1BU4A

Ribonuclease 1 complex with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bu4A00
1BU4A 1UCLA 1T2IA 4J5GA 7RNTA 1BRHA 1I2FA 1B27A 1LOVA 1RGEA 2SARA 3AGNA 1GOVA 1GOUA 1YNVX 1I2EA 2KF3A 1RGCA 3BU4A 2AADA 5BIRA 1GSPA 1MGRA 1B20A 3AHSA 1I3FA 1RMSA 1SARA 1PY3A 3D4AA 1CH0A 5RNTA 1HYFA 3HOHA 1B2SA 2AAEA 3BIRA 6GSPA 1I3IA 1FUTA 1DETA 1B2MA 1BAOA 3RNTA 2F5WA 1RCLA 3WHOA 1X1UA 1ZGXA 1IYYA 3DH2A 1X1XA 1B21A 1JBRA 3GSPA 2F5MA 3SYUA 1MGWA 1UCIA 1TTOA 1AQZA 4RNTA 1BUJA 1X1YA 3KCHA 1RLSA 1RGLA 1DE3A 1BGSA 1RGKA 1GMQA 2RBIA 1HZ1A 2ZA4A 5HOHA 3D5GA 1BSCA 1AY7A 1BSEA 3DGYA 5BU4A 2KF5A 1A2PA 1FW7A 1RGFA 3Q3FA 1Q9EA 1BNFA 1BRJA 2BIRA 1I0VA 1BSBA 1RGAA 1RGHA 2BU4A 3A5EA 2C4BA 1BNEA 1GMPA 1GMRA 2F56A 1BIRA 1TRQA 1RHLA 1JBTA 1YVSA 1T2HA 1I0XA 3AHWA 1RDSA 4HAAA 1RCKA 1PYLA 1R4YA 1LRAA 3WR2A 1BRIA 1RTUA 1C54A 2F4YA 1LOYA 1BVIA 5GSPA 1BRSA 4J5KA 6RNTA 1B2UA 1BNGA 1B2XA 1LNIA 1UCKA 2GSPA 1RNTA 2KF4A 4HOHA 2HOHA 1BANA 1BNRA 1I70A 7GSPA 1RN4A 1FYSA 1BOXA 2KAAA 1I2GA 1BSDA 2KF6A 1B2ZA 1UCJA 1FZUA 9RNTA 1LOWA 1YGWA 2RNTA 1BNSA 1BNIA 1TRPA 3D5IA 1RSNA 3AGOA 4GHOA 1JBSA 1BRKA 4GSPA 1RNBA 1RGGA 1I8VA 3URPA 1BSAA 1B3SA 4BIRA 1X1WA 4BU4A 8RNTA 1GOYA 1FUSA 1RN1A 1BRNL 1G02A 1BNJA 1BRGA
chains in the Genus database with same CATH superfamily
1BU4A 1UCLA 2W56B 1T2IA 4J5GA 5AIGA 1E97A 4RNYA 1I2FA 1A2VA 1LOVA 3MG1A 1DYUA 3HIIA 3AGNA 3EB8A 4HM7B 4I4KA 3F8HA 4XBYA 1CYVA 2KF3A 4IT7A 2XFSA 5ELUA 5IEPA 3CCL3 3PYJA 3CME3 3LT8A 3EN8A 3LTCA 4MMYB 3B4OA 2D42A 4N6NB 5BIRA 5D82A 1GSPA 1QMAA 1MGRA 1B20A 1IVWA 2A15A 5DRVA 1IVUA 3OWUA 4FMDA 4O02B 2PZVA 1OH0A 3S29A 5RNTA 2M7OA 3CMA3 3HOHA 3DUKA 1OGXA 2BHMA 3BIRA 4LYLB 6GSPA 1I3IA 2WOFA 3PZWA 1OUNA 4R9KA 3WHOA 1GYBA 1DVCA 2UUGC 1GD3A 3QRDA 8CHOA 1D6ZA 3LTAA 2B24B 2J8XB 4BTYA 2HMOB 1AV4A 5M19A 1TTOA 4XBTA 2ML5A 2GU3A 2INXA 5EVHA 1W2ZA 3AMOA 1BGSA 1Q7HA 3T0UA 4GL6A 6STDA 2CX1A 2BNGA 2WO0A 1FGQA 3S5CA 1YIJ3 4JRFA 3V99A 4AEQA 1HKXA 1EEJA 3IPTA 4OK0A 1AY7A 4FCJA 3ZFZA 1VQ43 3DGYA 3ALAA 2KF5A 1UUWB 1NB3I 1FW7A 1NJI4 3SOAA 3X3YA 5KP1A 1IT8A 4HM0B 1Q9EA 1BNFA 1GY7A 1WMOA 3EF8A 2B1XB 4X2OA 2OTL3 1LQGC 3WOEB 1UUVB 1ZO2A 3D9RA 3X3XA 4O8SA 1RGAA 1RGHA 2BU4A 3EBYA 4N6OB 5AIHA 1VQO3 1T3BA 4WHAA 2BT3A 1N9EA 2CC3A 5CXOA 2OQEA 1ROVA 3RGRA 1V57A 4AKYA 4N6UA 5G1KA 3AHWA 1RDSA 3HI7A 1N8QA 1QALA 1RCKA 5JBSA 1LRAA 2YFIB 2FGTA 5AIFA 5FW5A 1Q7Y4 3CD63 3GWRA 1IU7A 5BVBA 1QVF2 3LXUX 1VZZA 2W2CA 5JPUA 3OX9A 4RZMA 4U13A 1S723 4HM6B 3SVAA 1OCVA 4XM4A 2CX0A 3OV4A 4J5KA 1LQMB 3EC9A 4J8TA 3TDGA 4CJNA 4CPKA 1B2XA 1Q40A 4WYKB 2OQEC 2W6JH 4QWTA 1SIIA 3HZPA 1TU5A 1BNRA 3WDGB 3DY5A 2CWVA 1NU3A 1V58A 1EG9B 2KF6A 1I2GA 1BSDA 1B2ZA 9RNTA 1K9M4 1TIJA 3RDEA 2R4IA 1BNSA 1SIHA 5I97A 2Q07A 3CC73 1AR0A 2XSHB 3D5IA 4HM5B 2Z77A 3K9MC 3SX1A 4GHOA 1VQ93 3D3LA 4GSPA 4ILFA 1JV2B 1RNBA 3GRDA 4FCMA 4Q53A 1D6UA 3EJVA 1B3SA 4RBNA 4BIRA 2BO9B 1GOYA 3E99A 1ZS7A 2BMOB 2I9WA 3F9SA 3V98A 1BRNL 1BNJA 1YGEA 2CWTA 1OHOA 5IEOA 2STDA 7RNTA 4HKVB 1UGHI 2P38A 1K8A4 1B27A 1TJDA 4BL3A 1YNVX 4L8OA 4KFDA 3CNMA 4K1UA 3MG2A 1JKGA 2HMJB 3ZG0A 1WMPA 1IVXA 1VQ73 1VQ53 3CCR3 3H51A 1VQQA 4WP5A 4OUQA 1W01A 1EQKA 2L1SA 1STDA 1PY3A 3NM7A 5M18A 3BLZA 1AVKA 1QAKA 1K28A 2FXTA 1C7HA 1LVNA 1QJGA 3FLJA 5KP3A 4HJLB 4EC6A 1B2SA 1NB5I 3JVCA 4HM4B 3BNEA 2C10A 1JRQA 3DGMA 3VF1A 3FG4A 1YJW3 2XEPA 1W7CA 1TUHA 4MMXB 2F5WA 3RNTA 5IG3A 2IA7A 3DH2A 1X1XA 4IPBA 3WOFB 2P0XA 3NV0B 3EE1A 3WA3A 1JBRA 3PCSA 2Z7AA 1LOXA 1WQLB 1TP6A 3GSPA 3SYUA 4RNTA 1RJOA 4KVHA 2YX9A 3FSDA 3KCHA 3MG3A 1RGLA 1OHSA 3CPOA 1O7PB 3F40A 3B7CA 3FF0A 4PEJA 1GMQA 3OW22 1YHQ3 3G0KA 3EBTA 1KD14 3JUQA 3LOYA 1WMNA 5D81A 5EEOA 3UB1A 1BSEA 3MKIA 1RGFA 2ZHXB 1KC84 1FA3A 4K1VA 1NO3A 1BRJA 1O7NB 3EN1B 3JUPA 1EKMA 2GBXB 1G96A 1BSBA 2K0MA 1A2KA 2W03A 4R80A 5CF1A 3N8BA 4N6MA 4N6LA 3LMLA 3S28A 4BL2A 1BNEA 1JN5B 1GMPA 2F56A 2YFLB 3FZWA 2W56A 1RHLA 4X2HA 4RNZA 4WWUC 5IW9A 1I0XA 2QEX3 2D1WA 2BMRB 1JBTA 1PYLA 3EX9A 3FGYA 2XSOB 2Z76A 1YVBI 5DREA 2XH9A 1S5AA 3STDA 3DZLA 4CDLA 1RN7A 3FCSB 1F8NA 1WNHA 4HBRA 2QA43 1BUQA 1BRSA 1STFI 4KZ1A 1B2UA 4I5QA 1FGOA 1MWTA 2WGQA 4H3UA 4K61A 1RN4A 3NQYA 2E2TA 1OF5A 2KAAA 2WGOA 2O9UX 1RRHA 2IUJA 1O7GB 3LZAA 5D83A 3NM2A 1LOWA 3GZYB 3WODG 3CC23 1NNVA 2P05A 3Q1CA 3MHEA 3G6E3 3EQQB 1GY6A 2XGLA 4EW5A 1Q40B 2Y73A 2P09A 3K7CA 1ULIB 1BRKA 3BNCA 2XRXB 2CFLA 3ECFA 1RGGA 1I8VA 4NPBA 5ELJA 3URPA 3G8ZA 2XF3A 3NBRA 1IK3A 4LSOA 2CWUA 1UW1A 4ZM8A 3IMAB 1OGZA 2E2UA 2H0IA 2YFJB 1RN1A 3KSPA 5LC6A 4BU4A 1Y4KA 3NHXA 1JB2A 2PNCA 4FMAA 3VSYA 3PCRA 1BRGA 1UUGB 1YJ93 1W4NA 2P0MA 4FCZA 4EV5A 3CCE3 1VQL3 3NXJA 1BRHA 1N5HA 1N5PA 2UGIA 4MEIA 1RGEA 1J2BA 2CIUA 2ML6A 1GOUA 3CXC2 1CEWI 2OOVA 4HZBB 1I2EA 1CYUA 3DGLA 4TX4A 3UNLA 3F14A 3MPHA 2AADA 5AIIA 2RCDA 2CFDA 3GZBA 4CCVA 1YI23 3LT9A 4ORLA 3N54B 3AHSA 3N9HA 4XB5A 4LGQA 1I3FA 1RMSA 1HU9A 1SPUA 1SARA 1ULJB 2GXFA 2RGQA 4N6V0 3BB9A 2F98A 1CH0A 1U8CB 2BMQB 1IQYA 1FGRA 1O7HB 2H0GA 4R1KA 1JZDA 2GU1A 1M904 4XBXA 5AI1A 2OOVC 1RCLA 5AEUB 1ZGXA 5FGOA 2JQ5A 1LNHA 1VQ83 1GD4A 1YIT3 2HMNB 4AKZA 1DMNA 3JUNA 1B21A 1LXEA 2WOHA 4LMIA 1IDPA 3BNBA 2F5MA 2W9QA 1FGMA 4K90B 5AYSC 4FMBA 4WYKA 2CK3H 2XR8B 1DE3A 1RGKA 2RBIA 2KXGA 1DMMA 4OVMA 5HOHA 4EBGA 5CK6A 2HMLB 3CCQ3 3FG1A 3SXXA 3UJMA 4DKIA 1JB5A 3IJEB 1A2PA 2F99A 3BNDA 1IV7A 1KQS2 2CFKA 1IT7A 5IERA 1E3VA 2IUKA 3FG3A 3ZG5A 2K54A 2BIRA 3MYTA 1M1XB 4G1MB 5HGRA 3S67A 4EXRA 1OHPA 3X42A 4NHFA 3I553 3PS8A 3J7Yd 3DMCA 4O3VA 5AYRB 3DGOA 3MSOA 1FUWA 4XDWA 1BIRA 1TRQA 1D6YA 3H3HA 1ROAA 4HAAA 3CCS3 1R4YA 4HYZA 1IQ8A 3NUVA 2IMJA 2RFRA 4MMZB 1T5YA 3NBBA 4N3VA 4KT3B 1C54A 3CCU3 1PU4A 3X40A 3B8LA 4IIAA 1WTHA 3U97A 3CPW2 5GSPA 3KE7A 5IG5A 1EUIC 3LTDA 3VGNA 1KWIA 2CG1A 2ZDJA 3CNXA 1TFOA 3DGNA 1BNGA 4HOHA 3WA2X 1RNTA 2HOHA 3DM8A 1UGIA 3AMOB 5EQLA 1I70A 4BTXA 1MWRA 7GSPA 2R41A 1FYSA 3OXAA 4HM2B 7STDA 2CFGA 3JUMA 5IENA 1W2B2 1FZUA 1DMQA 3LH4A 1Q814 3KIIA 1YGWA 2RNTA 1FGTA 1KSIA 2W0QA 3LTBA 4R4KA 4J9AA 5IG0A 1O7WB 3CU3A 1TRPA 3G713 1VQ63 1RSNA 1W00A 3NV0A 4EYCA 3AGOA 1VQK3 1W5ZA 5STDA 2JDIH 4KFFA 1OF5B 4LZIA 3O8YA 3GAXA 2SBLA 3EHCA 1O7MB 2V1LA 1BSAA 2CHCA 1X1WA 2LQVA 8RNTA 1FUSA 5A0OB 3I563 1MWSA 1VQM3 1W02A 3GZRA 2XFTA 1G02A 3CCV3 3F8XA 3NQZA 2CFWA 1IV9A 2HMMB 2K3DA 1RKYA 1M9GA 3V92A 4LEHA 2H0HA 2SARA 4WFOA 1GOVA 3OWSA 4FR9A 2MC8A 1RGCA 1UI8A 3BU4A 1IQXA 1ZX2A 2Y74A 3LYGA 5IG4A 2KCDA 1ISKA 3M8CA 1PFPA 4XDVA 1VQP3 1US1A 3G16A 4GB5A 1GS3A 1QAFA 5IF6A 1Q42A 1NWWA 3D4AA 1GY5A 3T8NA 4R9LA 1MWUA 1HYFA 3KKGA 3PXMA 3Q2PA 3NX0A 1JN5A 1AVLA 2AAEA 2IY2A 2XGNA 1OPYA 1B2MA 1FUTA 1DETA 1BAOA 3UL5A 3SEDA 1L5GB 1IYYA 1X1UA 1OACA 3S27A 1MOLA 3NBJA 1E3RA 3GZXB 2IYJA 2QIYA 5TGNA 3X41A 5CF2A 2HMKB 5M1AA 2FNQA 1MGWA 3HIGA 1UCIA 1AQZA 5LC7A 3F7SA 3K63A 1BUJA 4MJDA 1X1YA 2GBWB 1RLSA 4L7KA 2W04A 1ASKA 5AEWB 1HZ1A 4EV2A 3RGAA 1Z1SA 2ZA4A 4KFEA 5G1LA 3D5GA 3KZTA 1JB4A 1JZOA 2GEYA 3FF2A 1BSCA 1A67A 3SOYA 2ZL8A 1A90A 3B4PA 5BU4A 1SQWA 1JKGB 4L8PA 1SJWA 4BTWA 2OCTA 4O2HA 3Q3FA 2CKFB 2QGUA 2Z6BA 3QK9A 3U1WA 1JJ22 3D79A 2OTJ3 1I0VA 2F86B 4N6TA 1M1K4 1DVDA 4FMCA 3FH1A 2CH9A 4H61A 3A5EA 3PGBA 2C4BA 5BXQA 3G4S3 3JUOA 3WMDA 1K41A 1GMRA 2W9PA 1UI7A 4HM1B 3KSED 1YVSA 1RRLA 1T2HA 3HK4A 4NREA 2OWPA 3L0RA 1QVG2 5CLKA 3WR2A 3DXOA 1BRIA 1RTUA 1N9JA 2GEXA 3FKAA 4HM8B 2F4YA 2CG0A 1LOYA 1BVIA 1K734 2C11A 1G0TA 1TFKA 3MWZA 3CCJ3 3Q90A 1Q824 1W6CA 3ROBA 1CQSA 1V74A 4HVNA 1JNQA 2LYXA 6RNTA 1NDOB 2KF4A 1Q864 1LNIA 1UCKA 2GSPA 3X3ZA 1N8R4 3OWYA 3SLUA 1BANA 4JF8A 1BOXA 1IVVA 3KN4A 4STDA 1R4CA 1UCJA 1W6YA 4HM3B 5JPPA 1U5OA 2MF7A 1BNIA 1W6GA 5G2GA 2RSXA 3A76A 1MNLA 2L4VA 2UX0A 3KFQC 3K5TA 1JBSA 3K0ZA 3ER7A 2E2VA 5KP4A 3CCM3 2CW9A 3I0YA 3T8UA 1UDII 2O3OA 3CC43 3UL6A 1VQN3 4HZ9B 1EA2A 3HX8A 1YJN3 3F7XA 2KRTA
chains in the Genus database with same CATH topology
1BU4A 1UCLA 1T2IA 4J5GA 7RNTA 1BRHA 1I2FA 1B27A 1LOVA 1RGEA 2SARA 3AGNA 1GOVA 1GOUA 1YNVX 1I2EA 2KF3A 1RGCA 3BU4A 2AADA 5BIRA 1GSPA 1MGRA 1B20A 3AHSA 1I3FA 1RMSA 1SARA 1PY3A 3D4AA 1CH0A 5RNTA 1HYFA 3HOHA 1B2SA 2AAEA 3BIRA 6GSPA 1I3IA 1FUTA 1DETA 1B2MA 1BAOA 3RNTA 2F5WA 1RCLA 3WHOA 1X1UA 1ZGXA 1IYYA 3DH2A 1X1XA 1B21A 1JBRA 3GSPA 2F5MA 3SYUA 1MGWA 1UCIA 1TTOA 1AQZA 4RNTA 1BUJA 1X1YA 3KCHA 1RLSA 1RGLA 1DE3A 1BGSA 1RGKA 1GMQA 2RBIA 1HZ1A 2ZA4A 5HOHA 3D5GA 1BSCA 1AY7A 1BSEA 3DGYA 5BU4A 2KF5A 1A2PA 1FW7A 1RGFA 3Q3FA 1Q9EA 1BNFA 1BRJA 2BIRA 1I0VA 1BSBA 1RGAA 1RGHA 2BU4A 3A5EA 2C4BA 1BNEA 1GMPA 1GMRA 2F56A 1BIRA 1TRQA 1RHLA 1JBTA 1YVSA 1T2HA 1I0XA 3AHWA 1RDSA 4HAAA 1RCKA 1PYLA 1R4YA 1LRAA 3WR2A 1BRIA 1RTUA 1C54A 2F4YA 1LOYA 1BVIA 5GSPA 1BRSA 4J5KA 6RNTA 1B2UA 1BNGA 1B2XA 1LNIA 1UCKA 2GSPA 1RNTA 2KF4A 4HOHA 2HOHA 1BANA 1BNRA 1I70A 7GSPA 1RN4A 1FYSA 1BOXA 2KAAA 1I2GA 1BSDA 2KF6A 1B2ZA 1UCJA 1FZUA 9RNTA 1LOWA 1YGWA 2RNTA 1BNSA 1BNIA 1TRPA 3D5IA 1RSNA 3AGOA 4GHOA 1JBSA 1BRKA 4GSPA 1RNBA 1RGGA 1I8VA 3URPA 1BSAA 1B3SA 4BIRA 1X1WA 4BU4A 8RNTA 1GOYA 1FUSA 1RN1A 1BRNL 1G02A 1BNJA 1BRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BU4 A;  1UCL A;  1T2I A;  4J5G A;  7RNT A;  1BRH A;  1I2F A;  1B27 A;  1LOV A;  1RGE A;  2SAR A;  3AGN A;  1GOV A;  1GOU A;  1YNV X;  1I2E A;  2KF3 A;  1RGC A;  3BU4 A;  2AAD A;  5BIR A;  1GSP A;  1MGR A;  1B20 A;  3AHS A;  1I3F A;  1RMS A;  1SAR A;  1PY3 A;  3D4A A;  1CH0 A;  5RNT A;  1HYF A;  3HOH A;  1B2S A;  2AAE A;  3BIR A;  6GSP A;  1I3I A;  1FUT A;  1DET A;  1B2M A;  1BAO A;  3RNT A;  2F5W A;  1RCL A;  3WHO A;  1X1U A;  1ZGX A;  1IYY A;  3DH2 A;  1X1X A;  1B21 A;  1JBR A;  3GSP A;  2F5M A;  3SYU A;  1MGW A;  1UCI A;  1TTO A;  1AQZ A;  4RNT A;  1BUJ A;  1X1Y A;  3KCH A;  1RLS A;  1RGL A;  1DE3 A;  1BGS A;  1RGK A;  1GMQ A;  2RBI A;  1HZ1 A;  2ZA4 A;  5HOH A;  3D5G A;  1BSC A;  1AY7 A;  1BSE A;  3DGY A;  5BU4 A;  2KF5 A;  1A2P A;  1FW7 A;  1RGF A;  3Q3F A;  1Q9E A;  1BNF A;  1BRJ A;  2BIR A;  1I0V A;  1BSB A;  1RGA A;  1RGH A;  2BU4 A;  3A5E A;  2C4B A;  1BNE A;  1GMP A;  1GMR A;  2F56 A;  1BIR A;  1TRQ A;  1RHL A;  1JBT A;  1YVS A;  1T2H A;  1I0X A;  3AHW A;  1RDS A;  4HAA A;  1RCK A;  1PYL A;  1R4Y A;  1LRA A;  3WR2 A;  1BRI A;  1RTU A;  1C54 A;  2F4Y A;  1LOY A;  1BVI A;  5GSP A;  1BRS A;  4J5K A;  6RNT A;  1B2U A;  1BNG A;  1B2X A;  1LNI A;  1UCK A;  2GSP A;  1RNT A;  2KF4 A;  4HOH A;  2HOH A;  1BAN A;  1BNR A;  1I70 A;  7GSP A;  1RN4 A;  1FYS A;  1BOX A;  2KAA A;  1I2G A;  1BSD A;  2KF6 A;  1B2Z A;  1UCJ A;  1FZU A;  9RNT A;  1LOW A;  1YGW A;  2RNT A;  1BNS A;  1BNI A;  1TRP A;  3D5I A;  1RSN A;  3AGO A;  4GHO A;  1JBS A;  1BRK A;  4GSP A;  1RNB A;  1RGG A;  1I8V A;  3URP A;  1BSA A;  1B3S A;  4BIR A;  1X1W A;  4BU4 A;  8RNT A;  1GOY A;  1FUS A;  1RN1 A;  1BRN L;  1G02 A;  1BNJ A;  1BRG A; 
#chains in the Genus database with same CATH topology
 1BU4 A;  1UCL A;  2W56 B;  1T2I A;  4J5G A;  5AIG A;  1E97 A;  4RNY A;  1I2F A;  1A2V A;  1LOV A;  3MG1 A;  1DYU A;  3HII A;  3AGN A;  3EB8 A;  4HM7 B;  4I4K A;  3F8H A;  4XBY A;  1CYV A;  2KF3 A;  4IT7 A;  2XFS A;  5ELU A;  5IEP A;  3CCL 3;  3PYJ A;  3CME 3;  3LT8 A;  3EN8 A;  3LTC A;  4MMY B;  3B4O A;  2D42 A;  4N6N B;  5BIR A;  5D82 A;  1GSP A;  1QMA A;  1MGR A;  1B20 A;  1IVW A;  2A15 A;  5DRV A;  1IVU A;  3OWU A;  4FMD A;  4O02 B;  2PZV A;  1OH0 A;  3S29 A;  5RNT A;  2M7O A;  3CMA 3;  3HOH A;  3DUK A;  1OGX A;  2BHM A;  3BIR A;  4LYL B;  6GSP A;  1I3I A;  2WOF A;  3PZW A;  1OUN A;  4R9K A;  3WHO A;  1GYB A;  1DVC A;  2UUG C;  1GD3 A;  3QRD A;  8CHO A;  1D6Z A;  3LTA A;  2B24 B;  2J8X B;  4BTY A;  2HMO B;  1AV4 A;  5M19 A;  1TTO A;  4XBT A;  2ML5 A;  2GU3 A;  2INX A;  5EVH A;  1W2Z A;  3AMO A;  1BGS A;  1Q7H A;  3T0U A;  4GL6 A;  6STD A;  2CX1 A;  2BNG A;  2WO0 A;  1FGQ A;  3S5C A;  1YIJ 3;  4JRF A;  3V99 A;  4AEQ A;  1HKX A;  1EEJ A;  3IPT A;  4OK0 A;  1AY7 A;  4FCJ A;  3ZFZ A;  1VQ4 3;  3DGY A;  3ALA A;  2KF5 A;  1UUW B;  1NB3 I;  1FW7 A;  1NJI 4;  3SOA A;  3X3Y A;  5KP1 A;  1IT8 A;  4HM0 B;  1Q9E A;  1BNF A;  1GY7 A;  1WMO A;  3EF8 A;  2B1X B;  4X2O A;  2OTL 3;  1LQG C;  3WOE B;  1UUV B;  1ZO2 A;  3D9R A;  3X3X A;  4O8S A;  1RGA A;  1RGH A;  2BU4 A;  3EBY A;  4N6O B;  5AIH A;  1VQO 3;  1T3B A;  4WHA A;  2BT3 A;  1N9E A;  2CC3 A;  5CXO A;  2OQE A;  1ROV A;  3RGR A;  1V57 A;  4AKY A;  4N6U A;  5G1K A;  3AHW A;  1RDS A;  3HI7 A;  1N8Q A;  1QAL A;  1RCK A;  5JBS A;  1LRA A;  2YFI B;  2FGT A;  5AIF A;  5FW5 A;  1Q7Y 4;  3CD6 3;  3GWR A;  1IU7 A;  5BVB A;  1QVF 2;  3LXU X;  1VZZ A;  2W2C A;  5JPU A;  3OX9 A;  4RZM A;  4U13 A;  1S72 3;  4HM6 B;  3SVA A;  1OCV A;  4XM4 A;  2CX0 A;  3OV4 A;  4J5K A;  1LQM B;  3EC9 A;  4J8T A;  3TDG A;  4CJN A;  4CPK A;  1B2X A;  1Q40 A;  4WYK B;  2OQE C;  2W6J H;  4QWT A;  1SII A;  3HZP A;  1TU5 A;  1BNR A;  3WDG B;  3DY5 A;  2CWV A;  1NU3 A;  1V58 A;  1EG9 B;  2KF6 A;  1I2G A;  1BSD A;  1B2Z A;  9RNT A;  1K9M 4;  1TIJ A;  3RDE A;  2R4I A;  1BNS A;  1SIH A;  5I97 A;  2Q07 A;  3CC7 3;  1AR0 A;  2XSH B;  3D5I A;  4HM5 B;  2Z77 A;  3K9M C;  3SX1 A;  4GHO A;  1VQ9 3;  3D3L A;  4GSP A;  4ILF A;  1JV2 B;  1RNB A;  3GRD A;  4FCM A;  4Q53 A;  1D6U A;  3EJV A;  1B3S A;  4RBN A;  4BIR A;  2BO9 B;  1GOY A;  3E99 A;  1ZS7 A;  2BMO B;  2I9W A;  3F9S A;  3V98 A;  1BRN L;  1BNJ A;  1YGE A;  2CWT A;  1OHO A;  5IEO A;  2STD A;  7RNT A;  4HKV B;  1UGH I;  2P38 A;  1K8A 4;  1B27 A;  1TJD A;  4BL3 A;  1YNV X;  4L8O A;  4KFD A;  3CNM A;  4K1U A;  3MG2 A;  1JKG A;  2HMJ B;  3ZG0 A;  1WMP A;  1IVX A;  1VQ7 3;  1VQ5 3;  3CCR 3;  3H51 A;  1VQQ A;  4WP5 A;  4OUQ A;  1W01 A;  1EQK A;  2L1S A;  1STD A;  1PY3 A;  3NM7 A;  5M18 A;  3BLZ A;  1AVK A;  1QAK A;  1K28 A;  2FXT A;  1C7H A;  1LVN A;  1QJG A;  3FLJ A;  5KP3 A;  4HJL B;  4EC6 A;  1B2S A;  1NB5 I;  3JVC A;  4HM4 B;  3BNE A;  2C10 A;  1JRQ A;  3DGM A;  3VF1 A;  3FG4 A;  1YJW 3;  2XEP A;  1W7C A;  1TUH A;  4MMX B;  2F5W A;  3RNT A;  5IG3 A;  2IA7 A;  3DH2 A;  1X1X A;  4IPB A;  3WOF B;  2P0X A;  3NV0 B;  3EE1 A;  3WA3 A;  1JBR A;  3PCS A;  2Z7A A;  1LOX A;  1WQL B;  1TP6 A;  3GSP A;  3SYU A;  4RNT A;  1RJO A;  4KVH A;  2YX9 A;  3FSD A;  3KCH A;  3MG3 A;  1RGL A;  1OHS A;  3CPO A;  1O7P B;  3F40 A;  3B7C A;  3FF0 A;  4PEJ A;  1GMQ A;  3OW2 2;  1YHQ 3;  3G0K A;  3EBT A;  1KD1 4;  3JUQ A;  3LOY A;  1WMN A;  5D81 A;  5EEO A;  3UB1 A;  1BSE A;  3MKI A;  1RGF A;  2ZHX B;  1KC8 4;  1FA3 A;  4K1V A;  1NO3 A;  1BRJ A;  1O7N B;  3EN1 B;  3JUP A;  1EKM A;  2GBX B;  1G96 A;  1BSB A;  2K0M A;  1A2K A;  2W03 A;  4R80 A;  5CF1 A;  3N8B A;  4N6M A;  4N6L A;  3LML A;  3S28 A;  4BL2 A;  1BNE A;  1JN5 B;  1GMP A;  2F56 A;  2YFL B;  3FZW A;  2W56 A;  1RHL A;  4X2H A;  4RNZ A;  4WWU C;  5IW9 A;  1I0X A;  2QEX 3;  2D1W A;  2BMR B;  1JBT A;  1PYL A;  3EX9 A;  3FGY A;  2XSO B;  2Z76 A;  1YVB I;  5DRE A;  2XH9 A;  1S5A A;  3STD A;  3DZL A;  4CDL A;  1RN7 A;  3FCS B;  1F8N A;  1WNH A;  4HBR A;  2QA4 3;  1BUQ A;  1BRS A;  1STF I;  4KZ1 A;  1B2U A;  4I5Q A;  1FGO A;  1MWT A;  2WGQ A;  4H3U A;  4K61 A;  1RN4 A;  3NQY A;  2E2T A;  1OF5 A;  2KAA A;  2WGO A;  2O9U X;  1RRH A;  2IUJ A;  1O7G B;  3LZA A;  5D83 A;  3NM2 A;  1LOW A;  3GZY B;  3WOD G;  3CC2 3;  1NNV A;  2P05 A;  3Q1C A;  3MHE A;  3G6E 3;  3EQQ B;  1GY6 A;  2XGL A;  4EW5 A;  1Q40 B;  2Y73 A;  2P09 A;  3K7C A;  1ULI B;  1BRK A;  3BNC A;  2XRX B;  2CFL A;  3ECF A;  1RGG A;  1I8V A;  4NPB A;  5ELJ A;  3URP A;  3G8Z A;  2XF3 A;  3NBR A;  1IK3 A;  4LSO A;  2CWU A;  1UW1 A;  4ZM8 A;  3IMA B;  1OGZ A;  2E2U A;  2H0I A;  2YFJ B;  1RN1 A;  3KSP A;  5LC6 A;  4BU4 A;  1Y4K A;  3NHX A;  1JB2 A;  2PNC A;  4FMA A;  3VSY A;  3PCR A;  1BRG A;  1UUG B;  1YJ9 3;  1W4N A;  2P0M A;  4FCZ A;  4EV5 A;  3CCE 3;  1VQL 3;  3NXJ A;  1BRH A;  1N5H A;  1N5P A;  2UGI A;  4MEI A;  1RGE A;  1J2B A;  2CIU A;  2ML6 A;  1GOU A;  3CXC 2;  1CEW I;  2OOV A;  4HZB B;  1I2E A;  1CYU A;  3DGL A;  4TX4 A;  3UNL A;  3F14 A;  3MPH A;  2AAD A;  5AII A;  2RCD A;  2CFD A;  3GZB A;  4CCV A;  1YI2 3;  3LT9 A;  4ORL A;  3N54 B;  3AHS A;  3N9H A;  4XB5 A;  4LGQ A;  1I3F A;  1RMS A;  1HU9 A;  1SPU A;  1SAR A;  1ULJ B;  2GXF A;  2RGQ A;  4N6V 0;  3BB9 A;  2F98 A;  1CH0 A;  1U8C B;  2BMQ B;  1IQY A;  1FGR A;  1O7H B;  2H0G A;  4R1K A;  1JZD A;  2GU1 A;  1M90 4;  4XBX A;  5AI1 A;  2OOV C;  1RCL A;  5AEU B;  1ZGX A;  5FGO A;  2JQ5 A;  1LNH A;  1VQ8 3;  1GD4 A;  1YIT 3;  2HMN B;  4AKZ A;  1DMN A;  3JUN A;  1B21 A;  1LXE A;  2WOH A;  4LMI A;  1IDP A;  3BNB A;  2F5M A;  2W9Q A;  1FGM A;  4K90 B;  5AYS C;  4FMB A;  4WYK A;  2CK3 H;  2XR8 B;  1DE3 A;  1RGK A;  2RBI A;  2KXG A;  1DMM A;  4OVM A;  5HOH A;  4EBG A;  5CK6 A;  2HML B;  3CCQ 3;  3FG1 A;  3SXX A;  3UJM A;  4DKI A;  1JB5 A;  3IJE B;  1A2P A;  2F99 A;  3BND A;  1IV7 A;  1KQS 2;  2CFK A;  1IT7 A;  5IER A;  1E3V A;  2IUK A;  3FG3 A;  3ZG5 A;  2K54 A;  2BIR A;  3MYT A;  1M1X B;  4G1M B;  5HGR A;  3S67 A;  4EXR A;  1OHP A;  3X42 A;  4NHF A;  3I55 3;  3PS8 A;  3J7Y d;  3DMC A;  4O3V A;  5AYR B;  3DGO A;  3MSO A;  1FUW A;  4XDW A;  1BIR A;  1TRQ A;  1D6Y A;  3H3H A;  1ROA A;  4HAA A;  3CCS 3;  1R4Y A;  4HYZ A;  1IQ8 A;  3NUV A;  2IMJ A;  2RFR A;  4MMZ B;  1T5Y A;  3NBB A;  4N3V A;  4KT3 B;  1C54 A;  3CCU 3;  1PU4 A;  3X40 A;  3B8L A;  4IIA A;  1WTH A;  3U97 A;  3CPW 2;  5GSP A;  3KE7 A;  5IG5 A;  1EUI C;  3LTD A;  3VGN A;  1KWI A;  2CG1 A;  2ZDJ A;  3CNX A;  1TFO A;  3DGN A;  1BNG A;  4HOH A;  3WA2 X;  1RNT A;  2HOH A;  3DM8 A;  1UGI A;  3AMO B;  5EQL A;  1I70 A;  4BTX A;  1MWR A;  7GSP A;  2R41 A;  1FYS A;  3OXA A;  4HM2 B;  7STD A;  2CFG A;  3JUM A;  5IEN A;  1W2B 2;  1FZU A;  1DMQ A;  3LH4 A;  1Q81 4;  3KII A;  1YGW A;  2RNT A;  1FGT A;  1KSI A;  2W0Q A;  3LTB A;  4R4K A;  4J9A A;  5IG0 A;  1O7W B;  3CU3 A;  1TRP A;  3G71 3;  1VQ6 3;  1RSN A;  1W00 A;  3NV0 A;  4EYC A;  3AGO A;  1VQK 3;  1W5Z A;  5STD A;  2JDI H;  4KFF A;  1OF5 B;  4LZI A;  3O8Y A;  3GAX A;  2SBL A;  3EHC A;  1O7M B;  2V1L A;  1BSA A;  2CHC A;  1X1W A;  2LQV A;  8RNT A;  1FUS A;  5A0O B;  3I56 3;  1MWS A;  1VQM 3;  1W02 A;  3GZR A;  2XFT A;  1G02 A;  3CCV 3;  3F8X A;  3NQZ A;  2CFW A;  1IV9 A;  2HMM B;  2K3D A;  1RKY A;  1M9G A;  3V92 A;  4LEH A;  2H0H A;  2SAR A;  4WFO A;  1GOV A;  3OWS A;  4FR9 A;  2MC8 A;  1RGC A;  1UI8 A;  3BU4 A;  1IQX A;  1ZX2 A;  2Y74 A;  3LYG A;  5IG4 A;  2KCD A;  1ISK A;  3M8C A;  1PFP A;  4XDV A;  1VQP 3;  1US1 A;  3G16 A;  4GB5 A;  1GS3 A;  1QAF A;  5IF6 A;  1Q42 A;  1NWW A;  3D4A A;  1GY5 A;  3T8N A;  4R9L A;  1MWU A;  1HYF A;  3KKG A;  3PXM A;  3Q2P A;  3NX0 A;  1JN5 A;  1AVL A;  2AAE A;  2IY2 A;  2XGN A;  1OPY A;  1B2M A;  1FUT A;  1DET A;  1BAO A;  3UL5 A;  3SED A;  1L5G B;  1IYY A;  1X1U A;  1OAC A;  3S27 A;  1MOL A;  3NBJ A;  1E3R A;  3GZX B;  2IYJ A;  2QIY A;  5TGN A;  3X41 A;  5CF2 A;  2HMK B;  5M1A A;  2FNQ A;  1MGW A;  3HIG A;  1UCI A;  1AQZ A;  5LC7 A;  3F7S A;  3K63 A;  1BUJ A;  4MJD A;  1X1Y A;  2GBW B;  1RLS A;  4L7K A;  2W04 A;  1ASK A;  5AEW B;  1HZ1 A;  4EV2 A;  3RGA A;  1Z1S A;  2ZA4 A;  4KFE A;  5G1L A;  3D5G A;  3KZT A;  1JB4 A;  1JZO A;  2GEY A;  3FF2 A;  1BSC A;  1A67 A;  3SOY A;  2ZL8 A;  1A90 A;  3B4P A;  5BU4 A;  1SQW A;  1JKG B;  4L8P A;  1SJW A;  4BTW A;  2OCT A;  4O2H A;  3Q3F A;  2CKF B;  2QGU A;  2Z6B A;  3QK9 A;  3U1W A;  1JJ2 2;  3D79 A;  2OTJ 3;  1I0V A;  2F86 B;  4N6T A;  1M1K 4;  1DVD A;  4FMC A;  3FH1 A;  2CH9 A;  4H61 A;  3A5E A;  3PGB A;  2C4B A;  5BXQ A;  3G4S 3;  3JUO A;  3WMD A;  1K41 A;  1GMR A;  2W9P A;  1UI7 A;  4HM1 B;  3KSE D;  1YVS A;  1RRL A;  1T2H A;  3HK4 A;  4NRE A;  2OWP A;  3L0R A;  1QVG 2;  5CLK A;  3WR2 A;  3DXO A;  1BRI A;  1RTU A;  1N9J A;  2GEX A;  3FKA A;  4HM8 B;  2F4Y A;  2CG0 A;  1LOY A;  1BVI A;  1K73 4;  2C11 A;  1G0T A;  1TFK A;  3MWZ A;  3CCJ 3;  3Q90 A;  1Q82 4;  1W6C A;  3ROB A;  1CQS A;  1V74 A;  4HVN A;  1JNQ A;  2LYX A;  6RNT A;  1NDO B;  2KF4 A;  1Q86 4;  1LNI A;  1UCK A;  2GSP A;  3X3Z A;  1N8R 4;  3OWY A;  3SLU A;  1BAN A;  4JF8 A;  1BOX A;  1IVV A;  3KN4 A;  4STD A;  1R4C A;  1UCJ A;  1W6Y A;  4HM3 B;  5JPP A;  1U5O A;  2MF7 A;  1BNI A;  1W6G A;  5G2G A;  2RSX A;  3A76 A;  1MNL A;  2L4V A;  2UX0 A;  3KFQ C;  3K5T A;  1JBS A;  3K0Z A;  3ER7 A;  2E2V A;  5KP4 A;  3CCM 3;  2CW9 A;  3I0Y A;  3T8U A;  1UDI I;  2O3O A;  3CC4 3;  3UL6 A;  1VQN 3;  4HZ9 B;  1EA2 A;  3HX8 A;  1YJN 3;  3F7X A;  2KRT A; 
#chains in the Genus database with same CATH homology
 1BU4 A;  1UCL A;  1T2I A;  4J5G A;  7RNT A;  1BRH A;  1I2F A;  1B27 A;  1LOV A;  1RGE A;  2SAR A;  3AGN A;  1GOV A;  1GOU A;  1YNV X;  1I2E A;  2KF3 A;  1RGC A;  3BU4 A;  2AAD A;  5BIR A;  1GSP A;  1MGR A;  1B20 A;  3AHS A;  1I3F A;  1RMS A;  1SAR A;  1PY3 A;  3D4A A;  1CH0 A;  5RNT A;  1HYF A;  3HOH A;  1B2S A;  2AAE A;  3BIR A;  6GSP A;  1I3I A;  1FUT A;  1DET A;  1B2M A;  1BAO A;  3RNT A;  2F5W A;  1RCL A;  3WHO A;  1X1U A;  1ZGX A;  1IYY A;  3DH2 A;  1X1X A;  1B21 A;  1JBR A;  3GSP A;  2F5M A;  3SYU A;  1MGW A;  1UCI A;  1TTO A;  1AQZ A;  4RNT A;  1BUJ A;  1X1Y A;  3KCH A;  1RLS A;  1RGL A;  1DE3 A;  1BGS A;  1RGK A;  1GMQ A;  2RBI A;  1HZ1 A;  2ZA4 A;  5HOH A;  3D5G A;  1BSC A;  1AY7 A;  1BSE A;  3DGY A;  5BU4 A;  2KF5 A;  1A2P A;  1FW7 A;  1RGF A;  3Q3F A;  1Q9E A;  1BNF A;  1BRJ A;  2BIR A;  1I0V A;  1BSB A;  1RGA A;  1RGH A;  2BU4 A;  3A5E A;  2C4B A;  1BNE A;  1GMP A;  1GMR A;  2F56 A;  1BIR A;  1TRQ A;  1RHL A;  1JBT A;  1YVS A;  1T2H A;  1I0X A;  3AHW A;  1RDS A;  4HAA A;  1RCK A;  1PYL A;  1R4Y A;  1LRA A;  3WR2 A;  1BRI A;  1RTU A;  1C54 A;  2F4Y A;  1LOY A;  1BVI A;  5GSP A;  1BRS A;  4J5K A;  6RNT A;  1B2U A;  1BNG A;  1B2X A;  1LNI A;  1UCK A;  2GSP A;  1RNT A;  2KF4 A;  4HOH A;  2HOH A;  1BAN A;  1BNR A;  1I70 A;  7GSP A;  1RN4 A;  1FYS A;  1BOX A;  2KAA A;  1I2G A;  1BSD A;  2KF6 A;  1B2Z A;  1UCJ A;  1FZU A;  9RNT A;  1LOW A;  1YGW A;  2RNT A;  1BNS A;  1BNI A;  1TRP A;  3D5I A;  1RSN A;  3AGO A;  4GHO A;  1JBS A;  1BRK A;  4GSP A;  1RNB A;  1RGG A;  1I8V A;  3URP A;  1BSA A;  1B3S A;  4BIR A;  1X1W A;  4BU4 A;  8RNT A;  1GOY A;  1FUS A;  1RN1 A;  1BRN L;  1G02 A;  1BNJ A;  1BRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...