2F99A

Crystal structure of the polyketide cyclase aknh with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
RSEQIAAVRRMVEAYNTGKTDDVADYIHPEYMNPGTLEFTSLRGPELFAINVAWVKKTFSEEARLEEVGIEERADWVRARLVLYGRHVGEMVGMAPTGRLFSGEQIHLLHFVDGKIHHHRDWPDYQGTYRQLGEPWPETEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Aklanonic Acid methyl Ester Cyclase, AknH
publication title Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
pubmed doi rcsb
source organism Streptomyces galilaeus
total genus 44
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.23: Aklanonic acid methyl ester cyclase.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f99A00
3NM2A 3RGRA 3DUKA 3HZPA 3MG3A 2HMLB 4Q53A 2OWPA 1JKGA 2YFJB 4HJLB 5D81A 4HZ9B 5G2GA 2B1XB 1A2KA 4J9AA 2Z77A 3B4PA 3OV4A 5AIGA 2B24B 3H51A 5IERA 1O7HB 1OF5B 4LMIA 1OHPA 3DZLA 5TGNA 3E99A 3DXOA 5HGRA 1UUVB 5JPPA 4N3VA 3FF2A 2F86B 4ORLA 2RGQA 1Z1SA 1GYBA 5IEOA 4WYKA 3F40A 1ULIB 1E3RA 3FH1A 3T8NA 3SEDA 3H3HA 4HM2B 6STDA 2INXA 1NU3A 3M8CA 1ZO2A 2JQ5A 5IG5A 4HKVB 4HM4B 4R9KA 4XBTA 3EBTA 3F9SA 4I4KA 3EBYA 4WP5A 3MG2A 5AEUB 3F7SA 4L8PA 2XSHB 4H3UA 4K1UA 1GY5A 2XRXB 3BLZA 4L7KA 1ASKA 3T8UA 5STDA 2GXFA 5AIIA 5AI1A 3FGYA 3GZYB 1STDA 1AR0A 3OXAA 5DRVA 1O7WB 4HM1B 8CHOA 3JUMA 3D9RA 3VGNA 3MHEA 3UNLA 4PEJA 1HKXA 3FSDA 4HM3B 1EA2A 5AIHA 1O7MB 2BNGA 4FCJA 4MJDA 4U13A 2HMKB 1CQSA 4XDWA 3VSYA 4WYKB 1BUQA 1Q42A 3LZAA 4XBXA 3NUVA 1QJGA 1QMAA 2Z7AA 1UUWB 3K7CA 5DREA 3JUOA 3DMCA 3GRDA 5D83A 1OH0A 1S5AA 1JN5B 3EF8A 1JB4A 5JPUA 4STDA 3KKGA 1ISKA 7STDA 2CHCA 2A15A 1NDOB 3GZRA 4CDLA 1OHOA 3KSPA 5KP4A 2QGUA 5CF2A 1O7PB 3FF0A 4K1VA 1GY6A 3HX8A 1O7GB 3NV0B 5BVBA 4X2OA 3EJVA 3KZTA 3NHXA 3ECFA 3CU3A 3MYTA 5IF6A 3FKAA 4HM8B 4R1KA 3Q90A 1W01A 1ZX2A 2HMJB 1TUHA 2CKFB 5AEWB 2HMOB 2R4IA 3NBRA 2STDA 1OGXA 1JN5A 1OCVA 2HMMB 4GB5A 4OUQA 1Q40B 3HK4A 2GBWB 2HMNB 1WQLB 2BMRB 5IG0A 1W00A 3SOYA 4OVMA 3EN8A 4RZMA 2XR8B 1GY7A 3OWYA 2K54A 1TP6A 3JUNA 4HM0B 3NV0A 1IDPA 3I0YA 5CK6A 5EVHA 1DMMA 1DMQA 3DM8A 4HM5B 4HVNA 4LGQA 3G8ZA 1W02A 2GBXB 2PZVA 3S5CA 1DMNA 1C7HA 3FZWA 5IG3A 5CLKA 5CF1A 2RCDA 3G16A 3LYGA 5FW5A 3FLJA 4X2HA 1VZZA 1Q40A 3GZBA 2XSOB 2I9WA 1GS3A 4HZBB 3EQQB 4XB5A 3ER7A 2YFIB 4XM4A 4IIAA 4HM6B 3IPTA 2Z76A 4HM7B 2IMJA 2W2CA 4L8OA 1OHSA 1OPYA 3F8XA 3B8LA 5IEPA 1U5OA 3WMDA 1O7NB 3K0ZA 3EHCA 3OWUA 5IENA 1EG9B 3MSOA 3OWSA 3JUPA 1E3VA 5AIFA 3GZXB 3STDA 2YFLB 1OGZA 3BB9A 5BXQA 4LEHA 4J8TA 3B7CA 5KP1A 3MKIA 4XDVA 4WWUC 1NWWA 1JB5A 1W6YA 1OUNA 1E97A 3RGAA 3G0KA 3JUQA 3OX9A 2F99A 4FCMA 5KP3A 3NXJA 2BMQB 3F8HA 5CXOA 1ULJB 3CNMA 3MG1A 1OF5A 2GEYA 4KVHA 3F14A 5D82A 2BMOB 4R9LA 3ROBA 1SJWA 2UX0A 3CNXA 2F98A 1JKGB 4XBYA 3F7XA 3KE7A 3UJMA 2GEXA 3EX9A 1K41A 2QIYA 3CPOA 3SOAA 3EN1B 2RFRA 3A76A 3B4OA 1JB2A 3GWRA 5IG4A 3EC9A
chains in the Genus database with same CATH superfamily
1FYSA 3NM2A 2BHMA 3PS8A 2W56A 1AV4A 3RGRA 1AQZA 3DUKA 3NQYA 1LOXA 3HZPA 3MG3A 4LYLB 1BIRA 4TX4A 1TTOA 1CEWI 2IYJA 2SARA 4MEIA 4O2HA 1R4CA 2HMLB 1QVF2 4Q53A 1RNBA 1KQS2 2OWPA 1JKGA 1LNIA 3OW22 3ZG0A 2YFJB 1RGCA 4HJLB 5IW9A 5D81A 1YIJ3 2CK3H 4HZ9B 1YI23 4BTYA 2C11A 5G2GA 1IVXA 1I3IA 3DGOA 2C10A 4WFOA 3KSED 2B1XB 1A2KA 2Y73A 2SBLA 4J9AA 1WTHA 3T0UA 2Z77A 3B4PA 3OV4A 5AIGA 1LOWA 4R4KA 2B24B 1N5PA 1BNIA 4WHAA 1VQL3 1LQGC 2CIUA 3H51A 1EQKA 1DVCA 1GOYA 1FGOA 5IERA 2CFDA 2XGNA 1YJ93 1O7HB 1RGLA 1VQ53 1OF5B 1VQ63 1LRAA 1IVVA 4LMIA 1OHPA 3PCSA 1B27A 2CG1A 3DZLA 5TGNA 3NX0A 2L4VA 1YIT3 3E99A 3DXOA 4K90B 2CG0A 1RKYA 1RJOA 1WMNA 5HGRA 1UUVB 5JPPA 1UCLA 1T2HA 4N3VA 4AKZA 3K9MC 3FF2A 4JF8A 5ELUA 3X42A 1KWIA 2F86B 4ORLA 3PCRA 2RGQA 4HAAA 1Z1SA 1I2FA 3RDEA 3CCU3 1GYBA 2XH9A 3QK9A 1QVG2 4LZIA 1BSAA 1U8CB 1W4NA 5IEOA 1BRKA 3N54B 2FGTA 3Q3FA 1K734 1N8QA 2H0HA 3K63A 4WYKA 2O3OA 3F40A 1ULIB 3AGOA 1E3RA 3FH1A 5G1LA 3LTCA 1W2ZA 2W9PA 3KFQC 3T8NA 1B2ZA 5BIRA 1TFKA 3SEDA 4N6NB 1RGKA 2F5WA 3BNDA 1B21A 1LOVA 3ZFZA 3H3HA 4HM2B 4IT7A 6STDA 1X1WA 2INXA 4I5QA 1KSIA 1NU3A 3M8CA 3CCQ3 1ZO2A 3X40A 1RN1A 1EUIC 1N8R4 2W0QA 2JQ5A 3CCJ3 1NB5I 5IG5A 4N6TA 3V98A 4HKVB 2IA7A 1RCLA 1B2UA 2KF4A 4HM4B 2QA43 2LQVA 4R9KA 4XBTA 3EBTA 3V92A 3F9SA 2KCDA 1BUJA 4I4KA 4QWTA 4G1MB 2BU4A 3EBYA 3MPHA 4WP5A 1V58A 2CWTA 4NHFA 3MG2A 2C4BA 5AEUB 1BGSA 1SPUA 2KRTA 2CX0A 3D5IA 5G1KA 4AEQA 1RN7A 2WO0A 3F7SA 4L8PA 2KF3A 3SVAA 2XSHB 2OQEC 4H3UA 2OQEA 4K1UA 1GY5A 2XRXB 2GSPA 2LYXA 3BLZA 2F56A 4L7KA 2H0IA 4GSPA 1ASKA 1D6ZA 1Q7HA 1RGGA 2OCTA 9RNTA 3Q1CA 2AADA 1HYFA 1UGIA 1N9EA 4FMAA 3T8UA 5STDA 2GXFA 5AIIA 3S29A 1CH0A 5AI1A 2P0XA 3KCHA 3L0RA 3FGYA 1I2EA 2IY2A 1FUSA 1JZDA 3GZYB 2RBIA 1STDA 2OTL3 1I0XA 1IVWA 3CCE3 1GD3A 4BTWA 2KAAA 1YJN3 1AR0A 3X41A 4MMZB 2GU3A 3OXAA 5DRVA 1TJDA 1O7WB 4HM1B 1IQXA 8CHOA 3GAXA 1US1A 2MF7A 1T2IA 2W03A 3JUMA 4OK0A 1SIHA 1EKMA 2CX1A 3D9RA 3EE1A 3VGNA 3D3LA 3MHEA 4O8SA 2KF5A 2E2VA 3UNLA 4PEJA 2D1WA 1I8VA 1TRQA 4EW5A 1BRGA 1HKXA 3FSDA 4HM3B 1W6CA 3NBBA 1EA2A 3SYUA 3CCL3 2CC3A 5AIHA 2KXGA 3DGYA 1FGQA 3FG4A 1O7MB 1X1XA 3BNEA 2BNGA 3G4S3 4FCJA 4MJDA 4U13A 2HMKB 1CQSA 2WGOA 4XDWA 5HOHA 1QAFA 3VSYA 3WA3A 1S723 4N6OB 4WYKB 1BUQA 2BO9B 3G713 2RNTA 3PXMA 2OTJ3 2CFWA 4LSOA 1Q42A 3LZAA 4XBXA 1JBRA 3NUVA 1GMRA 1QJGA 1MWTA 3S67A 1VQQA 1QMAA 1VQN3 1UUGB 1BRNL 2JDIH 2Z7AA 2KF6A 1T3BA 2H0GA 4EXRA 1RCKA 4FMCA 1UUWB 1TIJA 3K7CA 5DREA 1D6UA 1GMQA 3IMAB 3NQZA 3JUOA 1W2B2 1BNRA 3DMCA 3GRDA 3KN4A 1FGTA 1ROAA 1BANA 5D83A 1OH0A 1DETA 1S5AA 2IUKA 1JN5B 3EF8A 3HOHA 1B2MA 1JB4A 3CC73 5JPUA 1STFI 3CD63 3JVCA 3Q2PA 3UB1A 2RSXA 4STDA 1JNQA 1WMPA 1A2PA 1IT7A 3KKGA 1BRJA 3I563 3DGMA 1CYVA 1AVKA 4FR9A 1VQ43 1ISKA 1HZ1A 4AKYA 7STDA 5AYSC 2CHCA 2F4YA 2ZA4A 1M1K4 2A15A 1YJW3 1NDOB 1RTUA 3FCSB 3GZRA 1IVUA 1UW1A 4CDLA 1OHOA 5JBSA 3KSPA 3A5EA 5KP4A 2QGUA 4HOHA 1ROVA 2FNQA 5AYRB 2Q07A 3AHWA 2CW9A 2CWUA 4BL2A 5CF2A 3WODG 1IQYA 2GU1A 2W6JH 1O7PB 3N8BA 4K61A 3FF0A 2CFGA 1GY6A 1MGWA 4K1VA 3HX8A 1O7GB 2E2TA 3NV0B 1VQ93 2OOVC 5BVBA 1C54A 1BRIA 4X2OA 2CH9A 1J2BA 3EJVA 4RNTA 5GSPA 3KZTA 1F8NA 2L1SA 4MMYB 1BRSA 1G02A 3WA2X 1NO3A 4H61A 4DKIA 3S28A 3NHXA 1TU5A 1QAKA 3ECFA 3CU3A 6RNTA 4O02B 3MYTA 1RGHA 1MNLA 1JZOA 5IF6A 2J8XB 3FKAA 3IJEB 1M9GA 1Q9EA 2V1LA 4HM8B 4R1KA 3Q90A 1W01A 3J7Yd 1FW7A 3DGNA 3K5TA 5M19A 1ZX2A 2HMJB 2K3DA 1TUHA 3LTAA 1PYLA 3CC23 2CKFB 5AEWB 2HMOB 3CMA3 1RHLA 2R4IA 4BTXA 1KC84 2XFTA 4ZM8A 3LOYA 3NBRA 2STDA 1OGXA 1JN5A 1N5HA 1OCVA 1Q814 3LH4A 2HMMB 4J5KA 4GB5A 2ZL8A 8RNTA 1IV9A 3U97A 1K9M4 1B2SA 1GMPA 4OUQA 1Q40B 1K8A4 1FGRA 1LQMB 3HK4A 2GBWB 4N6V0 1MWRA 2HMNB 1RSNA 1WQLB 1I3FA 2W04A 2BIRA 2BMRB 2Z6BA 5IG0A 1OACA 1W00A 1SIIA 3SOYA 3DGLA 4OVMA 3EN8A 1Q7Y4 4RZMA 1B2XA 2XR8B 3U1WA 1GY7A 1T5YA 1W6GA 1DYUA 2WGQA 3OWYA 3WOEB 1N9JA 2K54A 1IYYA 1YGEA 1TP6A 1Y4KA 4FMDA 1VQP3 3AMOA 3JUNA 3CPW2 1FGMA 2R41A 1R4YA 2XF3A 4HM0B 2XEPA 3BNBA 3NV0A 1IDPA 3I0YA 5CK6A 3WDGB 4EYCA 3UL5A 1TRPA 1ZS7A 2BT3A 3MWZA 5RNTA 1MWSA 2UUGC 1BNGA 3EB8A 4HBRA 4EBGA 4N6UA 5EVHA 1DMMA 1UI7A 5FGOA 1DMQA 2PNCA 1RGEA 2E2UA 3DM8A 4HM5B 4HVNA 4LGQA 1G0TA 1JBTA 3G8ZA 1W02A 2GBXB 3LTDA 2PZVA 3ALAA 3S5CA 1DMNA 1C7HA 3O8YA 3FZWA 1UI8A 3D4AA 5IG3A 2CWVA 3DH2A 4EV2A 4KFFA 1VQM3 3BU4A 1YHQ3 5CLKA 4GHOA 4BU4A 5CF1A 2RCDA 3G16A 3LYGA 1FZUA 2UGIA 5FW5A 3FLJA 4BL3A 1I70A 1A2VA 1SQWA 4X2HA 3LT9A 1VZZA 1Q40A 3NM7A 1UCJA 2O9UX 6GSPA 3GZBA 2XSOB 4HYZA 2I9WA 1NB3I 1YVSA 5I97A 3DY5A 3FG1A 3PGBA 1I0VA 3LMLA 1GS3A 2F5MA 3CCR3 3CCV3 4J5GA 1FUWA 1DE3A 4HZBB 1AVLA 3EQQB 2MC8A 1FA3A 4XB5A 3ER7A 1BSCA 1GSPA 1UGHI 1A90A 1FUTA 1PFPA 2YFIB 3CCM3 1G96A 1D6YA 1UCIA 1PY3A 4HM6B 1W7CA 4IIAA 4O3VA 4KFDA 1MWUA 4XM4A 4CPKA 3WOFB 1HU9A 1Q824 1JBSA 3SX1A 3IPTA 2Z76A 4HM7B 4MMXB 1IK3A 3AHSA 1YGWA 2IMJA 2P09A 2W2CA 4L8OA 4RNYA 1YNVX 1OHSA 4IPBA 1EEJA 1RNTA 1DVDA 1RGAA 1IU7A 1OPYA 1BSBA 1PU4A 3F8XA 3URPA 2ML6A 1X1UA 2QEX3 3V99A 1GOUA 3B8LA 1LNHA 2D42A 2P0MA 7RNTA 5IEPA 1U5OA 2ZHXB 3HIIA 4RBNA 1M904 3WMDA 3GSPA 1O7NB 3K0ZA 3EHCA 3NBJA 3OWUA 3AMOB 5IENA 1EG9B 3MSOA 2ZDJA 1RMSA 3OWSA 1BNFA 3JUPA 1RGFA 1E3VA 3TDGA 1GOVA 1IT8A 1GD4A 5AIFA 2OOVA 2WOHA 3GZXB 4KFEA 3STDA 2YFLB 1OGZA 3BB9A 5BXQA 3CC43 4LEHA 1MGRA 3SLUA 4JRFA 1IQ8A 3BNCA 4CJNA 1KD14 2HOHA 4J8TA 3B7CA 5BU4A 5KP1A 1BSDA 4BIRA 3MKIA 4XDVA 4WWUC 1NWWA 4N6MA 1VQO3 3BIRA 1JB5A 1W6YA 3WR2A 1OUNA 3SXXA 2ML5A 1E97A 3ZG5A 3D5GA 4GL6A 4R80A 1L5GB 1A67A 1BVIA 1JRQA 1W5ZA 1X1YA 1BAOA 3D79A 3G0KA 3JUQA 1RRLA 1NNVA 3RGAA 3WHOA 3G6E3 3OX9A 2F99A 1BNJA 2M7OA 1TFOA 3PZWA 4FCMA 5KP3A 3X3ZA 4FMBA 3NXJA 3CXC2 2BMQB 3LT8A 5A0OB 3F8HA 3S27A 1RN4A 1RLSA 4NPBA 1LXEA 1ULJB 5CXOA 3VF1A 3CNMA 5EQLA 1YVBI 2K0MA 2XGLA 3MG1A 1QALA 4EV5A 2CFLA 4CCVA 1BNEA 2YX9A 5M1AA 5EEOA 1LOYA 5M18A 1BSEA 2Y74A 1VQK3 2W56B 4NREA 3AGNA 1VQ73 4FCZA 2FXTA 1OF5A 2GEYA 4RNZA 4KVHA 5LC6A 3F14A 1B3SA 5D82A 3HI7A 4N6LA 2BMOB 1VQ83 1LVNA 4R9LA 3ROBA 1SJWA 1ZGXA 2UX0A 3CNXA 1RRHA 2F98A 1JKGB 3RNTA 1I2GA 1BU4A 4XBYA 1WMOA 3F7XA 3KE7A 3UL6A 2P38A 5LC7A 4EC6A 1BRHA 2CFKA 3KIIA 1UDII 1BOXA 3UJMA 2GEXA 3X3XA 2XFSA 1V74A 1BNSA 2WOFA 5ELJA 1JV2B 1SARA 2P05A 3EX9A 1UCKA 2AAEA 3FG3A 1WNHA 3PYJA 1NJI4 2IUJA 1K41A 1K28A 1V57A 2QIYA 1RDSA 4KZ1A 7GSPA 1MOLA 1B20A 1Q864 3QRDA 3CCS3 3CPOA 3SOAA 3I553 3EN1B 1IV7A 2RFRA 3A76A 3HIGA 1AY7A 4ILFA 3B4OA 1JB2A 3GWRA 3LXUX 3N9HA 3X3YA 3CME3 1CYUA 5IG4A 3LTBA 2W9QA 1JJ22 4KT3B 1M1XB 3EC9A
chains in the Genus database with same CATH topology
3NM2A 2BHMA 3PS8A 2W56A 1AV4A 3RGRA 3DUKA 3NQYA 1LOXA 3HZPA 3MG3A 4TX4A 1CEWI 1QVF2 4MEIA 4O2HA 1R4CA 2HMLB 4Q53A 1KQS2 2OWPA 1JKGA 3OW22 2YFJB 4HJLB 5IW9A 1YIJ3 5D81A 2CK3H 4HZ9B 1YI23 4BTYA 2C11A 5G2GA 1IVXA 3DGOA 2C10A 4WFOA 3KSED 2B1XB 1A2KA 2Y73A 2SBLA 4J9AA 1WTHA 3T0UA 2Z77A 3B4PA 3OV4A 5AIGA 4R4KA 2B24B 1N5PA 4WHAA 1VQL3 2CIUA 3H51A 1EQKA 1DVCA 1FGOA 5IERA 2CFDA 2XGNA 1YJ93 1O7HB 1VQ53 1VQ63 1OF5B 1IVVA 4LMIA 1OHPA 3PCSA 2CG1A 3DZLA 5TGNA 3NX0A 2L4VA 1YIT3 3E99A 3DXOA 4K90B 2CG0A 1RKYA 1RJOA 1WMNA 5HGRA 1UUVB 5JPPA 4N3VA 4AKZA 3K9MC 3FF2A 4JF8A 5ELUA 3X42A 1KWIA 2F86B 4ORLA 3PCRA 2RGQA 1Z1SA 3RDEA 3CCU3 1GYBA 2XH9A 3QK9A 1QVG2 4LZIA 1U8CB 1W4NA 5IEOA 3N54B 2FGTA 1K734 1N8QA 3K63A 4WYKA 2O3OA 3F40A 1ULIB 1E3RA 3FH1A 3LTCA 1W2ZA 2W9PA 3KFQC 3T8NA 1TFKA 3SEDA 4N6NB 3BNDA 3H3HA 4HM2B 4IT7A 6STDA 2INXA 1KSIA 1NU3A 3M8CA 3CCQ3 1ZO2A 3X40A 1N8R4 2W0QA 2JQ5A 3CCJ3 5IG5A 4N6TA 3V98A 4HKVB 2IA7A 2QA43 4HM4B 2LQVA 4R9KA 4XBTA 3EBTA 3V92A 3F9SA 2KCDA 4I4KA 4QWTA 4G1MB 3EBYA 3MPHA 4WP5A 2CWTA 4NHFA 3MG2A 5AEUB 1SPUA 2KRTA 4AEQA 1RN7A 2WO0A 3F7SA 4L8PA 3SVAA 2XSHB 2OQEC 4H3UA 2OQEA 4K1UA 1GY5A 2XRXB 2LYXA 3BLZA 4L7KA 1ASKA 1D6ZA 2OCTA 3Q1CA 1N9EA 4FMAA 3T8UA 5STDA 2GXFA 5AIIA 3S29A 5AI1A 2P0XA 3L0RA 3FGYA 2OTL3 3GZYB 1STDA 1IVWA 3CCE3 1GD3A 4BTWA 1YJN3 1AR0A 3X41A 4MMZB 2GU3A 3OXAA 5DRVA 1O7WB 4HM1B 1IQXA 8CHOA 3GAXA 1US1A 2MF7A 2W03A 3JUMA 4OK0A 1SIHA 1EKMA 3D9RA 3EE1A 3VGNA 3D3LA 3MHEA 4O8SA 3UNLA 2E2VA 4PEJA 2D1WA 1HKXA 3FSDA 4HM3B 1W6CA 3NBBA 1EA2A 3CCL3 2CC3A 5AIHA 2KXGA 1FGQA 3FG4A 1O7MB 3BNEA 2BNGA 3G4S3 4FCJA 4MJDA 4U13A 2HMKB 1CQSA 2WGOA 4XDWA 3WA3A 1QAFA 3VSYA 1S723 4N6OB 4WYKB 1BUQA 2BO9B 3G713 3PXMA 2OTJ3 2CFWA 4LSOA 1Q42A 3LZAA 4XBXA 3NUVA 1QJGA 3S67A 1QMAA 1VQN3 2JDIH 2Z7AA 4EXRA 4FMCA 1UUWB 1TIJA 3K7CA 5DREA 1D6UA 3IMAB 3NQZA 3JUOA 1W2B2 3DMCA 3GRDA 3KN4A 1FGTA 1ROAA 5D83A 1OH0A 1S5AA 2IUKA 1JN5B 3EF8A 1JB4A 3CC73 5JPUA 1STFI 3CD63 3JVCA 3Q2PA 3UB1A 2RSXA 4STDA 1JNQA 1WMPA 1IT7A 3KKGA 3I563 3DGMA 1CYVA 1AVKA 4FR9A 1VQ43 1ISKA 4AKYA 7STDA 5AYSC 2CHCA 1M1K4 2A15A 1YJW3 1NDOB 3FCSB 3GZRA 1IVUA 1UW1A 4CDLA 1OHOA 5JBSA 3KSPA 5KP4A 2QGUA 5AYRB 1ROVA 2FNQA 2Q07A 2CW9A 2CWUA 5CF2A 3WODG 1IQYA 2GU1A 2W6JH 1O7PB 3N8BA 4K61A 3FF0A 2CFGA 1GY6A 4K1VA 3HX8A 1O7GB 2E2TA 3NV0B 1VQ93 2OOVC 5BVBA 4X2OA 2CH9A 1J2BA 3EJVA 1NB5I 3KZTA 1F8NA 3WA2X 4MMYB 1NO3A 4H61A 3S28A 3NHXA 1TU5A 1QAKA 3ECFA 3CU3A 4O02B 3MYTA 1MNLA 5IF6A 3FKAA 3IJEB 1M9GA 2V1LA 4HM8B 4R1KA 3Q90A 1W01A 3J7Yd 3DGNA 3K5TA 1ZX2A 2HMJB 1TUHA 3LTAA 3CC23 2CKFB 5AEWB 2HMOB 3CMA3 2R4IA 4BTXA 1KC84 2XFTA 4ZM8A 3LOYA 3NBRA 2STDA 1OGXA 1JN5A 1N5HA 1OCVA 1Q814 3LH4A 2HMMB 4GB5A 2ZL8A 1K9M4 1IV9A 3U97A 1K8A4 4OUQA 1Q40B 1FGRA 3HK4A 2GBWB 4N6V0 2HMNB 1WQLB 2W04A 2BMRB 2Z6BA 5IG0A 1OACA 1W00A 1SIIA 3SOYA 3DGLA 4OVMA 3EN8A 1Q7Y4 4RZMA 2XR8B 3U1WA 1GY7A 1T5YA 1W6GA 1DYUA 2WGQA 3OWYA 3WOEB 1N9JA 2K54A 1YGEA 1TP6A 1Y4KA 4FMDA 1VQP3 3AMOA 3JUNA 3CPW2 1FGMA 2XF3A 4HM0B 2XEPA 3BNBA 3NV0A 1IDPA 3I0YA 5CK6A 3WDGB 4EYCA 3UL5A 2BT3A 3MWZA 3EB8A 4HBRA 4EBGA 4N6UA 5EVHA 1DMMA 1UI7A 5FGOA 1DMQA 2PNCA 2E2UA 3DM8A 4HM5B 4HVNA 4LGQA 3G8ZA 1W02A 2GBXB 3LTDA 2PZVA 3ALAA 3S5CA 1DMNA 1C7HA 3O8YA 3FZWA 1UI8A 5IG3A 2CWVA 4EV2A 4KFFA 1VQM3 1YHQ3 5CLKA 5CF1A 2RCDA 3G16A 3LYGA 5FW5A 3FLJA 1SQWA 1A2VA 4X2HA 3LT9A 1VZZA 1Q40A 3NM7A 2O9UX 3GZBA 2XSOB 4HYZA 2I9WA 1NB3I 5I97A 3DY5A 3FG1A 3PGBA 3LMLA 1GS3A 3CCR3 3CCV3 1FUWA 4HZBB 1AVLA 3EQQB 2MC8A 1FA3A 4XB5A 3ER7A 1A90A 1PFPA 2YFIB 3CCM3 1G96A 1D6YA 4XM4A 4IIAA 4HM6B 1W7CA 4O3VA 4KFDA 3WOFB 1HU9A 1Q824 3SX1A 3IPTA 2Z76A 4HM7B 4MMXB 1IK3A 2IMJA 2P09A 2W2CA 4L8OA 4RNYA 1OHSA 4IPBA 1DVDA 1IU7A 1OPYA 1PU4A 3F8XA 2ML6A 2QEX3 3V99A 3B8LA 1LNHA 2D42A 2P0MA 5IEPA 1U5OA 4RBNA 3HIIA 1M904 3WMDA 1O7NB 3K0ZA 3EHCA 3NBJA 3OWUA 3AMOB 5IENA 1EG9B 3MSOA 2ZDJA 3OWSA 3JUPA 1E3VA 3TDGA 1IT8A 1GD4A 5AIFA 2OOVA 2WOHA 3GZXB 4KFEA 3STDA 2YFLB 1OGZA 3BB9A 5BXQA 3CC43 4LEHA 3SLUA 4JRFA 1IQ8A 3BNCA 1KD14 4J8TA 3B7CA 5KP1A 3MKIA 4XDVA 4WWUC 1NWWA 4N6MA 1VQO3 1JB5A 1W6YA 1OUNA 3SXXA 2ML5A 1E97A 4GL6A 4R80A 1L5GB 1A67A 1JRQA 1W5ZA 3RGAA 3G0KA 3JUQA 1RRLA 3G6E3 3OX9A 2F99A 2M7OA 1TFOA 3PZWA 4FCMA 5KP3A 3X3ZA 4FMBA 3NXJA 3CXC2 2BMQB 3LT8A 5A0OB 3F8HA 3S27A 5CXOA 3VF1A 1LXEA 1ULJB 3CNMA 5EQLA 1YVBI 2K0MA 2XGLA 3MG1A 1QALA 4EV5A 2CFLA 4CCVA 2YX9A 5EEOA 2Y74A 1VQK3 2W56B 4NREA 1VQ73 4FCZA 2FXTA 1OF5A 2GEYA 4RNZA 4KVHA 5LC6A 3F14A 5D82A 3HI7A 4N6LA 2BMOB 1VQ83 1LVNA 4R9LA 3ROBA 1SJWA 2UX0A 3CNXA 1RRHA 2F98A 1JKGB 4XBYA 1WMOA 3F7XA 3KE7A 3UL6A 2P38A 5LC7A 4EC6A 2CFKA 3KIIA 3UJMA 2GEXA 3X3XA 2XFSA 1V74A 2WOFA 5ELJA 1JV2B 2P05A 3EX9A 3FG3A 1WNHA 3PYJA 1NJI4 2IUJA 1K41A 1K28A 2QIYA 4KZ1A 1MOLA 1Q864 3QRDA 3CCS3 3CPOA 3SOAA 3I553 3EN1B 1IV7A 2RFRA 3A76A 3HIGA 3CME3 3B4OA 1JB2A 3GWRA 3LXUX 3N9HA 3X3YA 1CYUA 5IG4A 3LTBA 2W9QA 1JJ22 1M1XB 3EC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NM2 A;  3RGR A;  3DUK A;  3HZP A;  3MG3 A;  2HML B;  4Q53 A;  2OWP A;  1JKG A;  2YFJ B;  4HJL B;  5D81 A;  4HZ9 B;  5G2G A;  2B1X B;  1A2K A;  4J9A A;  2Z77 A;  3B4P A;  3OV4 A;  5AIG A;  2B24 B;  3H51 A;  5IER A;  1O7H B;  1OF5 B;  4LMI A;  1OHP A;  3DZL A;  5TGN A;  3E99 A;  3DXO A;  5HGR A;  1UUV B;  5JPP A;  4N3V A;  3FF2 A;  2F86 B;  4ORL A;  2RGQ A;  1Z1S A;  1GYB A;  5IEO A;  4WYK A;  3F40 A;  1ULI B;  1E3R A;  3FH1 A;  3T8N A;  3SED A;  3H3H A;  4HM2 B;  6STD A;  2INX A;  1NU3 A;  3M8C A;  1ZO2 A;  2JQ5 A;  5IG5 A;  4HKV B;  4HM4 B;  4R9K A;  4XBT A;  3EBT A;  3F9S A;  4I4K A;  3EBY A;  4WP5 A;  3MG2 A;  5AEU B;  3F7S A;  4L8P A;  2XSH B;  4H3U A;  4K1U A;  1GY5 A;  2XRX B;  3BLZ A;  4L7K A;  1ASK A;  3T8U A;  5STD A;  2GXF A;  5AII A;  5AI1 A;  3FGY A;  3GZY B;  1STD A;  1AR0 A;  3OXA A;  5DRV A;  1O7W B;  4HM1 B;  8CHO A;  3JUM A;  3D9R A;  3VGN A;  3MHE A;  3UNL A;  4PEJ A;  1HKX A;  3FSD A;  4HM3 B;  1EA2 A;  5AIH A;  1O7M B;  2BNG A;  4FCJ A;  4MJD A;  4U13 A;  2HMK B;  1CQS A;  4XDW A;  3VSY A;  4WYK B;  1BUQ A;  1Q42 A;  3LZA A;  4XBX A;  3NUV A;  1QJG A;  1QMA A;  2Z7A A;  1UUW B;  3K7C A;  5DRE A;  3JUO A;  3DMC A;  3GRD A;  5D83 A;  1OH0 A;  1S5A A;  1JN5 B;  3EF8 A;  1JB4 A;  5JPU A;  4STD A;  3KKG A;  1ISK A;  7STD A;  2CHC A;  2A15 A;  1NDO B;  3GZR A;  4CDL A;  1OHO A;  3KSP A;  5KP4 A;  2QGU A;  5CF2 A;  1O7P B;  3FF0 A;  4K1V A;  1GY6 A;  3HX8 A;  1O7G B;  3NV0 B;  5BVB A;  4X2O A;  3EJV A;  3KZT A;  3NHX A;  3ECF A;  3CU3 A;  3MYT A;  5IF6 A;  3FKA A;  4HM8 B;  4R1K A;  3Q90 A;  1W01 A;  1ZX2 A;  2HMJ B;  1TUH A;  2CKF B;  5AEW B;  2HMO B;  2R4I A;  3NBR A;  2STD A;  1OGX A;  1JN5 A;  1OCV A;  2HMM B;  4GB5 A;  4OUQ A;  1Q40 B;  3HK4 A;  2GBW B;  2HMN B;  1WQL B;  2BMR B;  5IG0 A;  1W00 A;  3SOY A;  4OVM A;  3EN8 A;  4RZM A;  2XR8 B;  1GY7 A;  3OWY A;  2K54 A;  1TP6 A;  3JUN A;  4HM0 B;  3NV0 A;  1IDP A;  3I0Y A;  5CK6 A;  5EVH A;  1DMM A;  1DMQ A;  3DM8 A;  4HM5 B;  4HVN A;  4LGQ A;  3G8Z A;  1W02 A;  2GBX B;  2PZV A;  3S5C A;  1DMN A;  1C7H A;  3FZW A;  5IG3 A;  5CLK A;  5CF1 A;  2RCD A;  3G16 A;  3LYG A;  5FW5 A;  3FLJ A;  4X2H A;  1VZZ A;  1Q40 A;  3GZB A;  2XSO B;  2I9W A;  1GS3 A;  4HZB B;  3EQQ B;  4XB5 A;  3ER7 A;  2YFI B;  4XM4 A;  4IIA A;  4HM6 B;  3IPT A;  2Z76 A;  4HM7 B;  2IMJ A;  2W2C A;  4L8O A;  1OHS A;  1OPY A;  3F8X A;  3B8L A;  5IEP A;  1U5O A;  3WMD A;  1O7N B;  3K0Z A;  3EHC A;  3OWU A;  5IEN A;  1EG9 B;  3MSO A;  3OWS A;  3JUP A;  1E3V A;  5AIF A;  3GZX B;  3STD A;  2YFL B;  1OGZ A;  3BB9 A;  5BXQ A;  4LEH A;  4J8T A;  3B7C A;  5KP1 A;  3MKI A;  4XDV A;  4WWU C;  1NWW A;  1JB5 A;  1W6Y A;  1OUN A;  1E97 A;  3RGA A;  3G0K A;  3JUQ A;  3OX9 A;  2F99 A;  4FCM A;  5KP3 A;  3NXJ A;  2BMQ B;  3F8H A;  5CXO A;  1ULJ B;  3CNM A;  3MG1 A;  1OF5 A;  2GEY A;  4KVH A;  3F14 A;  5D82 A;  2BMO B;  4R9L A;  3ROB A;  1SJW A;  2UX0 A;  3CNX A;  2F98 A;  1JKG B;  4XBY A;  3F7X A;  3KE7 A;  3UJM A;  2GEX A;  3EX9 A;  1K41 A;  2QIY A;  3CPO A;  3SOA A;  3EN1 B;  2RFR A;  3A76 A;  3B4O A;  1JB2 A;  3GWR A;  5IG4 A;  3EC9 A; 
#chains in the Genus database with same CATH topology
 1FYS A;  3NM2 A;  2BHM A;  3PS8 A;  2W56 A;  1AV4 A;  3RGR A;  1AQZ A;  3DUK A;  3NQY A;  1LOX A;  3HZP A;  3MG3 A;  4LYL B;  1BIR A;  4TX4 A;  1TTO A;  1CEW I;  2IYJ A;  2SAR A;  4MEI A;  4O2H A;  1R4C A;  2HML B;  1QVF 2;  4Q53 A;  1RNB A;  1KQS 2;  2OWP A;  1JKG A;  1LNI A;  3OW2 2;  3ZG0 A;  2YFJ B;  1RGC A;  4HJL B;  5IW9 A;  5D81 A;  1YIJ 3;  2CK3 H;  4HZ9 B;  1YI2 3;  4BTY A;  2C11 A;  5G2G A;  1IVX A;  1I3I A;  3DGO A;  2C10 A;  4WFO A;  3KSE D;  2B1X B;  1A2K A;  2Y73 A;  2SBL A;  4J9A A;  1WTH A;  3T0U A;  2Z77 A;  3B4P A;  3OV4 A;  5AIG A;  1LOW A;  4R4K A;  2B24 B;  1N5P A;  1BNI A;  4WHA A;  1VQL 3;  1LQG C;  2CIU A;  3H51 A;  1EQK A;  1DVC A;  1GOY A;  1FGO A;  5IER A;  2CFD A;  2XGN A;  1YJ9 3;  1O7H B;  1RGL A;  1VQ5 3;  1OF5 B;  1VQ6 3;  1LRA A;  1IVV A;  4LMI A;  1OHP A;  3PCS A;  1B27 A;  2CG1 A;  3DZL A;  5TGN A;  3NX0 A;  2L4V A;  1YIT 3;  3E99 A;  3DXO A;  4K90 B;  2CG0 A;  1RKY A;  1RJO A;  1WMN A;  5HGR A;  1UUV B;  5JPP A;  1UCL A;  1T2H A;  4N3V A;  4AKZ A;  3K9M C;  3FF2 A;  4JF8 A;  5ELU A;  3X42 A;  1KWI A;  2F86 B;  4ORL A;  3PCR A;  2RGQ A;  4HAA A;  1Z1S A;  1I2F A;  3RDE A;  3CCU 3;  1GYB A;  2XH9 A;  3QK9 A;  1QVG 2;  4LZI A;  1BSA A;  1U8C B;  1W4N A;  5IEO A;  1BRK A;  3N54 B;  2FGT A;  3Q3F A;  1K73 4;  1N8Q A;  2H0H A;  3K63 A;  4WYK A;  2O3O A;  3F40 A;  1ULI B;  3AGO A;  1E3R A;  3FH1 A;  5G1L A;  3LTC A;  1W2Z A;  2W9P A;  3KFQ C;  3T8N A;  1B2Z A;  5BIR A;  1TFK A;  3SED A;  4N6N B;  1RGK A;  2F5W A;  3BND A;  1B21 A;  1LOV A;  3ZFZ A;  3H3H A;  4HM2 B;  4IT7 A;  6STD A;  1X1W A;  2INX A;  4I5Q A;  1KSI A;  1NU3 A;  3M8C A;  3CCQ 3;  1ZO2 A;  3X40 A;  1RN1 A;  1EUI C;  1N8R 4;  2W0Q A;  2JQ5 A;  3CCJ 3;  1NB5 I;  5IG5 A;  4N6T A;  3V98 A;  4HKV B;  2IA7 A;  1RCL A;  1B2U A;  2KF4 A;  4HM4 B;  2QA4 3;  2LQV A;  4R9K A;  4XBT A;  3EBT A;  3V92 A;  3F9S A;  2KCD A;  1BUJ A;  4I4K A;  4QWT A;  4G1M B;  2BU4 A;  3EBY A;  3MPH A;  4WP5 A;  1V58 A;  2CWT A;  4NHF A;  3MG2 A;  2C4B A;  5AEU B;  1BGS A;  1SPU A;  2KRT A;  2CX0 A;  3D5I A;  5G1K A;  4AEQ A;  1RN7 A;  2WO0 A;  3F7S A;  4L8P A;  2KF3 A;  3SVA A;  2XSH B;  2OQE C;  4H3U A;  2OQE A;  4K1U A;  1GY5 A;  2XRX B;  2GSP A;  2LYX A;  3BLZ A;  2F56 A;  4L7K A;  2H0I A;  4GSP A;  1ASK A;  1D6Z A;  1Q7H A;  1RGG A;  2OCT A;  9RNT A;  3Q1C A;  2AAD A;  1HYF A;  1UGI A;  1N9E A;  4FMA A;  3T8U A;  5STD A;  2GXF A;  5AII A;  3S29 A;  1CH0 A;  5AI1 A;  2P0X A;  3KCH A;  3L0R A;  3FGY A;  1I2E A;  2IY2 A;  1FUS A;  1JZD A;  3GZY B;  2RBI A;  1STD A;  2OTL 3;  1I0X A;  1IVW A;  3CCE 3;  1GD3 A;  4BTW A;  2KAA A;  1YJN 3;  1AR0 A;  3X41 A;  4MMZ B;  2GU3 A;  3OXA A;  5DRV A;  1TJD A;  1O7W B;  4HM1 B;  1IQX A;  8CHO A;  3GAX A;  1US1 A;  2MF7 A;  1T2I A;  2W03 A;  3JUM A;  4OK0 A;  1SIH A;  1EKM A;  2CX1 A;  3D9R A;  3EE1 A;  3VGN A;  3D3L A;  3MHE A;  4O8S A;  2KF5 A;  2E2V A;  3UNL A;  4PEJ A;  2D1W A;  1I8V A;  1TRQ A;  4EW5 A;  1BRG A;  1HKX A;  3FSD A;  4HM3 B;  1W6C A;  3NBB A;  1EA2 A;  3SYU A;  3CCL 3;  2CC3 A;  5AIH A;  2KXG A;  3DGY A;  1FGQ A;  3FG4 A;  1O7M B;  1X1X A;  3BNE A;  2BNG A;  3G4S 3;  4FCJ A;  4MJD A;  4U13 A;  2HMK B;  1CQS A;  2WGO A;  4XDW A;  5HOH A;  1QAF A;  3VSY A;  3WA3 A;  1S72 3;  4N6O B;  4WYK B;  1BUQ A;  2BO9 B;  3G71 3;  2RNT A;  3PXM A;  2OTJ 3;  2CFW A;  4LSO A;  1Q42 A;  3LZA A;  4XBX A;  1JBR A;  3NUV A;  1GMR A;  1QJG A;  1MWT A;  3S67 A;  1VQQ A;  1QMA A;  1VQN 3;  1UUG B;  1BRN L;  2JDI H;  2Z7A A;  2KF6 A;  1T3B A;  2H0G A;  4EXR A;  1RCK A;  4FMC A;  1UUW B;  1TIJ A;  3K7C A;  5DRE A;  1D6U A;  1GMQ A;  3IMA B;  3NQZ A;  3JUO A;  1W2B 2;  1BNR A;  3DMC A;  3GRD A;  3KN4 A;  1FGT A;  1ROA A;  1BAN A;  5D83 A;  1OH0 A;  1DET A;  1S5A A;  2IUK A;  1JN5 B;  3EF8 A;  3HOH A;  1B2M A;  1JB4 A;  3CC7 3;  5JPU A;  1STF I;  3CD6 3;  3JVC A;  3Q2P A;  3UB1 A;  2RSX A;  4STD A;  1JNQ A;  1WMP A;  1A2P A;  1IT7 A;  3KKG A;  1BRJ A;  3I56 3;  3DGM A;  1CYV A;  1AVK A;  4FR9 A;  1VQ4 3;  1ISK A;  1HZ1 A;  4AKY A;  7STD A;  5AYS C;  2CHC A;  2F4Y A;  2ZA4 A;  1M1K 4;  2A15 A;  1YJW 3;  1NDO B;  1RTU A;  3FCS B;  3GZR A;  1IVU A;  1UW1 A;  4CDL A;  1OHO A;  5JBS A;  3KSP A;  3A5E A;  5KP4 A;  2QGU A;  4HOH A;  1ROV A;  2FNQ A;  5AYR B;  2Q07 A;  3AHW A;  2CW9 A;  2CWU A;  4BL2 A;  5CF2 A;  3WOD G;  1IQY A;  2GU1 A;  2W6J H;  1O7P B;  3N8B A;  4K61 A;  3FF0 A;  2CFG A;  1GY6 A;  1MGW A;  4K1V A;  3HX8 A;  1O7G B;  2E2T A;  3NV0 B;  1VQ9 3;  2OOV C;  5BVB A;  1C54 A;  1BRI A;  4X2O A;  2CH9 A;  1J2B A;  3EJV A;  4RNT A;  5GSP A;  3KZT A;  1F8N A;  2L1S A;  4MMY B;  1BRS A;  1G02 A;  3WA2 X;  1NO3 A;  4H61 A;  4DKI A;  3S28 A;  3NHX A;  1TU5 A;  1QAK A;  3ECF A;  3CU3 A;  6RNT A;  4O02 B;  3MYT A;  1RGH A;  1MNL A;  1JZO A;  5IF6 A;  2J8X B;  3FKA A;  3IJE B;  1M9G A;  1Q9E A;  2V1L A;  4HM8 B;  4R1K A;  3Q90 A;  1W01 A;  3J7Y d;  1FW7 A;  3DGN A;  3K5T A;  5M19 A;  1ZX2 A;  2HMJ B;  2K3D A;  1TUH A;  3LTA A;  1PYL A;  3CC2 3;  2CKF B;  5AEW B;  2HMO B;  3CMA 3;  1RHL A;  2R4I A;  4BTX A;  1KC8 4;  2XFT A;  4ZM8 A;  3LOY A;  3NBR A;  2STD A;  1OGX A;  1JN5 A;  1N5H A;  1OCV A;  1Q81 4;  3LH4 A;  2HMM B;  4J5K A;  4GB5 A;  2ZL8 A;  8RNT A;  1IV9 A;  3U97 A;  1K9M 4;  1B2S A;  1GMP A;  4OUQ A;  1Q40 B;  1K8A 4;  1FGR A;  1LQM B;  3HK4 A;  2GBW B;  4N6V 0;  1MWR A;  2HMN B;  1RSN A;  1WQL B;  1I3F A;  2W04 A;  2BIR A;  2BMR B;  2Z6B A;  5IG0 A;  1OAC A;  1W00 A;  1SII A;  3SOY A;  3DGL A;  4OVM A;  3EN8 A;  1Q7Y 4;  4RZM A;  1B2X A;  2XR8 B;  3U1W A;  1GY7 A;  1T5Y A;  1W6G A;  1DYU A;  2WGQ A;  3OWY A;  3WOE B;  1N9J A;  2K54 A;  1IYY A;  1YGE A;  1TP6 A;  1Y4K A;  4FMD A;  1VQP 3;  3AMO A;  3JUN A;  3CPW 2;  1FGM A;  2R41 A;  1R4Y A;  2XF3 A;  4HM0 B;  2XEP A;  3BNB A;  3NV0 A;  1IDP A;  3I0Y A;  5CK6 A;  3WDG B;  4EYC A;  3UL5 A;  1TRP A;  1ZS7 A;  2BT3 A;  3MWZ A;  5RNT A;  1MWS A;  2UUG C;  1BNG A;  3EB8 A;  4HBR A;  4EBG A;  4N6U A;  5EVH A;  1DMM A;  1UI7 A;  5FGO A;  1DMQ A;  2PNC A;  1RGE A;  2E2U A;  3DM8 A;  4HM5 B;  4HVN A;  4LGQ A;  1G0T A;  1JBT A;  3G8Z A;  1W02 A;  2GBX B;  3LTD A;  2PZV A;  3ALA A;  3S5C A;  1DMN A;  1C7H A;  3O8Y A;  3FZW A;  1UI8 A;  3D4A A;  5IG3 A;  2CWV A;  3DH2 A;  4EV2 A;  4KFF A;  1VQM 3;  3BU4 A;  1YHQ 3;  5CLK A;  4GHO A;  4BU4 A;  5CF1 A;  2RCD A;  3G16 A;  3LYG A;  1FZU A;  2UGI A;  5FW5 A;  3FLJ A;  4BL3 A;  1I70 A;  1A2V A;  1SQW A;  4X2H A;  3LT9 A;  1VZZ A;  1Q40 A;  3NM7 A;  1UCJ A;  2O9U X;  6GSP A;  3GZB A;  2XSO B;  4HYZ A;  2I9W A;  1NB3 I;  1YVS A;  5I97 A;  3DY5 A;  3FG1 A;  3PGB A;  1I0V A;  3LML A;  1GS3 A;  2F5M A;  3CCR 3;  3CCV 3;  4J5G A;  1FUW A;  1DE3 A;  4HZB B;  1AVL A;  3EQQ B;  2MC8 A;  1FA3 A;  4XB5 A;  3ER7 A;  1BSC A;  1GSP A;  1UGH I;  1A90 A;  1FUT A;  1PFP A;  2YFI B;  3CCM 3;  1G96 A;  1D6Y A;  1UCI A;  1PY3 A;  4HM6 B;  1W7C A;  4IIA A;  4O3V A;  4KFD A;  1MWU A;  4XM4 A;  4CPK A;  3WOF B;  1HU9 A;  1Q82 4;  1JBS A;  3SX1 A;  3IPT A;  2Z76 A;  4HM7 B;  4MMX B;  1IK3 A;  3AHS A;  1YGW A;  2IMJ A;  2P09 A;  2W2C A;  4L8O A;  4RNY A;  1YNV X;  1OHS A;  4IPB A;  1EEJ A;  1RNT A;  1DVD A;  1RGA A;  1IU7 A;  1OPY A;  1BSB A;  1PU4 A;  3F8X A;  3URP A;  2ML6 A;  1X1U A;  2QEX 3;  3V99 A;  1GOU A;  3B8L A;  1LNH A;  2D42 A;  2P0M A;  7RNT A;  5IEP A;  1U5O A;  2ZHX B;  3HII A;  4RBN A;  1M90 4;  3WMD A;  3GSP A;  1O7N B;  3K0Z A;  3EHC A;  3NBJ A;  3OWU A;  3AMO B;  5IEN A;  1EG9 B;  3MSO A;  2ZDJ A;  1RMS A;  3OWS A;  1BNF A;  3JUP A;  1RGF A;  1E3V A;  3TDG A;  1GOV A;  1IT8 A;  1GD4 A;  5AIF A;  2OOV A;  2WOH A;  3GZX B;  4KFE A;  3STD A;  2YFL B;  1OGZ A;  3BB9 A;  5BXQ A;  3CC4 3;  4LEH A;  1MGR A;  3SLU A;  4JRF A;  1IQ8 A;  3BNC A;  4CJN A;  1KD1 4;  2HOH A;  4J8T A;  3B7C A;  5BU4 A;  5KP1 A;  1BSD A;  4BIR A;  3MKI A;  4XDV A;  4WWU C;  1NWW A;  4N6M A;  1VQO 3;  3BIR A;  1JB5 A;  1W6Y A;  3WR2 A;  1OUN A;  3SXX A;  2ML5 A;  1E97 A;  3ZG5 A;  3D5G A;  4GL6 A;  4R80 A;  1L5G B;  1A67 A;  1BVI A;  1JRQ A;  1W5Z A;  1X1Y A;  1BAO A;  3D79 A;  3G0K A;  3JUQ A;  1RRL A;  1NNV A;  3RGA A;  3WHO A;  3G6E 3;  3OX9 A;  2F99 A;  1BNJ A;  2M7O A;  1TFO A;  3PZW A;  4FCM A;  5KP3 A;  3X3Z A;  4FMB A;  3NXJ A;  3CXC 2;  2BMQ B;  3LT8 A;  5A0O B;  3F8H A;  3S27 A;  1RN4 A;  1RLS A;  4NPB A;  1LXE A;  1ULJ B;  5CXO A;  3VF1 A;  3CNM A;  5EQL A;  1YVB I;  2K0M A;  2XGL A;  3MG1 A;  1QAL A;  4EV5 A;  2CFL A;  4CCV A;  1BNE A;  2YX9 A;  5M1A A;  5EEO A;  1LOY A;  5M18 A;  1BSE A;  2Y74 A;  1VQK 3;  2W56 B;  4NRE A;  3AGN A;  1VQ7 3;  4FCZ A;  2FXT A;  1OF5 A;  2GEY A;  4RNZ A;  4KVH A;  5LC6 A;  3F14 A;  1B3S A;  5D82 A;  3HI7 A;  4N6L A;  2BMO B;  1VQ8 3;  1LVN A;  4R9L A;  3ROB A;  1SJW A;  1ZGX A;  2UX0 A;  3CNX A;  1RRH A;  2F98 A;  1JKG B;  3RNT A;  1I2G A;  1BU4 A;  4XBY A;  1WMO A;  3F7X A;  3KE7 A;  3UL6 A;  2P38 A;  5LC7 A;  4EC6 A;  1BRH A;  2CFK A;  3KII A;  1UDI I;  1BOX A;  3UJM A;  2GEX A;  3X3X A;  2XFS A;  1V74 A;  1BNS A;  2WOF A;  5ELJ A;  1JV2 B;  1SAR A;  2P05 A;  3EX9 A;  1UCK A;  2AAE A;  3FG3 A;  1WNH A;  3PYJ A;  1NJI 4;  2IUJ A;  1K41 A;  1K28 A;  1V57 A;  2QIY A;  1RDS A;  4KZ1 A;  7GSP A;  1MOL A;  1B20 A;  1Q86 4;  3QRD A;  3CCS 3;  3CPO A;  3SOA A;  3I55 3;  3EN1 B;  1IV7 A;  2RFR A;  3A76 A;  3HIG A;  1AY7 A;  4ILF A;  3B4O A;  1JB2 A;  3GWR A;  3LXU X;  3N9H A;  3X3Y A;  3CME 3;  1CYU A;  5IG4 A;  3LTB A;  2W9Q A;  1JJ2 2;  4KT3 B;  1M1X B;  3EC9 A; 
#chains in the Genus database with same CATH homology
 3NM2 A;  2BHM A;  3PS8 A;  2W56 A;  1AV4 A;  3RGR A;  3DUK A;  3NQY A;  1LOX A;  3HZP A;  3MG3 A;  4TX4 A;  1CEW I;  1QVF 2;  4MEI A;  4O2H A;  1R4C A;  2HML B;  4Q53 A;  1KQS 2;  2OWP A;  1JKG A;  3OW2 2;  2YFJ B;  4HJL B;  5IW9 A;  1YIJ 3;  5D81 A;  2CK3 H;  4HZ9 B;  1YI2 3;  4BTY A;  2C11 A;  5G2G A;  1IVX A;  3DGO A;  2C10 A;  4WFO A;  3KSE D;  2B1X B;  1A2K A;  2Y73 A;  2SBL A;  4J9A A;  1WTH A;  3T0U A;  2Z77 A;  3B4P A;  3OV4 A;  5AIG A;  4R4K A;  2B24 B;  1N5P A;  4WHA A;  1VQL 3;  2CIU A;  3H51 A;  1EQK A;  1DVC A;  1FGO A;  5IER A;  2CFD A;  2XGN A;  1YJ9 3;  1O7H B;  1VQ5 3;  1VQ6 3;  1OF5 B;  1IVV A;  4LMI A;  1OHP A;  3PCS A;  2CG1 A;  3DZL A;  5TGN A;  3NX0 A;  2L4V A;  1YIT 3;  3E99 A;  3DXO A;  4K90 B;  2CG0 A;  1RKY A;  1RJO A;  1WMN A;  5HGR A;  1UUV B;  5JPP A;  4N3V A;  4AKZ A;  3K9M C;  3FF2 A;  4JF8 A;  5ELU A;  3X42 A;  1KWI A;  2F86 B;  4ORL A;  3PCR A;  2RGQ A;  1Z1S A;  3RDE A;  3CCU 3;  1GYB A;  2XH9 A;  3QK9 A;  1QVG 2;  4LZI A;  1U8C B;  1W4N A;  5IEO A;  3N54 B;  2FGT A;  1K73 4;  1N8Q A;  3K63 A;  4WYK A;  2O3O A;  3F40 A;  1ULI B;  1E3R A;  3FH1 A;  3LTC A;  1W2Z A;  2W9P A;  3KFQ C;  3T8N A;  1TFK A;  3SED A;  4N6N B;  3BND A;  3H3H A;  4HM2 B;  4IT7 A;  6STD A;  2INX A;  1KSI A;  1NU3 A;  3M8C A;  3CCQ 3;  1ZO2 A;  3X40 A;  1N8R 4;  2W0Q A;  2JQ5 A;  3CCJ 3;  5IG5 A;  4N6T A;  3V98 A;  4HKV B;  2IA7 A;  2QA4 3;  4HM4 B;  2LQV A;  4R9K A;  4XBT A;  3EBT A;  3V92 A;  3F9S A;  2KCD A;  4I4K A;  4QWT A;  4G1M B;  3EBY A;  3MPH A;  4WP5 A;  2CWT A;  4NHF A;  3MG2 A;  5AEU B;  1SPU A;  2KRT A;  4AEQ A;  1RN7 A;  2WO0 A;  3F7S A;  4L8P A;  3SVA A;  2XSH B;  2OQE C;  4H3U A;  2OQE A;  4K1U A;  1GY5 A;  2XRX B;  2LYX A;  3BLZ A;  4L7K A;  1ASK A;  1D6Z A;  2OCT A;  3Q1C A;  1N9E A;  4FMA A;  3T8U A;  5STD A;  2GXF A;  5AII A;  3S29 A;  5AI1 A;  2P0X A;  3L0R A;  3FGY A;  2OTL 3;  3GZY B;  1STD A;  1IVW A;  3CCE 3;  1GD3 A;  4BTW A;  1YJN 3;  1AR0 A;  3X41 A;  4MMZ B;  2GU3 A;  3OXA A;  5DRV A;  1O7W B;  4HM1 B;  1IQX A;  8CHO A;  3GAX A;  1US1 A;  2MF7 A;  2W03 A;  3JUM A;  4OK0 A;  1SIH A;  1EKM A;  3D9R A;  3EE1 A;  3VGN A;  3D3L A;  3MHE A;  4O8S A;  3UNL A;  2E2V A;  4PEJ A;  2D1W A;  1HKX A;  3FSD A;  4HM3 B;  1W6C A;  3NBB A;  1EA2 A;  3CCL 3;  2CC3 A;  5AIH A;  2KXG A;  1FGQ A;  3FG4 A;  1O7M B;  3BNE A;  2BNG A;  3G4S 3;  4FCJ A;  4MJD A;  4U13 A;  2HMK B;  1CQS A;  2WGO A;  4XDW A;  3WA3 A;  1QAF A;  3VSY A;  1S72 3;  4N6O B;  4WYK B;  1BUQ A;  2BO9 B;  3G71 3;  3PXM A;  2OTJ 3;  2CFW A;  4LSO A;  1Q42 A;  3LZA A;  4XBX A;  3NUV A;  1QJG A;  3S67 A;  1QMA A;  1VQN 3;  2JDI H;  2Z7A A;  4EXR A;  4FMC A;  1UUW B;  1TIJ A;  3K7C A;  5DRE A;  1D6U A;  3IMA B;  3NQZ A;  3JUO A;  1W2B 2;  3DMC A;  3GRD A;  3KN4 A;  1FGT A;  1ROA A;  5D83 A;  1OH0 A;  1S5A A;  2IUK A;  1JN5 B;  3EF8 A;  1JB4 A;  3CC7 3;  5JPU A;  1STF I;  3CD6 3;  3JVC A;  3Q2P A;  3UB1 A;  2RSX A;  4STD A;  1JNQ A;  1WMP A;  1IT7 A;  3KKG A;  3I56 3;  3DGM A;  1CYV A;  1AVK A;  4FR9 A;  1VQ4 3;  1ISK A;  4AKY A;  7STD A;  5AYS C;  2CHC A;  1M1K 4;  2A15 A;  1YJW 3;  1NDO B;  3FCS B;  3GZR A;  1IVU A;  1UW1 A;  4CDL A;  1OHO A;  5JBS A;  3KSP A;  5KP4 A;  2QGU A;  5AYR B;  1ROV A;  2FNQ A;  2Q07 A;  2CW9 A;  2CWU A;  5CF2 A;  3WOD G;  1IQY A;  2GU1 A;  2W6J H;  1O7P B;  3N8B A;  4K61 A;  3FF0 A;  2CFG A;  1GY6 A;  4K1V A;  3HX8 A;  1O7G B;  2E2T A;  3NV0 B;  1VQ9 3;  2OOV C;  5BVB A;  4X2O A;  2CH9 A;  1J2B A;  3EJV A;  1NB5 I;  3KZT A;  1F8N A;  3WA2 X;  4MMY B;  1NO3 A;  4H61 A;  3S28 A;  3NHX A;  1TU5 A;  1QAK A;  3ECF A;  3CU3 A;  4O02 B;  3MYT A;  1MNL A;  5IF6 A;  3FKA A;  3IJE B;  1M9G A;  2V1L A;  4HM8 B;  4R1K A;  3Q90 A;  1W01 A;  3J7Y d;  3DGN A;  3K5T A;  1ZX2 A;  2HMJ B;  1TUH A;  3LTA A;  3CC2 3;  2CKF B;  5AEW B;  2HMO B;  3CMA 3;  2R4I A;  4BTX A;  1KC8 4;  2XFT A;  4ZM8 A;  3LOY A;  3NBR A;  2STD A;  1OGX A;  1JN5 A;  1N5H A;  1OCV A;  1Q81 4;  3LH4 A;  2HMM B;  4GB5 A;  2ZL8 A;  1K9M 4;  1IV9 A;  3U97 A;  1K8A 4;  4OUQ A;  1Q40 B;  1FGR A;  3HK4 A;  2GBW B;  4N6V 0;  2HMN B;  1WQL B;  2W04 A;  2BMR B;  2Z6B A;  5IG0 A;  1OAC A;  1W00 A;  1SII A;  3SOY A;  3DGL A;  4OVM A;  3EN8 A;  1Q7Y 4;  4RZM A;  2XR8 B;  3U1W A;  1GY7 A;  1T5Y A;  1W6G A;  1DYU A;  2WGQ A;  3OWY A;  3WOE B;  1N9J A;  2K54 A;  1YGE A;  1TP6 A;  1Y4K A;  4FMD A;  1VQP 3;  3AMO A;  3JUN A;  3CPW 2;  1FGM A;  2XF3 A;  4HM0 B;  2XEP A;  3BNB A;  3NV0 A;  1IDP A;  3I0Y A;  5CK6 A;  3WDG B;  4EYC A;  3UL5 A;  2BT3 A;  3MWZ A;  3EB8 A;  4HBR A;  4EBG A;  4N6U A;  5EVH A;  1DMM A;  1UI7 A;  5FGO A;  1DMQ A;  2PNC A;  2E2U A;  3DM8 A;  4HM5 B;  4HVN A;  4LGQ A;  3G8Z A;  1W02 A;  2GBX B;  3LTD A;  2PZV A;  3ALA A;  3S5C A;  1DMN A;  1C7H A;  3O8Y A;  3FZW A;  1UI8 A;  5IG3 A;  2CWV A;  4EV2 A;  4KFF A;  1VQM 3;  1YHQ 3;  5CLK A;  5CF1 A;  2RCD A;  3G16 A;  3LYG A;  5FW5 A;  3FLJ A;  1SQW A;  1A2V A;  4X2H A;  3LT9 A;  1VZZ A;  1Q40 A;  3NM7 A;  2O9U X;  3GZB A;  2XSO B;  4HYZ A;  2I9W A;  1NB3 I;  5I97 A;  3DY5 A;  3FG1 A;  3PGB A;  3LML A;  1GS3 A;  3CCR 3;  3CCV 3;  1FUW A;  4HZB B;  1AVL A;  3EQQ B;  2MC8 A;  1FA3 A;  4XB5 A;  3ER7 A;  1A90 A;  1PFP A;  2YFI B;  3CCM 3;  1G96 A;  1D6Y A;  4XM4 A;  4IIA A;  4HM6 B;  1W7C A;  4O3V A;  4KFD A;  3WOF B;  1HU9 A;  1Q82 4;  3SX1 A;  3IPT A;  2Z76 A;  4HM7 B;  4MMX B;  1IK3 A;  2IMJ A;  2P09 A;  2W2C A;  4L8O A;  4RNY A;  1OHS A;  4IPB A;  1DVD A;  1IU7 A;  1OPY A;  1PU4 A;  3F8X A;  2ML6 A;  2QEX 3;  3V99 A;  3B8L A;  1LNH A;  2D42 A;  2P0M A;  5IEP A;  1U5O A;  4RBN A;  3HII A;  1M90 4;  3WMD A;  1O7N B;  3K0Z A;  3EHC A;  3NBJ A;  3OWU A;  3AMO B;  5IEN A;  1EG9 B;  3MSO A;  2ZDJ A;  3OWS A;  3JUP A;  1E3V A;  3TDG A;  1IT8 A;  1GD4 A;  5AIF A;  2OOV A;  2WOH A;  3GZX B;  4KFE A;  3STD A;  2YFL B;  1OGZ A;  3BB9 A;  5BXQ A;  3CC4 3;  4LEH A;  3SLU A;  4JRF A;  1IQ8 A;  3BNC A;  1KD1 4;  4J8T A;  3B7C A;  5KP1 A;  3MKI A;  4XDV A;  4WWU C;  1NWW A;  4N6M A;  1VQO 3;  1JB5 A;  1W6Y A;  1OUN A;  3SXX A;  2ML5 A;  1E97 A;  4GL6 A;  4R80 A;  1L5G B;  1A67 A;  1JRQ A;  1W5Z A;  3RGA A;  3G0K A;  3JUQ A;  1RRL A;  3G6E 3;  3OX9 A;  2F99 A;  2M7O A;  1TFO A;  3PZW A;  4FCM A;  5KP3 A;  3X3Z A;  4FMB A;  3NXJ A;  3CXC 2;  2BMQ B;  3LT8 A;  5A0O B;  3F8H A;  3S27 A;  5CXO A;  3VF1 A;  1LXE A;  1ULJ B;  3CNM A;  5EQL A;  1YVB I;  2K0M A;  2XGL A;  3MG1 A;  1QAL A;  4EV5 A;  2CFL A;  4CCV A;  2YX9 A;  5EEO A;  2Y74 A;  1VQK 3;  2W56 B;  4NRE A;  1VQ7 3;  4FCZ A;  2FXT A;  1OF5 A;  2GEY A;  4RNZ A;  4KVH A;  5LC6 A;  3F14 A;  5D82 A;  3HI7 A;  4N6L A;  2BMO B;  1VQ8 3;  1LVN A;  4R9L A;  3ROB A;  1SJW A;  2UX0 A;  3CNX A;  1RRH A;  2F98 A;  1JKG B;  4XBY A;  1WMO A;  3F7X A;  3KE7 A;  3UL6 A;  2P38 A;  5LC7 A;  4EC6 A;  2CFK A;  3KII A;  3UJM A;  2GEX A;  3X3X A;  2XFS A;  1V74 A;  2WOF A;  5ELJ A;  1JV2 B;  2P05 A;  3EX9 A;  3FG3 A;  1WNH A;  3PYJ A;  1NJI 4;  2IUJ A;  1K41 A;  1K28 A;  2QIY A;  4KZ1 A;  1MOL A;  1Q86 4;  3QRD A;  3CCS 3;  3CPO A;  3SOA A;  3I55 3;  3EN1 B;  1IV7 A;  2RFR A;  3A76 A;  3HIG A;  3CME 3;  3B4O A;  1JB2 A;  3GWR A;  3LXU X;  3N9H A;  3X3Y A;  1CYU A;  5IG4 A;  3LTB A;  2W9Q A;  1JJ2 2;  1M1X B;  3EC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...