;  2AAD A;  4JF8 A;  1UDI I;  4K90 B;  4N3V A;  3T8N A;  1A2P A;  2KF4 A;  1N5H A;  5CK6 A;  1NO3 A;  3CD6 3;  1IU7 A;  3CME 3;  3DY5 A;  3RDE A;  1AVK A;  1T2I A;  2O9U X;  2GBW B;  2W56 A;  1FGR A;  3NXJ A;  1LOV A;  1OCV A;  1ULJ B;  1GMR A;  5AYR B;  1HYF A;  1NU3 A;  2GU3 A;  7STD A;  2BU4 A;  2XFS A;  5AIH A;  3SX1 A;  2BIR A;  1GMQ A;  3K9M C;  4XBY A;  2W9P A;  1K9M 4;  1Q82 4;  1SJW A;  3HZP A;  2F98 A;  4WWU C;  2Y73 A;  1FUT A;  2CHC A;  3STD A;  3E99 A;  2YFJ B;  5HGR A;  1TU5 A;  2OTJ 3;  1CEW I;  1NB3 I;  1V58 A;  4O02 B;  2FGT A;  2E2T A;  4J5G A;  4K61 A;  4U13 A;  1BSC A;  3WMD A;  1CYU A;  1T5Y A;  4J5K A;  4HM7 B;  4O2H A;  1UUW B;  3IPT A;  1B2M A;  3NBB A;  3TDG A;  2BHM A;  1N8R 4;  2OOV C;  4HM8 B;  4N6L A;  2CFD A;  1WTH A;  4HJL B;  8CHO A;  5IEN A;  3DGO A;  1I70 A;  3OX9 A;  1IQ8 A;  1NDO B;  4QWT A;  3CNM A;  2HMK B;  2W6J H;  5G1L A;  3CCQ 3;  5A0O B;  2OQE A;  1BNJ A;  3AMO B;  1HZ1 A;  3FH1 A;  1TUH A;  1W02 A;  2ML6 A;  1US1 A;  2PZV A;  1W00 A;  4EYC A;  2BMR B;  1VQ8 3;  4K1V A;  1D6Z A;  2D42 A;  4N6V 0;  1CYV A;  4EV2 A;  1I3F A;  1W6C A;  4EW5 A;  4BIR A;  3D5I A;  1B3S A;  4L7K A;  1DMM A;  1MWR A;  1Q9E A;  1UGH I;  4XBX A;  3X40 A;  1OGX A;  5JPP A;  3FKA A;  3PCR A;  2P09 A;  4HM4 B;  2IUJ A;  3X3Z A;  4N6M A;  1ROV A;  5CF1 A;  2D1W A;  2OWP A;  3KCH A;  1LVN A;  2CFL A;  2H0H A;  2KRT A;  4G1M B;  4O8S A;  1TRP A;  4N6U A;  1DVC A;  1MOL A;  1ZO2 A;  2V1L A;  2XEP A;  3D3L A;  2M7O A;  4LYL B;  3T8U A;  1V74 A; 
#chains in the Genus database with same CATH homology
 3RNT A;  1RTU A;  4GHO A;  3Q3F A;  1BNR A;  1BRJ A;  1RSN A;  4GSP A;  1RMS A;  1PY3 A;  1RNT A;  3AGO A;  1RGL A;  1LRA A;  1T2H A;  1G02 A;  1LOW A;  6GSP A;  3AHW A;  1FZU A;  1BNF A;  4HAA A;  1I3I A;  1RLS A;  5GSP A;  1RN1 A;  1BSE A;  1X1Y A;  1BNE A;  1GMP A;  3DGY A;  1JBT A;  1UCK A;  6RNT A;  1B20 A;  1I8V A;  1I0X A;  1BRG A;  1RGE A;  2ZA4 A;  1B2Z A;  3AGN A;  1BSA A;  1YGW A;  1BUJ A;  1B2X A;  1BRK A;  2GSP A;  4BU4 A;  1BRN L;  1BRH A;  1SAR A;  3DH2 A;  1B21 A;  5BIR A;  1BU4 A;  1AY7 A;  1RGA A;  1BIR A;  1B2S A;  1RNB A;  1X1W A;  1RCK A;  1RGF A;  2KF5 A;  3SYU A;  9RNT A;  5HOH A;  1JBR A;  1BSB A;  2AAD A;  3GSP A;  2AAE A;  1BAN A;  1A2P A;  1PYL A;  1UCL A;  2KF4 A;  1X1X A;  1FW7 A;  7RNT A;  1RN4 A;  3WHO A;  1YVS A;  1LOY A;  1R4Y A;  1BAO A;  7GSP A;  2KF6 A;  1T2I A;  1LOV A;  1BNI A;  1GMR A;  1GOU A;  1HYF A;  8RNT A;  2BU4 A;  2HOH A;  2BIR A;  1GMQ A;  1BNG A;  1TRQ A;  1TTO A;  1YNV X;  2F5W A;  1I2G A;  1GSP A;  1FUT A;  1RDS A;  1ZGX A;  4J5G A;  2F5M A;  1RGG A;  1B2U A;  1BSC A;  1BVI A;  4J5K A;  1JBS A;  1I0V A;  3URP A;  2KAA A;  2RBI A;  1B2M A;  1BNS A;  1CH0 A;  2F56 A;  1MGR A;  1FYS A;  4RNT A;  1BRI A;  2RNT A;  1RGK A;  1DE3 A;  1IYY A;  1I70 A;  3WR2 A;  1RCL A;  3BU4 A;  3AHS A;  4HOH A;  1C54 A;  1LNI A;  1BNJ A;  1HZ1 A;  1AQZ A;  1RGC A;  1UCJ A;  1I3F A;  4BIR A;  3D5I A;  1I2E A;  1B3S A;  1I2F A;  1Q9E A;  3BIR A;  3HOH A;  5BU4 A;  1B27 A;  1GOV A;  2KF3 A;  1X1U A;  5RNT A;  1DET A;  1BSD A;  1MGW A;  1GOY A;  1BOX A;  2SAR A;  1RHL A;  3D4A A;  3KCH A;  2C4B A;  2F4Y A;  1RGH A;  1TRP A;  1BRS A;  1FUS A;  1UCI A;  3A5E A;  3D5G A;  1BGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...