2F99A

Crystal structure of the polyketide cyclase aknh with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
RSEQIAAVRRMVEAYNTGKTDDVADYIHPEYMNPGTLEFTSLRGPELFAINVAWVKKTFSEEARLEEVGIEERADWVRARLVLYGRHVGEMVGMAPTGRLFSGEQIHLLHFVDGKIHHHRDWPDYQGTYRQLGEPWPETEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aklanonic Acid methyl Ester Cyclase, AknH
publication title Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
pubmed doi rcsb
source organism Streptomyces galilaeus
molecule tags Biosynthetic protein
total genus 44
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.23: Aklanonic acid methyl ester cyclase.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f99A00
4WP5A 1JN5B 4R1KA 3M8CA 5CLKA 1OH0A 4HM4B 3OV4A 4HKVB 4RZMA 4J8TA 5D81A 4MJDA 3CNXA 5AEUB 5HGRA 4X2OA 3T8NA 1C7HA 4LGQA 4HM3B 3UJMA 3VGNA 3OWYA 1S5AA 2K54A 1DMNA 3MHEA 3FH1A 3FSDA 4L7KA 4H3UA 5TGNA 4LEHA 3SOAA 5BVBA 1OF5B 4N3VA 2F98A 5D82A 4HZ9B 3NHXA 3NXJA 4HJLB 3FF2A 1GYBA 1GS3A 1O7MB 3DMCA 3ER7A 2BMOB 3B8LA 4OUQA 2F86B 3MG1A 1NDOB 2QIYA 3I0YA 1JN5A 3GZXB 3EBYA 3GZYB 3F8HA 2BMRB 1STDA 3GZRA 3SEDA 3FF0A 1W6YA 3MKIA 4I4KA 1OHPA 2XSHB 3HZPA 5DREA 1A2KA 1W00A 2Z77A 3EN1B 3G16A 3NUVA 3FGYA 5D83A 3F40A 4HM8B 3A76A 3UNLA 3LYGA 1DMMA 1TP6A 2RGQA 4GB5A 3G0KA 3ECFA 5IENA 3SOYA 2HMOB 2XR8B 4KVHA 3NM2A 1OCVA 2YFJB 2W2CA 5BXQA 3IPTA 4HM5B 1Q40B 2PZVA 4XM4A 1GY5A 1OF5A 3KE7A 3KZTA 5AIIA 3FLJA 4WYKB 1WQLB 1BUQA 4STDA 5IG0A 5IG3A 5CK6A 3D9RA 5AI1A 1E97A 1U5OA 3DUKA 3EX9A 1AR0A 1ULIB 3B7CA 2GEXA 3E99A 3KSPA 4OVMA 3OWUA 5CXOA 2B24B 3EHCA 2HMJB 1IDPA 3GRDA 4XDVA 2F99A 3MYTA 3EBTA 4J9AA 3WMDA 4R9KA 2GXFA 5KP4A 1HKXA 3F7SA 1UUWB 2A15A 2QGUA 3G8ZA 3RGAA 2RFRA 5AIFA 1E3RA 5CF2A 3JUMA 2CHCA 1O7PB 3MG3A 2STDA 1TUHA 2GBXB 3NV0A 3HK4A 1W01A 4ORLA 1Q40A 4L8PA 3EQQB 5IEPA 1JB2A 5IERA 3NBRA 1O7HB 2UX0A 5JPUA 2GEYA 1CQSA 4WYKA 5AIHA 3EN8A 3T8UA 3EJVA 3S5CA 1OGXA 5IG4A 1JB4A 3JUQA 5FW5A 1NWWA 2YFLB 1SJWA 3OX9A 3Q90A 3GZBA 3CPOA 1O7WB 1O7NB 1O7GB 4PEJA 4Q53A 1OGZA 8CHOA 1QMAA 1JKGB 3F9SA 3GWRA 1GY6A 1DMQA 3DM8A 4HM2B 1W02A 1Z1SA 3HX8A 4WWUC 3OWSA 4XB5A 5DRVA 1E3VA 3BB9A 3OXAA 4K1UA 4K1VA 3ROBA 1K41A 5AIGA 4R9LA 4FCJA 2HMNB 3F7XA 1EG9B 2Z76A 1VZZA 3K7CA 3BLZA 2RCDA 5G2GA 1UUVB 3H51A 2R4IA 3B4OA 2HMKB 2CKFB 2BNGA 2HMMB 2JQ5A 3B4PA 3JUOA 4HM6B 3F14A 4XDWA 1ASKA 3EC9A 3K0ZA 4HM0B 4IIAA 3LZAA 1JKGA 2YFIB 1EA2A 3DZLA 2OWPA 3RGRA 3KKGA 1OPYA 3MSOA 2XSOB 2IMJA 4U13A 4LMIA 1NU3A 4HM1B 4XBTA 2B1XB 3EF8A 3H3HA 1OHOA 3F8XA 4HM7B 1ULJB 5KP1A 5IF6A 4L8OA 5AEWB 3MG2A 4XBYA 3CNMA 3FKAA 3DXOA 1OUNA 1QJGA 4HZBB 4CDLA 5CF1A 1ZO2A 5STDA 3VSYA 5KP3A 2GBWB 4HVNA 3FZWA 5EVHA 1ZX2A 2INXA 3JUPA 2I9WA 1JB5A 4XBXA 2HMLB 1Q42A 2Z7AA 3CU3A 2XRXB 5IG5A 3JUNA 7STDA 1GY7A 2BMQB 1OHSA 6STDA 5JPPA 1ISKA 4FCMA 5IEOA 3NV0B 4X2HA 3STDA
chains in the Genus database with same CATH superfamily
2XFSA 5GSPA 2K0MA 4WP5A 3LH4A 3D4AA 1JN5B 4HBRA 4R1KA 2ML5A 1S723 3DGOA 2E2TA 3M8CA 1TIJA 5CLKA 2GU3A 4RNZA 2RBIA 1OH0A 1LRAA 1TFKA 1TFOA 4N6UA 5A0OB 1QAKA 1ROVA 1FUTA 1YNVX 3K63A 2BIRA 4HM4B 3OV4A 4HKVB 4RZMA 4J8TA 1US1A 3U97A 4N6OB 4BTXA 3CPW2 1IYYA 3WDGB 5D81A 1IVUA 1LQMB 1A67A 4MJDA 3LTDA 4J5KA 1FGRA 3CNXA 4O2HA 5AEUB 1BNIA 2QA43 1KC84 3FCSB 3K5TA 5HGRA 4X2OA 3SXXA 3CCM3 1EEJA 3T8NA 1C7HA 3N54B 1BUJA 3ZG0A 4LGQA 4BU4A 1F8NA 5ELJA 1JJ22 2CX0A 1KQS2 2XGLA 1VQQA 4HM3B 3UJMA 4NHFA 3WHOA 3BNDA 3VGNA 1EKMA 3BNEA 4DKIA 3OWYA 5HOHA 1RTUA 4N6NB 1S5AA 2J8XB 3RDEA 2OOVC 2K54A 2CFLA 3Q3FA 4EC6A 2BO9B 1RNBA 3CC23 1UGHI 1IQYA 1DMNA 3FH1A 3MHEA 3X40A 1FGOA 3DGNA 3FSDA 2OTJ3 4L7KA 4H3UA 5TGNA 1A2PA 1FYSA 3SOAA 2LYXA 5BVBA 1GMQA 1X1YA 2YX9A 3D5GA 1OF5B 4JRFA 2OOVA 4EBGA 2F4YA 1RHLA 1D6ZA 1IQXA 4MMXB 1PY3A 1RGKA 1TRPA 1ZGXA 2F98A 2P0MA 2Q07A 3PZWA 4N3VA 3K9MC 4GL6A 5D82A 4HZ9B 3NHXA 4KZ1A 4RBNA 3NXJA 1WMOA 1W2B2 1MWUA 1J2BA 4HJLB 2CK3H 3FF2A 1GYBA 3S27A 3CC73 1GS3A 4BTYA 5RNTA 1DVCA 1O7MB 3I563 2KF5A 2RSXA 1BU4A 3DMCA 4O02B 1AV4A 1AVLA 3QK9A 1Y4KA 3HI7A 5M1AA 3ER7A 2WOFA 2BMOB 2FXTA 1T2HA 2W56B 3B8LA 4OUQA 1RSNA 2F86B 3MG1A 3LTCA 1NDOB 3NQZA 1W4NA 4FMBA 2K3DA 1CYUA 2QIYA 1OACA 3BIRA 1BNSA 3I0YA 1GOYA 1N5PA 4MEIA 2CFWA 3AGNA 1JN5A 3GZXB 1UDII 3EBYA 3F8HA 1B2UA 2V1LA 2BMRB 3GZYB 1STDA 3GZRA 3SEDA 3FF0A 1W6YA 3KN4A 3MKIA 2JDIH 4I4KA 1OHPA 2L4VA 1VQ53 1YVBI 3HIIA 2XSHB 2MC8A 1B2ZA 1UI8A 1BAOA 3HZPA 1EUIC 5DREA 1A2KA 1W00A 2H0GA 4MMZB 2ML6A 2Z77A 1CH0A 2OCTA 3EN1B 3NQYA 8RNTA 2IY2A 1FGQA 1DETA 3G16A 3FGYA 3NBJA 3NUVA 4FMDA 5D83A 3IMAB 3G6E3 1I70A 3L0RA 3F40A 3LXUX 3PGBA 4HM8B 3DGYA 2WO0A 3A76A 3UNLA 2CG0A 3LYGA 5LC6A 3HIGA 1DMMA 4ILFA 1DYUA 1TP6A 3D5IA 3CD63 1SARA 2RGQA 4GB5A 3G0KA 1RGCA 3X41A 3ECFA 2KF6A 1RLSA 2XH9A 5IENA 3SOYA 5EQLA 2HMOB 2XR8B 4KVHA 1YJN3 3NM2A 1OCVA 5M19A 3A5EA 3PCSA 4G1MB 1QAFA 3CXC2 3NX0A 1V58A 3V98A 3CME3 2YFJB 2CFGA 2W2CA 2BHMA 5G1LA 1B21A 5BXQA 1K734 3IPTA 4HM5B 3U1WA 4CJNA 5AYSC 1Q40B 2PZVA 1DE3A 4XM4A 1I3FA 2ZL8A 4RNYA 2AAEA 2RNTA 1G02A 3X3ZA 1GY5A 4O3VA 4QWTA 1OF5A 2GSPA 2H0IA 3KE7A 1IU7A 3KZTA 5AIIA 2C4BA 2KRTA 5AYRB 2OQEC 2CWTA 3V92A 3FLJA 3V99A 1HYFA 4WYKB 1BNJA 1WQLB 2WGQA 3G713 1BUQA 1FGMA 2LQVA 1LOWA 2XF3A 3KSED 4STDA 2MF7A 5IG0A 1X1WA 4MMYB 5IG3A 1FUWA 2UGIA 5FGOA 3KCHA 5CK6A 1RGLA 1N8QA 3D9RA 2WOHA 5IW9A 5AI1A 1WNHA 1W2ZA 1E97A 4H61A 2XEPA 1FW7A 2OQEA 1IVWA 1MWTA 1U5OA 2Y74A 3DUKA 3EX9A 2KF4A 1VQL3 1AR0A 1LOYA 2KF3A 2W56A 3NM7A 4N6TA 1R4CA 4RNTA 1BSBA 4GSPA 1I2EA 1VQ93 4BTWA 2L1SA 1ULIB 1VQK3 3B7CA 5I97A 1JNQA 2D42A 2GEXA 4GHOA 3E99A 1B2XA 1RGHA 3KSPA 4OVMA 2ZHXB 4KFDA 1BRSA 1T2IA 1M9GA 1YIT3 3OWUA 5CXOA 1VQN3 2B24B 3EHCA 1LNHA 1NB3I 2HMJB 1IDPA 1IV9A 2CWUA 3BU4A 1BVIA 1IVVA 3WOEB 3GRDA 4XDVA 1GOUA 2F99A 3MYTA 1VQ73 3AHWA 3EBTA 4J9AA 1I2GA 3WMDA 3CCL3 3MPHA 2CFKA 3BNBA 2IYJA 1QVF2 4BL3A 1VQ63 4R9KA 5BIRA 1A90A 1BRHA 1LNIA 2GXFA 5KP4A 1HKXA 1PYLA 1M904 1BRNL 1JV2B 3F7SA 1UUWB 2A15A 3FG3A 2QGUA 1W6CA 3Q2PA 1QALA 3KFQC 1CEWI 5G1KA 3G8ZA 3RGAA 1MGRA 1N9JA 2RFRA 4WHAA 1VQO3 1YHQ3 3SVAA 5AIFA 1RN7A 2CW9A 4KFFA 3EB8A 1E3RA 1ROAA 5CF2A 4R4KA 3JUMA 7GSPA 4O8SA 1MNLA 1GSPA 1O7PB 2CHCA 1BRJA 1U8CB 3WODG 3JVCA 3MG3A 4LYLB 2STDA 1TUHA 3RNTA 2GBXB 3CCJ3 1Q814 3NV0A 3HK4A 1LXEA 3I553 1W01A 4ORLA 1Q40A 4L8PA 1BOXA 1YIJ3 1HZ1A 3EQQB 4N6LA 3DGLA 5IEPA 1GOVA 3BNCA 1JB2A 5IERA 3NBRA 1MWSA 3FG4A 3ZFZA 1B27A 1O7HB 1EQKA 1LVNA 1RRHA 3G4S3 2UX0A 5JPUA 2GEYA 3CCU3 2W9QA 1NJI4 1KWIA 1CQSA 1G0TA 1RCLA 4WYKA 3LTBA 1I8VA 3EN8A 5AIHA 4AKYA 4FR9A 3T8UA 1BNEA 2SARA 3EJVA 1K8A4 2R41A 1MGWA 1T5YA 1RRLA 1OGXA 2XGNA 3S5CA 4EV5A 3NBBA 3PCRA 1R4YA 5IG4A 3CCQ3 1DVDA 1TTOA 3CCE3 1JB4A 2BU4A 1SIHA 2KCDA 3JUQA 1BRIA 3O8YA 5FW5A 3SX1A 3TDGA 1GMRA 1NWWA 1W5ZA 1M1K4 2YFLB 1RCKA 1SJWA 3OX9A 1K9M4 2H0HA 3Q90A 1Q824 3GZBA 1UW1A 1Q9EA 3WA2X 4CCVA 3CPOA 1AY7A 1O7WB 1V74A 5M18A 1O7NB 1O7GB 1X1XA 4PEJA 4Q53A 1OGZA 2UUGC 8CHOA 3EE1A 4I5QA 4JF8A 1QMAA 2CFDA 3FG1A 1UCIA 1JKGB 2GU1A 3F9SA 4K90B 1IV7A 3STDA 1YJ93 3LOYA 1W7CA 3GWRA 1GY6A 2BT3A 4OK0A 3S67A 1MWRA 2XFTA 1D6YA 1JBSA 3S28A 1B20A 2CIUA 1DMQA 4LZIA 3CMA3 2CG1A 2F5WA 1YGEA 1HU9A 3X42A 4CPKA 3DM8A 4HM2B 2HOHA 1W02A 1GMPA 1IT8A 2P09A 3ALAA 3CC43 1Z1SA 3Q1CA 2D1WA 1SPUA 3HX8A 4WWUC 1L5GB 2W6JH 3OWSA 2WGOA 1IT7A 1JRQA 1K28A 1RMSA 2W9PA 3KIIA 4XB5A 3SYUA 1TU5A 1VQ43 5DRVA 3S29A 1E3VA 3BB9A 1FA3A 3N9HA 1IVXA 2W0QA 2W04A 3D79A 1JZDA 2CX1A 4HYZA 2CH9A 1KSIA 3DY5A 3WA3A 2CC3A 3N8BA 2CWVA 3IJEB 3OXAA 4K1UA 4K1VA 1LOXA 1Q7HA 4WFOA 2F56A 1BSDA 3LT9A 4N6MA 4BIRA 2OTL3 2W03A 3ROBA 1K41A 1X1UA 5AIGA 4R9LA 4KT3B 1B3SA 1N5HA 1RGFA 3PS8A 1VQ83 1PFPA 1IQ8A 1TJDA 4FCJA 1G96A 6GSPA 9RNTA 2HMNB 4LSOA 3DH2A 3ZG5A 1Q864 2SBLA 3F7XA 2KAAA 1EG9B 1BIRA 2Z76A 1RGEA 2Y73A 1VZZA 3K7CA 3AGOA 3BLZA 4R80A 2RCDA 1I0XA 5G2GA 1JZOA 3SLUA 1MOLA 1UUVB 1LOVA 3AMOB 4IT7A 7RNTA 4NREA 3WR2A 3H51A 2R4IA 3UB1A 1IK3A 3B4OA 2P05A 1VQM3 1FGTA 1BNGA 1YVSA 2PNCA 1BANA 1D6UA 1N9EA 1UUGB 1LQGC 5ELUA 3LT8A 1KD14 2HMKB 3CCV3 2CKFB 2BNGA 1YJW3 2HMMB 1RJOA 2JQ5A 3B4PA 1SQWA 1A2VA 2ZA4A 2AADA 2P0XA 3JUOA 4HAAA 3F14A 4HM6B 3UL6A 4XDWA 2P38A 1RGAA 1ASKA 1AQZA 3EC9A 3D3LA 3K0ZA 2FGTA 3VF1A 4HM0B 1BNRA 1N8R4 4IIAA 4IPBA 3LZAA 1JKGA 3HOHA 2YFIB 3LMLA 4EV2A 1W6GA 1I2FA 4FMCA 4NPBA 4EW5A 1T3BA 2C10A 3LTAA 1EA2A 1UI7A 1WMPA 1WTHA 1ZS7A 3DZLA 1YGWA 2FNQA 2OWPA 3DGMA 1JBRA 3RGRA 3KKGA 1OPYA 1NNVA 3MSOA 1I3IA 1UCLA 2XSOB 1RN1A 3MWZA 2IMJA 4LMIA 1NU3A 1BNFA 4HM1B 4U13A 4XBTA 2B1XB 3EF8A 3GSPA 3X3YA 4ZM8A 1JBTA 5EEOA 3H3HA 2IUJA 1TRQA 4EYCA 1C54A 1UGIA 1OHOA 3F8XA 1BRKA 3QRDA 2ZDJA 2IA7A 3AHSA 1RGGA 4HM7B 3PYJA 1VQP3 5LC7A 2C11A 2QEX3 1RN4A 1UCKA 1WMNA 1ULJB 5BU4A 4TX4A 1I0VA 2KXGA 5KP1A 1FZUA 5IF6A 1BRGA 1BSEA 3GAXA 4L8OA 4FCZA 1Q7Y4 1SIIA 5AEWB 3MG2A 1BGSA 4XBYA 3J7Yd 1M1XB 1NO3A 3CNMA 2O3OA 3FKAA 1RKYA 3DXOA 1AVKA 1OUNA 1QJGA 4HZBB 4CDLA 3CCR3 5CF1A 1ZO2A 5STDA 3UL5A 3VSYA 5KP3A 1RNTA 2GBWB 4HVNA 3FZWA 1CYVA 3WOFB 4EXRA 3X3XA 4N6V0 3OW22 2F5MA 6RNTA 5JBSA 5EVHA 1ZX2A 1BSCA 2INXA 1YI23 3JUPA 2I9WA 4BL2A 2M7OA 1JB5A 4XBXA 1GD3A 1BSAA 1UCJA 4K61A 1FUSA 3T0UA 2HMLB 4AEQA 1GD4A 1Q42A 2Z7AA 3CU3A 1B2MA 1PU4A 2XRXB 1QVG2 4FMAA 1RDSA 1V57A 1NB5I 3CCS3 5IG5A 2Z6BA 2E2UA 3AMOA 2O9UX 3JUNA 3PXMA 7STDA 1GY7A 2BMQB 1OHSA 3URPA 2E2VA 4J5GA 1B2SA 4HOHA 1STFI 2IUKA 6STDA 5JPPA 1ISKA 4FCMA 5IEOA 4KFEA 4AKZA 3NV0B 4X2HA 4LEHA
chains in the Genus database with same CATH topology
2XFSA 2K0MA 4WP5A 3LH4A 1JN5B 4HBRA 4R1KA 2ML5A 1S723 3DGOA 2E2TA 3M8CA 1TIJA 5CLKA 2GU3A 4RNZA 1OH0A 1TFKA 1TFOA 4N6UA 5A0OB 1QAKA 1ROVA 3K63A 4HM4B 3OV4A 4HKVB 4RZMA 4J8TA 1US1A 3U97A 4N6OB 4BTXA 3CPW2 3WDGB 5D81A 1IVUA 1A67A 4MJDA 3LTDA 4O2HA 1FGRA 3CNXA 5AEUB 2QA43 1KC84 3FCSB 3K5TA 5HGRA 4X2OA 3SXXA 3CCM3 3T8NA 1C7HA 3N54B 4LGQA 1F8NA 5ELJA 1JJ22 1KQS2 2XGLA 4HM3B 3UJMA 4NHFA 3BNDA 3VGNA 1EKMA 3BNEA 3OWYA 4N6NB 1S5AA 3RDEA 2OOVC 2K54A 2CFLA 4EC6A 2BO9B 3CC23 1IQYA 1DMNA 3FH1A 3MHEA 3X40A 1FGOA 3DGNA 3FSDA 2OTJ3 4L7KA 4H3UA 5TGNA 3SOAA 2LYXA 5BVBA 2YX9A 2OOVA 4JRFA 4EBGA 1OF5B 1D6ZA 1IQXA 4MMXB 4N3VA 2F98A 2P0MA 2Q07A 3PZWA 3K9MC 4GL6A 5D82A 4HZ9B 3NHXA 4KZ1A 4RBNA 3NXJA 1WMOA 1W2B2 1J2BA 4HJLB 2CK3H 3FF2A 1GYBA 3S27A 3CC73 1GS3A 4BTYA 1DVCA 1O7MB 3I563 2RSXA 3DMCA 4O02B 1AV4A 1AVLA 3QK9A 1Y4KA 3HI7A 3ER7A 2WOFA 2BMOB 2FXTA 2W56B 3B8LA 4OUQA 2F86B 3MG1A 3LTCA 1NDOB 3NQZA 1W4NA 4FMBA 1CYUA 2QIYA 1OACA 3I0YA 1N5PA 4MEIA 2CFWA 1JN5A 3GZXB 3EBYA 3GZYB 3F8HA 2V1LA 2BMRB 1STDA 3GZRA 3SEDA 3FF0A 1W6YA 3KN4A 3MKIA 2JDIH 4I4KA 1OHPA 2L4VA 1VQ53 1YVBI 3HIIA 2XSHB 2MC8A 1UI8A 3HZPA 5DREA 1A2KA 1W00A 4MMZB 2ML6A 2Z77A 2OCTA 3NQYA 3EN1B 1FGQA 3G16A 3NBJA 3FGYA 3NUVA 4FMDA 5D83A 3IMAB 3G6E3 3L0RA 3F40A 3LXUX 3PGBA 4HM8B 2WO0A 3A76A 3UNLA 2CG0A 3LYGA 5LC6A 3HIGA 1DMMA 3CD63 1DYUA 1TP6A 2RGQA 4GB5A 3G0KA 3X41A 3ECFA 2XH9A 5IENA 3SOYA 5EQLA 2HMOB 2XR8B 4KVHA 1YJN3 3NM2A 1OCVA 3PCSA 4G1MB 1QAFA 3CXC2 3NX0A 3V98A 3CME3 2YFJB 2CFGA 2W2CA 2BHMA 5BXQA 1K734 3IPTA 4HM5B 3U1WA 5AYSC 1Q40B 2PZVA 4XM4A 2ZL8A 4RNYA 3X3ZA 1GY5A 4O3VA 4QWTA 1OF5A 3KE7A 1IU7A 3KZTA 5AIIA 2KRTA 5AYRB 3V92A 2OQEC 2CWTA 3FLJA 3V99A 4WYKB 1WQLB 2WGQA 3G713 1BUQA 1FGMA 2LQVA 2XF3A 3KSED 4STDA 2MF7A 5IG0A 5IG3A 4MMYB 1FUWA 5FGOA 5CK6A 1N8QA 3D9RA 2WOHA 5IW9A 5AI1A 1WNHA 1W2ZA 1E97A 4H61A 2XEPA 2OQEA 1IVWA 1U5OA 2Y74A 3DUKA 3EX9A 1VQL3 1AR0A 2W56A 3NM7A 4N6TA 1R4CA 1VQ93 4BTWA 1ULIB 1VQK3 3B7CA 5I97A 1JNQA 2D42A 2GEXA 3E99A 3KSPA 4OVMA 4KFDA 1YIT3 1M9GA 3OWUA 5CXOA 1VQN3 2B24B 3EHCA 1LNHA 1NB3I 2HMJB 1IDPA 1IV9A 2CWUA 1IVVA 3WOEB 3GRDA 4XDVA 2F99A 3MYTA 1VQ73 3EBTA 4J9AA 3WMDA 3CCL3 3MPHA 2CFKA 3BNBA 1QVF2 1VQ63 4R9KA 1A90A 2GXFA 5KP4A 1HKXA 1M904 1JV2B 3F7SA 1UUWB 2A15A 3FG3A 2QGUA 1W6CA 3Q2PA 1QALA 3KFQC 1CEWI 3G8ZA 3RGAA 1N9JA 2RFRA 4WHAA 1VQO3 1YHQ3 3SVAA 5AIFA 1RN7A 2CW9A 4KFFA 3EB8A 1E3RA 1ROAA 5CF2A 4R4KA 3JUMA 4O8SA 1MNLA 2CHCA 1O7PB 1U8CB 3WODG 3JVCA 3MG3A 2STDA 1TUHA 3CCJ3 2GBXB 1Q814 3NV0A 3HK4A 1LXEA 3I553 1W01A 4ORLA 1Q40A 4L8PA 1YIJ3 3EQQB 4N6LA 3DGLA 5IEPA 3BNCA 1JB2A 5IERA 3NBRA 3FG4A 1O7HB 1EQKA 1LVNA 1RRHA 3G4S3 2UX0A 5JPUA 2GEYA 3CCU3 2W9QA 1NJI4 1KWIA 1CQSA 4WYKA 5AIHA 3LTBA 3EN8A 4AKYA 4FR9A 3T8UA 3EJVA 1K8A4 1T5YA 1RRLA 1OGXA 2XGNA 3S5CA 4EV5A 3NBBA 3PCRA 5IG4A 3CCQ3 1DVDA 3CCE3 1JB4A 1SIHA 2KCDA 3JUQA 3O8YA 5FW5A 3SX1A 3TDGA 1NWWA 1W5ZA 1M1K4 2YFLB 1SJWA 3OX9A 1K9M4 3Q90A 1Q824 3GZBA 1UW1A 3WA2X 4CCVA 3CPOA 1O7WB 1V74A 1O7NB 1O7GB 4PEJA 4Q53A 1OGZA 8CHOA 3EE1A 4JF8A 1QMAA 2CFDA 3FG1A 2GU1A 1JKGB 4K90B 3F9SA 3STDA 1IV7A 1YJ93 3LOYA 1W7CA 3GWRA 1GY6A 2BT3A 4OK0A 3S67A 2XFTA 1D6YA 3S28A 2CIUA 1DMQA 4LZIA 3CMA3 2CG1A 1YGEA 1HU9A 3X42A 3DM8A 4HM2B 1W02A 1IT8A 2P09A 3ALAA 3CC43 1Z1SA 3Q1CA 2D1WA 1SPUA 3HX8A 4WWUC 1L5GB 2W6JH 3OWSA 2WGOA 1JRQA 1K28A 1IT7A 2W9PA 3KIIA 4XB5A 1TU5A 1VQ43 5DRVA 3S29A 1E3VA 3BB9A 1FA3A 3N9HA 1IVXA 2W0QA 2W04A 4HYZA 2CH9A 1KSIA 3DY5A 3WA3A 2CC3A 3N8BA 2CWVA 3IJEB 3OXAA 4K1UA 4K1VA 1LOXA 4WFOA 3LT9A 4N6MA 2OTL3 2W03A 3ROBA 1K41A 5AIGA 4R9LA 1N5HA 3PS8A 1VQ83 1PFPA 1IQ8A 4FCJA 1G96A 2HMNB 4LSOA 1Q864 2SBLA 3F7XA 1EG9B 2Z76A 2Y73A 1VZZA 3K7CA 3BLZA 4R80A 2RCDA 5G2GA 3SLUA 1MOLA 1UUVB 3AMOB 4IT7A 4NREA 3H51A 2R4IA 3UB1A 1IK3A 3B4OA 2P05A 1VQM3 1FGTA 2PNCA 1D6UA 1N9EA 5ELUA 3LT8A 1KD14 2HMKB 3CCV3 2CKFB 2BNGA 1YJW3 2HMMB 1RJOA 2JQ5A 3B4PA 1SQWA 1A2VA 3JUOA 2P0XA 4HM6B 3F14A 3UL6A 4XDWA 2P38A 1ASKA 3EC9A 3D3LA 3K0ZA 2FGTA 3VF1A 4HM0B 1N8R4 4IIAA 4IPBA 3LZAA 1JKGA 2YFIB 3LMLA 4EV2A 1W6GA 4FMCA 2C10A 3LTAA 1EA2A 1UI7A 1WMPA 1WTHA 3DZLA 2FNQA 2OWPA 3DGMA 3RGRA 3KKGA 1OPYA 3MSOA 2XSOB 3MWZA 2IMJA 4LMIA 1NU3A 4HM1B 4U13A 4XBTA 3X3YA 2B1XB 3EF8A 4ZM8A 5EEOA 3H3HA 2IUJA 4EYCA 1OHOA 3F8XA 3QRDA 4HM7B 2ZDJA 2IA7A 4TX4A 1VQP3 3PYJA 5LC7A 2C11A 2QEX3 1WMNA 1ULJB 2KXGA 5KP1A 5IF6A 3GAXA 4L8OA 4FCZA 1Q7Y4 1SIIA 5AEWB 3MG2A 4XBYA 3J7Yd 1M1XB 1NO3A 3CNMA 2O3OA 3FKAA 1RKYA 3DXOA 1AVKA 1OUNA 1QJGA 4HZBB 4CDLA 3CCR3 5CF1A 1ZO2A 5STDA 3UL5A 3VSYA 5KP3A 2GBWB 4HVNA 3FZWA 1CYVA 3WOFB 4EXRA 3X3XA 4N6V0 3OW22 5JBSA 5EVHA 1ZX2A 2INXA 1YI23 3JUPA 2I9WA 2M7OA 1JB5A 4XBXA 1GD3A 4K61A 3T0UA 2HMLB 4AEQA 1GD4A 1Q42A 2Z7AA 3CU3A 1PU4A 2XRXB 1QVG2 4FMAA 1NB5I 3CCS3 5IG5A 2Z6BA 2E2UA 3AMOA 2O9UX 3JUNA 3PXMA 7STDA 1GY7A 2BMQB 1OHSA 2E2VA 1STFI 2IUKA 6STDA 5JPPA 1ISKA 4FCMA 5IEOA 4KFEA 4AKZA 3NV0B 4X2HA 4LEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP5 A;  1JN5 B;  4R1K A;  3M8C A;  5CLK A;  1OH0 A;  4HM4 B;  3OV4 A;  4HKV B;  4RZM A;  4J8T A;  5D81 A;  4MJD A;  3CNX A;  5AEU B;  5HGR A;  4X2O A;  3T8N A;  1C7H A;  4LGQ A;  4HM3 B;  3UJM A;  3VGN A;  3OWY A;  1S5A A;  2K54 A;  1DMN A;  3MHE A;  3FH1 A;  3FSD A;  4L7K A;  4H3U A;  5TGN A;  4LEH A;  3SOA A;  5BVB A;  1OF5 B;  4N3V A;  2F98 A;  5D82 A;  4HZ9 B;  3NHX A;  3NXJ A;  4HJL B;  3FF2 A;  1GYB A;  1GS3 A;  1O7M B;  3DMC A;  3ER7 A;  2BMO B;  3B8L A;  4OUQ A;  2F86 B;  3MG1 A;  1NDO B;  2QIY A;  3I0Y A;  1JN5 A;  3GZX B;  3EBY A;  3GZY B;  3F8H A;  2BMR B;  1STD A;  3GZR A;  3SED A;  3FF0 A;  1W6Y A;  3MKI A;  4I4K A;  1OHP A;  2XSH B;  3HZP A;  5DRE A;  1A2K A;  1W00 A;  2Z77 A;  3EN1 B;  3G16 A;  3NUV A;  3FGY A;  5D83 A;  3F40 A;  4HM8 B;  3A76 A;  3UNL A;  3LYG A;  1DMM A;  1TP6 A;  2RGQ A;  4GB5 A;  3G0K A;  3ECF A;  5IEN A;  3SOY A;  2HMO B;  2XR8 B;  4KVH A;  3NM2 A;  1OCV A;  2YFJ B;  2W2C A;  5BXQ A;  3IPT A;  4HM5 B;  1Q40 B;  2PZV A;  4XM4 A;  1GY5 A;  1OF5 A;  3KE7 A;  3KZT A;  5AII A;  3FLJ A;  4WYK B;  1WQL B;  1BUQ A;  4STD A;  5IG0 A;  5IG3 A;  5CK6 A;  3D9R A;  5AI1 A;  1E97 A;  1U5O A;  3DUK A;  3EX9 A;  1AR0 A;  1ULI B;  3B7C A;  2GEX A;  3E99 A;  3KSP A;  4OVM A;  3OWU A;  5CXO A;  2B24 B;  3EHC A;  2HMJ B;  1IDP A;  3GRD A;  4XDV A;  2F99 A;  3MYT A;  3EBT A;  4J9A A;  3WMD A;  4R9K A;  2GXF A;  5KP4 A;  1HKX A;  3F7S A;  1UUW B;  2A15 A;  2QGU A;  3G8Z A;  3RGA A;  2RFR A;  5AIF A;  1E3R A;  5CF2 A;  3JUM A;  2CHC A;  1O7P B;  3MG3 A;  2STD A;  1TUH A;  2GBX B;  3NV0 A;  3HK4 A;  1W01 A;  4ORL A;  1Q40 A;  4L8P A;  3EQQ B;  5IEP A;  1JB2 A;  5IER A;  3NBR A;  1O7H B;  2UX0 A;  5JPU A;  2GEY A;  1CQS A;  4WYK A;  5AIH A;  3EN8 A;  3T8U A;  3EJV A;  3S5C A;  1OGX A;  5IG4 A;  1JB4 A;  3JUQ A;  5FW5 A;  1NWW A;  2YFL B;  1SJW A;  3OX9 A;  3Q90 A;  3GZB A;  3CPO A;  1O7W B;  1O7N B;  1O7G B;  4PEJ A;  4Q53 A;  1OGZ A;  8CHO A;  1QMA A;  1JKG B;  3F9S A;  3GWR A;  1GY6 A;  1DMQ A;  3DM8 A;  4HM2 B;  1W02 A;  1Z1S A;  3HX8 A;  4WWU C;  3OWS A;  4XB5 A;  5DRV A;  1E3V A;  3BB9 A;  3OXA A;  4K1U A;  4K1V A;  3ROB A;  1K41 A;  5AIG A;  4R9L A;  4FCJ A;  2HMN B;  3F7X A;  1EG9 B;  2Z76 A;  1VZZ A;  3K7C A;  3BLZ A;  2RCD A;  5G2G A;  1UUV B;  3H51 A;  2R4I A;  3B4O A;  2HMK B;  2CKF B;  2BNG A;  2HMM B;  2JQ5 A;  3B4P A;  3JUO A;  4HM6 B;  3F14 A;  4XDW A;  1ASK A;  3EC9 A;  3K0Z A;  4HM0 B;  4IIA A;  3LZA A;  1JKG A;  2YFI B;  1EA2 A;  3DZL A;  2OWP A;  3RGR A;  3KKG A;  1OPY A;  3MSO A;  2XSO B;  2IMJ A;  4U13 A;  4LMI A;  1NU3 A;  4HM1 B;  4XBT A;  2B1X B;  3EF8 A;  3H3H A;  1OHO A;  3F8X A;  4HM7 B;  1ULJ B;  5KP1 A;  5IF6 A;  4L8O A;  5AEW B;  3MG2 A;  4XBY A;  3CNM A;  3FKA A;  3DXO A;  1OUN A;  1QJG A;  4HZB B;  4CDL A;  5CF1 A;  1ZO2 A;  5STD A;  3VSY A;  5KP3 A;  2GBW B;  4HVN A;  3FZW A;  5EVH A;  1ZX2 A;  2INX A;  3JUP A;  2I9W A;  1JB5 A;  4XBX A;  2HML B;  1Q42 A;  2Z7A A;  3CU3 A;  2XRX B;  5IG5 A;  3JUN A;  7STD A;  1GY7 A;  2BMQ B;  1OHS A;  6STD A;  5JPP A;  1ISK A;  4FCM A;  5IEO A;  3NV0 B;  4X2H A;  3STD A; 
#chains in the Genus database with same CATH topology
 2XFS A;  5GSP A;  2K0M A;  4WP5 A;  3LH4 A;  3D4A A;  1JN5 B;  4HBR A;  4R1K A;  2ML5 A;  1S72 3;  3DGO A;  2E2T A;  3M8C A;  1TIJ A;  5CLK A;  2GU3 A;  4RNZ A;  2RBI A;  1OH0 A;  1LRA A;  1TFK A;  1TFO A;  4N6U A;  5A0O B;  1QAK A;  1ROV A;  1FUT A;  1YNV X;  3K63 A;  2BIR A;  4HM4 B;  3OV4 A;  4HKV B;  4RZM A;  4J8T A;  1US1 A;  3U97 A;  4N6O B;  4BTX A;  3CPW 2;  1IYY A;  3WDG B;  5D81 A;  1IVU A;  1LQM B;  1A67 A;  4MJD A;  3LTD A;  4J5K A;  1FGR A;  3CNX A;  4O2H A;  5AEU B;  1BNI A;  2QA4 3;  1KC8 4;  3FCS B;  3K5T A;  5HGR A;  4X2O A;  3SXX A;  3CCM 3;  1EEJ A;  3T8N A;  1C7H A;  3N54 B;  1BUJ A;  3ZG0 A;  4LGQ A;  4BU4 A;  1F8N A;  5ELJ A;  1JJ2 2;  2CX0 A;  1KQS 2;  2XGL A;  1VQQ A;  4HM3 B;  3UJM A;  4NHF A;  3WHO A;  3BND A;  3VGN A;  1EKM A;  3BNE A;  4DKI A;  3OWY A;  5HOH A;  1RTU A;  4N6N B;  1S5A A;  2J8X B;  3RDE A;  2OOV C;  2K54 A;  2CFL A;  3Q3F A;  4EC6 A;  2BO9 B;  1RNB A;  3CC2 3;  1UGH I;  1IQY A;  1DMN A;  3FH1 A;  3MHE A;  3X40 A;  1FGO A;  3DGN A;  3FSD A;  2OTJ 3;  4L7K A;  4H3U A;  5TGN A;  1A2P A;  1FYS A;  3SOA A;  2LYX A;  5BVB A;  1GMQ A;  1X1Y A;  2YX9 A;  3D5G A;  1OF5 B;  4JRF A;  2OOV A;  4EBG A;  2F4Y A;  1RHL A;  1D6Z A;  1IQX A;  4MMX B;  1PY3 A;  1RGK A;  1TRP A;  1ZGX A;  2F98 A;  2P0M A;  2Q07 A;  3PZW A;  4N3V A;  3K9M C;  4GL6 A;  5D82 A;  4HZ9 B;  3NHX A;  4KZ1 A;  4RBN A;  3NXJ A;  1WMO A;  1W2B 2;  1MWU A;  1J2B A;  4HJL B;  2CK3 H;  3FF2 A;  1GYB A;  3S27 A;  3CC7 3;  1GS3 A;  4BTY A;  5RNT A;  1DVC A;  1O7M B;  3I56 3;  2KF5 A;  2RSX A;  1BU4 A;  3DMC A;  4O02 B;  1AV4 A;  1AVL A;  3QK9 A;  1Y4K A;  3HI7 A;  5M1A A;  3ER7 A;  2WOF A;  2BMO B;  2FXT A;  1T2H A;  2W56 B;  3B8L A;  4OUQ A;  1RSN A;  2F86 B;  3MG1 A;  3LTC A;  1NDO B;  3NQZ A;  1W4N A;  4FMB A;  2K3D A;  1CYU A;  2QIY A;  1OAC A;  3BIR A;  1BNS A;  3I0Y A;  1GOY A;  1N5P A;  4MEI A;  2CFW A;  3AGN A;  1JN5 A;  3GZX B;  1UDI I;  3EBY A;  3F8H A;  1B2U A;  2V1L A;  2BMR B;  3GZY B;  1STD A;  3GZR A;  3SED A;  3FF0 A;  1W6Y A;  3KN4 A;  3MKI A;  2JDI H;  4I4K A;  1OHP A;  2L4V A;  1VQ5 3;  1YVB I;  3HII A;  2XSH B;  2MC8 A;  1B2Z A;  1UI8 A;  1BAO A;  3HZP A;  1EUI C;  5DRE A;  1A2K A;  1W00 A;  2H0G A;  4MMZ B;  2ML6 A;  2Z77 A;  1CH0 A;  2OCT A;  3EN1 B;  3NQY A;  8RNT A;  2IY2 A;  1FGQ A;  1DET A;  3G16 A;  3FGY A;  3NBJ A;  3NUV A;  4FMD A;  5D83 A;  3IMA B;  3G6E 3;  1I70 A;  3L0R A;  3F40 A;  3LXU X;  3PGB A;  4HM8 B;  3DGY A;  2WO0 A;  3A76 A;  3UNL A;  2CG0 A;  3LYG A;  5LC6 A;  3HIG A;  1DMM A;  4ILF A;  1DYU A;  1TP6 A;  3D5I A;  3CD6 3;  1SAR A;  2RGQ A;  4GB5 A;  3G0K A;  1RGC A;  3X41 A;  3ECF A;  2KF6 A;  1RLS A;  2XH9 A;  5IEN A;  3SOY A;  5EQL A;  2HMO B;  2XR8 B;  4KVH A;  1YJN 3;  3NM2 A;  1OCV A;  5M19 A;  3A5E A;  3PCS A;  4G1M B;  1QAF A;  3CXC 2;  3NX0 A;  1V58 A;  3V98 A;  3CME 3;  2YFJ B;  2CFG A;  2W2C A;  2BHM A;  5G1L A;  1B21 A;  5BXQ A;  1K73 4;  3IPT A;  4HM5 B;  3U1W A;  4CJN A;  5AYS C;  1Q40 B;  2PZV A;  1DE3 A;  4XM4 A;  1I3F A;  2ZL8 A;  4RNY A;  2AAE A;  2RNT A;  1G02 A;  3X3Z A;  1GY5 A;  4O3V A;  4QWT A;  1OF5 A;  2GSP A;  2H0I A;  3KE7 A;  1IU7 A;  3KZT A;  5AII A;  2C4B A;  2KRT A;  5AYR B;  2OQE C;  2CWT A;  3V92 A;  3FLJ A;  3V99 A;  1HYF A;  4WYK B;  1BNJ A;  1WQL B;  2WGQ A;  3G71 3;  1BUQ A;  1FGM A;  2LQV A;  1LOW A;  2XF3 A;  3KSE D;  4STD A;  2MF7 A;  5IG0 A;  1X1W A;  4MMY B;  5IG3 A;  1FUW A;  2UGI A;  5FGO A;  3KCH A;  5CK6 A;  1RGL A;  1N8Q A;  3D9R A;  2WOH A;  5IW9 A;  5AI1 A;  1WNH A;  1W2Z A;  1E97 A;  4H61 A;  2XEP A;  1FW7 A;  2OQE A;  1IVW A;  1MWT A;  1U5O A;  2Y74 A;  3DUK A;  3EX9 A;  2KF4 A;  1VQL 3;  1AR0 A;  1LOY A;  2KF3 A;  2W56 A;  3NM7 A;  4N6T A;  1R4C A;  4RNT A;  1BSB A;  4GSP A;  1I2E A;  1VQ9 3;  4BTW A;  2L1S A;  1ULI B;  1VQK 3;  3B7C A;  5I97 A;  1JNQ A;  2D42 A;  2GEX A;  4GHO A;  3E99 A;  1B2X A;  1RGH A;  3KSP A;  4OVM A;  2ZHX B;  4KFD A;  1BRS A;  1T2I A;  1M9G A;  1YIT 3;  3OWU A;  5CXO A;  1VQN 3;  2B24 B;  3EHC A;  1LNH A;  1NB3 I;  2HMJ B;  1IDP A;  1IV9 A;  2CWU A;  3BU4 A;  1BVI A;  1IVV A;  3WOE B;  3GRD A;  4XDV A;  1GOU A;  2F99 A;  3MYT A;  1VQ7 3;  3AHW A;  3EBT A;  4J9A A;  1I2G A;  3WMD A;  3CCL 3;  3MPH A;  2CFK A;  3BNB A;  2IYJ A;  1QVF 2;  4BL3 A;  1VQ6 3;  4R9K A;  5BIR A;  1A90 A;  1BRH A;  1LNI A;  2GXF A;  5KP4 A;  1HKX A;  1PYL A;  1M90 4;  1BRN L;  1JV2 B;  3F7S A;  1UUW B;  2A15 A;  3FG3 A;  2QGU A;  1W6C A;  3Q2P A;  1QAL A;  3KFQ C;  1CEW I;  5G1K A;  3G8Z A;  3RGA A;  1MGR A;  1N9J A;  2RFR A;  4WHA A;  1VQO 3;  1YHQ 3;  3SVA A;  5AIF A;  1RN7 A;  2CW9 A;  4KFF A;  3EB8 A;  1E3R A;  1ROA A;  5CF2 A;  4R4K A;  3JUM A;  7GSP A;  4O8S A;  1MNL A;  1GSP A;  1O7P B;  2CHC A;  1BRJ A;  1U8C B;  3WOD G;  3JVC A;  3MG3 A;  4LYL B;  2STD A;  1TUH A;  3RNT A;  2GBX B;  3CCJ 3;  1Q81 4;  3NV0 A;  3HK4 A;  1LXE A;  3I55 3;  1W01 A;  4ORL A;  1Q40 A;  4L8P A;  1BOX A;  1YIJ 3;  1HZ1 A;  3EQQ B;  4N6L A;  3DGL A;  5IEP A;  1GOV A;  3BNC A;  1JB2 A;  5IER A;  3NBR A;  1MWS A;  3FG4 A;  3ZFZ A;  1B27 A;  1O7H B;  1EQK A;  1LVN A;  1RRH A;  3G4S 3;  2UX0 A;  5JPU A;  2GEY A;  3CCU 3;  2W9Q A;  1NJI 4;  1KWI A;  1CQS A;  1G0T A;  1RCL A;  4WYK A;  3LTB A;  1I8V A;  3EN8 A;  5AIH A;  4AKY A;  4FR9 A;  3T8U A;  1BNE A;  2SAR A;  3EJV A;  1K8A 4;  2R41 A;  1MGW A;  1T5Y A;  1RRL A;  1OGX A;  2XGN A;  3S5C A;  4EV5 A;  3NBB A;  3PCR A;  1R4Y A;  5IG4 A;  3CCQ 3;  1DVD A;  1TTO A;  3CCE 3;  1JB4 A;  2BU4 A;  1SIH A;  2KCD A;  3JUQ A;  1BRI A;  3O8Y A;  5FW5 A;  3SX1 A;  3TDG A;  1GMR A;  1NWW A;  1W5Z A;  1M1K 4;  2YFL B;  1RCK A;  1SJW A;  3OX9 A;  1K9M 4;  2H0H A;  3Q90 A;  1Q82 4;  3GZB A;  1UW1 A;  1Q9E A;  3WA2 X;  4CCV A;  3CPO A;  1AY7 A;  1O7W B;  1V74 A;  5M18 A;  1O7N B;  1O7G B;  1X1X A;  4PEJ A;  4Q53 A;  1OGZ A;  2UUG C;  8CHO A;  3EE1 A;  4I5Q A;  4JF8 A;  1QMA A;  2CFD A;  3FG1 A;  1UCI A;  1JKG B;  2GU1 A;  3F9S A;  4K90 B;  1IV7 A;  3STD A;  1YJ9 3;  3LOY A;  1W7C A;  3GWR A;  1GY6 A;  2BT3 A;  4OK0 A;  3S67 A;  1MWR A;  2XFT A;  1D6Y A;  1JBS A;  3S28 A;  1B20 A;  2CIU A;  1DMQ A;  4LZI A;  3CMA 3;  2CG1 A;  2F5W A;  1YGE A;  1HU9 A;  3X42 A;  4CPK A;  3DM8 A;  4HM2 B;  2HOH A;  1W02 A;  1GMP A;  1IT8 A;  2P09 A;  3ALA A;  3CC4 3;  1Z1S A;  3Q1C A;  2D1W A;  1SPU A;  3HX8 A;  4WWU C;  1L5G B;  2W6J H;  3OWS A;  2WGO A;  1IT7 A;  1JRQ A;  1K28 A;  1RMS A;  2W9P A;  3KII A;  4XB5 A;  3SYU A;  1TU5 A;  1VQ4 3;  5DRV A;  3S29 A;  1E3V A;  3BB9 A;  1FA3 A;  3N9H A;  1IVX A;  2W0Q A;  2W04 A;  3D79 A;  1JZD A;  2CX1 A;  4HYZ A;  2CH9 A;  1KSI A;  3DY5 A;  3WA3 A;  2CC3 A;  3N8B A;  2CWV A;  3IJE B;  3OXA A;  4K1U A;  4K1V A;  1LOX A;  1Q7H A;  4WFO A;  2F56 A;  1BSD A;  3LT9 A;  4N6M A;  4BIR A;  2OTL 3;  2W03 A;  3ROB A;  1K41 A;  1X1U A;  5AIG A;  4R9L A;  4KT3 B;  1B3S A;  1N5H A;  1RGF A;  3PS8 A;  1VQ8 3;  1PFP A;  1IQ8 A;  1TJD A;  4FCJ A;  1G96 A;  6GSP A;  9RNT A;  2HMN B;  4LSO A;  3DH2 A;  3ZG5 A;  1Q86 4;  2SBL A;  3F7X A;  2KAA A;  1EG9 B;  1BIR A;  2Z76 A;  1RGE A;  2Y73 A;  1VZZ A;  3K7C A;  3AGO A;  3BLZ A;  4R80 A;  2RCD A;  1I0X A;  5G2G A;  1JZO A;  3SLU A;  1MOL A;  1UUV B;  1LOV A;  3AMO B;  4IT7 A;  7RNT A;  4NRE A;  3WR2 A;  3H51 A;  2R4I A;  3UB1 A;  1IK3 A;  3B4O A;  2P05 A;  1VQM 3;  1FGT A;  1BNG A;  1YVS A;  2PNC A;  1BAN A;  1D6U A;  1N9E A;  1UUG B;  1LQG C;  5ELU A;  3LT8 A;  1KD1 4;  2HMK B;  3CCV 3;  2CKF B;  2BNG A;  1YJW 3;  2HMM B;  1RJO A;  2JQ5 A;  3B4P A;  1SQW A;  1A2V A;  2ZA4 A;  2AAD A;  2P0X A;  3JUO A;  4HAA A;  3F14 A;  4HM6 B;  3UL6 A;  4XDW A;  2P38 A;  1RGA A;  1ASK A;  1AQZ A;  3EC9 A;  3D3L A;  3K0Z A;  2FGT A;  3VF1 A;  4HM0 B;  1BNR A;  1N8R 4;  4IIA A;  4IPB A;  3LZA A;  1JKG A;  3HOH A;  2YFI B;  3LML A;  4EV2 A;  1W6G A;  1I2F A;  4FMC A;  4NPB A;  4EW5 A;  1T3B A;  2C10 A;  3LTA A;  1EA2 A;  1UI7 A;  1WMP A;  1WTH A;  1ZS7 A;  3DZL A;  1YGW A;  2FNQ A;  2OWP A;  3DGM A;  1JBR A;  3RGR A;  3KKG A;  1OPY A;  1NNV A;  3MSO A;  1I3I A;  1UCL A;  2XSO B;  1RN1 A;  3MWZ A;  2IMJ A;  4LMI A;  1NU3 A;  1BNF A;  4HM1 B;  4U13 A;  4XBT A;  2B1X B;  3EF8 A;  3GSP A;  3X3Y A;  4ZM8 A;  1JBT A;  5EEO A;  3H3H A;  2IUJ A;  1TRQ A;  4EYC A;  1C54 A;  1UGI A;  1OHO A;  3F8X A;  1BRK A;  3QRD A;  2ZDJ A;  2IA7 A;  3AHS A;  1RGG A;  4HM7 B;  3PYJ A;  1VQP 3;  5LC7 A;  2C11 A;  2QEX 3;  1RN4 A;  1UCK A;  1WMN A;  1ULJ B;  5BU4 A;  4TX4 A;  1I0V A;  2KXG A;  5KP1 A;  1FZU A;  5IF6 A;  1BRG A;  1BSE A;  3GAX A;  4L8O A;  4FCZ A;  1Q7Y 4;  1SII A;  5AEW B;  3MG2 A;  1BGS A;  4XBY A;  3J7Y d;  1M1X B;  1NO3 A;  3CNM A;  2O3O A;  3FKA A;  1RKY A;  3DXO A;  1AVK A;  1OUN A;  1QJG A;  4HZB B;  4CDL A;  3CCR 3;  5CF1 A;  1ZO2 A;  5STD A;  3UL5 A;  3VSY A;  5KP3 A;  1RNT A;  2GBW B;  4HVN A;  3FZW A;  1CYV A;  3WOF B;  4EXR A;  3X3X A;  4N6V 0;  3OW2 2;  2F5M A;  6RNT A;  5JBS A;  5EVH A;  1ZX2 A;  1BSC A;  2INX A;  1YI2 3;  3JUP A;  2I9W A;  4BL2 A;  2M7O A;  1JB5 A;  4XBX A;  1GD3 A;  1BSA A;  1UCJ A;  4K61 A;  1FUS A;  3T0U A;  2HML B;  4AEQ A;  1GD4 A;  1Q42 A;  2Z7A A;  3CU3 A;  1B2M A;  1PU4 A;  2XRX B;  1QVG 2;  4FMA A;  1RDS A;  1V57 A;  1NB5 I;  3CCS 3;  5IG5 A;  2Z6B A;  2E2U A;  3AMO A;  2O9U X;  3JUN A;  3PXM A;  7STD A;  1GY7 A;  2BMQ B;  1OHS A;  3URP A;  2E2V A;  4J5G A;  1B2S A;  4HOH A;  1STF I;  2IUK A;  6STD A;  5JPP A;  1ISK A;  4FCM A;  5IEO A;  4KFE A;  4AKZ A;  3NV0 B;  4X2H A;  4LEH A; 
#chains in the Genus database with same CATH homology
 2XFS A;  2K0M A;  4WP5 A;  3LH4 A;  1JN5 B;  4HBR A;  4R1K A;  2ML5 A;  1S72 3;  3DGO A;  2E2T A;  3M8C A;  1TIJ A;  5CLK A;  2GU3 A;  4RNZ A;  1OH0 A;  1TFK A;  1TFO A;  4N6U A;  5A0O B;  1QAK A;  1ROV A;  3K63 A;  4HM4 B;  3OV4 A;  4HKV B;  4RZM A;  4J8T A;  1US1 A;  3U97 A;  4N6O B;  4BTX A;  3CPW 2;  3WDG B;  5D81 A;  1IVU A;  1A67 A;  4MJD A;  3LTD A;  4O2H A;  1FGR A;  3CNX A;  5AEU B;  2QA4 3;  1KC8 4;  3FCS B;  3K5T A;  5HGR A;  4X2O A;  3SXX A;  3CCM 3;  3T8N A;  1C7H A;  3N54 B;  4LGQ A;  1F8N A;  5ELJ A;  1JJ2 2;  1KQS 2;  2XGL A;  4HM3 B;  3UJM A;  4NHF A;  3BND A;  3VGN A;  1EKM A;  3BNE A;  3OWY A;  4N6N B;  1S5A A;  3RDE A;  2OOV C;  2K54 A;  2CFL A;  4EC6 A;  2BO9 B;  3CC2 3;  1IQY A;  1DMN A;  3FH1 A;  3MHE A;  3X40 A;  1FGO A;  3DGN A;  3FSD A;  2OTJ 3;  4L7K A;  4H3U A;  5TGN A;  3SOA A;  2LYX A;  5BVB A;  2YX9 A;  2OOV A;  4JRF A;  4EBG A;  1OF5 B;  1D6Z A;  1IQX A;  4MMX B;  4N3V A;  2F98 A;  2P0M A;  2Q07 A;  3PZW A;  3K9M C;  4GL6 A;  5D82 A;  4HZ9 B;  3NHX A;  4KZ1 A;  4RBN A;  3NXJ A;  1WMO A;  1W2B 2;  1J2B A;  4HJL B;  2CK3 H;  3FF2 A;  1GYB A;  3S27 A;  3CC7 3;  1GS3 A;  4BTY A;  1DVC A;  1O7M B;  3I56 3;  2RSX A;  3DMC A;  4O02 B;  1AV4 A;  1AVL A;  3QK9 A;  1Y4K A;  3HI7 A;  3ER7 A;  2WOF A;  2BMO B;  2FXT A;  2W56 B;  3B8L A;  4OUQ A;  2F86 B;  3MG1 A;  3LTC A;  1NDO B;  3NQZ A;  1W4N A;  4FMB A;  1CYU A;  2QIY A;  1OAC A;  3I0Y A;  1N5P A;  4MEI A;  2CFW A;  1JN5 A;  3GZX B;  3EBY A;  3GZY B;  3F8H A;  2V1L A;  2BMR B;  1STD A;  3GZR A;  3SED A;  3FF0 A;  1W6Y A;  3KN4 A;  3MKI A;  2JDI H;  4I4K A;  1OHP A;  2L4V A;  1VQ5 3;  1YVB I;  3HII A;  2XSH B;  2MC8 A;  1UI8 A;  3HZP A;  5DRE A;  1A2K A;  1W00 A;  4MMZ B;  2ML6 A;  2Z77 A;  2OCT A;  3NQY A;  3EN1 B;  1FGQ A;  3G16 A;  3NBJ A;  3FGY A;  3NUV A;  4FMD A;  5D83 A;  3IMA B;  3G6E 3;  3L0R A;  3F40 A;  3LXU X;  3PGB A;  4HM8 B;  2WO0 A;  3A76 A;  3UNL A;  2CG0 A;  3LYG A;  5LC6 A;  3HIG A;  1DMM A;  3CD6 3;  1DYU A;  1TP6 A;  2RGQ A;  4GB5 A;  3G0K A;  3X41 A;  3ECF A;  2XH9 A;  5IEN A;  3SOY A;  5EQL A;  2HMO B;  2XR8 B;  4KVH A;  1YJN 3;  3NM2 A;  1OCV A;  3PCS A;  4G1M B;  1QAF A;  3CXC 2;  3NX0 A;  3V98 A;  3CME 3;  2YFJ B;  2CFG A;  2W2C A;  2BHM A;  5BXQ A;  1K73 4;  3IPT A;  4HM5 B;  3U1W A;  5AYS C;  1Q40 B;  2PZV A;  4XM4 A;  2ZL8 A;  4RNY A;  3X3Z A;  1GY5 A;  4O3V A;  4QWT A;  1OF5 A;  3KE7 A;  1IU7 A;  3KZT A;  5AII A;  2KRT A;  5AYR B;  3V92 A;  2OQE C;  2CWT A;  3FLJ A;  3V99 A;  4WYK B;  1WQL B;  2WGQ A;  3G71 3;  1BUQ A;  1FGM A;  2LQV A;  2XF3 A;  3KSE D;  4STD A;  2MF7 A;  5IG0 A;  5IG3 A;  4MMY B;  1FUW A;  5FGO A;  5CK6 A;  1N8Q A;  3D9R A;  2WOH A;  5IW9 A;  5AI1 A;  1WNH A;  1W2Z A;  1E97 A;  4H61 A;  2XEP A;  2OQE A;  1IVW A;  1U5O A;  2Y74 A;  3DUK A;  3EX9 A;  1VQL 3;  1AR0 A;  2W56 A;  3NM7 A;  4N6T A;  1R4C A;  1VQ9 3;  4BTW A;  1ULI B;  1VQK 3;  3B7C A;  5I97 A;  1JNQ A;  2D42 A;  2GEX A;  3E99 A;  3KSP A;  4OVM A;  4KFD A;  1YIT 3;  1M9G A;  3OWU A;  5CXO A;  1VQN 3;  2B24 B;  3EHC A;  1LNH A;  1NB3 I;  2HMJ B;  1IDP A;  1IV9 A;  2CWU A;  1IVV A;  3WOE B;  3GRD A;  4XDV A;  2F99 A;  3MYT A;  1VQ7 3;  3EBT A;  4J9A A;  3WMD A;  3CCL 3;  3MPH A;  2CFK A;  3BNB A;  1QVF 2;  1VQ6 3;  4R9K A;  1A90 A;  2GXF A;  5KP4 A;  1HKX A;  1M90 4;  1JV2 B;  3F7S A;  1UUW B;  2A15 A;  3FG3 A;  2QGU A;  1W6C A;  3Q2P A;  1QAL A;  3KFQ C;  1CEW I;  3G8Z A;  3RGA A;  1N9J A;  2RFR A;  4WHA A;  1VQO 3;  1YHQ 3;  3SVA A;  5AIF A;  1RN7 A;  2CW9 A;  4KFF A;  3EB8 A;  1E3R A;  1ROA A;  5CF2 A;  4R4K A;  3JUM A;  4O8S A;  1MNL A;  2CHC A;  1O7P B;  1U8C B;  3WOD G;  3JVC A;  3MG3 A;  2STD A;  1TUH A;  3CCJ 3;  2GBX B;  1Q81 4;  3NV0 A;  3HK4 A;  1LXE A;  3I55 3;  1W01 A;  4ORL A;  1Q40 A;  4L8P A;  1YIJ 3;  3EQQ B;  4N6L A;  3DGL A;  5IEP A;  3BNC A;  1JB2 A;  5IER A;  3NBR A;  3FG4 A;  1O7H B;  1EQK A;  1LVN A;  1RRH A;  3G4S 3;  2UX0 A;  5JPU A;  2GEY A;  3CCU 3;  2W9Q A;  1NJI 4;  1KWI A;  1CQS A;  4WYK A;  5AIH A;  3LTB A;  3EN8 A;  4AKY A;  4FR9 A;  3T8U A;  3EJV A;  1K8A 4;  1T5Y A;  1RRL A;  1OGX A;  2XGN A;  3S5C A;  4EV5 A;  3NBB A;  3PCR A;  5IG4 A;  3CCQ 3;  1DVD A;  3CCE 3;  1JB4 A;  1SIH A;  2KCD A;  3JUQ A;  3O8Y A;  5FW5 A;  3SX1 A;  3TDG A;  1NWW A;  1W5Z A;  1M1K 4;  2YFL B;  1SJW A;  3OX9 A;  1K9M 4;  3Q90 A;  1Q82 4;  3GZB A;  1UW1 A;  3WA2 X;  4CCV A;  3CPO A;  1O7W B;  1V74 A;  1O7N B;  1O7G B;  4PEJ A;  4Q53 A;  1OGZ A;  8CHO A;  3EE1 A;  4JF8 A;  1QMA A;  2CFD A;  3FG1 A;  2GU1 A;  1JKG B;  4K90 B;  3F9S A;  3STD A;  1IV7 A;  1YJ9 3;  3LOY A;  1W7C A;  3GWR A;  1GY6 A;  2BT3 A;  4OK0 A;  3S67 A;  2XFT A;  1D6Y A;  3S28 A;  2CIU A;  1DMQ A;  4LZI A;  3CMA 3;  2CG1 A;  1YGE A;  1HU9 A;  3X42 A;  3DM8 A;  4HM2 B;  1W02 A;  1IT8 A;  2P09 A;  3ALA A;  3CC4 3;  1Z1S A;  3Q1C A;  2D1W A;  1SPU A;  3HX8 A;  4WWU C;  1L5G B;  2W6J H;  3OWS A;  2WGO A;  1JRQ A;  1K28 A;  1IT7 A;  2W9P A;  3KII A;  4XB5 A;  1TU5 A;  1VQ4 3;  5DRV A;  3S29 A;  1E3V A;  3BB9 A;  1FA3 A;  3N9H A;  1IVX A;  2W0Q A;  2W04 A;  4HYZ A;  2CH9 A;  1KSI A;  3DY5 A;  3WA3 A;  2CC3 A;  3N8B A;  2CWV A;  3IJE B;  3OXA A;  4K1U A;  4K1V A;  1LOX A;  4WFO A;  3LT9 A;  4N6M A;  2OTL 3;  2W03 A;  3ROB A;  1K41 A;  5AIG A;  4R9L A;  1N5H A;  3PS8 A;  1VQ8 3;  1PFP A;  1IQ8 A;  4FCJ A;  1G96 A;  2HMN B;  4LSO A;  1Q86 4;  2SBL A;  3F7X A;  1EG9 B;  2Z76 A;  2Y73 A;  1VZZ A;  3K7C A;  3BLZ A;  4R80 A;  2RCD A;  5G2G A;  3SLU A;  1MOL A;  1UUV B;  3AMO B;  4IT7 A;  4NRE A;  3H51 A;  2R4I A;  3UB1 A;  1IK3 A;  3B4O A;  2P05 A;  1VQM 3;  1FGT A;  2PNC A;  1D6U A;  1N9E A;  5ELU A;  3LT8 A;  1KD1 4;  2HMK B;  3CCV 3;  2CKF B;  2BNG A;  1YJW 3;  2HMM B;  1RJO A;  2JQ5 A;  3B4P A;  1SQW A;  1A2V A;  3JUO A;  2P0X A;  4HM6 B;  3F14 A;  3UL6 A;  4XDW A;  2P38 A;  1ASK A;  3EC9 A;  3D3L A;  3K0Z A;  2FGT A;  3VF1 A;  4HM0 B;  1N8R 4;  4IIA A;  4IPB A;  3LZA A;  1JKG A;  2YFI B;  3LML A;  4EV2 A;  1W6G A;  4FMC A;  2C10 A;  3LTA A;  1EA2 A;  1UI7 A;  1WMP A;  1WTH A;  3DZL A;  2FNQ A;  2OWP A;  3DGM A;  3RGR A;  3KKG A;  1OPY A;  3MSO A;  2XSO B;  3MWZ A;  2IMJ A;  4LMI A;  1NU3 A;  4HM1 B;  4U13 A;  4XBT A;  3X3Y A;  2B1X B;  3EF8 A;  4ZM8 A;  5EEO A;  3H3H A;  2IUJ A;  4EYC A;  1OHO A;  3F8X A;  3QRD A;  4HM7 B;  2ZDJ A;  2IA7 A;  4TX4 A;  1VQP 3;  3PYJ A;  5LC7 A;  2C11 A;  2QEX 3;  1WMN A;  1ULJ B;  2KXG A;  5KP1 A;  5IF6 A;  3GAX A;  4L8O A;  4FCZ A;  1Q7Y 4;  1SII A;  5AEW B;  3MG2 A;  4XBY A;  3J7Y d;  1M1X B;  1NO3 A;  3CNM A;  2O3O A;  3FKA A;  1RKY A;  3DXO A;  1AVK A;  1OUN A;  1QJG A;  4HZB B;  4CDL A;  3CCR 3;  5CF1 A;  1ZO2 A;  5STD A;  3UL5 A;  3VSY A;  5KP3 A;  2GBW B;  4HVN A;  3FZW A;  1CYV A;  3WOF B;  4EXR A;  3X3X A;  4N6V 0;  3OW2 2;  5JBS A;  5EVH A;  1ZX2 A;  2INX A;  1YI2 3;  3JUP A;  2I9W A;  2M7O A;  1JB5 A;  4XBX A;  1GD3 A;  4K61 A;  3T0U A;  2HML B;  4AEQ A;  1GD4 A;  1Q42 A;  2Z7A A;  3CU3 A;  1PU4 A;  2XRX B;  1QVG 2;  4FMA A;  1NB5 I;  3CCS 3;  5IG5 A;  2Z6B A;  2E2U A;  3AMO A;  2O9U X;  3JUN A;  3PXM A;  7STD A;  1GY7 A;  2BMQ B;  1OHS A;  2E2V A;  1STF I;  2IUK A;  6STD A;  5JPP A;  1ISK A;  4FCM A;  5IEO A;  4KFE A;  4AKZ A;  3NV0 B;  4X2H A;  4LEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...