2F99A

Crystal structure of the polyketide cyclase aknh with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
RSEQIAAVRRMVEAYNTGKTDDVADYIHPEYMNPGTLEFTSLRGPELFAINVAWVKKTFSEEARLEEVGIEERADWVRARLVLYGRHVGEMVGMAPTGRLFSGEQIHLLHFVDGKIHHHRDWPDYQGTYRQLGEPWPETEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
pubmed doi rcsb
source organism Streptomyces galilaeus
molecule tags Biosynthetic protein
molecule keywords Aklanonic Acid methyl Ester Cyclase, AknH
total genus 44
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.23: Aklanonic acid methyl ester cyclase.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f99A00
1ASKA 5IF6A 3FSDA 3EHCA 1NDOB 4WWUC 2STDA 2RGQA 3F7SA 3E99A 3F40A 1DMQA 1OHPA 2BNGA 1OF5B 1TUHA 3EN1B 1JKGA 3FF2A 4HM5B 3FH1A 1OPYA 2XR8B 4PEJA 3EJVA 3GZRA 3IPTA 1GYBA 4OUQA 2F98A 3JUQA 2A15A 3EX9A 5D82A 1BUQA 2HMMB 1U5OA 3UNLA 3RGRA 5KP4A 1WQLB 1C7HA 3KZTA 1OGZA 1GY7A 2GBXB 4HM2B 3LYGA 5HGRA 5KP1A 3LZAA 2PZVA 1E3RA 3FGYA 1Q40A 3EBTA 5IG4A 1IDPA 1UUWB 4HM4B 3GWRA 5CXOA 1AR0A 2YFJB 3EN8A 4XBYA 1S5AA 8CHOA 1HKXA 4R1KA 3CU3A 4LGQA 3CPOA 1OHSA 1VZZA 4Q53A 5KP3A 3DUKA 5EVHA 1OF5A 3OV4A 5BXQA 3SOAA 3FZWA 4WP5A 4IIAA 3ER7A 1DMNA 1CQSA 3H3HA 3KKGA 4HM8B 4HZBB 3UJMA 3FF0A 4OVMA 4XB5A 2GXFA 5IG3A 3RGAA 3NXJA 5CK6A 5D81A 1ZO2A 1O7NB 5AIGA 1OH0A 4U13A 3T8NA 3T8UA 4WYKB 2XSHB 3VGNA 2IMJA 4ORLA 3DXOA 3OWSA 3SEDA 1JB4A 1SJWA 2HMNB 3FLJA 3M8CA 5CLKA 4L8PA 2UX0A 1E3VA 3EF8A 3JUNA 1ZX2A 2HMLB 3GZBA 3GZXB 3OX9A 2OWPA 4L8OA 2YFLB 3G0KA 5JPUA 3G16A 2XRXB 3F8XA 1NU3A 4HZ9B 5BVBA 2Z76A 3MSOA 2INXA 3NHXA 3MG1A 2GBWB 3MG2A 2B24B 4HJLB 4R9LA 4XBTA 5IERA 5IEOA 1OCVA 1OHOA 3G8ZA 3K0ZA 1UUVB 4XM4A 1O7GB 2F86B 3B8LA 2F99A 2B1XB 3ECFA 3F8HA 2QGUA 3MHEA 2XSOB 4HM1B 5D83A 2CHCA 3EQQB 3K7CA 1JN5A 5DREA 3FKAA 3A76A 2BMOB 1TP6A 2BMRB 3KSPA 3NM2A 3NV0B 5CF2A 1K41A 3DM8A 5AI1A 4HKVB 1W00A 4STDA 2JQ5A 4HM6B 5DRVA 3OWYA 1STDA 3I0YA 3DMCA 3JUPA 4H3UA 3HX8A 1OGXA 3JUMA 5AIFA 1W6YA 2HMJB 1DMMA 3BLZA 1GY5A 3MG3A 3DZLA 2YFIB 2Z7AA 3OWUA 5AIHA 3S5CA 5IG5A 1A2KA 1O7MB 1O7WB 4LEHA 5IEPA 3B7CA 5JPPA 3NUVA 5STDA 3VSYA 4K1VA 3EC9A 4FCJA 3EBYA 3Q90A 3D9RA 4R9KA 2K54A 4XDVA 5G2GA 7STDA 5IG0A 4HM3B 4X2HA 5AIIA 1Z1SA 1W01A 4LMIA 1O7PB 2HMKB 1JB5A 1GS3A 2GEYA 3GZYB 3WMDA 1ISKA 3F14A 4XDWA 3STDA 6STDA 4J9AA 3MKIA 2W2CA 1ULIB 1GY6A 1JB2A 3BB9A 2BMQB 3CNMA 3H51A 1Q40B 1ULJB 1EA2A 1Q42A 4K1UA 5IENA 2R4IA 4GB5A 2HMOB 1QMAA 1E97A 1W02A 3GRDA 3CNXA 3HK4A 3MYTA 4MJDA 4N3VA 4FCMA 3HZPA 3OXAA 5TGNA 2GEXA 3F7XA 3F9SA 5AEUB 3SOYA 1JKGB 2RFRA 3B4OA 4I4KA 1NWWA 2QIYA 1OUNA 3NV0A 4KVHA 1JN5B 4X2OA 4XBXA 4L7KA 3KE7A 4HVNA 3JUOA 2CKFB 1QJGA 4CDLA 2I9WA 3NBRA 4J8TA 4RZMA 1EG9B 5FW5A 3B4PA 2RCDA 2Z77A 4HM7B 4WYKA 5CF1A 5AEWB 3ROBA 4HM0B 1O7HB
chains in the Genus database with same CATH superfamily
2R41A 3BU4A 1NDOB 3D5IA 4EV2A 4WWUC 2STDA 1BRHA 2BT3A 3E99A 1DMQA 1BGSA 3JVCA 3WR2A 2BNGA 1IVWA 1RJOA 3EN1B 3LTBA 2XR8B 1BAOA 1GMRA 2RNTA 1Y4KA 2KXGA 1Q9EA 3WOFB 1V58A 1YJ93 1G02A 1HZ1A 3PCRA 2V1LA 3LTAA 4DKIA 3KZTA 2Y73A 3LYGA 1LNHA 4GHOA 3N8BA 3SYUA 3UL5A 4TX4A 1AR0A 3D5GA 2H0HA 3CC73 4Q53A 5KP3A 1B3SA 1UCLA 1V57A 4EC6A 3AGNA 2CWUA 4WP5A 4IIAA 3ER7A 3AGOA 2H0IA 5IG4A 1RNTA 1PFPA 1WMOA 4HM8B 4HZBB 4N6OB 1MNLA 4OVMA 4FMBA 3UJMA 5D81A 4QWTA 1RTUA 1OH0A 3HOHA 4AKYA 2RSXA 2XSHB 1RGFA 3AHSA 3BIRA 4ORLA 3CCV3 3M8CA 4GSPA 5CLKA 5IW9A 3GAXA 4L8PA 3VF1A 4NHFA 3J7Yd 1MWUA 1E3VA 3EF8A 4XBXA 2HMLB 1VQQA 4L8OA 5LC7A 1PYLA 2KF4A 1RGHA 1A90A 1BNFA 1MWRA 3NHXA 3MG2A 1GD4A 2B24B 2W56A 4HJLB 4AEQA 5IERA 1YJW3 1OCVA 3K0ZA 5AI1A 2KAAA 5G1LA 1O7GB 1RDSA 4HM1B 2AADA 2KRTA 2YX9A 4U13A 2GU1A 1BNJA 1PU4A 1UI8A 1KQS2 1JN5A 3A76A 2BMOB 1BSCA 3NM2A 1NB3I 1GMQA 1M1K4 1J2BA 4STDA 4HM6B 4WFOA 3OWYA 1STDA 1LXEA 3CCQ3 3JUPA 1GOUA 5AIFA 1UW1A 1W6YA 7STDA 1DMMA 1A2KA 3BNDA 4HAAA 4LEHA 4EXRA 3B7CA 3CCE3 2ZL8A 4K1VA 1U8CB 2CK3H 1B2SA 3A5EA 3EC9A 3D9RA 2ZA4A 3EBYA 4MEIA 1LVNA 4R9KA 4WHAA 1N9EA 2CG0A 4HM3B 5IG0A 3X40A 2KF6A 1O7PB 4HBRA 1CYVA 2O9UX 2W2CA 1GY6A 1B20A 1ULIB 3BB9A 1VQO3 3MWZA 1EA2A 5ELUA 1UCIA 1MWSA 4K1UA 2R4IA 2OTL3 1TU5A 1YI23 2IUJA 1BSAA 3GRDA 3CNXA 4KT3B 4HYZA 4FCMA 3FCSB 1IYYA 4RNYA 5AEUB 3SOYA 4EW5A 1JKGB 3B4OA 1BRKA 3IJEB 4I4KA 2QIYA 4MMZB 3NV0A 3G4S3 1VQK3 1FW7A 1X1UA 3KSED 1IV9A 1JRQA 3NQZA 2CFWA 4CDLA 2Q07A 3K5TA 1IQ8A 1N8QA 3NBRA 3DGNA 3AMOA 1RRHA 4WYKA 1FUSA 2GSPA 1WMPA 1ASKA 2W9PA 3SOAA 5IF6A 3EHCA 1KD14 1W5ZA 3FG4A 1R4CA 2FXTA 3UB1A 3SVAA 1MGWA 1OHPA 4NPBA 1OF5B 4HM5B 1IVXA 4K90B 4PEJA 3RGAA 2OCTA 1SIHA 3URPA 3PGBA 3JUQA 5AYRB 4MMXB 2OOVA 1BSDA 1U5OA 3UNLA 1Q824 2P0XA 3NBBA 2O3OA 1C7HA 4JRFA 7GSPA 1VQN3 1GY7A 1Q814 1JJ22 1BUJA 2F5WA 2PZVA 1MGRA 3FGYA 2MF7A 1Q40A 3EBTA 3LZAA 1IDPA 3MPHA 1VQM3 3EN8A 4XBYA 1S5AA 8CHOA 1HKXA 3KIIA 4R1KA 2MC8A 3CME3 3CU3A 1OHSA 1VZZA 1T5YA 3V99A 2D1WA 5EVHA 3OV4A 3BNBA 2BHMA 2CWTA 1M904 3H3HA 1D6YA 4MMYB 2BU4A 2D42A 3FF0A 1VQ43 3CMA3 5CK6A 5AIGA 1M9GA 9RNTA 1IT7A 5HOHA 1KC84 3VGNA 2BIRA 2W03A 1JB4A 3FLJA 2HMNB 3IMAB 1FGOA 1GD3A 1YIT3 1ZX2A 3GZBA 3GZXB 5JPUA 1BNGA 1NO3A 5G1KA 3G0KA 3G16A 2XRXB 2M7OA 1NU3A 3F8XA 4HZ9B 3MSOA 2W04A 3N9HA 2W6JH 3MG1A 4XBTA 3CCJ3 1YHQ3 3QK9A 1GMPA 4FMDA 4O2HA 4EV5A 1OHOA 1SIIA 3BNEA 2IA7A 2L4VA 1AVLA 4LZIA 1QAFA 1IVVA 5DREA 1VQ53 3S27A 2CHCA 3DGOA 1B2XA 3EQQB 2BO9B 3K7CA 7RNTA 1TP6A 1HYFA 1YNVX 1DETA 3NV0B 1K41A 1RRLA 1V74A 2LQVA 3DM8A 1W00A 8RNTA 2JQ5A 1IQYA 1FGRA 3L0RA 1L5GB 2SBLA 3CPW2 4H3UA 3NX0A 1TFKA 3MG3A 3OWUA 3DGLA 2Z6BA 1SPUA 1O7MB 1O7WB 1RN4A 3UL6A 5IEPA 1BRGA 1LNIA 2J8XB 3CCS3 4XDVA 3Q90A 1X1XA 5AIIA 1GOVA 1W7CA 3LOYA 3Q2PA 1K734 2GEYA 1BNSA 1BNEA 4XDWA 3STDA 1VQL3 1O7HB 1JB2A 1YGWA 2P09A 3H51A 1BNRA 1Q40B 1RLSA 1ULJB 1Q42A 2WOFA 1BSEA 3Q1CA 1W2ZA 4GB5A 1Q864 2OOVC 2OQEC 3X3ZA 1QMAA 4N6V0 1E97A 1I0XA 1UGHI 1W02A 4NREA 5LC6A 1SARA 3MYTA 1F8NA 3I563 3HZPA 1ZS7A 1TTOA 2CFDA 3F7XA 1I2FA 1YGEA 2HOHA 3EE1A 2RFRA 2QEX3 1YVBI 2XF3A 2XFTA 3WOEB 2ML5A 2JDIH 1BOXA 1JN5B 4K61A 3WHOA 4L7KA 4O02B 1WTHA 1QJGA 3KFQC 4BL2A 1FGMA 1DVCA 1EG9B 3LT9A 3AMOB 1GSPA 2W56B 1NB5I 5AEWB 5AYSC 1KSIA 1ZGXA 3FSDA 1R4YA 4LYLB 1UCKA 1EKMA 3F7SA 3F40A 3S29A 1DYUA 1TUHA 2QA43 1JKGA 3DY5A 3S28A 3FH1A 3WA2X 1N5HA 1B21A 3LH4A 3X41A 3GZRA 3IPTA 4ILFA 5M18A 3SLUA 2A15A 3K9MC 5D82A 2HMMB 4KFFA 1VQ63 1K28A 1FYSA 1CH0A 1LQGC 1LOYA 2K0MA 2XGNA 2ZDJA 2E2UA 4FR9A 4GL6A 4IPBA 1OGZA 1G0TA 5HGRA 3I553 2ZHXB 2CFLA 1UUWB 3NBJA 4HM4B 2Y74A 1BRJA 2YFJB 1RCLA 2P38A 1SQWA 3CPOA 4CJNA 1FZUA 1OF5A 3CD63 4FMCA 2ML6A 1HU9A 3HIIA 3SXXA 5BIRA 1S723 1CQSA 3KKGA 1IK3A 1K8A4 1ROAA 4OK0A 5IG3A 1I70A 4BTXA 1BSBA 1O7NB 1FUTA 1RGAA 2UGIA 3S67A 3V92A 3EB8A 3LMLA 1JBTA 3T8UA 4WYKB 2XEPA 1T2IA 2IMJA 2F56A 3DXOA 3OWSA 1C54A 1A67A 1SJWA 1N8R4 2IY2A 2UX0A 3CCL3 1BVIA 3OX9A 3GSPA 2OWPA 3CXC2 5BVBA 1RGGA 3D4AA 1Q7HA 1T3BA 1WMNA 2C11A 2GBWB 2WGQA 3PYJA 1RCKA 3G8ZA 4FMAA 3S5CA 1TRQA 1UUVB 4XM4A 2F86B 3ECFA 2C4BA 4IT7A 2IYJA 3F8HA 2QGUA 2XSOB 1BU4A 1JZOA 3D79A 3KSPA 4BU4A 1JBRA 1BANA 3DGYA 2AAEA 1QALA 4HKVB 4EYCA 1JNQA 4HOHA 3V98A 1I3IA 3I0YA 3DMCA 3HX8A 5AIHA 2HMJB 2LYXA 3DH2A 1GY5A 1US1A 3DZLA 2YFIB 4ZM8A 1RKYA 4N6MA 2IUKA 3X42A 4BL3A 1FGQA 3FG3A 2CC3A 4N6UA 3NUVA 5JPPA 4J5KA 1QAKA 4FCJA 3K63A 1I2EA 5M19A 4X2HA 2KF5A 4G1MB 1W01A 3AHWA 3WDGB 4LMIA 5I97A 2HMKB 1JB5A 3CCM3 1M1XB 1N9JA 2K3DA 3GZYB 3G713 3BNCA 5EQLA 6STDA 1MOLA 3MKIA 3CNMA 3OW22 3LTCA 1IQXA 1UI7A 5JBSA 4R4KA 1PY3A 5IENA 2F4YA 1TFOA 1QVF2 1RMSA 1GOYA 3NM7A 1DE3A 3X3YA 6GSPA 1VQ73 4I5QA 4FCZA 1BRIA 2GEXA 1W2B2 2W9QA 4LSOA 2OQEA 2XFSA 1X1YA 3CC23 1NWWA 4KVHA 3O8YA 1K9M4 1OACA 2E2TA 1W6GA 4HVNA 3JUOA 2CKFB 3PXMA 2I9WA 4KFEA 3U97A 3QRDA 3U1WA 3B4PA 2RCDA 2Z77A 1RSNA 4HM7B 5CF1A 2F5MA 3ROBA 4HM0B 3CCU3 3WA3A 3HI7A 5EEOA 3LTDA 3LT8A 1KWIA 1ROVA 2RBIA 2RGQA 1LRAA 4JF8A 1BIRA 3FF2A 1OPYA 1RN7A 1CEWI 2SARA 3EJVA 5M1AA 1GYBA 3ZG5A 4OUQA 4CCVA 2F98A 1CYUA 1D6ZA 3EX9A 1BUQA 1VQP3 1MWTA 3RGRA 1W4NA 1JZDA 3NQYA 5KP4A 1WQLB 2GBXB 4HM2B 2E2VA 2KF3A 1E3RA 1RN1A 3GWRA 5CXOA 3X3XA 1I8VA 3CC43 1IV7A 4AKZA 4LGQA 3RNTA 2WOHA 3DUKA 5BXQA 4BTYA 3ZFZA 3FZWA 4KFDA 2P05A 1DMNA 1T2HA 1RGCA 4XB5A 2GXFA 3NXJA 1I0VA 1W6CA 1ZO2A 1QVG2 4J5GA 4O8SA 4RBNA 2CIUA 3ZG0A 3T8NA 2XH9A 3PZWA 3SEDA 1N5PA 1WNHA 3WODG 1IT8A 3SX1A 3JUNA 1RGEA 1FGTA 3FG1A 2YFLB 2WO0A 1YIJ3 2CX1A 2Z76A 1TIJA 2INXA 4R9LA 5FGOA 1FUWA 3CCR3 1TJDA 1DVDA 6RNTA 1AV4A 4R80A 3B8LA 2F99A 2B1XB 1RNBA 1D6UA 3MHEA 5D83A 1JBSA 3KN4A 2GU3A 3FKAA 4CPKA 2BMRB 2KCDA 1I2GA 5GSPA 5CF2A 1LOWA 2L1SA 2CFGA 1BNIA 1X1WA 5DRVA 1AY7A 1Q7Y4 4KZ1A 1UUGB 5KP1A 1A2VA 5IEOA 1OGXA 1LOVA 1AVKA 3BLZA 2H0GA 3JUMA 2CFKA 2P0MA 1B2MA 2Z7AA 5IG5A 1BRNL 1B27A 2CW9A 2XGLA 5A0OB 1YVSA 1VQ83 1EQKA 1STFI 1AQZA 3LXUX 2PNCA 1NNVA 1TRPA 5STDA 3VSYA 1B2ZA 2K54A 4H61A 3ALAA 1Z1SA 3KCHA 3Q3FA 1GS3A 1G96A 3N54B 4RNTA 3WMDA 1NJI4 1B2UA 3F14A 1ISKA 1A2PA 4J9AA 2FGTA 2WGOA 1YJN3 4N6NB 5FW5A 2OTJ3 2BMQB 2FNQA 1EUIC 1EEJA 1UDII 2HMOB 4N6LA 5G2GA 3T0UA 1RGKA 1UCJA 1I3FA 3HK4A 3TDGA 1IVUA 1LQMB 5BU4A 3DGMA 3PS8A 3G6E3 2UUGC 4MJDA 4N3VA 3OXAA 5TGNA 1JV2B 1BRSA 3F9SA 3PCSA 4EBGA 4BIRA 1RHLA 2W0QA 4O3VA 5ELJA 4BTWA 1UGIA 3D3LA 1OUNA 2C10A 2CG1A 4RNZA 4N6TA 5RNTA 4X2OA 1IU7A 3KE7A 1LOXA 1FA3A 2CH9A 2CWVA 4J8TA 4RZMA 1VQ93 3HIGA 3RDEA 1RGLA 2CX0A
chains in the Genus database with same CATH topology
1NDOB 4EV2A 4WWUC 2STDA 2BT3A 3E99A 1DMQA 3JVCA 2BNGA 1IVWA 1RJOA 3EN1B 3LTBA 2XR8B 1Y4KA 2KXGA 3WOFB 1YJ93 3PCRA 2V1LA 3LTAA 3KZTA 2Y73A 3LYGA 1LNHA 3UL5A 3N8BA 4TX4A 1AR0A 3CC73 4Q53A 5KP3A 4EC6A 2CWUA 4WP5A 4IIAA 3ER7A 5IG4A 1YJW3 4HM8B 1PFPA 1WMOA 4HZBB 4N6OB 4OVMA 1MNLA 3UJMA 4FMBA 5D81A 4QWTA 1OH0A 4AKYA 2RSXA 2XSHB 4ORLA 3CCV3 3M8CA 5CLKA 5IW9A 3GAXA 4L8PA 3VF1A 4NHFA 3J7Yd 3EF8A 1E3VA 4XBXA 2HMLB 4L8OA 5LC7A 1A90A 3NHXA 3MG2A 1GD4A 2B24B 2W56A 4HJLB 4AEQA 5IERA 1OCVA 3K0ZA 5AI1A 1O7GB 4U13A 4HM1B 2KRTA 2YX9A 2GU1A 1PU4A 1UI8A 1KQS2 1JN5A 3A76A 2BMOB 3NM2A 1NB3I 1M1K4 1J2BA 4STDA 4HM6B 4WFOA 3OWYA 1STDA 1LXEA 3CCQ3 3JUPA 5AIFA 1UW1A 1W6YA 7STDA 1DMMA 1A2KA 3BNDA 4LEHA 4EXRA 3B7CA 3CCE3 2ZL8A 4K1VA 1U8CB 2CK3H 3EC9A 3EBYA 4MEIA 3D9RA 4R9KA 5G2GA 1YHQ3 1LVNA 4WHAA 1N9EA 2CG0A 4HM3B 5IG0A 3X40A 1O7PB 4HBRA 1CYVA 2O9UX 2W2CA 1GY6A 1ULIB 3BB9A 1VQO3 3MWZA 1EA2A 5ELUA 4K1UA 2R4IA 2OTL3 1TU5A 1YI23 2IUJA 3GRDA 3CNXA 4HYZA 4FCMA 3FCSB 4RNYA 5AEUB 3SOYA 1JKGB 3B4OA 3IJEB 4I4KA 2QIYA 4MMZB 3NV0A 3G4S3 1VQK3 3KSED 1IV9A 1JRQA 3NQZA 2CFWA 4CDLA 2Q07A 3K5TA 1IQ8A 1N8QA 3NBRA 3DGNA 3AMOA 1RRHA 4WYKA 3SOAA 1WMPA 1ASKA 2W9PA 5IF6A 1KD14 3EHCA 1W5ZA 3FG4A 1R4CA 2FXTA 3UB1A 3SVAA 1OHPA 3RGAA 1OF5B 4HM5B 1IVXA 4K90B 4PEJA 2OCTA 1SIHA 3PGBA 3JUQA 5AYRB 4MMXB 1U5OA 3UNLA 1Q824 2P0XA 3NBBA 2O3OA 1C7HA 4JRFA 1VQN3 1GY7A 1Q814 1JJ22 3LZAA 2PZVA 3FGYA 2MF7A 1Q40A 3EBTA 1IDPA 3MPHA 1VQM3 3EN8A 4XBYA 1S5AA 8CHOA 1HKXA 3KIIA 4R1KA 2MC8A 3CME3 3CU3A 1OHSA 1VZZA 1T5YA 3V99A 2D1WA 5EVHA 3OV4A 3BNBA 2BHMA 2CWTA 1M904 3H3HA 1D6YA 4MMYB 3FF0A 2D42A 1VQ43 3CMA3 5CK6A 5AIGA 1M9GA 1IT7A 1KC84 3VGNA 2W03A 1JB4A 3FLJA 2HMNB 3IMAB 1FGOA 1GD3A 1YIT3 1ZX2A 3GZBA 3GZXB 5JPUA 1NO3A 3G0KA 3G16A 2XRXB 2M7OA 1NU3A 3F8XA 4HZ9B 3MSOA 2W04A 3N9HA 2W6JH 3MG1A 4XBTA 3CCJ3 3QK9A 4O2HA 4FMDA 4EV5A 1OHOA 1SIIA 3BNEA 2IA7A 2L4VA 1AVLA 4LZIA 1QAFA 1IVVA 5DREA 1VQ53 3S27A 2CHCA 3DGOA 3EQQB 3K7CA 2BO9B 1TP6A 3NV0B 1K41A 1RRLA 1V74A 2LQVA 3DM8A 1W00A 2JQ5A 1IQYA 1FGRA 3L0RA 1L5GB 2SBLA 3CPW2 4H3UA 3NX0A 1TFKA 3MG3A 3OWUA 3DGLA 2Z6BA 1SPUA 1O7MB 1O7WB 3UL6A 5IEPA 3CCS3 4XDVA 3Q90A 5AIIA 1W7CA 3LOYA 3Q2PA 1K734 2GEYA 4XDWA 3STDA 1VQL3 2P09A 1JB2A 3H51A 1Q40B 1ULJB 1Q42A 2WOFA 3Q1CA 1W2ZA 4GB5A 1Q864 2OOVC 2OQEC 3X3ZA 1QMAA 4N6V0 1E97A 1W02A 4NREA 5LC6A 3MYTA 1F8NA 3I563 3HZPA 2CFDA 3F7XA 1YGEA 3EE1A 2QEX3 2RFRA 1YVBI 2XF3A 2XFTA 3WOEB 2ML5A 2JDIH 1JN5B 4K61A 4L7KA 4O02B 1WTHA 1QJGA 3KFQC 1FGMA 1DVCA 1EG9B 3LT9A 3AMOB 2W56B 5AEWB 5AYSC 1KSIA 3FSDA 1EKMA 3F7SA 3F40A 3S29A 1DYUA 1TUHA 1JKGA 3DY5A 3S28A 3FH1A 3WA2X 1N5HA 3LH4A 3X41A 3GZRA 3IPTA 3SLUA 2A15A 3K9MC 5D82A 2HMMB 4KFFA 1VQ63 1K28A 2K0MA 2XGNA 2ZDJA 4FR9A 4GL6A 2E2UA 4IPBA 1OGZA 5HGRA 3I553 2CFLA 1UUWB 3NBJA 4HM4B 2Y74A 2YFJB 2P38A 1SQWA 3CPOA 1OF5A 3CD63 4FMCA 2ML6A 1HU9A 3HIIA 3SXXA 1S723 1CQSA 3KKGA 1IK3A 1K8A4 1ROAA 4OK0A 5IG3A 4BTXA 1O7NB 3V92A 3S67A 3EB8A 3LMLA 1NB5I 3T8UA 4WYKB 2XEPA 2IMJA 3DXOA 3OWSA 1A67A 1SJWA 1N8R4 2UX0A 3CCL3 3OX9A 2OWPA 3CXC2 5BVBA 1WMNA 2WGQA 3PYJA 2C11A 2GBWB 3G8ZA 4FMAA 3S5CA 1UUVB 4XM4A 2OOVA 3ECFA 2F86B 4IT7A 2OQEA 3F8HA 2QGUA 2XSOB 3KSPA 1QALA 4HKVB 4EYCA 1JNQA 3V98A 3I0YA 3DMCA 3HX8A 5AIHA 2HMJB 2LYXA 1GY5A 1US1A 3DZLA 2YFIB 4ZM8A 1RKYA 4N6MA 2IUKA 3X42A 1FGQA 3FG3A 2CC3A 4N6UA 3NUVA 5JPPA 1QAKA 4FCJA 3K63A 4X2HA 4G1MB 1W01A 3WDGB 4LMIA 5I97A 2HMKB 1JB5A 3CCM3 1M1XB 1N9JA 3GZYB 3G713 3BNCA 5EQLA 6STDA 1MOLA 3MKIA 3CNMA 3OW22 3LTCA 1IQXA 1UI7A 5JBSA 4R4KA 5IENA 1TFOA 1QVF2 3NM7A 3X3YA 1VQ73 4FCZA 2GEXA 1W2B2 2W9QA 4LSOA 2XFSA 3CC23 1NWWA 4KVHA 3O8YA 1K9M4 1OACA 2E2TA 1W6GA 4HVNA 3JUOA 2CKFB 3PXMA 2I9WA 4KFEA 3U97A 3QRDA 3U1WA 3B4PA 2RCDA 2Z77A 4HM7B 5CF1A 3ROBA 4HM0B 3CCU3 3WA3A 3HI7A 5EEOA 3LTDA 3LT8A 1KWIA 1ROVA 2RGQA 4JF8A 3FF2A 1OPYA 1RN7A 1CEWI 3EJVA 1GYBA 4OUQA 4CCVA 2F98A 1CYUA 1D6ZA 3EX9A 1BUQA 1VQP3 3RGRA 1W4NA 3NQYA 5KP4A 1WQLB 2GBXB 4HM2B 2E2VA 1E3RA 5CXOA 3GWRA 3X3XA 3CC43 1IV7A 4AKZA 4LGQA 2WOHA 3DUKA 5BXQA 4BTYA 3FZWA 4KFDA 2P05A 1DMNA 4XB5A 2GXFA 3NXJA 1W6CA 1QVG2 1ZO2A 4O8SA 4RBNA 2CIUA 3T8NA 2XH9A 3PZWA 3SEDA 1N5PA 1WNHA 3WODG 1IT8A 3SX1A 3JUNA 1FGTA 3FG1A 2YFLB 2WO0A 1YIJ3 2Z76A 1TIJA 2INXA 4R9LA 5FGOA 1FUWA 3CCR3 1DVDA 1AV4A 4R80A 3B8LA 2F99A 2B1XB 1D6UA 3MHEA 5D83A 3KN4A 2GU3A 3FKAA 2BMRB 2KCDA 5CF2A 2CFGA 5DRVA 1Q7Y4 4KZ1A 5KP1A 1A2VA 5IEOA 1OGXA 3JUMA 1AVKA 3BLZA 2CFKA 2P0MA 2Z7AA 5IG5A 1VQ83 5A0OB 2CW9A 2XGLA 1EQKA 1STFI 3LXUX 2PNCA 5STDA 3VSYA 2K54A 4H61A 3ALAA 1Z1SA 1GS3A 1G96A 3N54B 3WMDA 1NJI4 3F14A 1ISKA 4J9AA 2FGTA 2WGOA 1YJN3 4N6NB 5FW5A 2OTJ3 2BMQB 2FNQA 2HMOB 4N6LA 3T0UA 2QA43 3HK4A 3TDGA 1IVUA 3G6E3 3DGMA 3PS8A 4MJDA 4N3VA 3OXAA 5TGNA 1JV2B 3F9SA 3PCSA 4EBGA 2W0QA 5ELJA 4O3VA 4BTWA 3D3LA 1OUNA 2C10A 2CG1A 4RNZA 4N6TA 4X2OA 1IU7A 3KE7A 1LOXA 1FA3A 2CH9A 2CWVA 4J8TA 4RZMA 1VQ93 3HIGA 3RDEA 1O7HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASK A;  5IF6 A;  3FSD A;  3EHC A;  1NDO B;  4WWU C;  2STD A;  2RGQ A;  3F7S A;  3E99 A;  3F40 A;  1DMQ A;  1OHP A;  2BNG A;  1OF5 B;  1TUH A;  3EN1 B;  1JKG A;  3FF2 A;  4HM5 B;  3FH1 A;  1OPY A;  2XR8 B;  4PEJ A;  3EJV A;  3GZR A;  3IPT A;  1GYB A;  4OUQ A;  2F98 A;  3JUQ A;  2A15 A;  3EX9 A;  5D82 A;  1BUQ A;  2HMM B;  1U5O A;  3UNL A;  3RGR A;  5KP4 A;  1WQL B;  1C7H A;  3KZT A;  1OGZ A;  1GY7 A;  2GBX B;  4HM2 B;  3LYG A;  5HGR A;  5KP1 A;  3LZA A;  2PZV A;  1E3R A;  3FGY A;  1Q40 A;  3EBT A;  5IG4 A;  1IDP A;  1UUW B;  4HM4 B;  3GWR A;  5CXO A;  1AR0 A;  2YFJ B;  3EN8 A;  4XBY A;  1S5A A;  8CHO A;  1HKX A;  4R1K A;  3CU3 A;  4LGQ A;  3CPO A;  1OHS A;  1VZZ A;  4Q53 A;  5KP3 A;  3DUK A;  5EVH A;  1OF5 A;  3OV4 A;  5BXQ A;  3SOA A;  3FZW A;  4WP5 A;  4IIA A;  3ER7 A;  1DMN A;  1CQS A;  3H3H A;  3KKG A;  4HM8 B;  4HZB B;  3UJM A;  3FF0 A;  4OVM A;  4XB5 A;  2GXF A;  5IG3 A;  3RGA A;  3NXJ A;  5CK6 A;  5D81 A;  1ZO2 A;  1O7N B;  5AIG A;  1OH0 A;  4U13 A;  3T8N A;  3T8U A;  4WYK B;  2XSH B;  3VGN A;  2IMJ A;  4ORL A;  3DXO A;  3OWS A;  3SED A;  1JB4 A;  1SJW A;  2HMN B;  3FLJ A;  3M8C A;  5CLK A;  4L8P A;  2UX0 A;  1E3V A;  3EF8 A;  3JUN A;  1ZX2 A;  2HML B;  3GZB A;  3GZX B;  3OX9 A;  2OWP A;  4L8O A;  2YFL B;  3G0K A;  5JPU A;  3G16 A;  2XRX B;  3F8X A;  1NU3 A;  4HZ9 B;  5BVB A;  2Z76 A;  3MSO A;  2INX A;  3NHX A;  3MG1 A;  2GBW B;  3MG2 A;  2B24 B;  4HJL B;  4R9L A;  4XBT A;  5IER A;  5IEO A;  1OCV A;  1OHO A;  3G8Z A;  3K0Z A;  1UUV B;  4XM4 A;  1O7G B;  2F86 B;  3B8L A;  2F99 A;  2B1X B;  3ECF A;  3F8H A;  2QGU A;  3MHE A;  2XSO B;  4HM1 B;  5D83 A;  2CHC A;  3EQQ B;  3K7C A;  1JN5 A;  5DRE A;  3FKA A;  3A76 A;  2BMO B;  1TP6 A;  2BMR B;  3KSP A;  3NM2 A;  3NV0 B;  5CF2 A;  1K41 A;  3DM8 A;  5AI1 A;  4HKV B;  1W00 A;  4STD A;  2JQ5 A;  4HM6 B;  5DRV A;  3OWY A;  1STD A;  3I0Y A;  3DMC A;  3JUP A;  4H3U A;  3HX8 A;  1OGX A;  3JUM A;  5AIF A;  1W6Y A;  2HMJ B;  1DMM A;  3BLZ A;  1GY5 A;  3MG3 A;  3DZL A;  2YFI B;  2Z7A A;  3OWU A;  5AIH A;  3S5C A;  5IG5 A;  1A2K A;  1O7M B;  1O7W B;  4LEH A;  5IEP A;  3B7C A;  5JPP A;  3NUV A;  5STD A;  3VSY A;  4K1V A;  3EC9 A;  4FCJ A;  3EBY A;  3Q90 A;  3D9R A;  4R9K A;  2K54 A;  4XDV A;  5G2G A;  7STD A;  5IG0 A;  4HM3 B;  4X2H A;  5AII A;  1Z1S A;  1W01 A;  4LMI A;  1O7P B;  2HMK B;  1JB5 A;  1GS3 A;  2GEY A;  3GZY B;  3WMD A;  1ISK A;  3F14 A;  4XDW A;  3STD A;  6STD A;  4J9A A;  3MKI A;  2W2C A;  1ULI B;  1GY6 A;  1JB2 A;  3BB9 A;  2BMQ B;  3CNM A;  3H51 A;  1Q40 B;  1ULJ B;  1EA2 A;  1Q42 A;  4K1U A;  5IEN A;  2R4I A;  4GB5 A;  2HMO B;  1QMA A;  1E97 A;  1W02 A;  3GRD A;  3CNX A;  3HK4 A;  3MYT A;  4MJD A;  4N3V A;  4FCM A;  3HZP A;  3OXA A;  5TGN A;  2GEX A;  3F7X A;  3F9S A;  5AEU B;  3SOY A;  1JKG B;  2RFR A;  3B4O A;  4I4K A;  1NWW A;  2QIY A;  1OUN A;  3NV0 A;  4KVH A;  1JN5 B;  4X2O A;  4XBX A;  4L7K A;  3KE7 A;  4HVN A;  3JUO A;  2CKF B;  1QJG A;  4CDL A;  2I9W A;  3NBR A;  4J8T A;  4RZM A;  1EG9 B;  5FW5 A;  3B4P A;  2RCD A;  2Z77 A;  4HM7 B;  4WYK A;  5CF1 A;  5AEW B;  3ROB A;  4HM0 B;  1O7H B; 
#chains in the Genus database with same CATH topology
 2R41 A;  3BU4 A;  1NDO B;  3D5I A;  4EV2 A;  4WWU C;  2STD A;  1BRH A;  2BT3 A;  3E99 A;  1DMQ A;  1BGS A;  3JVC A;  3WR2 A;  2BNG A;  1IVW A;  1RJO A;  3EN1 B;  3LTB A;  2XR8 B;  1BAO A;  1GMR A;  2RNT A;  1Y4K A;  2KXG A;  1Q9E A;  3WOF B;  1V58 A;  1YJ9 3;  1G02 A;  1HZ1 A;  3PCR A;  2V1L A;  3LTA A;  4DKI A;  3KZT A;  2Y73 A;  3LYG A;  1LNH A;  4GHO A;  3N8B A;  3SYU A;  3UL5 A;  4TX4 A;  1AR0 A;  3D5G A;  2H0H A;  3CC7 3;  4Q53 A;  5KP3 A;  1B3S A;  1UCL A;  1V57 A;  4EC6 A;  3AGN A;  2CWU A;  4WP5 A;  4IIA A;  3ER7 A;  3AGO A;  2H0I A;  5IG4 A;  1RNT A;  1PFP A;  1WMO A;  4HM8 B;  4HZB B;  4N6O B;  1MNL A;  4OVM A;  4FMB A;  3UJM A;  5D81 A;  4QWT A;  1RTU A;  1OH0 A;  3HOH A;  4AKY A;  2RSX A;  2XSH B;  1RGF A;  3AHS A;  3BIR A;  4ORL A;  3CCV 3;  3M8C A;  4GSP A;  5CLK A;  5IW9 A;  3GAX A;  4L8P A;  3VF1 A;  4NHF A;  3J7Y d;  1MWU A;  1E3V A;  3EF8 A;  4XBX A;  2HML B;  1VQQ A;  4L8O A;  5LC7 A;  1PYL A;  2KF4 A;  1RGH A;  1A90 A;  1BNF A;  1MWR A;  3NHX A;  3MG2 A;  1GD4 A;  2B24 B;  2W56 A;  4HJL B;  4AEQ A;  5IER A;  1YJW 3;  1OCV A;  3K0Z A;  5AI1 A;  2KAA A;  5G1L A;  1O7G B;  1RDS A;  4HM1 B;  2AAD A;  2KRT A;  2YX9 A;  4U13 A;  2GU1 A;  1BNJ A;  1PU4 A;  1UI8 A;  1KQS 2;  1JN5 A;  3A76 A;  2BMO B;  1BSC A;  3NM2 A;  1NB3 I;  1GMQ A;  1M1K 4;  1J2B A;  4STD A;  4HM6 B;  4WFO A;  3OWY A;  1STD A;  1LXE A;  3CCQ 3;  3JUP A;  1GOU A;  5AIF A;  1UW1 A;  1W6Y A;  7STD A;  1DMM A;  1A2K A;  3BND A;  4HAA A;  4LEH A;  4EXR A;  3B7C A;  3CCE 3;  2ZL8 A;  4K1V A;  1U8C B;  2CK3 H;  1B2S A;  3A5E A;  3EC9 A;  3D9R A;  2ZA4 A;  3EBY A;  4MEI A;  1LVN A;  4R9K A;  4WHA A;  1N9E A;  2CG0 A;  4HM3 B;  5IG0 A;  3X40 A;  2KF6 A;  1O7P B;  4HBR A;  1CYV A;  2O9U X;  2W2C A;  1GY6 A;  1B20 A;  1ULI B;  3BB9 A;  1VQO 3;  3MWZ A;  1EA2 A;  5ELU A;  1UCI A;  1MWS A;  4K1U A;  2R4I A;  2OTL 3;  1TU5 A;  1YI2 3;  2IUJ A;  1BSA A;  3GRD A;  3CNX A;  4KT3 B;  4HYZ A;  4FCM A;  3FCS B;  1IYY A;  4RNY A;  5AEU B;  3SOY A;  4EW5 A;  1JKG B;  3B4O A;  1BRK A;  3IJE B;  4I4K A;  2QIY A;  4MMZ B;  3NV0 A;  3G4S 3;  1VQK 3;  1FW7 A;  1X1U A;  3KSE D;  1IV9 A;  1JRQ A;  3NQZ A;  2CFW A;  4CDL A;  2Q07 A;  3K5T A;  1IQ8 A;  1N8Q A;  3NBR A;  3DGN A;  3AMO A;  1RRH A;  4WYK A;  1FUS A;  2GSP A;  1WMP A;  1ASK A;  2W9P A;  3SOA A;  5IF6 A;  3EHC A;  1KD1 4;  1W5Z A;  3FG4 A;  1R4C A;  2FXT A;  3UB1 A;  3SVA A;  1MGW A;  1OHP A;  4NPB A;  1OF5 B;  4HM5 B;  1IVX A;  4K90 B;  4PEJ A;  3RGA A;  2OCT A;  1SIH A;  3URP A;  3PGB A;  3JUQ A;  5AYR B;  4MMX B;  2OOV A;  1BSD A;  1U5O A;  3UNL A;  1Q82 4;  2P0X A;  3NBB A;  2O3O A;  1C7H A;  4JRF A;  7GSP A;  1VQN 3;  1GY7 A;  1Q81 4;  1JJ2 2;  1BUJ A;  2F5W A;  2PZV A;  1MGR A;  3FGY A;  2MF7 A;  1Q40 A;  3EBT A;  3LZA A;  1IDP A;  3MPH A;  1VQM 3;  3EN8 A;  4XBY A;  1S5A A;  8CHO A;  1HKX A;  3KII A;  4R1K A;  2MC8 A;  3CME 3;  3CU3 A;  1OHS A;  1VZZ A;  1T5Y A;  3V99 A;  2D1W A;  5EVH A;  3OV4 A;  3BNB A;  2BHM A;  2CWT A;  1M90 4;  3H3H A;  1D6Y A;  4MMY B;  2BU4 A;  2D42 A;  3FF0 A;  1VQ4 3;  3CMA 3;  5CK6 A;  5AIG A;  1M9G A;  9RNT A;  1IT7 A;  5HOH A;  1KC8 4;  3VGN A;  2BIR A;  2W03 A;  1JB4 A;  3FLJ A;  2HMN B;  3IMA B;  1FGO A;  1GD3 A;  1YIT 3;  1ZX2 A;  3GZB A;  3GZX B;  5JPU A;  1BNG A;  1NO3 A;  5G1K A;  3G0K A;  3G16 A;  2XRX B;  2M7O A;  1NU3 A;  3F8X A;  4HZ9 B;  3MSO A;  2W04 A;  3N9H A;  2W6J H;  3MG1 A;  4XBT A;  3CCJ 3;  1YHQ 3;  3QK9 A;  1GMP A;  4FMD A;  4O2H A;  4EV5 A;  1OHO A;  1SII A;  3BNE A;  2IA7 A;  2L4V A;  1AVL A;  4LZI A;  1QAF A;  1IVV A;  5DRE A;  1VQ5 3;  3S27 A;  2CHC A;  3DGO A;  1B2X A;  3EQQ B;  2BO9 B;  3K7C A;  7RNT A;  1TP6 A;  1HYF A;  1YNV X;  1DET A;  3NV0 B;  1K41 A;  1RRL A;  1V74 A;  2LQV A;  3DM8 A;  1W00 A;  8RNT A;  2JQ5 A;  1IQY A;  1FGR A;  3L0R A;  1L5G B;  2SBL A;  3CPW 2;  4H3U A;  3NX0 A;  1TFK A;  3MG3 A;  3OWU A;  3DGL A;  2Z6B A;  1SPU A;  1O7M B;  1O7W B;  1RN4 A;  3UL6 A;  5IEP A;  1BRG A;  1LNI A;  2J8X B;  3CCS 3;  4XDV A;  3Q90 A;  1X1X A;  5AII A;  1GOV A;  1W7C A;  3LOY A;  3Q2P A;  1K73 4;  2GEY A;  1BNS A;  1BNE A;  4XDW A;  3STD A;  1VQL 3;  1O7H B;  1JB2 A;  1YGW A;  2P09 A;  3H51 A;  1BNR A;  1Q40 B;  1RLS A;  1ULJ B;  1Q42 A;  2WOF A;  1BSE A;  3Q1C A;  1W2Z A;  4GB5 A;  1Q86 4;  2OOV C;  2OQE C;  3X3Z A;  1QMA A;  4N6V 0;  1E97 A;  1I0X A;  1UGH I;  1W02 A;  4NRE A;  5LC6 A;  1SAR A;  3MYT A;  1F8N A;  3I56 3;  3HZP A;  1ZS7 A;  1TTO A;  2CFD A;  3F7X A;  1I2F A;  1YGE A;  2HOH A;  3EE1 A;  2RFR A;  2QEX 3;  1YVB I;  2XF3 A;  2XFT A;  3WOE B;  2ML5 A;  2JDI H;  1BOX A;  1JN5 B;  4K61 A;  3WHO A;  4L7K A;  4O02 B;  1WTH A;  1QJG A;  3KFQ C;  4BL2 A;  1FGM A;  1DVC A;  1EG9 B;  3LT9 A;  3AMO B;  1GSP A;  2W56 B;  1NB5 I;  5AEW B;  5AYS C;  1KSI A;  1ZGX A;  3FSD A;  1R4Y A;  4LYL B;  1UCK A;  1EKM A;  3F7S A;  3F40 A;  3S29 A;  1DYU A;  1TUH A;  2QA4 3;  1JKG A;  3DY5 A;  3S28 A;  3FH1 A;  3WA2 X;  1N5H A;  1B21 A;  3LH4 A;  3X41 A;  3GZR A;  3IPT A;  4ILF A;  5M18 A;  3SLU A;  2A15 A;  3K9M C;  5D82 A;  2HMM B;  4KFF A;  1VQ6 3;  1K28 A;  1FYS A;  1CH0 A;  1LQG C;  1LOY A;  2K0M A;  2XGN A;  2ZDJ A;  2E2U A;  4FR9 A;  4GL6 A;  4IPB A;  1OGZ A;  1G0T A;  5HGR A;  3I55 3;  2ZHX B;  2CFL A;  1UUW B;  3NBJ A;  4HM4 B;  2Y74 A;  1BRJ A;  2YFJ B;  1RCL A;  2P38 A;  1SQW A;  3CPO A;  4CJN A;  1FZU A;  1OF5 A;  3CD6 3;  4FMC A;  2ML6 A;  1HU9 A;  3HII A;  3SXX A;  5BIR A;  1S72 3;  1CQS A;  3KKG A;  1IK3 A;  1K8A 4;  1ROA A;  4OK0 A;  5IG3 A;  1I70 A;  4BTX A;  1BSB A;  1O7N B;  1FUT A;  1RGA A;  2UGI A;  3S67 A;  3V92 A;  3EB8 A;  3LML A;  1JBT A;  3T8U A;  4WYK B;  2XEP A;  1T2I A;  2IMJ A;  2F56 A;  3DXO A;  3OWS A;  1C54 A;  1A67 A;  1SJW A;  1N8R 4;  2IY2 A;  2UX0 A;  3CCL 3;  1BVI A;  3OX9 A;  3GSP A;  2OWP A;  3CXC 2;  5BVB A;  1RGG A;  3D4A A;  1Q7H A;  1T3B A;  1WMN A;  2C11 A;  2GBW B;  2WGQ A;  3PYJ A;  1RCK A;  3G8Z A;  4FMA A;  3S5C A;  1TRQ A;  1UUV B;  4XM4 A;  2F86 B;  3ECF A;  2C4B A;  4IT7 A;  2IYJ A;  3F8H A;  2QGU A;  2XSO B;  1BU4 A;  1JZO A;  3D79 A;  3KSP A;  4BU4 A;  1JBR A;  1BAN A;  3DGY A;  2AAE A;  1QAL A;  4HKV B;  4EYC A;  1JNQ A;  4HOH A;  3V98 A;  1I3I A;  3I0Y A;  3DMC A;  3HX8 A;  5AIH A;  2HMJ B;  2LYX A;  3DH2 A;  1GY5 A;  1US1 A;  3DZL A;  2YFI B;  4ZM8 A;  1RKY A;  4N6M A;  2IUK A;  3X42 A;  4BL3 A;  1FGQ A;  3FG3 A;  2CC3 A;  4N6U A;  3NUV A;  5JPP A;  4J5K A;  1QAK A;  4FCJ A;  3K63 A;  1I2E A;  5M19 A;  4X2H A;  2KF5 A;  4G1M B;  1W01 A;  3AHW A;  3WDG B;  4LMI A;  5I97 A;  2HMK B;  1JB5 A;  3CCM 3;  1M1X B;  1N9J A;  2K3D A;  3GZY B;  3G71 3;  3BNC A;  5EQL A;  6STD A;  1MOL A;  3MKI A;  3CNM A;  3OW2 2;  3LTC A;  1IQX A;  1UI7 A;  5JBS A;  4R4K A;  1PY3 A;  5IEN A;  2F4Y A;  1TFO A;  1QVF 2;  1RMS A;  1GOY A;  3NM7 A;  1DE3 A;  3X3Y A;  6GSP A;  1VQ7 3;  4I5Q A;  4FCZ A;  1BRI A;  2GEX A;  1W2B 2;  2W9Q A;  4LSO A;  2OQE A;  2XFS A;  1X1Y A;  3CC2 3;  1NWW A;  4KVH A;  3O8Y A;  1K9M 4;  1OAC A;  2E2T A;  1W6G A;  4HVN A;  3JUO A;  2CKF B;  3PXM A;  2I9W A;  4KFE A;  3U97 A;  3QRD A;  3U1W A;  3B4P A;  2RCD A;  2Z77 A;  1RSN A;  4HM7 B;  5CF1 A;  2F5M A;  3ROB A;  4HM0 B;  3CCU 3;  3WA3 A;  3HI7 A;  5EEO A;  3LTD A;  3LT8 A;  1KWI A;  1ROV A;  2RBI A;  2RGQ A;  1LRA A;  4JF8 A;  1BIR A;  3FF2 A;  1OPY A;  1RN7 A;  1CEW I;  2SAR A;  3EJV A;  5M1A A;  1GYB A;  3ZG5 A;  4OUQ A;  4CCV A;  2F98 A;  1CYU A;  1D6Z A;  3EX9 A;  1BUQ A;  1VQP 3;  1MWT A;  3RGR A;  1W4N A;  1JZD A;  3NQY A;  5KP4 A;  1WQL B;  2GBX B;  4HM2 B;  2E2V A;  2KF3 A;  1E3R A;  1RN1 A;  3GWR A;  5CXO A;  3X3X A;  1I8V A;  3CC4 3;  1IV7 A;  4AKZ A;  4LGQ A;  3RNT A;  2WOH A;  3DUK A;  5BXQ A;  4BTY A;  3ZFZ A;  3FZW A;  4KFD A;  2P05 A;  1DMN A;  1T2H A;  1RGC A;  4XB5 A;  2GXF A;  3NXJ A;  1I0V A;  1W6C A;  1ZO2 A;  1QVG 2;  4J5G A;  4O8S A;  4RBN A;  2CIU A;  3ZG0 A;  3T8N A;  2XH9 A;  3PZW A;  3SED A;  1N5P A;  1WNH A;  3WOD G;  1IT8 A;  3SX1 A;  3JUN A;  1RGE A;  1FGT A;  3FG1 A;  2YFL B;  2WO0 A;  1YIJ 3;  2CX1 A;  2Z76 A;  1TIJ A;  2INX A;  4R9L A;  5FGO A;  1FUW A;  3CCR 3;  1TJD A;  1DVD A;  6RNT A;  1AV4 A;  4R80 A;  3B8L A;  2F99 A;  2B1X B;  1RNB A;  1D6U A;  3MHE A;  5D83 A;  1JBS A;  3KN4 A;  2GU3 A;  3FKA A;  4CPK A;  2BMR B;  2KCD A;  1I2G A;  5GSP A;  5CF2 A;  1LOW A;  2L1S A;  2CFG A;  1BNI A;  1X1W A;  5DRV A;  1AY7 A;  1Q7Y 4;  4KZ1 A;  1UUG B;  5KP1 A;  1A2V A;  5IEO A;  1OGX A;  1LOV A;  1AVK A;  3BLZ A;  2H0G A;  3JUM A;  2CFK A;  2P0M A;  1B2M A;  2Z7A A;  5IG5 A;  1BRN L;  1B27 A;  2CW9 A;  2XGL A;  5A0O B;  1YVS A;  1VQ8 3;  1EQK A;  1STF I;  1AQZ A;  3LXU X;  2PNC A;  1NNV A;  1TRP A;  5STD A;  3VSY A;  1B2Z A;  2K54 A;  4H61 A;  3ALA A;  1Z1S A;  3KCH A;  3Q3F A;  1GS3 A;  1G96 A;  3N54 B;  4RNT A;  3WMD A;  1NJI 4;  1B2U A;  3F14 A;  1ISK A;  1A2P A;  4J9A A;  2FGT A;  2WGO A;  1YJN 3;  4N6N B;  5FW5 A;  2OTJ 3;  2BMQ B;  2FNQ A;  1EUI C;  1EEJ A;  1UDI I;  2HMO B;  4N6L A;  5G2G A;  3T0U A;  1RGK A;  1UCJ A;  1I3F A;  3HK4 A;  3TDG A;  1IVU A;  1LQM B;  5BU4 A;  3DGM A;  3PS8 A;  3G6E 3;  2UUG C;  4MJD A;  4N3V A;  3OXA A;  5TGN A;  1JV2 B;  1BRS A;  3F9S A;  3PCS A;  4EBG A;  4BIR A;  1RHL A;  2W0Q A;  4O3V A;  5ELJ A;  4BTW A;  1UGI A;  3D3L A;  1OUN A;  2C10 A;  2CG1 A;  4RNZ A;  4N6T A;  5RNT A;  4X2O A;  1IU7 A;  3KE7 A;  1LOX A;  1FA3 A;  2CH9 A;  2CWV A;  4J8T A;  4RZM A;  1VQ9 3;  3HIG A;  3RDE A;  1RGL A;  2CX0 A; 
#chains in the Genus database with same CATH homology
 1NDO B;  4EV2 A;  4WWU C;  2STD A;  2BT3 A;  3E99 A;  1DMQ A;  3JVC A;  2BNG A;  1IVW A;  1RJO A;  3EN1 B;  3LTB A;  2XR8 B;  1Y4K A;  2KXG A;  3WOF B;  1YJ9 3;  3PCR A;  2V1L A;  3LTA A;  3KZT A;  2Y73 A;  3LYG A;  1LNH A;  3UL5 A;  3N8B A;  4TX4 A;  1AR0 A;  3CC7 3;  4Q53 A;  5KP3 A;  4EC6 A;  2CWU A;  4WP5 A;  4IIA A;  3ER7 A;  5IG4 A;  1YJW 3;  4HM8 B;  1PFP A;  1WMO A;  4HZB B;  4N6O B;  4OVM A;  1MNL A;  3UJM A;  4FMB A;  5D81 A;  4QWT A;  1OH0 A;  4AKY A;  2RSX A;  2XSH B;  4ORL A;  3CCV 3;  3M8C A;  5CLK A;  5IW9 A;  3GAX A;  4L8P A;  3VF1 A;  4NHF A;  3J7Y d;  3EF8 A;  1E3V A;  4XBX A;  2HML B;  4L8O A;  5LC7 A;  1A90 A;  3NHX A;  3MG2 A;  1GD4 A;  2B24 B;  2W56 A;  4HJL B;  4AEQ A;  5IER A;  1OCV A;  3K0Z A;  5AI1 A;  1O7G B;  4U13 A;  4HM1 B;  2KRT A;  2YX9 A;  2GU1 A;  1PU4 A;  1UI8 A;  1KQS 2;  1JN5 A;  3A76 A;  2BMO B;  3NM2 A;  1NB3 I;  1M1K 4;  1J2B A;  4STD A;  4HM6 B;  4WFO A;  3OWY A;  1STD A;  1LXE A;  3CCQ 3;  3JUP A;  5AIF A;  1UW1 A;  1W6Y A;  7STD A;  1DMM A;  1A2K A;  3BND A;  4LEH A;  4EXR A;  3B7C A;  3CCE 3;  2ZL8 A;  4K1V A;  1U8C B;  2CK3 H;  3EC9 A;  3EBY A;  4MEI A;  3D9R A;  4R9K A;  5G2G A;  1YHQ 3;  1LVN A;  4WHA A;  1N9E A;  2CG0 A;  4HM3 B;  5IG0 A;  3X40 A;  1O7P B;  4HBR A;  1CYV A;  2O9U X;  2W2C A;  1GY6 A;  1ULI B;  3BB9 A;  1VQO 3;  3MWZ A;  1EA2 A;  5ELU A;  4K1U A;  2R4I A;  2OTL 3;  1TU5 A;  1YI2 3;  2IUJ A;  3GRD A;  3CNX A;  4HYZ A;  4FCM A;  3FCS B;  4RNY A;  5AEU B;  3SOY A;  1JKG B;  3B4O A;  3IJE B;  4I4K A;  2QIY A;  4MMZ B;  3NV0 A;  3G4S 3;  1VQK 3;  3KSE D;  1IV9 A;  1JRQ A;  3NQZ A;  2CFW A;  4CDL A;  2Q07 A;  3K5T A;  1IQ8 A;  1N8Q A;  3NBR A;  3DGN A;  3AMO A;  1RRH A;  4WYK A;  3SOA A;  1WMP A;  1ASK A;  2W9P A;  5IF6 A;  1KD1 4;  3EHC A;  1W5Z A;  3FG4 A;  1R4C A;  2FXT A;  3UB1 A;  3SVA A;  1OHP A;  3RGA A;  1OF5 B;  4HM5 B;  1IVX A;  4K90 B;  4PEJ A;  2OCT A;  1SIH A;  3PGB A;  3JUQ A;  5AYR B;  4MMX B;  1U5O A;  3UNL A;  1Q82 4;  2P0X A;  3NBB A;  2O3O A;  1C7H A;  4JRF A;  1VQN 3;  1GY7 A;  1Q81 4;  1JJ2 2;  3LZA A;  2PZV A;  3FGY A;  2MF7 A;  1Q40 A;  3EBT A;  1IDP A;  3MPH A;  1VQM 3;  3EN8 A;  4XBY A;  1S5A A;  8CHO A;  1HKX A;  3KII A;  4R1K A;  2MC8 A;  3CME 3;  3CU3 A;  1OHS A;  1VZZ A;  1T5Y A;  3V99 A;  2D1W A;  5EVH A;  3OV4 A;  3BNB A;  2BHM A;  2CWT A;  1M90 4;  3H3H A;  1D6Y A;  4MMY B;  3FF0 A;  2D42 A;  1VQ4 3;  3CMA 3;  5CK6 A;  5AIG A;  1M9G A;  1IT7 A;  1KC8 4;  3VGN A;  2W03 A;  1JB4 A;  3FLJ A;  2HMN B;  3IMA B;  1FGO A;  1GD3 A;  1YIT 3;  1ZX2 A;  3GZB A;  3GZX B;  5JPU A;  1NO3 A;  3G0K A;  3G16 A;  2XRX B;  2M7O A;  1NU3 A;  3F8X A;  4HZ9 B;  3MSO A;  2W04 A;  3N9H A;  2W6J H;  3MG1 A;  4XBT A;  3CCJ 3;  3QK9 A;  4O2H A;  4FMD A;  4EV5 A;  1OHO A;  1SII A;  3BNE A;  2IA7 A;  2L4V A;  1AVL A;  4LZI A;  1QAF A;  1IVV A;  5DRE A;  1VQ5 3;  3S27 A;  2CHC A;  3DGO A;  3EQQ B;  3K7C A;  2BO9 B;  1TP6 A;  3NV0 B;  1K41 A;  1RRL A;  1V74 A;  2LQV A;  3DM8 A;  1W00 A;  2JQ5 A;  1IQY A;  1FGR A;  3L0R A;  1L5G B;  2SBL A;  3CPW 2;  4H3U A;  3NX0 A;  1TFK A;  3MG3 A;  3OWU A;  3DGL A;  2Z6B A;  1SPU A;  1O7M B;  1O7W B;  3UL6 A;  5IEP A;  3CCS 3;  4XDV A;  3Q90 A;  5AII A;  1W7C A;  3LOY A;  3Q2P A;  1K73 4;  2GEY A;  4XDW A;  3STD A;  1VQL 3;  2P09 A;  1JB2 A;  3H51 A;  1Q40 B;  1ULJ B;  1Q42 A;  2WOF A;  3Q1C A;  1W2Z A;  4GB5 A;  1Q86 4;  2OOV C;  2OQE C;  3X3Z A;  1QMA A;  4N6V 0;  1E97 A;  1W02 A;  4NRE A;  5LC6 A;  3MYT A;  1F8N A;  3I56 3;  3HZP A;  2CFD A;  3F7X A;  1YGE A;  3EE1 A;  2QEX 3;  2RFR A;  1YVB I;  2XF3 A;  2XFT A;  3WOE B;  2ML5 A;  2JDI H;  1JN5 B;  4K61 A;  4L7K A;  4O02 B;  1WTH A;  1QJG A;  3KFQ C;  1FGM A;  1DVC A;  1EG9 B;  3LT9 A;  3AMO B;  2W56 B;  5AEW B;  5AYS C;  1KSI A;  3FSD A;  1EKM A;  3F7S A;  3F40 A;  3S29 A;  1DYU A;  1TUH A;  1JKG A;  3DY5 A;  3S28 A;  3FH1 A;  3WA2 X;  1N5H A;  3LH4 A;  3X41 A;  3GZR A;  3IPT A;  3SLU A;  2A15 A;  3K9M C;  5D82 A;  2HMM B;  4KFF A;  1VQ6 3;  1K28 A;  2K0M A;  2XGN A;  2ZDJ A;  4FR9 A;  4GL6 A;  2E2U A;  4IPB A;  1OGZ A;  5HGR A;  3I55 3;  2CFL A;  1UUW B;  3NBJ A;  4HM4 B;  2Y74 A;  2YFJ B;  2P38 A;  1SQW A;  3CPO A;  1OF5 A;  3CD6 3;  4FMC A;  2ML6 A;  1HU9 A;  3HII A;  3SXX A;  1S72 3;  1CQS A;  3KKG A;  1IK3 A;  1K8A 4;  1ROA A;  4OK0 A;  5IG3 A;  4BTX A;  1O7N B;  3V92 A;  3S67 A;  3EB8 A;  3LML A;  1NB5 I;  3T8U A;  4WYK B;  2XEP A;  2IMJ A;  3DXO A;  3OWS A;  1A67 A;  1SJW A;  1N8R 4;  2UX0 A;  3CCL 3;  3OX9 A;  2OWP A;  3CXC 2;  5BVB A;  1WMN A;  2WGQ A;  3PYJ A;  2C11 A;  2GBW B;  3G8Z A;  4FMA A;  3S5C A;  1UUV B;  4XM4 A;  2OOV A;  3ECF A;  2F86 B;  4IT7 A;  2OQE A;  3F8H A;  2QGU A;  2XSO B;  3KSP A;  1QAL A;  4HKV B;  4EYC A;  1JNQ A;  3V98 A;  3I0Y A;  3DMC A;  3HX8 A;  5AIH A;  2HMJ B;  2LYX A;  1GY5 A;  1US1 A;  3DZL A;  2YFI B;  4ZM8 A;  1RKY A;  4N6M A;  2IUK A;  3X42 A;  1FGQ A;  3FG3 A;  2CC3 A;  4N6U A;  3NUV A;  5JPP A;  1QAK A;  4FCJ A;  3K63 A;  4X2H A;  4G1M B;  1W01 A;  3WDG B;  4LMI A;  5I97 A;  2HMK B;  1JB5 A;  3CCM 3;  1M1X B;  1N9J A;  3GZY B;  3G71 3;  3BNC A;  5EQL A;  6STD A;  1MOL A;  3MKI A;  3CNM A;  3OW2 2;  3LTC A;  1IQX A;  1UI7 A;  5JBS A;  4R4K A;  5IEN A;  1TFO A;  1QVF 2;  3NM7 A;  3X3Y A;  1VQ7 3;  4FCZ A;  2GEX A;  1W2B 2;  2W9Q A;  4LSO A;  2XFS A;  3CC2 3;  1NWW A;  4KVH A;  3O8Y A;  1K9M 4;  1OAC A;  2E2T A;  1W6G A;  4HVN A;  3JUO A;  2CKF B;  3PXM A;  2I9W A;  4KFE A;  3U97 A;  3QRD A;  3U1W A;  3B4P A;  2RCD A;  2Z77 A;  4HM7 B;  5CF1 A;  3ROB A;  4HM0 B;  3CCU 3;  3WA3 A;  3HI7 A;  5EEO A;  3LTD A;  3LT8 A;  1KWI A;  1ROV A;  2RGQ A;  4JF8 A;  3FF2 A;  1OPY A;  1RN7 A;  1CEW I;  3EJV A;  1GYB A;  4OUQ A;  4CCV A;  2F98 A;  1CYU A;  1D6Z A;  3EX9 A;  1BUQ A;  1VQP 3;  3RGR A;  1W4N A;  3NQY A;  5KP4 A;  1WQL B;  2GBX B;  4HM2 B;  2E2V A;  1E3R A;  5CXO A;  3GWR A;  3X3X A;  3CC4 3;  1IV7 A;  4AKZ A;  4LGQ A;  2WOH A;  3DUK A;  5BXQ A;  4BTY A;  3FZW A;  4KFD A;  2P05 A;  1DMN A;  4XB5 A;  2GXF A;  3NXJ A;  1W6C A;  1QVG 2;  1ZO2 A;  4O8S A;  4RBN A;  2CIU A;  3T8N A;  2XH9 A;  3PZW A;  3SED A;  1N5P A;  1WNH A;  3WOD G;  1IT8 A;  3SX1 A;  3JUN A;  1FGT A;  3FG1 A;  2YFL B;  2WO0 A;  1YIJ 3;  2Z76 A;  1TIJ A;  2INX A;  4R9L A;  5FGO A;  1FUW A;  3CCR 3;  1DVD A;  1AV4 A;  4R80 A;  3B8L A;  2F99 A;  2B1X B;  1D6U A;  3MHE A;  5D83 A;  3KN4 A;  2GU3 A;  3FKA A;  2BMR B;  2KCD A;  5CF2 A;  2CFG A;  5DRV A;  1Q7Y 4;  4KZ1 A;  5KP1 A;  1A2V A;  5IEO A;  1OGX A;  3JUM A;  1AVK A;  3BLZ A;  2CFK A;  2P0M A;  2Z7A A;  5IG5 A;  1VQ8 3;  5A0O B;  2CW9 A;  2XGL A;  1EQK A;  1STF I;  3LXU X;  2PNC A;  5STD A;  3VSY A;  2K54 A;  4H61 A;  3ALA A;  1Z1S A;  1GS3 A;  1G96 A;  3N54 B;  3WMD A;  1NJI 4;  3F14 A;  1ISK A;  4J9A A;  2FGT A;  2WGO A;  1YJN 3;  4N6N B;  5FW5 A;  2OTJ 3;  2BMQ B;  2FNQ A;  2HMO B;  4N6L A;  3T0U A;  2QA4 3;  3HK4 A;  3TDG A;  1IVU A;  3G6E 3;  3DGM A;  3PS8 A;  4MJD A;  4N3V A;  3OXA A;  5TGN A;  1JV2 B;  3F9S A;  3PCS A;  4EBG A;  2W0Q A;  5ELJ A;  4O3V A;  4BTW A;  3D3L A;  1OUN A;  2C10 A;  2CG1 A;  4RNZ A;  4N6T A;  4X2O A;  1IU7 A;  3KE7 A;  1LOX A;  1FA3 A;  2CH9 A;  2CWV A;  4J8T A;  4RZM A;  1VQ9 3;  3HIG A;  3RDE A;  1O7H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...