1BU4A

Ribonuclease 1 complex with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bu4A00
1GOVA 1I3IA 1JBTA 1B2UA 1BNJA 1HZ1A 1YNVX 2HOHA 1RLSA 2BIRA 1B27A 1BRNL 2F56A 5GSPA 1AQZA 2RBIA 3D5IA 4GHOA 1BNSA 3AHSA 1BRGA 1FYSA 1FW7A 1RMSA 1R4YA 1RGGA 1RCLA 4BU4A 2KF4A 1BSAA 3GSPA 1MGWA 8RNTA 1I2GA 3KCHA 1SARA 1JBSA 1RHLA 1RSNA 3AGOA 2F5WA 4J5GA 1BANA 1GSPA 1HYFA 1RGCA 5HOHA 1BSEA 1BUJA 1YVSA 1LOVA 3BU4A 1BAOA 1B2ZA 1DETA 5RNTA 1RGEA 1X1UA 1B2SA 5BU4A 5BIRA 3BIRA 7RNTA 1MGRA 1BRSA 1B2XA 2RNTA 1BNGA 9RNTA 3WR2A 1T2HA 7GSPA 1X1WA 4HOHA 1AY7A 1BRIA 1YGWA 2KF3A 1G02A 1BNFA 1ZGXA 1RNTA 3AHWA 6GSPA 1FZUA 1I0VA 3URPA 1PY3A 1X1YA 1CH0A 1RN1A 3DH2A 1RDSA 3Q3FA 1JBRA 1BOXA 1I2FA 1I70A 1A2PA 1B21A 1RGAA 2C4BA 1IYYA 1GMPA 6RNTA 3SYUA 4RNTA 1RTUA 1BNRA 1BNIA 1GOUA 1RGFA 1B3SA 1FUTA 1I2EA 2BU4A 1BSCA 1GOYA 1RN4A 2F4YA 4HAAA 1UCJA 1LRAA 1LOWA 2AADA 3WHOA 4GSPA 1BSDA 1BRHA 3A5EA 1TRQA 3D4AA 2KAAA 1BVIA 2KF5A 1I8VA 2GSPA 1BSBA 3DGYA 1Q9EA 3AGNA 1GMQA 3RNTA 1T2IA 1TTOA 4BIRA 1RCKA 1BRKA 2F5MA 2KF6A 1GMRA 1UCLA 1I3FA 1UCIA 1B20A 1LOYA 1I0XA 1UCKA 3HOHA 4J5KA 1PYLA 1TRPA 1B2MA 1X1XA 1RGKA 2AAEA 1BIRA 1BU4A 1BNEA 1RGHA 1FUSA 1BRJA 1LNIA 2SARA 1RNBA 1RGLA 1BGSA 3D5GA 1C54A 2ZA4A 1DE3A
chains in the Genus database with same CATH superfamily
1GOVA 2CX0A 3DGMA 1JBTA 1B2UA 2XF3A 1HZ1A 1YNVX 2HOHA 1RLSA 1RN7A 1UGHI 4IIAA 4LEHA 3BNDA 3STDA 1B27A 3RDEA 2BMRB 1D6UA 4WYKB 1O7GB 4WYKA 3NQYA 1UI8A 3D5IA 3LH4A 3EN1B 1EA2A 1BRGA 1A67A 2KCDA 2YX9A 5DREA 1RMSA 2O3OA 1R4YA 4H61A 4HZBB 4RBNA 4BL3A 1T5YA 2C10A 4HM4B 1VQL3 5IG3A 4IT7A 2Y73A 4OK0A 1TFOA 3QK9A 1I2GA 3KCHA 4R80A 2HMJB 4LGQA 4RNZA 5CLKA 1Y4KA 2OTJ3 3PXMA 4EC6A 1RSNA 2K3DA 5M18A 1IVUA 1HYFA 2CFDA 2HMKB 4XM4A 1BUJA 1EQKA 1V57A 5AYRB 1LOVA 1CEWI 1BAOA 1DVDA 1IVXA 2CHCA 2ZDJA 1FGRA 3Q1CA 4LZIA 1IV7A 3MG1A 1VQ63 3K0ZA 5AEUB 1KSIA 2E2TA 3NM7A 4FCZA 2FGTA 3KIIA 1BRSA 1B2XA 4K1UA 5LC6A 2W9PA 3V99A 3VF1A 3N8BA 3LT9A 2YFLB 3KKGA 5AI1A 2XH9A 1S723 2GEXA 4XBXA 1C7HA 1GD3A 5KP4A 3FG4A 1O7NB 3I553 2W56B 1F8NA 1FGMA 3GZRA 2W56A 1AY7A 3JUQA 4AKZA 1OHPA 2B24B 1VQM3 1IU7A 1YVBI 2OQEC 3FH1A 1J2BA 1LVNA 4WFOA 1E97A 2Q07A 4PEJA 1GYBA 1G0TA 4RZMA 2INXA 1VQ53 4AKYA 4WP5A 1CYUA 1RDSA 1T3BA 2CH9A 3Q3FA 2W04A 1I2FA 3LTDA 1JNQA 1NDOB 4O2HA 4OVMA 1RGAA 2QGUA 1GS3A 4FMDA 4HM6B 5A0OB 6RNTA 3TDGA 3D3LA 4R9KA 1ASKA 1JJ22 2XEPA 1RGFA 2QEX3 2LYXA 1LNHA 1MWTA 4LYLB 1GY7A 3PGBA 4O02B 3EJVA 4O3VA 4GB5A 1NJI4 1W02A 2BHMA 1DVCA 5CXOA 5STDA 2CG1A 1CYVA 2QA43 1BRHA 2E2VA 2XGNA 4WWUC 4CJNA 5KP1A 1ZO2A 1FGOA 2B1XB 4CPKA 3G6E3 3DGYA 3AGNA 1GMQA 3O8YA 3CU3A 2P05A 4BIRA 3ER7A 3DGNA 1Q824 1VQ83 2BMOB 2L4VA 1NB3I 5G2GA 4KFDA 5IEPA 1G96A 3ECFA 3PCSA 6STDA 2OCTA 4N6MA 1LOYA 1TUHA 3B4PA 1W2ZA 1WQLB 1WTHA 2WOHA 3MWZA 4N6NB 4BL2A 5BVBA 3EN8A 4FMAA 1OUNA 3CXC2 1SIIA 4HM7B 3CCR3 1JZOA 2PNCA 3MPHA 4XDWA 2XR8B 3RGRA 1RGHA 1LNIA 2CFWA 1RGLA 1RNBA 2J8XB 2HMLB 3I0YA 1TP6A 1BGSA 4JRFA 2GBWB 2D1WA 4GSPA 1WNHA 1E3VA 1MOLA 1BNJA 2SBLA 3WOFB 1AV4A 4K90B 2MF7A 3MG3A 3BB9A 4I4KA 4U13A 1LQGC 1KWIA 3S29A 1RJOA 3UL6A 5M19A 3X41A 1M904 2F56A 4RNYA 1DMNA 1M9GA 1TJDA 3GZXB 3K7CA 1S5AA 1AQZA 3SEDA 1RRLA 4GHOA 1LXEA 1QALA 1BNSA 1EEJA 3AHSA 3K5TA 3WODG 3J7Yd 4L7KA 8CHOA 4XBYA 1Z1SA 1IT8A 3T8UA 1RCLA 3HZPA 5AIFA 4BU4A 2HMNB 1MWSA 2P0MA 3EBYA 3N9HA 2KF4A 3GSPA 2F99A 3T8NA 1OACA 3DM8A 4TX4A 5AIIA 1HU9A 4O8SA 5D82A 1W01A 4J8TA 5G1KA 3OWSA 1W6CA 2OOVC 3SLUA 3CCJ3 4DKIA 2F98A 1BANA 4BTXA 4EW5A 2V1LA 4EBGA 3QRDA 1JRQA 3PCRA 4CDLA 3KSPA 3CC43 1RGEA 2I9WA 3LMLA 2CC3A 1YJ93 1Q864 3MSOA 1UI7A 3OX9A 3BIRA 1MGRA 1US1A 1QVG2 1JKGB 5CK6A 5IG5A 1JKGA 1M1XB 3Q90A 4R9LA 9RNTA 1T2HA 2Y74A 1X1WA 4HOHA 5KP3A 1SQWA 1STDA 2ML5A 3U1WA 1RKYA 3VSYA 3LT8A 1ZGXA 3AHWA 3EX9A 4KZ1A 2RFRA 2XSOB 1DMQA 3URPA 1PY3A 5IEOA 2ZHXB 3OWYA 3K63A 5EVHA 3KFQC 1RN1A 5JBSA 4IPBA 7STDA 2ZA4A 3LOYA 4GL6A 1BOXA 4X2OA 1JBRA 1VQ43 3S67A 1A2PA 1ULJB 3H3HA 3WA3A 1GMPA 2K0MA 3KN4A 3SYUA 4R4KA 4BTWA 5IERA 2RSXA 4NPBA 4J9AA 2M7OA 1I2EA 3D79A 3KZTA 3NM2A 3UB1A 2PZVA 4HAAA 3OV4A 4ORLA 1LRAA 1O7WB 1LOWA 3F9SA 1BSDA 4FCMA 2CWUA 1UUGB 3PYJA 3HX8A 1TRQA 1Q40B 1KC84 2WGQA 5IG4A 1Q40A 2KRTA 1D6YA 5D81A 1DMMA 1BSBA 1KD14 1Q9EA 1ROVA 3F8XA 2UUGC 3AMOB 4KVHA 1JV2B 3AMOA 2BO9B 1RCKA 2GBXB 1O7PB 3DXOA 2KF6A 1AVKA 1N9EA 1UCIA 4ILFA 2CG0A 2O9UX 3WOEB 1B20A 1N5PA 3B8LA 1YJW3 1ISKA 1UCKA 3HOHA 4J5KA 1IQ8A 1PYLA 2CWVA 1YIJ3 4HZ9B 4HKVB 1R4CA 1GY6A 4KFFA 2HMOB 2Z7AA 2OQEA 3SXXA 4Q53A 1Q814 4STDA 3G8ZA 1NU3A 5HGRA 2IMJA 1U8CB 2WOFA 3SOYA 2W6JH 1NB5I 3EBTA 4N3VA 1DE3A 1Q7HA 4MJDA 3X42A 1I3IA 1QVF2 3OW22 1NNVA 2BIRA 4HM2B 2D42A 1IK3A 1A2VA 2CX1A 4OUQA 3CCS3 3NQZA 1W2B2 4HBRA 2CK3H 2IY2A 2UX0A 3IPTA 3FLJA 1BRNL 5GSPA 2W2CA 2P09A 1OF5B 2RBIA 1OF5A 1WMOA 1FW7A 2Z6BA 1STFI 3CCE3 3LXUX 2UGIA 3UJMA 1N5HA 3ZG5A 3JUPA 2GXFA 1IT7A 8RNTA 3FZWA 1NWWA 3HK4A 4XBTA 3CME3 1FGQA 1JBSA 3LTAA 1RHLA 5M1AA 1YGEA 3CCV3 4QWTA 3F40A 4J5GA 2F5WA 2KXGA 3SX1A 1GSPA 5HOHA 3CNMA 1VQ73 4L8OA 2STDA 4NHFA 3FKAA 3G0KA 3E99A 5AYSC 1D6ZA 3S27A 1HKXA 5RNTA 2C11A 1IVWA 1B2SA 1EUIC 3MHEA 1OH0A 3DUKA 1E3RA 5BU4A 3G4S3 7RNTA 2OTL3 1WMNA 4N6TA 4BTYA 1YI23 2RNTA 4FMBA 3X40A 2BMQB 3UNLA 4AEQA 3DGLA 1TIJA 7GSPA 3L0RA 1A90A 1FA3A 3JUNA 2CFGA 4G1MB 3MKIA 3F7SA 3HI7A 1BRIA 1YGWA 2KF3A 4FR9A 1G02A 1UUWB 1BNFA 1ZS7A 2LQVA 1DYUA 1K734 1KQS2 3FSDA 4I5QA 1MWRA 1JN5B 1I0VA 1OPYA 1VQ93 1JN5A 2CW9A 4HYZA 5G1LA 2CFLA 2R41A 1CH0A 2W9QA 1SJWA 2IUKA 4XDVA 2F86B 5CF1A 2L1SA 3DY5A 1A2KA 2E2UA 5BXQA 3X3XA 1UW1A 2C4BA 3DMCA 3F8HA 1N8R4 1OHOA 3X3YA 4KFEA 4RNTA 2H0HA 1W6YA 1BNIA 3M8CA 1GOUA 5JPUA 3CMA3 1EKMA 1ULIB 2XFSA 2ZL8A 1AVLA 4CCVA 1OCVA 1SPUA 4LSOA 1JB4A 1GOYA 1O7MB 2QIYA 2OOVA 1K9M4 1PFPA 1RN4A 2F4YA 1FUWA 1UCJA 3FF0A 3WDGB 2JDIH 2YFJB 5JPPA 1O7HB 2KAAA 3JVCA 2KF5A 5IENA 1IV9A 3FG3A 2GSPA 3H51A 3BNCA 2H0IA 3WMDA 3RGAA 1TTOA 3MG2A 4ZM8A 4HM8B 1BRKA 1AR0A 2F5MA 2RGQA 3F7XA 1UDII 1VZZA 3CCM3 4MMXB 2CKFB 3JUMA 1JB5A 4HVNA 3Q2PA 3NV0B 1TRPA 1B2MA 3KE7A 3NV0A 2WO0A 3N54B 5D83A 2XGLA 1RGKA 2AAEA 3OXAA 3NX0A 5ELJA 1YJN3 1BU4A 3VGNA 3LZAA 2SARA 1BRJA 1VQK3 3BLZA 1NO3A 4N6V0 2GEYA 4WHAA 1C54A 5ELUA 2H0GA 1VQQA 3ZFZA 2A15A 4K61A 2BNGA 3IMAB 2Z76A 3LTCA 1WMPA 1ZX2A 1GD4A 3GZYB 3ZG0A 3BNEA 1IQXA 2XRXB 3F14A 4LMIA 1YHQ3 1OGZA 1K28A 3CD63 1GY5A 2K54A 1FYSA 2XSHB 4EV2A 4FCJA 3DGOA 3FGYA 1RGGA 3FCSB 4N6UA 2Z77A 1BSAA 2CWTA 1U5OA 1MGWA 3CC73 3G16A 2HMMB 4H3UA 1SARA 3U97A 3MYTA 3CCU3 1VQO3 1Q7Y4 3AGOA 3JUOA 1RGCA 1VQN3 1IQYA 1BSEA 2IYJA 3G713 5DRVA 1QMAA 4HM1B 1YVSA 1L5GB 3T0UA 3BU4A 1B2ZA 5EQLA 1DETA 3GWRA 3OWUA 1X1UA 2P38A 1OHSA 1V58A 2W03A 4MMYB 3SVAA 5BIRA 1JB2A 3BNBA 5AEWB 3WA2X 3SOAA 1M1K4 1BNGA 4HM3B 4XB5A 1QAKA 3EB8A 1QAFA 3WR2A 3CCL3 3UL5A 3FG1A 5AIHA 3PS8A 2YFIB 4FMCA 2WGOA 4EXRA 5I97A 1RRHA 1N9JA 2P0XA 1N8QA 3A76A 2MC8A 2JQ5A 3ALAA 1RNTA 4HJLB 3CPW2 1YIT3 6GSPA 3NBJA 1PU4A 3LYGA 1FZUA 5AIGA 3NUVA 2CIUA 2R4IA 1X1YA 3B7CA 3DH2A 3EHCA 3B4OA 2ML6A 4L8PA 5IG0A 5TGNA 2IUJA 1VQP3 1SIHA 1W4NA 2FXTA 3S5CA 5IW9A 1I70A 1Q42A 4HM0B 1B21A 2IA7A 1IYYA 2FNQA 3GAXA 1LOXA 1RTUA 1UGIA 1BNRA 2GU1A 4KT3B 1ROAA 3V98A 3I563 1B3SA 2W0QA 1FUTA 1W6GA 1CQSA 1QJGA 4NREA 4MMZB 2BU4A 1BSCA 4R1KA 5FW5A 1UUVB 3GZBA 1K41A 3NBRA 1IDPA 4K1VA 4EYCA 5CF2A 3EE1A 2AADA 3WHOA 3HIGA 1TU5A 2BT3A 4N6LA 3A5EA 4JF8A 3D4AA 1MNLA 4MEIA 1BVIA 1I8VA 3CC23 3ROBA 4EV5A 1EG9B 3RNTA 1OGXA 1T2IA 3HIIA 1K8A4 2CFKA 2RCDA 1IVVA 4HM5B 5IF6A 3CCQ3 1FGTA 1GMRA 1UCLA 5FGOA 3LTBA 1I3FA 1LQMB 1W00A 3DZLA 3IJEB 4N6OB 3X3ZA 2OWPA 4X2HA 1I0XA 3KSED 3NHXA 1TFKA 3EQQB 3S28A 3V92A 1X1XA 1W5ZA 2XFTA 3GRDA 1MWUA 3CNXA 3CPOA 3PZWA 3D9RA 3EF8A 3NBBA 3NXJA 1BIRA 1BNEA 2GU3A 1FUSA 5LC7A 1W7CA 1JZDA 3FF2A 1BUQA 3K9MC 3D5GA 1V74A 3EC9A 5EEOA
chains in the Genus database with same CATH topology
1GOVA 1I3IA 1JBTA 1B2UA 1BNJA 1HZ1A 1YNVX 2HOHA 1RLSA 2BIRA 1B27A 1BRNL 2F56A 5GSPA 1AQZA 2RBIA 3D5IA 4GHOA 1BNSA 3AHSA 1BRGA 1FYSA 1FW7A 1RMSA 1R4YA 1RGGA 1RCLA 4BU4A 2KF4A 1BSAA 3GSPA 1MGWA 8RNTA 1I2GA 3KCHA 1SARA 1JBSA 1RHLA 1RSNA 3AGOA 2F5WA 4J5GA 1BANA 1GSPA 1HYFA 1RGCA 5HOHA 1BSEA 1BUJA 1YVSA 1LOVA 3BU4A 1BAOA 1B2ZA 1DETA 5RNTA 1RGEA 1X1UA 1B2SA 5BU4A 5BIRA 3BIRA 7RNTA 1MGRA 1BRSA 1B2XA 2RNTA 1BNGA 9RNTA 3WR2A 1T2HA 7GSPA 1X1WA 4HOHA 1AY7A 1BRIA 1YGWA 2KF3A 1G02A 1BNFA 1ZGXA 1RNTA 3AHWA 6GSPA 1FZUA 1I0VA 3URPA 1PY3A 1X1YA 1CH0A 1RN1A 3DH2A 1RDSA 3Q3FA 1JBRA 1BOXA 1I2FA 1I70A 1A2PA 1B21A 1RGAA 2C4BA 1IYYA 1GMPA 6RNTA 3SYUA 4RNTA 1RTUA 1BNRA 1BNIA 1GOUA 1RGFA 1B3SA 1FUTA 1I2EA 2BU4A 1BSCA 1GOYA 1RN4A 2F4YA 4HAAA 1UCJA 1LRAA 1LOWA 2AADA 3WHOA 4GSPA 1BSDA 1BRHA 3A5EA 1TRQA 3D4AA 2KAAA 1BVIA 2KF5A 1I8VA 2GSPA 1BSBA 3DGYA 1Q9EA 3AGNA 1GMQA 3RNTA 1T2IA 1TTOA 4BIRA 1RCKA 1BRKA 2F5MA 2KF6A 1GMRA 1UCLA 1I3FA 1UCIA 1B20A 1LOYA 1I0XA 1UCKA 3HOHA 4J5KA 1PYLA 1TRPA 1B2MA 1X1XA 1RGKA 2AAEA 1BIRA 1BU4A 1BNEA 1RGHA 1FUSA 1BRJA 1LNIA 2SARA 1RNBA 1RGLA 1BGSA 3D5GA 1C54A 2ZA4A 1DE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOV A;  1I3I A;  1JBT A;  1B2U A;  1BNJ A;  1HZ1 A;  1YNV X;  2HOH A;  1RLS A;  2BIR A;  1B27 A;  1BRN L;  2F56 A;  5GSP A;  1AQZ A;  2RBI A;  3D5I A;  4GHO A;  1BNS A;  3AHS A;  1BRG A;  1FYS A;  1FW7 A;  1RMS A;  1R4Y A;  1RGG A;  1RCL A;  4BU4 A;  2KF4 A;  1BSA A;  3GSP A;  1MGW A;  8RNT A;  1I2G A;  3KCH A;  1SAR A;  1JBS A;  1RHL A;  1RSN A;  3AGO A;  2F5W A;  4J5G A;  1BAN A;  1GSP A;  1HYF A;  1RGC A;  5HOH A;  1BSE A;  1BUJ A;  1YVS A;  1LOV A;  3BU4 A;  1BAO A;  1B2Z A;  1DET A;  5RNT A;  1RGE A;  1X1U A;  1B2S A;  5BU4 A;  5BIR A;  3BIR A;  7RNT A;  1MGR A;  1BRS A;  1B2X A;  2RNT A;  1BNG A;  9RNT A;  3WR2 A;  1T2H A;  7GSP A;  1X1W A;  4HOH A;  1AY7 A;  1BRI A;  1YGW A;  2KF3 A;  1G02 A;  1BNF A;  1ZGX A;  1RNT A;  3AHW A;  6GSP A;  1FZU A;  1I0V A;  3URP A;  1PY3 A;  1X1Y A;  1CH0 A;  1RN1 A;  3DH2 A;  1RDS A;  3Q3F A;  1JBR A;  1BOX A;  1I2F A;  1I70 A;  1A2P A;  1B21 A;  1RGA A;  2C4B A;  1IYY A;  1GMP A;  6RNT A;  3SYU A;  4RNT A;  1RTU A;  1BNR A;  1BNI A;  1GOU A;  1RGF A;  1B3S A;  1FUT A;  1I2E A;  2BU4 A;  1BSC A;  1GOY A;  1RN4 A;  2F4Y A;  4HAA A;  1UCJ A;  1LRA A;  1LOW A;  2AAD A;  3WHO A;  4GSP A;  1BSD A;  1BRH A;  3A5E A;  1TRQ A;  3D4A A;  2KAA A;  1BVI A;  2KF5 A;  1I8V A;  2GSP A;  1BSB A;  3DGY A;  1Q9E A;  3AGN A;  1GMQ A;  3RNT A;  1T2I A;  1TTO A;  4BIR A;  1RCK A;  1BRK A;  2F5M A;  2KF6 A;  1GMR A;  1UCL A;  1I3F A;  1UCI A;  1B20 A;  1LOY A;  1I0X A;  1UCK A;  3HOH A;  4J5K A;  1PYL A;  1TRP A;  1B2M A;  1X1X A;  1RGK A;  2AAE A;  1BIR A;  1BU4 A;  1BNE A;  1RGH A;  1FUS A;  1BRJ A;  1LNI A;  2SAR A;  1RNB A;  1RGL A;  1BGS A;  3D5G A;  1C54 A;  2ZA4 A;  1DE3 A; 
#chains in the Genus database with same CATH topology
 1GOV A;  2CX0 A;  3DGM A;  1JBT A;  1B2U A;  2XF3 A;  1HZ1 A;  1YNV X;  2HOH A;  1RLS A;  1RN7 A;  1UGH I;  4IIA A;  4LEH A;  3BND A;  3STD A;  1B27 A;  3RDE A;  2BMR B;  1D6U A;  4WYK B;  1O7G B;  4WYK A;  3NQY A;  1UI8 A;  3D5I A;  3LH4 A;  3EN1 B;  1EA2 A;  1BRG A;  1A67 A;  2KCD A;  2YX9 A;  5DRE A;  1RMS A;  2O3O A;  1R4Y A;  4H61 A;  4HZB B;  4RBN A;  4BL3 A;  1T5Y A;  2C10 A;  4HM4 B;  1VQL 3;  5IG3 A;  4IT7 A;  2Y73 A;  4OK0 A;  1TFO A;  3QK9 A;  1I2G A;  3KCH A;  4R80 A;  2HMJ B;  4LGQ A;  4RNZ A;  5CLK A;  1Y4K A;  2OTJ 3;  3PXM A;  4EC6 A;  1RSN A;  2K3D A;  5M18 A;  1IVU A;  1HYF A;  2CFD A;  2HMK B;  4XM4 A;  1BUJ A;  1EQK A;  1V57 A;  5AYR B;  1LOV A;  1CEW I;  1BAO A;  1DVD A;  1IVX A;  2CHC A;  2ZDJ A;  1FGR A;  3Q1C A;  4LZI A;  1IV7 A;  3MG1 A;  1VQ6 3;  3K0Z A;  5AEU B;  1KSI A;  2E2T A;  3NM7 A;  4FCZ A;  2FGT A;  3KII A;  1BRS A;  1B2X A;  4K1U A;  5LC6 A;  2W9P A;  3V99 A;  3VF1 A;  3N8B A;  3LT9 A;  2YFL B;  3KKG A;  5AI1 A;  2XH9 A;  1S72 3;  2GEX A;  4XBX A;  1C7H A;  1GD3 A;  5KP4 A;  3FG4 A;  1O7N B;  3I55 3;  2W56 B;  1F8N A;  1FGM A;  3GZR A;  2W56 A;  1AY7 A;  3JUQ A;  4AKZ A;  1OHP A;  2B24 B;  1VQM 3;  1IU7 A;  1YVB I;  2OQE C;  3FH1 A;  1J2B A;  1LVN A;  4WFO A;  1E97 A;  2Q07 A;  4PEJ A;  1GYB A;  1G0T A;  4RZM A;  2INX A;  1VQ5 3;  4AKY A;  4WP5 A;  1CYU A;  1RDS A;  1T3B A;  2CH9 A;  3Q3F A;  2W04 A;  1I2F A;  3LTD A;  1JNQ A;  1NDO B;  4O2H A;  4OVM A;  1RGA A;  2QGU A;  1GS3 A;  4FMD A;  4HM6 B;  5A0O B;  6RNT A;  3TDG A;  3D3L A;  4R9K A;  1ASK A;  1JJ2 2;  2XEP A;  1RGF A;  2QEX 3;  2LYX A;  1LNH A;  1MWT A;  4LYL B;  1GY7 A;  3PGB A;  4O02 B;  3EJV A;  4O3V A;  4GB5 A;  1NJI 4;  1W02 A;  2BHM A;  1DVC A;  5CXO A;  5STD A;  2CG1 A;  1CYV A;  2QA4 3;  1BRH A;  2E2V A;  2XGN A;  4WWU C;  4CJN A;  5KP1 A;  1ZO2 A;  1FGO A;  2B1X B;  4CPK A;  3G6E 3;  3DGY A;  3AGN A;  1GMQ A;  3O8Y A;  3CU3 A;  2P05 A;  4BIR A;  3ER7 A;  3DGN A;  1Q82 4;  1VQ8 3;  2BMO B;  2L4V A;  1NB3 I;  5G2G A;  4KFD A;  5IEP A;  1G96 A;  3ECF A;  3PCS A;  6STD A;  2OCT A;  4N6M A;  1LOY A;  1TUH A;  3B4P A;  1W2Z A;  1WQL B;  1WTH A;  2WOH A;  3MWZ A;  4N6N B;  4BL2 A;  5BVB A;  3EN8 A;  4FMA A;  1OUN A;  3CXC 2;  1SII A;  4HM7 B;  3CCR 3;  1JZO A;  2PNC A;  3MPH A;  4XDW A;  2XR8 B;  3RGR A;  1RGH A;  1LNI A;  2CFW A;  1RGL A;  1RNB A;  2J8X B;  2HML B;  3I0Y A;  1TP6 A;  1BGS A;  4JRF A;  2GBW B;  2D1W A;  4GSP A;  1WNH A;  1E3V A;  1MOL A;  1BNJ A;  2SBL A;  3WOF B;  1AV4 A;  4K90 B;  2MF7 A;  3MG3 A;  3BB9 A;  4I4K A;  4U13 A;  1LQG C;  1KWI A;  3S29 A;  1RJO A;  3UL6 A;  5M19 A;  3X41 A;  1M90 4;  2F56 A;  4RNY A;  1DMN A;  1M9G A;  1TJD A;  3GZX B;  3K7C A;  1S5A A;  1AQZ A;  3SED A;  1RRL A;  4GHO A;  1LXE A;  1QAL A;  1BNS A;  1EEJ A;  3AHS A;  3K5T A;  3WOD G;  3J7Y d;  4L7K A;  8CHO A;  4XBY A;  1Z1S A;  1IT8 A;  3T8U A;  1RCL A;  3HZP A;  5AIF A;  4BU4 A;  2HMN B;  1MWS A;  2P0M A;  3EBY A;  3N9H A;  2KF4 A;  3GSP A;  2F99 A;  3T8N A;  1OAC A;  3DM8 A;  4TX4 A;  5AII A;  1HU9 A;  4O8S A;  5D82 A;  1W01 A;  4J8T A;  5G1K A;  3OWS A;  1W6C A;  2OOV C;  3SLU A;  3CCJ 3;  4DKI A;  2F98 A;  1BAN A;  4BTX A;  4EW5 A;  2V1L A;  4EBG A;  3QRD A;  1JRQ A;  3PCR A;  4CDL A;  3KSP A;  3CC4 3;  1RGE A;  2I9W A;  3LML A;  2CC3 A;  1YJ9 3;  1Q86 4;  3MSO A;  1UI7 A;  3OX9 A;  3BIR A;  1MGR A;  1US1 A;  1QVG 2;  1JKG B;  5CK6 A;  5IG5 A;  1JKG A;  1M1X B;  3Q90 A;  4R9L A;  9RNT A;  1T2H A;  2Y74 A;  1X1W A;  4HOH A;  5KP3 A;  1SQW A;  1STD A;  2ML5 A;  3U1W A;  1RKY A;  3VSY A;  3LT8 A;  1ZGX A;  3AHW A;  3EX9 A;  4KZ1 A;  2RFR A;  2XSO B;  1DMQ A;  3URP A;  1PY3 A;  5IEO A;  2ZHX B;  3OWY A;  3K63 A;  5EVH A;  3KFQ C;  1RN1 A;  5JBS A;  4IPB A;  7STD A;  2ZA4 A;  3LOY A;  4GL6 A;  1BOX A;  4X2O A;  1JBR A;  1VQ4 3;  3S67 A;  1A2P A;  1ULJ B;  3H3H A;  3WA3 A;  1GMP A;  2K0M A;  3KN4 A;  3SYU A;  4R4K A;  4BTW A;  5IER A;  2RSX A;  4NPB A;  4J9A A;  2M7O A;  1I2E A;  3D79 A;  3KZT A;  3NM2 A;  3UB1 A;  2PZV A;  4HAA A;  3OV4 A;  4ORL A;  1LRA A;  1O7W B;  1LOW A;  3F9S A;  1BSD A;  4FCM A;  2CWU A;  1UUG B;  3PYJ A;  3HX8 A;  1TRQ A;  1Q40 B;  1KC8 4;  2WGQ A;  5IG4 A;  1Q40 A;  2KRT A;  1D6Y A;  5D81 A;  1DMM A;  1BSB A;  1KD1 4;  1Q9E A;  1ROV A;  3F8X A;  2UUG C;  3AMO B;  4KVH A;  1JV2 B;  3AMO A;  2BO9 B;  1RCK A;  2GBX B;  1O7P B;  3DXO A;  2KF6 A;  1AVK A;  1N9E A;  1UCI A;  4ILF A;  2CG0 A;  2O9U X;  3WOE B;  1B20 A;  1N5P A;  3B8L A;  1YJW 3;  1ISK A;  1UCK A;  3HOH A;  4J5K A;  1IQ8 A;  1PYL A;  2CWV A;  1YIJ 3;  4HZ9 B;  4HKV B;  1R4C A;  1GY6 A;  4KFF A;  2HMO B;  2Z7A A;  2OQE A;  3SXX A;  4Q53 A;  1Q81 4;  4STD A;  3G8Z A;  1NU3 A;  5HGR A;  2IMJ A;  1U8C B;  2WOF A;  3SOY A;  2W6J H;  1NB5 I;  3EBT A;  4N3V A;  1DE3 A;  1Q7H A;  4MJD A;  3X42 A;  1I3I A;  1QVF 2;  3OW2 2;  1NNV A;  2BIR A;  4HM2 B;  2D42 A;  1IK3 A;  1A2V A;  2CX1 A;  4OUQ A;  3CCS 3;  3NQZ A;  1W2B 2;  4HBR A;  2CK3 H;  2IY2 A;  2UX0 A;  3IPT A;  3FLJ A;  1BRN L;  5GSP A;  2W2C A;  2P09 A;  1OF5 B;  2RBI A;  1OF5 A;  1WMO A;  1FW7 A;  2Z6B A;  1STF I;  3CCE 3;  3LXU X;  2UGI A;  3UJM A;  1N5H A;  3ZG5 A;  3JUP A;  2GXF A;  1IT7 A;  8RNT A;  3FZW A;  1NWW A;  3HK4 A;  4XBT A;  3CME 3;  1FGQ A;  1JBS A;  3LTA A;  1RHL A;  5M1A A;  1YGE A;  3CCV 3;  4QWT A;  3F40 A;  4J5G A;  2F5W A;  2KXG A;  3SX1 A;  1GSP A;  5HOH A;  3CNM A;  1VQ7 3;  4L8O A;  2STD A;  4NHF A;  3FKA A;  3G0K A;  3E99 A;  5AYS C;  1D6Z A;  3S27 A;  1HKX A;  5RNT A;  2C11 A;  1IVW A;  1B2S A;  1EUI C;  3MHE A;  1OH0 A;  3DUK A;  1E3R A;  5BU4 A;  3G4S 3;  7RNT A;  2OTL 3;  1WMN A;  4N6T A;  4BTY A;  1YI2 3;  2RNT A;  4FMB A;  3X40 A;  2BMQ B;  3UNL A;  4AEQ A;  3DGL A;  1TIJ A;  7GSP A;  3L0R A;  1A90 A;  1FA3 A;  3JUN A;  2CFG A;  4G1M B;  3MKI A;  3F7S A;  3HI7 A;  1BRI A;  1YGW A;  2KF3 A;  4FR9 A;  1G02 A;  1UUW B;  1BNF A;  1ZS7 A;  2LQV A;  1DYU A;  1K73 4;  1KQS 2;  3FSD A;  4I5Q A;  1MWR A;  1JN5 B;  1I0V A;  1OPY A;  1VQ9 3;  1JN5 A;  2CW9 A;  4HYZ A;  5G1L A;  2CFL A;  2R41 A;  1CH0 A;  2W9Q A;  1SJW A;  2IUK A;  4XDV A;  2F86 B;  5CF1 A;  2L1S A;  3DY5 A;  1A2K A;  2E2U A;  5BXQ A;  3X3X A;  1UW1 A;  2C4B A;  3DMC A;  3F8H A;  1N8R 4;  1OHO A;  3X3Y A;  4KFE A;  4RNT A;  2H0H A;  1W6Y A;  1BNI A;  3M8C A;  1GOU A;  5JPU A;  3CMA 3;  1EKM A;  1ULI B;  2XFS A;  2ZL8 A;  1AVL A;  4CCV A;  1OCV A;  1SPU A;  4LSO A;  1JB4 A;  1GOY A;  1O7M B;  2QIY A;  2OOV A;  1K9M 4;  1PFP A;  1RN4 A;  2F4Y A;  1FUW A;  1UCJ A;  3FF0 A;  3WDG B;  2JDI H;  2YFJ B;  5JPP A;  1O7H B;  2KAA A;  3JVC A;  2KF5 A;  5IEN A;  1IV9 A;  3FG3 A;  2GSP A;  3H51 A;  3BNC A;  2H0I A;  3WMD A;  3RGA A;  1TTO A;  3MG2 A;  4ZM8 A;  4HM8 B;  1BRK A;  1AR0 A;  2F5M A;  2RGQ A;  3F7X A;  1UDI I;  1VZZ A;  3CCM 3;  4MMX B;  2CKF B;  3JUM A;  1JB5 A;  4HVN A;  3Q2P A;  3NV0 B;  1TRP A;  1B2M A;  3KE7 A;  3NV0 A;  2WO0 A;  3N54 B;  5D83 A;  2XGL A;  1RGK A;  2AAE A;  3OXA A;  3NX0 A;  5ELJ A;  1YJN 3;  1BU4 A;  3VGN A;  3LZA A;  2SAR A;  1BRJ A;  1VQK 3;  3BLZ A;  1NO3 A;  4N6V 0;  2GEY A;  4WHA A;  1C54 A;  5ELU A;  2H0G A;  1VQQ A;  3ZFZ A;  2A15 A;  4K61 A;  2BNG A;  3IMA B;  2Z76 A;  3LTC A;  1WMP A;  1ZX2 A;  1GD4 A;  3GZY B;  3ZG0 A;  3BNE A;  1IQX A;  2XRX B;  3F14 A;  4LMI A;  1YHQ 3;  1OGZ A;  1K28 A;  3CD6 3;  1GY5 A;  2K54 A;  1FYS A;  2XSH B;  4EV2 A;  4FCJ A;  3DGO A;  3FGY A;  1RGG A;  3FCS B;  4N6U A;  2Z77 A;  1BSA A;  2CWT A;  1U5O A;  1MGW A;  3CC7 3;  3G16 A;  2HMM B;  4H3U A;  1SAR A;  3U97 A;  3MYT A;  3CCU 3;  1VQO 3;  1Q7Y 4;  3AGO A;  3JUO A;  1RGC A;  1VQN 3;  1IQY A;  1BSE A;  2IYJ A;  3G71 3;  5DRV A;  1QMA A;  4HM1 B;  1YVS A;  1L5G B;  3T0U A;  3BU4 A;  1B2Z A;  5EQL A;  1DET A;  3GWR A;  3OWU A;  1X1U A;  2P38 A;  1OHS A;  1V58 A;  2W03 A;  4MMY B;  3SVA A;  5BIR A;  1JB2 A;  3BNB A;  5AEW B;  3WA2 X;  3SOA A;  1M1K 4;  1BNG A;  4HM3 B;  4XB5 A;  1QAK A;  3EB8 A;  1QAF A;  3WR2 A;  3CCL 3;  3UL5 A;  3FG1 A;  5AIH A;  3PS8 A;  2YFI B;  4FMC A;  2WGO A;  4EXR A;  5I97 A;  1RRH A;  1N9J A;  2P0X A;  1N8Q A;  3A76 A;  2MC8 A;  2JQ5 A;  3ALA A;  1RNT A;  4HJL B;  3CPW 2;  1YIT 3;  6GSP A;  3NBJ A;  1PU4 A;  3LYG A;  1FZU A;  5AIG A;  3NUV A;  2CIU A;  2R4I A;  1X1Y A;  3B7C A;  3DH2 A;  3EHC A;  3B4O A;  2ML6 A;  4L8P A;  5IG0 A;  5TGN A;  2IUJ A;  1VQP 3;  1SIH A;  1W4N A;  2FXT A;  3S5C A;  5IW9 A;  1I70 A;  1Q42 A;  4HM0 B;  1B21 A;  2IA7 A;  1IYY A;  2FNQ A;  3GAX A;  1LOX A;  1RTU A;  1UGI A;  1BNR A;  2GU1 A;  4KT3 B;  1ROA A;  3V98 A;  3I56 3;  1B3S A;  2W0Q A;  1FUT A;  1W6G A;  1CQS A;  1QJG A;  4NRE A;  4MMZ B;  2BU4 A;  1BSC A;  4R1K A;  5FW5 A;  1UUV B;  3GZB A;  1K41 A;  3NBR A;  1IDP A;  4K1V A;  4EYC A;  5CF2 A;  3EE1 A;  2AAD A;  3WHO A;  3HIG A;  1TU5 A;  2BT3 A;  4N6L A;  3A5E A;  4JF8 A;  3D4A A;  1MNL A;  4MEI A;  1BVI A;  1I8V A;  3CC2 3;  3ROB A;  4EV5 A;  1EG9 B;  3RNT A;  1OGX A;  1T2I A;  3HII A;  1K8A 4;  2CFK A;  2RCD A;  1IVV A;  4HM5 B;  5IF6 A;  3CCQ 3;  1FGT A;  1GMR A;  1UCL A;  5FGO A;  3LTB A;  1I3F A;  1LQM B;  1W00 A;  3DZL A;  3IJE B;  4N6O B;  3X3Z A;  2OWP A;  4X2H A;  1I0X A;  3KSE D;  3NHX A;  1TFK A;  3EQQ B;  3S28 A;  3V92 A;  1X1X A;  1W5Z A;  2XFT A;  3GRD A;  1MWU A;  3CNX A;  3CPO A;  3PZW A;  3D9R A;  3EF8 A;  3NBB A;  3NXJ A;  1BIR A;  1BNE A;  2GU3 A;  1FUS A;  5LC7 A;  1W7C A;  1JZD A;  3FF2 A;  1BUQ A;  3K9M C;  3D5G A;  1V74 A;  3EC9 A;  5EEO A; 
#chains in the Genus database with same CATH homology
 1GOV A;  1I3I A;  1JBT A;  1B2U A;  1BNJ A;  1HZ1 A;  1YNV X;  2HOH A;  1RLS A;  2BIR A;  1B27 A;  1BRN L;  2F56 A;  5GSP A;  1AQZ A;  2RBI A;  3D5I A;  4GHO A;  1BNS A;  3AHS A;  1BRG A;  1FYS A;  1FW7 A;  1RMS A;  1R4Y A;  1RGG A;  1RCL A;  4BU4 A;  2KF4 A;  1BSA A;  3GSP A;  1MGW A;  8RNT A;  1I2G A;  3KCH A;  1SAR A;  1JBS A;  1RHL A;  1RSN A;  3AGO A;  2F5W A;  4J5G A;  1BAN A;  1GSP A;  1HYF A;  1RGC A;  5HOH A;  1BSE A;  1BUJ A;  1YVS A;  1LOV A;  3BU4 A;  1BAO A;  1B2Z A;  1DET A;  5RNT A;  1RGE A;  1X1U A;  1B2S A;  5BU4 A;  5BIR A;  3BIR A;  7RNT A;  1MGR A;  1BRS A;  1B2X A;  2RNT A;  1BNG A;  9RNT A;  3WR2 A;  1T2H A;  7GSP A;  1X1W A;  4HOH A;  1AY7 A;  1BRI A;  1YGW A;  2KF3 A;  1G02 A;  1BNF A;  1ZGX A;  1RNT A;  3AHW A;  6GSP A;  1FZU A;  1I0V A;  3URP A;  1PY3 A;  1X1Y A;  1CH0 A;  1RN1 A;  3DH2 A;  1RDS A;  3Q3F A;  1JBR A;  1BOX A;  1I2F A;  1I70 A;  1A2P A;  1B21 A;  1RGA A;  2C4B A;  1IYY A;  1GMP A;  6RNT A;  3SYU A;  4RNT A;  1RTU A;  1BNR A;  1BNI A;  1GOU A;  1RGF A;  1B3S A;  1FUT A;  1I2E A;  2BU4 A;  1BSC A;  1GOY A;  1RN4 A;  2F4Y A;  4HAA A;  1UCJ A;  1LRA A;  1LOW A;  2AAD A;  3WHO A;  4GSP A;  1BSD A;  1BRH A;  3A5E A;  1TRQ A;  3D4A A;  2KAA A;  1BVI A;  2KF5 A;  1I8V A;  2GSP A;  1BSB A;  3DGY A;  1Q9E A;  3AGN A;  1GMQ A;  3RNT A;  1T2I A;  1TTO A;  4BIR A;  1RCK A;  1BRK A;  2F5M A;  2KF6 A;  1GMR A;  1UCL A;  1I3F A;  1UCI A;  1B20 A;  1LOY A;  1I0X A;  1UCK A;  3HOH A;  4J5K A;  1PYL A;  1TRP A;  1B2M A;  1X1X A;  1RGK A;  2AAE A;  1BIR A;  1BU4 A;  1BNE A;  1RGH A;  1FUS A;  1BRJ A;  1LNI A;  2SAR A;  1RNB A;  1RGL A;  1BGS A;  3D5G A;  1C54 A;  2ZA4 A;  1DE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...