2QGUA

Three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
b'ADAQATVKTAVDDVLATIKGDPDLRGGNLQKVFQLVDQKIVPRADFKRTTQIAMGRFWSQATPEQQQQIQDGFKSLLIRTYAGALANVRNQTVAYKPFRAAADDTDVVVRSTVNNNGEPVALDYRVEKSPNGWKVYDINISGLWLSETYKNQFADVISKRGGVGGLVQFLDERNAQLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable signal peptide protein
publication title Three-dimensional structure of the phospholipid-binding protein from Ralstonia solanacearum Q8XV73_RALSQ in complex with a phospholipid at the resolution 1.53 A.
rcsb
source organism Ralstonia solanacearum
molecule tags Structural genomics, unknown function
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05494 MlaC MlaC protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A phospholipid-binding protein 2qguA02
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qguA01
3OX9A 2XSHB 4LEHA 3MG3A 3NV0A 3NHXA 3B4OA 5IEOA 5AIHA 1Q40B 5AIGA 1ULJB 3NBRA 5KP4A 1Z1SA 2HMKB 1JB2A 5TGNA 2RCDA 3RGRA 2GBWB 4XDVA 2F99A 3T8UA 4WP5A 2YFJB 1OHOA 5AEUB 3Q90A 3FLJA 3M8CA 3SOAA 4FCMA 3EN1B 1C7HA 3ROBA 4HM2B 3RGAA 3F9SA 5KP1A 1GY7A 1ZX2A 5BVBA 3NV0B 3ER7A 3DUKA 3G8ZA 4WWUC 1NDOB 4H3UA 2OWPA 5IERA 3BLZA 3G16A 1JB4A 3F14A 3DM8A 3K0ZA 6STDA 3BB9A 2BMQB 4Q53A 2JQ5A 4U13A 1NWWA 4LMIA 3MYTA 3FZWA 1Q40A 4R9KA 4L8OA 5IENA 3FF0A 1QMAA 2HMLB 5EVHA 1OCVA 5IG5A 5DREA 3OXAA 1W6YA 2IMJA 5AEWB 3A76A 1O7WB 4RZMA 3MSOA 1GY6A 2GBXB 4WYKA 1GYBA 1W02A 2GEYA 2B1XB 4HVNA 2UX0A 3IPTA 1OUNA 2R4IA 3E99A 2A15A 2HMNB 3KKGA 1O7MB 1S5AA 5CK6A 3DMCA 4L8PA 5D82A 4XDWA 4MJDA 1ZO2A 3JUOA 4X2HA 2Z76A 3EJVA 2CHCA 3EN8A 2INXA 3DXOA 3MKIA 3OWYA 3I0YA 1ULIB 1AR0A 3EBTA 3F8HA 2STDA 5AIIA 3GWRA 3H51A 4XB5A 3H3HA 4HM4B 1O7PB 3S5CA 4WYKB 4HZ9B 1NU3A 1DMMA 2GXFA 1OGXA 1E3VA 4IIAA 3EX9A 3EF8A 3JUQA 5AIFA 4HJLB 2YFLB 1UUVB 7STDA 3B4PA 2XR8B 1HKXA 1JN5A 4K1UA 3FGYA 3GZYB 4KVHA 5CF2A 2RFRA 1SJWA 4XM4A 1Q42A 4J8TA 1JB5A 4N3VA 5IEPA 1OH0A 4HKVB 2W2CA 2QIYA 4STDA 2BMRB 1O7HB 4HM3B 3JUNA 5CF1A 1TP6A 1VZZA 5STDA 3CU3A 2Z77A 5IG0A 2F98A 3F8XA 3SEDA 4J9AA 3MG2A 3CPOA 4HM1B 4HZBB 3G0KA 3MHEA 4XBYA 3D9RA 5DRVA 1K41A 4K1VA 3EHCA 1JN5B 1ISKA 2BMOB 3B7CA 2RGQA 1CQSA 5D83A 5KP3A 1OPYA 4ORLA 4L7KA 1A2KA 3MG1A 3F7SA 3F7XA 3KE7A 1O7GB 1OHPA 5JPUA 3FKAA 1DMQA 4R9LA 4LGQA 3LZAA 4HM8B 5FW5A 2F86B 1OGZA 3GZXB 1TUHA 3FF2A 3UJMA 3JUPA 3STDA 4HM7B 3HX8A 5G2GA 1E3RA 3K7CA 5HGRA 3CNXA 1STDA 1WQLB 2CKFB 3KZTA 4OUQA 4GB5A 3NXJA 1QJGA 1UUWB 2Z7AA 5IG3A 5BXQA 4HM5B 1U5OA 3OWSA 2HMMB 1EG9B 1W00A 8CHOA 1OHSA 3FH1A 3EC9A 1OF5A 3CNMA 1EA2A 3B8LA 4X2OA 5IG4A 4CDLA 3F40A 3DZLA 3T8NA 2YFIB 3WMDA 2BNGA 1GY5A 3GRDA 3JUMA 3HK4A 1O7NB 3VGNA 3NUVA 3UNLA 3OV4A 5AI1A 3KSPA 1JKGA 3ECFA 4HM6B 3OWUA 4XBXA 2I9WA 5IF6A 1ASKA 4FCJA 1IDPA 2GEXA 2HMJB 1GS3A 3GZRA 3NM2A 4R1KA 1OF5B 3GZBA 2B24B 3EBYA 2HMOB 5CXOA 1E97A 4PEJA 5CLKA 4I4KA 2QGUA 5JPPA 1DMNA 2PZVA 4XBTA 3SOYA 3LYGA 3VSYA 1W01A 1JKGB 5D81A 2XSOB 3FSDA 4OVMA 2K54A 2XRXB 3EQQB 3HZPA 1BUQA 4HM0B
chains in the Genus database with same CATH superfamily
3CQZJ 3TOBA 2R7SA 4FE4A 2XSHB 1NB5I 3BR3A 4LEHA 2NVTJ 2VKHA 2R5YB 2M45A 5GPCA 4OIPF 3V98A 2LF8A 3RPUD 4KITB 5AIHA 3WG9A 5HDGA 2GLOA 4OAZA 1BRHA 2I5UA 4QPQA 1T5YA 1FYSA 4II2A 3I553 1M1K4 4P1WA 1JHFA 2R7QA 1J2BA 1BUJA 3BTCA 1N5HA 3PCRA 4BH9A 3PXMA 3LL7A 2IYJA 1YHQ3 3CCV3 1IXSB 1ZYRF 2DA5A 5EJCA 3BU4A 3ZOBA 2HMKB 2VBXA 2D1HA 2XPUA 3FDYA 4HW0A 2DMUA 3MFKA 3CJTB 1VQNI 3SZPA 3QP5A 4PSWA 5GTHC 3D5IA 3SXXA 1WJCA 3V99A 1UMQA 3CZ6A 1B4AA 2YSRA 3HHHA 4MEYF 3OYFA 1I0VA 1YGWA 4RAYA 4Y17A 1QNTA 2E2HJ 4LOCA 3G4SI 3T8UA 2HS5A 3VYRB 3H5AA 4E7ZA 1JJ6C 3R0JA 5FKLA 2K85A 2VJJA 5AEUB 1S72I 2L1SA 3NRVA 2JN6A 1XSDA 2DA2A 1B2MA 5DCFA 5ICCA 3OSFA 1DQUA 3JVCA 4A3JJ 3MZYA 4NB5A 3CCL3 2JQ7A 4RA2A 1RN4A 1P4XA 2M9HA 2OD5A 2UUZA 1RLSA 4UVAA 1JHHA 3PFYA 3CCU3 3ROBA 3F21A 3DTEA 3DTKA 4M6XA 1HC8A 4NC7A 2OOVC 1DP3A 4XLNF 4PJJA 3WHCA 4DGWB 1ZX2A 2PMHA 2LK2A 3IH3A 3M4OJ 3Q5FA 3BNBA 5BVBA 2P6SA 3WODG 2HQAA 1I8VA 1FC3A 2CFLA 4EJOA 4BNCA 3F8MA 4WWUC 4ZYEA 4BEHA 2F5EA 1XGNA 3FBNB 2HOAA 5M3MJ 2L4AA 3RPUA 5D5VB 4Q4ZF 2R7RA 4BDYA 3OYGA 3ELKA 1YE9A 2JMWA 3G16A 3UB1A 5FJ8J 3SQNA 4N6MA 6STDA 2MC4A 4CGZA 4OINF 1AHDP 4KT3B 5DS9A 2B63J 3BB9A 3L2VA 2BMQB 2OQGA 1FOWA 2E7WA 2TDXA 3ZQHA 4BJTA 2HOTA 4IL6C 5LGUA 3FBIB 2ZO4A 1NJI4 1K83J 4LMIA 1GV5A 4EXRA 4RAFA 3MYTA 1PDNC 2W57A 2X1EA 3GWZA 2R7VA 2C4BA 2UXNA 3NBBA 4R9KA 2K40A 4UVCA 1I1GA 2HYFA 3FWEA 2DAOA 2EFPA 2QKMB 3F72A 5IT9Z 4PFPA 1RKYA 3KYLA 1QMAA 4A93J 2PQ8A 2F2EA 3G71I 4N6NB 5IT9K 1VI0A 2HWVA 2XAQA 3HKZN 4U7DA 5FB2A 1RSNA 2JPBA 5KNLA 5EEGA 4N9IA 4RB2C 3UL5A 4ESFA 2F5FA 3KN4A 5DREA 5D6FA 3C2GA 2VPRA 2X9DA 3Q3SA 2IUKA 2L4VA 1VQ53 1JKQC 4LG3A 1T33A 2Q0OA 2XGDA 1YJWI 2CX0A 1FUSA 3A01A 4HBRA 1RKTA 2MBFA 1Z3XA 2VN2A 3ZRGA 1SVLA 1WI3A 2OCEA 1W02A 1XS9A 4K90B 2PI0A 2H0IA 3DGYA 2W85A 4AIKA 3I71A 3ZMTA 2GEYA 3QU3A 5LRRA 1FBSA 1Q7Y4 1AKHB 1IRXA 4BBRJ 3O3KA 4IZZA 2P5VA 3LSHA 1Z6TA 2JRMA 2VJ4A 4KMUX 1QBJA 4HF0A 2GIVA 4I2OA 3BR0A 2AQFA 1B2SA 1R1VA 1WQ2A 2NS8A 3IAM2 3GVAA 3BTLA 1D6YA 2WV0A 3FXQA 2Y0MA 5FROA 3K7AJ 4A3KJ 2HZDA 5HDNA 3PIOF 4JOMA 3E99A 3HPHA 3KYCB 3LSPA 2HMNB 3GTQJ 1KQS2 3QYEA 3KKGA 4L8PA 5D82A 4WFOA 4HBLA 3J81Z 4GSPA 1RN1A 1MBFA 2R41A 3KIOA 3CLQA 5DDGA 3OYHA 3K4LA 2BGCA 1ZG1A 2LBFA 1JKOC 2BOLA 1MNLA 4ZM8A 2YUSA 3BQZA 3OYIA 5LEKA 2Q8KA 1K6YA 4HDUA 2Y9ZA 2W04A 3E6BA 2HGCA 5DUKA 5FO5A 3I0YA 3D5RC 3AG4H 5HVQC 5E20A 3L9FA 1N75A 4LITA 5AIIA 4KT6A 1CYUA 5B1AH 3H3HA 2YX4A 2VT2A 3DF8A 4IQJA 1YRNB 4E7LA 3LSIA 1QZZA 4ENKA 4R8HA 4EEFG 2M8EA 3J80Z 1Y1VJ 2VKEA 2X85A 2ID6A 5F27A 2ZHXB 3ZQIA 2CWVA 2GXFA 3P5JA 4R1HA 3RZDJ 2FU4A 3ASNH 1UCJA 4ZDPA 3AG3H 3I9V2 4BGDA 1VQL3 3KZZA 1TQMA 1HDDC 1UB9A 1S6LA 2KF6A 4N4OB 1MKMA 1JTXA 5KAIC 3BG6A 2A05A 4BY7J 2CW7A 3X42A 3K10A 1OCPA 3QOEA 2PEXA 3JRGA 1BN5A 2ESNA 2ME0A 2UXXA 3FGYA 3GZYB 3G6E3 3Q0VA 1G96A 2E5ZA 3K4NA 4P9FA 3CTAA 3IH2A 1HW1A 5HODA 3KSED 2BY0A 4MGRA 2HU9A 2DDBA 2ZJPF 4OMYA 2XPVA 3OYNA 2STWA 2X6OA 4ILFA 1X1UA 3BROA 2OTJ3 5IW9A 3WTZA 1RNTA 1FW7A 1USTA 5HLGA 2HOSA 2K9QA 4G6QA 3TEDA 2JSPA 3ZQQA 5H6RA 1V5EA 1T0FA 1N9JA 4F3QA 3OYKA 3NAUA 4EMSA 1KYZA 1EV7A 3HOXJ 1D1CA 2BHZA 3OYLA 2XHKA 1T08B 3ERED 4NBQA 3H3VK 2A69F 2XRLA 1ACIA 1VQ43 2DMQA 2XSJC 4BL3A 1BI1A 1WWXA 1QA6A 3A2KA 1IV6A 1VZZA 1WHUA 3OR2C 1B8IA 3CJQB 3DP7A 3I58A 5K7ZA 1BRJA 4UNOA 2HR3A 2EZIA 1LDKB 1SIHA 1SIIA 3F8XA 3SEDA 4G7OF 2X1DA 4XLFA 3JRDA 4OU0A 1RN7A 2WB1A 4XSZF 4HOHA 1HXDA 3CCJI 1FYKA 1U8CB 1V58A 3G0KA 4LMYA 4DYQA 3LTCA 3D9RA 5DRVA 1OCCH 3CMMA 1AQZA 3MZHA 1RKWA 2W48A 1RGAA 2XF3A 1YX5A 3HL2A 2MG4A 4CO8A 1ISKA 2E2VA 1V55H 4B3AA 5GAEJ 3OL4A 3HI7A 2DFIA 2QYOA 1B2UA 2WAFA 4CCMA 3HC7A 1DUXC 5HLTA 3HOVJ 1OYIA 1ON1A 4E7JA 1REPC 1WGXA 5HS9A 3H5NA 3HXLA 4L7KA 4M9SA 1A2KA 1K734 3C2BA 1RUOA 3DPTA 3FG4A 1WMPA 5FFXA 3GEZA 3FKAA 2H6CA 1MJBA 4B48A 5D5WB 3CCQI 5JBSA 3CUOA 3ZMVA 2YU3A 3IKVA 1EEJA 1J0RA 2XFTA 3K1NA 1XGSA 2VQCA 3WOFB 2CH0A 2HYGD 3NX0A 2HMMB 4W97A 3ZQFA 5EEAA 1SFOJ 2JK3A 3BY6A 4HM8B 1Q7HA 2EA2A 2M2EA 2NVXJ 4W1UA 2JWTA 3IWFA 2E34A 1ITYA 1B2XA 2E71A 3M7GA 1OLTA 3EDPA 1W5SA 2NRAC 4WXHA 4B1RA 4EC6A 2Z33A 3N97A 1VFCA 1IRGA 4CZCA 3LOYA 1ZLKA 1TNSA 2QQBA 1GMRA 4HV5A 1RTUA 3VODA 2DYRH 3N54B 1B2ZA 2R7ZJ 2M4GA 1RGGA 1BOAA 2JUGA 4JX4A 3WTUC 3FX3A 2HVSA 4BHPA 1FEXA 6RNTA 1R00A 2LRDA 1O3TA 5F6FA 5JVGF 1APLC 2FNPA 3K5TA 4IT7A 3BDDA 2KPMA 4GCVA 3N4MA 1WH5A 2GIZA 2NXNB 4YEJA 1WQLB 3CME3 2IXSA 3CF5F 1KWIA 3KZTA 3ESWB 3UL6A 5FGMA 3DBLB 3P9KA 1SFKA 3RTRA 1L0OC 2Y30A 2F4OB 3LAPA 3Q0WA 4S0HB 4E7HA 2LREA 2ZXIA 3EE1A 3NXJA 1QJGA 2EJRA 1G0TA 1UUWB 3TDGA 1WVRA 2YX9A 5KVRA 1KU3A 4ZDLA 2NVQJ 1E3HA 4RS8A 1ZH5A 5IG3A 1XDSA 3HUGA 1VQ83 3CUQB 1U5OA 4MQ9F 1R49A 3CDLA 2FBIA 4XONA 5B1BH 1J09A 1LUJB 3PO2J 1EG9B 2VXZA 1W00A 2XASA 5D5XB 8CHOA 5D4SA 2KRTA 4HNVA 2RC4A 5JVTA 1HLVA 1OF5A 2V9KA 2X6XA 3QYBA 4PZJA 4DYRA 1Z67A 3BZCA 1QZEA 2FEZA 4XKCA 1SFXA 1FMVA 5E3OA 3OSGA 3PJRA 3AL0B 3OOUA 1GDTA 2VQGA 3GTGJ 2DA1A 3OOPA 2ZXWH 3S2DJ 3PL8A 3GRDA 1IJWC 3AG2H 1T39A 3GFJA 1EF4A 3HG9A 3LA2A 1U5TA 1SMTA 1IV8A 3CC2I 1MSEC 3KETA 5L3FA 2M87A 1QPIA 1ETQA 2IA7A 3H92A 2HXIA 3CLOA 2IJLA 3KZIC 2IS6A 4NHFA 2WAQN 1QVG2 1JUPA 1ZGJA 3OS2A 2X0LA 1KC84 1BIRA 1UCLA 3L7WA 3UNLA 5M19A 1YW7A 4F55A 4M9ZA 3C1DA 4HLXA 5EYRA 3TW6A 1BA5A 1X3ZB 1PU4A 4HM6B 4AVPA 3K4KA 3HZJA 2D1WA 4XBXA 3J7Yd 4MTEA 4WK8F 4M9XA 1GMPA 1O7FA 4UUSA 2I9WA 2DMNA 3WA2X 5IF6A 3B02A 3FCSB 1UG2A 4BQNA 1ZN2A 2P0XA 1YQAA 4CXFA 3ZQLA 1A90A 1FT9A 1MWSA 1AOYA 2YX7A 3QOPA 3HIFA 2HDDA 2GEXA 2Q2EA 4S05A 3FG1A 1WCMJ 4RGRA 2V9PA 3CCMI 2P5LC 5LD2C 5D8LB 2L9VA 5LGTA 1W36C 2V1DA 3JTGA 5A0OB 2K5CA 3DH2A 2F5VA 3UKGA 3W3CA 2KIUA 2W82A 2BZTA 4C2UA 3KP2A 4R1KA 2DLLA 5HLHA 1WSUA 2R5YA 3O6BB 5K7HA 3ZCOA 3ZMDA 1N8R4 5FD5A 3U2RA 4CCKA 3F0CA 3ZMZA 5AIQA 4A3CJ 2L4MA 1UW1A 2OQEA 2ME6A 1RUNA 1LDDA 4BE1A 5M3FJ 1T98A 3FMQA 3DGOA 4IEJA 4L9NA 2QGUA 2KCDA 4DJAA 4L9JA 1BRNL 5JPPA 3BZKA 1HBXG 1DMNA 3E97A 4DBQA 2Y74A 4A12A 2ACJA 1YFHA 3IRRA 2RBIA 1XGOA 1HOMA 3OMYA 4XLAA 1FP2A 3DTIA 4XBTA 2CUFA 2ISYA 3LYGA 2YPRA 1Q1VA 3K2AA 1SFEA 1X2MA 3JAMZ 1ZELA 3KEYA 4DYCA 3ZG0A 4HX7A 3X3XA 5LHGA 3F22A 1JKGB 3CP2A 1Z91A 3ERMA 1CYVA 3NARA 4E70A 4YFKF 3E7LA 1LVAA 1IVXA 4JX5A 1YI2I 2P0WA 3VYSB 1HDPA 2MGQA 2IBDA 5E8GA 3FSDA 3H5RA 1AWCA 3HGYA 1JXSA 5EF6A 1R5HA 1UCRA 1OPCA 2XDVA 4F52A 4QLCU 3EQQB 5E18F 1F9NA 1US1A 1WJBA 1ZRFA 4HAAA 1BUQA 4HNUA 4P9UA 5LC7A 5BMZA 1ORKA 2P05A 2MD0A 3S2HJ 4MEIA 1ZR2A 1P92A 3BIRA 3FK6A 4G12A 2GZWA 4AKYA 1S7OA 2H1KA 1Q40B 4UXNA 2CQ7A 2W0QA 2NYXA 1LE8B 4Y13A 5FRMA 2K4BA 3RDIA 1K9M4 5J6XA 4BQAA 3V7RA 5H20A 1LXEA 5AIGA 4I76A 2FQ3A 3R60A 4I99C 4JBAA 2QEXI 1X1DA 1ULJB 3NBRA 1FGRA 1N5PA 1SD4A 1NTCA 4E4HA 2VOPA 1Z1SA 2DPDA 1XMKA 5TGNA 3PNYA 3L09A 1IRZA 4G94A 4XLEA 4WXDA 1BI3A 1E0EA 2LKSA 4ZDOA 2HTSA 4PGHA 2RCDA 2CIUA 4O02B 3RGRA 2EWNA 2G7UA 1ZHFA 3BT9A 4C3HJ 4LG0B 3KLOA 1GSPA 4NPBA 2GBWB 2WV1A 1LVKA 1QO0D 5JI6A 1GXPA 2KDOA 1BNFA 5IPAA 3QPSA 3MN2A 4LK0F 1PFPA 3ABTA 5GTIC 1OHOA 3FK7A 2BXZA 3ZGKA 4IHVA 4CDGA 4HEA2 1T0FC 4M73A 3Q90A 4NNJA 1RDSA 2PJRB 1UELB 2EFOA 2O3FA 3GX4X 4BHCA 5GSPA 2P7CB 3U1DA 3M8CA 4UV9A 1W6CA 1U2WA 5B3SH 1JT6A 3V7CA 3G3ZA 4IPAA 3REOA 3H3UA 2DMPA 3S8PA 5BU4A 1IVUA 5IOZA 1Z6RA 4JX6A 4RMNA 1TRQA 2DO7A 4HM2B 4QSHA 3TL4X 4A3EJ 2CFWA 4JYKA 4ZJZA 1LDJA 4N4NB 5IT3A 2FMLA 4RBNA 2OTL3 5F1RA 1UHSA 1RGHA 4JRFA 1GY7A 4EV0A 3R0AA 3DEUA 4HZFA 5D5UB 3E6MA 1B59A 2LKPA 5EQLA 3HTSB 4N6V0 1NDOB 1HW5A 1ZREA 4A69C 2QF7A 1FBQA 4D5FA 4EJUA 3BLZA 3S67A 5EZGA 1AKHA 3K0ZA 1YS6A 3GO5A 5E1ZB 3AGNA 3IUOA 4FE7A 1VQKI 2MLKA 2A6EF 3H35A 1V74A 4EV5A 2E1CA 3BG9A 4EYCA 1R6RA 2L0KA 1A67A 1VQ7I 2HI3A 2OUMA 2JQ5A 1VQ93 4G6TB 1NK3P 1VQOI 2EIMH 1RETA 1TP4A 2BYVE 2DDAA 4G7HF 1BW6A 3LOCA 4YFXF 1JBTA 2DK5A 1YJ93 1O4XA 2V1UA 3WDGB 2Y9YA 3RPQA 4BL2A 4ZYAA 2HMLB 1QVUA 1RCKA 4A3IJ 1N8QA 4O2HA 6GSPA 1OYYA 1YW8A 4CCOA 2CH9A 1DPRA 2M30A 2XB5A 3LH4A 3RQIA 3OXAA 1FP1D 3W2AA 2FA5A 2QENA 1ZGWA 2ETHA 1TZLA 2W7NA 4CJNA 2PMZA 2Z16A 1FOXA 1R58A 1W7PB 2XAGA 1TWGJ 5FRNA 4I7HA 3MSOA 4A3BJ 3V4GA 2LLKA 1P4AA 1E2XA 1CGPA 5ERIA 2R5ZA 4Q47A 1T6SA 3IHUA 4CUGA 1I2EA 4BE0A 4CZZA 2A61A 3JTHA 3SDGA 4E7IA 3WU2C 4HSTA 1UAAA 1LOVA 2B1XB 1GT0C 3R4KA 2UX0A 3DLAA 1W0TA 3IPTA 2JPCA 2VKVA 1JUMA 3E0JB 5TRDA 4QWTA 1U78A 1OUNA 2XB0X 2BU4A 2BXYA 3FXMA 5CQGA 3LWFA 4NDLA 5J1YA 4N6TA 1IQ8A 2IGKA 2R4IA 2W24A 4QTRA 1Z7LA 4CH7A 5LGNA 1A35A 2W6JH 4JF8A 2FSWA 2VJ5A 1O7MB 1S5AA 3DMCA 1ETWA 3K1MA 4DQ2A 2D2WA 2IEKA 1IT7A 4GHOA 1VQM3 4XRMA 1IT8A 1ZO2A 3JUOA 1ULYA 2F4YA 3ABUA 1P9QC 3K0LA 3IKTA 1K78B 3VOEA 1WPKA 3NBJA 4IKFA 2IY2A 2R7DA 3UR3C 2P38A 1TIJA 1ZGXA 3EN8A 2INXA 3GFIA 1A2VA 2R7OA 2CQNA 4MEXF 3GBGA 4ZZDA 2R7FA 2EFWA 3LFUA 3T0YA 1YIJ3 3MKLA 5FLVA 1ROVA 4M6YA 3BNCA 3IH4A 1A2PA 1IV9A 5CPRB 4KFDA 2CWTA 1M1XB 1Q824 3M3YJ 3I4MJ 1OJLA 3WTTC 3GWRA 3WE2A 4KICA 2IS2A 2LG4A 1O7PB 3LAJA 1SEUA 1R4YA 3NWTA 1Q814 1ODDA 1GHCA 2L01A 5TJJA 3K4BA 4KN4X 1F4KA 4MLOA 1BBYA 3T5XA 3VB2A 3C3WA 4EJWA 3FZVA 4DZPA 5FKNA 3WU1B 1OGXA 1TQPA 4KFEA 4IIAA 2QM3A 5J40A 2VC1A 4I6ZA 1W4MA 1BSBA 4XRSA 2XIGA 3V8KA 2M5WA 5M5WJ 4LSOA 3DWLE 1QVTA 2MABA 1MMSA 4L5JA 3S2WA 3F6OA 3PS8A 2QSHX 5C44J 2XR8B 4K1UA 1X19A 5K7FA 1W36D 5CF2A 2A6TA 3IRQA 2Y0SN 2FOWA 2KF4A 2RFRA 2RKHA 1SJWA 2FXTA 2FOKA 2BVLA 4XM4A 1TRPA 1RZ4A 1JJ22 1QALA 1JB5A 3I59A 4N3VA 5IEPA 4UUTA 4OK0A 1VQN3 4R79A 1FSEA 4U7BA 4HDVA 4XORA 5GAGJ 3L1PA 4O3MA 1ETKA 4IJAA 1W2B2 5J47A 2O0YA 2KKOA 2OQEC 1UHWA 1V3FA 1S7EA 3QYFA 4M74A 4KMFA 3O8GA 1MH4A 4LFUA 3TO7A 2QIYA 3G4S3 3ML6A 4AYBN 2E1MB 4BTXA 4GO1A 3FKJA 2P8TA 2CFDA 1IO2A 1S723 4EQQA 1V57A 3S29A 4HM3B 4KISA 3GTJJ 1G8XA 3L2UA 4RM2A 2KIQA 1F36A 1TWCJ 2XF5A 4FMCA 3HSFA 1BGSA 2DBBA 3E6DA 4J19A 5LBQA 2CG1A 4IPBA 3OL3A 1R4MB 2UV1A 5STDA 3K1PA 1SD5A 1STZA 3RKYA 4YRVA 1IK3A 2L7ZA 4GYIA 3EYIA 1XX5A 1DP7P 4A3LJ 5IG0A 4UB6C 1BJZA 5L3DA 2W56B 3HOHA 1DGWY 1DDNA 2KF3A 2JA2A 3CPOA 4HM1B 3SYUA 1ETYA 1ZTRA 2E36A 4UHTA 5EEHA 1H8AC 2VUMJ 2H94A 1I2GA 2R7WA 1X1PA 3MHEA 4XBYA 3SVAA 1XGMA 1HSTA 2KQRA 3IC7A 3RCOA 1J9IA 4RGXA 1CF7B 1MNDA 2QBYB 4PJMA 2MH9A 3M8JA 1P2FA 1P7JA 3JR9A 1G02A 3EHCA 2F48A 3G1OA 1Z7UA 3FMRA 1Q1HA 3B73A 2A3SA 2KHMA 2TCTA 2PNCA 2IA2A 2CV0A 3H36A 1N25A 4DNCA 3HDDA 2DXIA 1NB3I 3TQNA 1I3FA 1W2ZA 2ZSHB 1G3SA 1CQSA 5KP3A 2WO0A 2HPMA 2CMPA 4LYLB 4L0YB 3OR1C 2KZGA 1LQMB 5A2QK 2JZYA 2XV4S 3GLXA 1Z21A 3MG1A 1XTAA 4UV8A 3F7XA 1O7GB 1W7CA 5LFAA 3CUQA 3I4NJ 2ICWG 4C9YA 2GBYA 3CMAI 5IP9J 3ABKH 1OACA 3Q2PA 2L54A 1LOXA 9RNTA 1OQYA 4LGQA 1QZYA 2XAFA 4BQOA 4C2MJ 1SARA 3JW4A 2GA2A 1OISA 4K2EA 1X1XA 2XF6A 3GTOJ 2RNJA 4Y7NJ 3G713 2KIFA 5B5EC 4XLPF 1OGZA 2F86B 1I3AA 1XSXA 3HOYJ 1FSHA 3HPGA 1SD7A 2VE8A 3GCMA 1IVWA 3FF2A 2E60A 1BM9A 1XPXA 2M7OA 4U0VA 3ZQGA 1LFPA 4LGWA 2ML5A 1MZBA 3HSEA 3STDA 4UVBA 2XGNA 3HX8A 1YJW3 1JT0A 3DXJF 1QGPA 4PK4A 3JRCA 3M1CA 2R93J 2JUCA 4M71A 5EGOA 2FRHA 1NG6A 2ZFUA 3K7CA 1MMNA 2QSFX 5ILUA 1GVDA 2M7BA 4RNZA 1R1TA 2KLOA 1AU7A 4MNUA 1M1EB 1FGTA 4NREA 2D1VA 3HOUJ 3BTJA 2MD5A 3SEQA 4DKIA 2FXAA 2LP0A 2CKFB 4MMXB 2OJED 5CQEA 3TO6A 5C4JJ 2R0QC 1DVCA 2HDWA 1IV7A 3JSPA 1PUEE 1I3IA 4UY8I 1K28A 1LKXA 4AU7A 1D1BA 1FMWA 1RRLA 4WHAA 2A68F 2Z7AA 4WWCA 4U0WA 2VE9A 2G7HA 2K9NA 2EBIA 3HIGA 2LDUA 2DT6A 4GYGA 3X2QH 3VYUB 3OYJA 4F92B 2CRGA 1R23A 3A03A 3LMMA 3H9JA 3PO3J 4Y52J 3FH1A 2B7EA 3L2RA 4IRGA 2F5MA 4Q48A 1V5GA 3R6SA 1GV2A 1SD6A 2GWRA 4I0BA 1B72A 2VONA 4HF1A 1XMXA 3CNMA 2OV7A 4XICA 3B8LA 4X2OA 5IG4A 2QA4I 2VBYA 4RAZA 2AO9A 3F40A 1MOLA 3OIPA 1BC8C 3CC4I 2O03A 1ZQ3P 1STFI 4BJ6C 2BNGA 5LLQA 1GY5A 1HU9A 2CU7A 5BS6A 3AFHA 3K70D 3DLLF 2M8GX 1YVBI 2GXAA 4BL0B 1GD3A 3HK4A 1LNWA 1TT5B 5DD8A 1QU3A 2JA5J 1KQ8A 3E1SA 1AVKA 2KAAA 2AADA 2W4SA 3CCEI 3GFMA 4FISA 4WXCA 1H88C 1G3TA 1O3QA 1IN4A 1EJ9A 3D0SA 3ONQA 1HKSA 1SVOA 3DBRB 3HRUA 3JSOA 3L0RA 4MMYB 2LTPA 2VL8A 5AI1A 3HBLA 4WF2A 4ENNA 4GGGA 3T1BA 3KSPA 2HZTA 1JKGA 3SFIA 5K5RA 5M1AA 1PVEA 2L7MP 1SFUA 1VQ6I 4XSXF 3EUKL 1BI0A 3DFGA 1SQWA 5C4XJ 1QPMA 2BY2A 1KU2A 4BE2A 3E5XA 2OZUA 4OIOF 1ZG5A 1YTYA 5F0FA 2FD5A 2XAUA 3BPVA 3PYJA 2XH9A 1CQTA 3X3ZA 1W0UA 1KD14 4N9HA 1WRJA 2PJPA 1I2FA 4XRSG 2L2OA 2X1CA 4M3DA 5CVJA 3IMAB 2OA4A 4WCGA 2LQVA 3M8FA 2QSGX 2Z2SB 2GU1A 1WJEA 3DQVC 2B24B 3MEXA 2CX1A 3OIOA 4CYCB 2CV1A 4BAYA 1TNTA 1ZRCA 5CYVA 2HMOB 3MCZA 1ZAOA 4ETSA 1LE8A 3GAXA 3VWBA 1RPWA 4FASD 2WGQA 1XD7A 5E3MA 2OU2A 4KIFA 2W84A 3HTUA 1VZ0A 5EG0B 4MFEA 1I6XA 2E2UA 4JQFA 5EEOA 1ZARA 1IN7A 2CJJA 4BBSJ 1Y0NA 4D0PA 2NVUB 5GAHJ 1YITI 2XKOA 1TFKA 2R3SA 3QAHA 3TBIA 2IRFG 1RGCA 3CC7I 1XCBA 2KMUA 2LR8A 1FWZA 4LG0A 3QK9A 1H9TA 1P7IA 1QRYA 2H27A 2UGIA 5BOXA 5D81A 5RNTA 2ZMEB 1XDUA 4EW5A 2ADUA 4WX9A 3DKXA 3CCJ3 1LQ1A 5IP6A 4M72A 1MMDA 3O8YA 4RBOA 5CKTA 4HX8A 2PJRA 2GA1A 4ABZA 3Q9VA 4V2GA 4G7ZF 1HSJA 2NNYA 1G3WA 4L5IA 3DY5A 2YU9J 4L9TA 4H4KC 1JZOA 1BOXA 1FGOA 4YIRX 4HM0B 2BEOA 4Y33A 5L3EA 3OX9A 1VQPI 2DTRA 1X4PA 1YJNI 3Q0UA 2JDIH 2COBA 5ICEA 2STTA 3S3MA 2RNGA 1S3JA 3F6VA 4AIJA 3CD6I 3G1LA 2XPWA 4OWRB 1GOYA 3BNEA 2N8GA 4AEQA 3CCQ3 4G9YA 5HOOA 3OIQA 1B6AA 2M3AA 1WJDA 1MW7A 3P9CA 5ICFA 4ASNA 1KSIA 2RVCA 2AS5F 5L3BA 5KP4A 2FF4A 4UB8C 2DOFA 1DYUA 3M9AA 3J7YJ 1JB2A 1F8NA 1VQQA 4Y3OA 5CLSA 2BBYA 5FFZA 1ONVA 1EA3A 1PUFB 1Y8RB 2P09A 1BC7C 3OWTA 2BT3A 1A6IA 4DBRA 1U9OA 3S15J 1GLNA 4ANJA 1RGFA 1RNBA 3F8NA 1MBEA 4FETA 1R36A 2JJ7A 2DW4A 4J01A 3D1NI 4HQEA 4YG2F 2BY3A 3D4AA 1IXCA 2ZDJA 2K02A 2QUFA 4BKXA 2H0GA 3AMOB 1U8BA 3FXLA 1IF1A 1BL0A 4FX0A 4B47A 1T2HA 2K3FA 3HRSA 1SANA 1UI8A 3AG1H 2WY7Q 4BDZA 1JNQA 3FLJA 1Y56A 1R4CA 1WJ5A 1XMAA 2ZNYA 2L9RA 3G1MA 3IJEB 1S8NA 3HJEA 2X51A 2WA0A 1KONA 2JVHA 4D1QA 1C7HA 4FCMA 1G3YA 4KT5C 4G1MB 1JE8A 4PUSA 1X1AA 5F1JA 4O5VA 1W6GA 3SEZA 5J8FA 2XSDC 3RGAA 5D8KB 3F9SA 3H9GA 2Z9OA 1JBSA 2H6BA 1Z9CA 1CEWI 3TO9A 4RLQA 1JV2B 3NV0B 4LJZF 2ZNZA 5K5QA 3LTAA 4XRFA 3PNTA 3DUKA 2Y75A 3CCRI 2H0HA 2Z6BA 1TLHB 2NVYJ 4LLGF 1J7KA 3JRBA 1DE3A 2OWPA 4H61A 5IERA 1RR7A 1X3UA 3BLYA 4XR6A 1ERDA 3MMYB 1UGIA 1MIJA 5M5YJ 4EGZA 2MC3A 4U88A 3IL2A 4AKZA 4C3IJ 1JB4A 4IX7A 3BP8A 1W5ZA 3F14A 3QQAA 3GW2A 1D0YA 2P81A 1IVVA 5E3LA 2VI6A 3BOQA 1LNIA 2XAJA 1Y6IA 1E3OC 2O8KA 2XC7A 2NAZA 2VPLA 1MMAA 2ZC2A 5AONA 3K4MA 3R61A 3WG7H 1AA7A 1MBKA 4ZH4F 4AM3A 4Q53A 1R22A 1NWWA 3CESA 3FISA 3AHWA 3QRFF 4ITVA 2ESHA 2UZKA 3CUQC 2G0EA 4M3BA 3CC23 3OYDA 2LH9A 4U0YA 1X1WA 5J1RA 4A0XA 1YNVX 6PAXA 3RSNA 2LSOA 2DT7B 3FXJA 3PUFA 3CCSI 3I3LA 1KA8A 2KIMA 5IP7J 3J7ZI 5IENA 1FOKA 1FA3A 2ELHA 3KP6A 1LOWA 4KFCA 3FF0A 1D3YA 4EM2A 4A6DA 2ZJ2A 7RNTA 4ZTJA 5EVHA 1OCVA 2GOMA 4B09A 3OS1A 4NUBA 4NQWB 3MZ8A 3LA3A 3LNQA 3OW22 5ILSA 1I0XA 3SHFA 2VC0A 1MGTA 2IMJA 3KFWX 3TP0A 3SZGA 2LF7A 4YIIA 4A2UA 4I02A 2WB1N 3A76A 2FQ4A 3PQKA 4FR9A 4ZYHA 2O9UX 1GY6A 4HV6A 1MSFC 3CCM3 4XN3A 3S3OA 2DT5A 3WTSC 1UFMA 2OCCH 4N6OB 1V5FA 2K9LA 1ZR4A 1Y39A 4NC8A 1FTTA 4XOPA 3GLLA 3OV8A 2VLAA 1IC8A 2EZLA 5D6EA 2VODA 4IXAA 1HYFA 2C10A 2LD5A 2DA4A 1HQCA 1X1BA 4XLHA 1MWRA 2BVMA 4M3EA 1Q9EA 3KYDB 2A15A 2ECCA 2KISA 2CC3A 3WODF 2P0MA 3AHSA 3LFKA 4XDWA 4MJDA 3HOTA 3KCCA 1YS7A 4M3GA 1UG0A 1T2KA 4BU2A 1ETXA 1X58A 3LSJA 1TQIA 3W6VA 3GTPJ 3DCFA 4B8XA 3TKYA 1B8IB 2Z76A 4X2HA 3ZQ7A 3E3VA 4EJTA 1F1ZA 2EB7A 3PSIA 2LY9A 1BNJA 2BIRA 3BR2A 3DXOA 3MKIA 3OWYA 1E3PA 3EB8A 5M5XJ 2EPFA 5CVIA 2FE3A 2D45A 4IHYA 3GTKJ 1AR0A 4BU4A 3EBTA 2M1BA 2P6TA 2STDA 5I97A 1YI23 3VYTB 4OAYA 2ZJQF 3I54A 2CWUA 5JR3A 2ELKA 1BSDA 2HQNA 3S16J 1M904 3A4CA 1LRAA 4BS9A 1KYWA 1N77A 4HAMA 5TISC 3BR1A 4XL9A 3S5CA 1FUWA 3I53A 4CCLA 3RKQA 4CHUA 2LYXA 3DGMA 4WYKB 4HZ9B 1G2HA 1FGMA 2WTEA 1R5ID 3V92A 2IT0A 4ZYDA 4LD5A 3F8CA 4Y4RA 3K6GA 1X3WB 2EIJH 4PDKA 5K1YA 1U0JA 3VDXA 1D1AA 1S7AA 5F64A 4EBGA 2XEPA 1XCVA 1TTYA 3EX9A 3EF8A 2LKXA 1BANA 4F7ZA 2Z99A 4HJLB 1O57A 2WADA 2ZSIB 3QPLA 1CF7A 2RREA 2QBYA 1UUVB 3B4PA 7STDA 3KLNA 1JTYA 1RRJA 1BJAA 5DYMA 2QEX3 3I64A 2XGLA 4HRIA 4FCYA 1F5TA 2CFXA 3KZYA 5JLXA 2CUZA 5HDKA 4IRHA 1Q42A 4J8TA 2DU9A 4TV7A 2MA3A 3CO6C 4A3DJ 2V9VA 1C0WA 1LFUP 3COAC 1MBHA 5K5OA 2KDZA 5L3CA 1DETA 1QVF2 3Q1CA 2AXTC 2HOHA 2E5NA 3PIPF 4D7NA 1ZRDA 4XKVA 1YVSA 3OYEA 2VOOA 1WNHA 2BY1A 1A04A 3LA7A 2FMYA 2KZVA 4RB0A 4CYDA 2IW5A 3K70C 2KRCA 2P7VB 3BWGA 5IY5H 2WAEA 3ZPLA 3KX2A 4BXFA 4A3MJ 2A07F 2VT3A 3HKZA 3JUNA 3M1EA 5CF1A 3K9MC 2O6GE 5KCMA 4XIDA 4XNFA 4I09A 4FTHA 3IAS2 3E5QA 4HX4A 1YX3A 1HW2A 2EZHA 3GZNB 2EH3A 2HFHA 5LRSA 1IRFA 1TBXA 4PFOA 2LY1A 3ROUA 3J7AY 1PJRA 4PJNA 2FBKA 3G73A 3N9HA 3BG3A 1PYVA 2K9MA 2VBWA 3CJNA 4JK1X 3QPTA 1K41A 3I56I 1MGWA 2CFKA 3FG3A 4K1VA 1YYVA 4MO7A 1IQXA 1UUGB 4GXOA 2EK5A 1I50J 1FPQA 4XQFA 5H6QA 5DM6F 4X6AJ 1JN5B 1MWUA 4XMYA 2V6CA 1PYLA 4E7KA 3PUBA 1YRNA 3OYMA 1YG2A 4A0YA 1SAXA 3D79A 4E6KG 2XAHA 2GXGA 5D83A 4RGSA 1VQK3 2GOXB 1WKMA 3HB9A 1TL8A 2XGCA 2KRFA 2IP2A 3I4PA 2DFFA 3DGLA 1LPQA 1B9MA 1FNNA 3F7SA 4A5NA 4XN0A 3ZN1A 2COMA 1FTZA 1J75A 3H9QA 4CCVA 4ZYGA 1VQO3 5JPUA 3BC8A 3DPUA 1YO5C 4IRIA 3I55I 1K61A 1E17A 2FNAA 1DPUA 1MNEA 1FJLA 2E7XA 1X2NA 1YHQI 3S32A 3CCVI 4Q5SF 4R9LA 1EQKA 2K7LA 1EKEA 2K9SA 1D0ZA 4IOCF 1D5VA 3TP3A 1L3LA 1FZUA 3FKIJ 3WGIA 3ABMH 2DODA 4BACA 5FW5A 4P96A 2XFSA 1IN5A 4BYYA 3GYHX 1EH6A 4B4CA 1MH3A 5DCMB 4O3VA 4NC6A 3Q3FA 3S1RJ 3D5GA 1V54H 5D4RA 3LT8A 2LY2A 2DCEA 2LOOA 4GDFA 1BIBA 3NWSA 4MHGA 4BJ5C 5IOYA 1NHAA 3M07A 3MVPA 4OOIA 2L7FP 3CCLI 2MSYA 4ESJA 3TOAA 2NOJB 2VBZA 1U5TC 2ZFWA 4XKWA 4QIWN 3CCUI 4X1EA 1A36A 4CSWA 3CNXA 4KDPA 1TTOA 1KU7A 1STDA 3GXOA 1NO3A 2BW3B 1JRQA 1QAKA 4OUQA 3GFLA 3HRTA 4GB5A 3KE2A 4EGYA 2IA0A 1BSCA 4I0AA 4L5EA 2QLZA 3S1NJ 4A6EA 2F4IA 5BXQA 1D5YA 2MC8A 1IDYA 1P4WA 1H89C 4C2TA 3CP8A 1H0MA 1T95A 2CGPA 2DA7A 1FUTA 3K69A 1OHSA 1WZ2A 2VQLA 1EH7A 2ECBA 2VASA 2IS1A 3JRFA 3HOZJ 1D8JA 1TT0A 1KZHA 2D5VA 1IYYA 4IF4A 3EC9A 3BZ6A 1EA2A 2YR2A 3LSKA 4CYCA 2MH2A 4DZJA 1RI7A 3S1QJ 2IGOA 4R4KA 4PSXA 3MD2A 3DZLA 4FMAA 3G2BA 3EPZA 2JRTA 3L2QA 1FYMA 2YFIB 3T8NA 3IWZA 1O3RA 3WTYC 5F0CA 1RIOH 1PY3A 2UWMA 3KCHA 5EG0A 3B6AA 3QWLA 3CO7C 2XF7A 5IYDJ 2VKDA 1O7NB 4NHJA 1BNSA 4XKBA 3T8TA 5JFRA 1JI8A 3VGNA 1MDMB 4RNYA 1OCTC 1T3BA 1BI2A 4BUPA 2P5KA 3H0DA 1B20A 4BTWA 5BNGA 2DA3A 4RB1A 9ANTA 1MWTA 3BQYA 1L5GB 2GXBA 2OF7A 2CQKA 4PJ0C 3ABLH 2MLGA 4A3GJ 3EUHA 4RAGA 1K7AA 4KNYA 1SPUA 2OC6A 2TRTA 3ECFA 2ZMEA 3WHOA 2QZ8A 3HGGA 2E35A 2ISZA 2KXGA 3FXOA 2I10A 1GD4A 2QWWA 3PNVA 2CG4A 1VQ5I 1FY7A 2KFDA 3PGBA 1S29A 2W25A 1B27A 2EZKA 2OPTA 4BXUA 2SARA 1USSA 2F6CA 1J5YA 1G4DA 3RKXA 2LMDA 4R80A 2HMJB 1GS3A 3GSPA 1QHHD 1DU6A 3S28A 3WE3A 3VFZA 3GZRA 1TW3A 3NM2A 2VQHA 1V4RA 2ZB9A 2O3OA 3K4CA 1S9HA 3FHNA 5J8CA 3F3XA 3EBYA 1HKTA 2DFHA 1ZGAA 2Z5UA 4MFDA 5GP9A 3IV5A 2MYSA 7GSPA 3LQRA 3JRIA 1IDZA 1E97A 4C3JJ 3N05A 2ELJA 4PEJA 5AYRB 3DU5A 5CLKA 4HF2A 5A2QZ 4HYEA 3KP7A 5GPAA 4I4KA 4HA8A 2EFQA 2DQRA 3MAJA 1U3EM 3WGHA 2HQRA 4CA0A 1SC7A 3SFZA 5E1WA 4MIMA 1MMGA 2H09A 4V19K 2K3DA 1PUFA 4HOBA 4IHTA 2W9PA 5E17F 3AAFA 3SOYA 3AGOA 4EATA 1BAOA 1FIPA 3NQYA 2HDCA 3KPHA 1RGEA 2K4JA 5DUIA 3WTWC 3LXUX 3ZFZA 2KF5A 1DU0A 4HNTA 2MW8A 5L3GA 2HNHA 1K79A 3OY9A 2J8XB 2GAUA 4M6VA 2ZKZA 1BW5A 2EIKH 1LQGC 3PCSA 4RNTA 3MQ0A 3AMOA 4FX4A 5CJ9A 3HOWJ 2E1MC 3OYAA 1O3SA 2BO9B 2OCTA 3VPRA 1QAFA 2RQQA 2AQEA 1OFCX 1RESA 2PMZN 3T0UA 1XG1A 2XRXB 5ILVA 2O9LA 4M3FA 3HZPA 5TGTA 1A31A 3RZOJ 5G1LA 1LNHA 5GADJ 2V7FA 2LYCA 2WGOA 3L2CA 3DKWA 1BSAA 2BHYA 3MG3A 2Y73A 2HEOA 1B9NA 1I6HJ 1OKRA 3H1CA 4RGUA 4J00A 1PP8F 3NV0A 5BPIA 3NHXA 3B4OA 3S27A 5IEOA 1I70A 1VQLI 1KU9A 3JRAA 3V7SA 1NK2P 2NS0A 2L7KA 2OZ6A 4EJVA 4HLYA 3J81K 3N8BA 3BTIA 2M0MA 3CMA3 3GMEA 1Z77A 4AUXA 1TC3C 4TX4A 1BR2A 3G6EI 5CVUA 1VTNC 1W4NA 4KIBA 3SDBA 4AIHA 4RLFA 2DN0A 4L9VA 5FLXZ 1QHGA 3DEWA 3GTLJ 1BNGA 5G1KA 2DPUA 4DW6A 5FLXK 1IN6A 4N6LA 4EM0B 2R7UA 2OTJI 2V79A 1SMYF 2RQPA 1LFBA 1WTHA 2V1NA 3W2WA 4XDVA 1KQ0A 2QQ9A 2R92J 2O8XA 2F99A 2HVQA 4LK1F 3TGNA 4KIGA 4WP5A 2YFJB 5FLMJ 3DPLC 5DD4A 1YW9A 2R5ZB 3A0HC 2J5PA 2B9SA 3RKWA 2WAQA 3J80K 3F8BA 2EFNA 1FLIA 2RV8A 1IQYA 4DIQA 1EUIC 4GFBA 3SOAA 2QCOA 3O8HA 5LHIA 4A0ZA 5HOHA 2CSOA 1POGA 3FXUA 2FJ1A 3PM1A 3ZMUA 1VQ4I 3EN1B 2BE5F 2O5RA 4LB6B 3DV8A 3OS0A 3WR2A 3KP3A 3WU0A 2IGMA 2LC2A 4NQWA 3NM7A 2H1LA 1SAUA 4X0GA 4ESBA 5KP1A 2R7TA 1ETVA 1Y8QB 3U9GA 4YELA 5B66C 4BXXJ 4N6UA 3ER7A 4KN7X 2RGVA 4ENJA 4J5GA 3G8ZA 3NEUA 5J3LA 3GZ5A 2KRHA 2W03A 1IZ1A 1R7JA 3QPHA 1GUUA 5DV5A 3LSGA 4A3FJ 4H3UA 1K6OA 1ON2A 3HOSA 3HYIA 3S3NA 3FM5A 1PP7U 1BRKA 2CW8A 4D9JA 4YFNF 1OCRH 3J7AO 3DM8A 1WMNA 4UUVA 4I98B 1BVIA 4DOZA 3WHBA 1R9TJ 1OMIA 1ETOA 3V42A 1LVNA 1WI9A 2Q1ZB 2B0LA 1B21A 2K86A 5F0HA 1LOYA 3SLUA 2QA43 2RNTA 3CC43 1I3QJ 1OR7A 1NH3A 2CV2A 3WOEB 1HKQA 4U13A 1Y4KA 1M9GA 4B44A 4HPQA 3FZWA 2L3DA 1Y0UA 2V1XA 3OYBA 3W6JB 4I01A 2GSPA 5J4VA 1Q40A 4MQVA 4L8OA 2EV0A 1UHMA 2X6YA 2FGTA 2P4WA 3CCE3 1EH8A 2W1OA 2E2TA 4FHTA 2WBMA 1AV4A 1UJ8A 3BR6A 2GU3A 3BCBA 1VF9A 1I1SA 4B43A 4IHWA 3MKYB 1QQIA 1T56A 2KL4A 3B6CA 1D6UA 4K61A 4BQQA 2DA6A 1XN7A 3I0TA 1IG7A 1YLFA 1UDII 5IG5A 3EYYA 2K27A 3QODA 4OMZA 1VQ63 3GUDA 3X3YA 2GM4A 4LB5A 4HQMA 1TU5A 2DI3A 2Z1DA 3ZQCA 1W6YA 2Y2ZA 5FKMA 3W2VA 5AEWB 5BQTA 1O7WB 2V26A 1VNDA 2W00A 2X4HA 2ZXJA 3LSMA 2HKXA 4BEHB 4CCNA 4P55A 4RM3A 3ZR8X 4AVZA 4ZTFA 1BRGA 2GBXB 1JKPC 4WYKA 1GYBA 1J2XA 3I59B 5DEQA 4FCZA 3WTVC 3ECHA 1MBGA 2VIXA 4LLNA 1WMOA 1U6GA 4HVNA 5HNFA 5CVRA 3CMEI 2PLYA 1UI7A 2RSXA 1LB2A 2CQXA 3FIWA 1FOYA 1R5GA 1RHLA 1NG7A 2JTVA 4C30A 3QRDA 1XC5A 1XSVA 2IS4A 3KFQC 4XOTA 2J5OA 2CW0F 4KYWA 2CG0A 1HA8A 1W7PD 1TFOA 1VQ8I 5EZHA 2HVRA 5CK6A 1JBRA 2JVGA 3A0BC 5ICGA 1OCOH 2C6YA 3ZG5A 4LIUA 2KP6A 2M4KA 3PSFA 3TMOA 4AC0A 5E8IA 3CF2A 3SJMA 1YIT3 1FBUA 4CICA 2WOFA 2PX9A 1YIOA 3WGGA 3K9TA 2CHCA 3EJVA 1Z05A 2R7XA 2CUJA 4AD9A 3LMLA 3RI4A 3L2WA 3CC73 1KQ9A 3ZXSA 3FMSA 3EETA 3RJPA 1MNMC 1BSEA 1K8A4 2IUJA 1ZG3A 3GF2A 3X40A 4PJLA 5BPDA 2IA1A 1ULIB 3LSRA 3VSLA 3F8HA 1D8KA 2X6WA 3FM3A 3HM5A 3K4JA 2PMUA 4LZIA 3H51A 4XB5A 1VQ73 1IW7F 2PBIA 4FT8A 1UZCA 4HM4B 5ED4A 2RN7A 3RIRA 3CDHA 3VEPA 3URPA 3A01B 5FKKA 1IUYA 1IU7A 5HLIA 4MTDA 3HIIA 4KA4A 1ENHA 1FGQA 1NU3A 3CDIA 1W5TA 5HS7A 1DMMA 2EQRA 5ELJA 2DTZA 1EKMA 1VQP3 3EUHC 2K3PA 4A5MA 4HYZA 2IVMA 3DKYA 3H3ZA 1O7LA 1YJN3 5J1UA 1E3VA 5BIRA 4FQGA 3WA3A 2DMTA 2HYJA 2ZMEC 2XRNA 2VB6A 5F04A 3DEEA 1SVMA 3C18A 2O61A 4D7MA 3AKZA 1BRIA 5KHDA 2CS3A 3RQ4A 2ZXHA 3JUQA 3FXKA 1A6QA 3CD63 1MGRA 1GOUA 3F23A 4FMDA 5AIFA 4BTYA 5KK1A 3MPHA 2NOGA 2E2JJ 2YFLB 3CJRB 1JZDA 4GL6A 2DK8A 3HHGA 4U87A 3LTDA 1HKXA 1JN5A 1WFXA 4FMBA 2Y31A 4KVHA 1RC9A 5E1XA 2QVOA 1W7PA 1ZKGA 2RDPA 4F91B 1HF0A 3KP5A 2LBFB 2ZBKA 1OH0A 2LVSA 1Q864 2F5DA 1JKRC 4EM1A 4HKVB 4IHXA 2CQQA 2O7OA 3FHZA 2W2CA 3I5UA 5DM7F 4STDA 3BJOA 2OQRA 1XB4A 5EGOB 2BMRB 1T2IA 1O7HB 2PFBA 2HOEA 3OYCA 1GOVA 2M7AA 3MKZA 3LTBA 1A5JA 2IGNA 1F43A 4J5KA 1LEAA 2XKPA 3BPXA 3E5UA 4KUMA 1JGSA 4IOAF 1TP6A 5E3NA 1LJ9A 5HNHA 1Z0XA 1AY7A 3NQOA 1G6NA 2QKLB 4LLLA 2OOVA 5DCMA 1K78A 1IN8A 3CU3A 2Z77A 1ROAA 2F98A 2L5QA 3LSTA 2OAZA 5JHFA 4J9AA 3RYPA 1R71A 3MG2A 3SXYA 4XK4A 3EQLF 3C2HA 3D5LA 2A5YB 2HTJA 1I39A 1RRHA 4HZBB 4L18B 1AVLA 4LIVA 2C11A 3AL0C 2SBLA 3CCR3 3DGNA 3CCYA 1YGEA 3RDEA 1B1BA 2VXDA 1MJAA 2CO5A 4EVIA 4QWQA 3CMYA 3F8FA 1B72B 3SZTA 3A02A 2EV5A 2XROA 4OIQF 4CPKA 2F56A 3FF5A 3D3LA 4IVNA 2DYSH 4YIFA 2BMOB 3B7CA 4EV2A 2FUG2 2BW3A 2RGQA 4O6JA 1TWAJ 1FZPB 2RAEA 2V6EA 2DOEA 1OPYA 2E1NA 4ORLA 1FIAA 3U1WA 4Y15A 3KE7A 2DJIA 3LQQA 5IYBJ 1B3SA 1W5CC 2G9WA 2HQ5A 1IXRC 5LEJA 1OHPA 1HCRA 2WC2A 2E2IJ 1GXQA 4HG2A 3ZN0A 1T38A 1RNLA 5FD6A 2QQAA 4RB3C 3VSKA 2ZL8A 1DGRM 1DMQA 2K0MA 5M18A 3C7JA 2F5CA 2UUGC 2JA7J 4XLCA 3CCS3 3JREA 3RYRA 3LZAA 4HSRA 1RGLA 5JHUA 1U8RA 3HRMA 2CW9A 3JAMK 3GZ6A 1LEBA 1WJAA 3IP4B 2FNQA 4PCQA 4ZC3A 3T8RA 1ZS7A 3RNTA 3NQZA 2V1LA 2DFEA 1BR4A 2A6HF 4IHSA 3GZXB 4MMZB 2CFOA 3BJ6A 3ECOA 1TUHA 1IUFA 5JLWA 5DTDA 4O8SA 1X1YA 2DOAA 1RMSA 3KEOA 3K63A 2H8WA 2Y69H 3DU6A 3JUPA 4KFFA 1CH0A 3UJMA 2DJNA 5LC6A 2Q07A 4HM7B 1D0XA 1MDMA 3S1MJ 5G2GA 4JP0A 3ZMSA 3X41A 1N9EA 4XM3A 3P7NA 1E3RA 3KEQA 3BCAA 5HGRA 3JRHA 2KJCA 3HSRA 4IO9F 3E6CC 2KT0A 3MWMA 1J59A 2X48A 3D5SC 2OBPA 1TJDA 3W6KB 3SX1A 4BY1J 2AHQA 1BR1A 4XBFA 2PN6A 2QQ8A 2ZCWA 2JA6J 3MWZA 5IYCJ 1DVDA 2BHMA 2OTLI 1RJOA 1N78A 2KJBA 5HS8A 4CCJA 1UCKA 3CXC2 4OIRF 3UNGC 2W56A 4KJZA 1Y1WJ 3BR5A 4HM5B 2D42A 3DBHB 1TWHJ 3OWSA 2JT1A 2M34A 2Y0SA 1P6RA 4H0EA 1MBJA 1IGNA 1TW2A 1R1UA 2VJIA 1RCLA 2FX0A 5FGOA 2ML6A 2NS7A 3MKWB 4E7SA 4GRIA 5J4YA 1BIAA 2A5WA 3P9IA 4CDLA 2M0CA 2H8RA 3ISPA 3O2PE 1I27A 3TDUC 3WMDA 3S93A 3FXRA 3SYTA 4AYBA 1VQ9I 1OR7C 3BG7A 2HXOA 4D5CA 3QP6A 4ZZLA 2JA8J 2W9QA 1K4TA 3JUMA 3S17J 1UGHI 2JSCA 1YJ9I 2GQQA 1RGKA 1BNRA 4L0ZB 2L9NA 1C54A 2LNBA 5EDNA 4P5OA 2HPIA 2XVCA 1IAWA 1WJFA 2CUEA 8RNTA 1HZ1A 3NUVA 3ULQB 1JJ8C 1S5LC 4Z6YA 3L00A 3OV4A 2EILH 1G59A 3HEFA 2EA4A 2F4MB 3F9KA 5C3EJ 4B3XA 4QPOA 3BJAA 3OWUA 1OYWA 2V4JC 4G6DA 4ON0A 2E1OA 2BV6A 1JGGA 5KAFC 3A1YA 3JCUC 3GTMJ 4BIRA 2AAEA 3TW7A 3U1KA 5LHHA 1OCZH 1ASKA 4I5QA 1H9GA 3PFIA 1Z3YA 1I5ZA 4BHBA 1D6ZA 1KGSA 3HUGB 1IDPA 1TWFJ 4FCJA 2LFBA 2NNNA 1FX7A 2Z3YA 1X4OA 2IPQX 5FKOA 3WTXC 1U9NA 3PQJA 1K4SA 1WH7A 3S14J 2AXLA 3VF1A 1W1WE 1GVJA 1RR8C 1OF5B 1Z1DA 3GZBA 1NNVA 1ZLJA 3PZWA 2CWEA 4IQ4A 4AIDA 2L02A 3ALAA 5CXOA 3ZP5A 1YOVB 4AWXB 2ZA4A 2WY8Q 2YS9A 1R4NB 3Q9SA 5H2FC 2WWYA 2HKOA 4G8XA 1BU4A 4II3A 2ID3A 3KP4A 1U5TB 2L9SA 5ELUA 3LT9A 2CYYA 2ZJRF 1VQMI 3A5EA 3H0GJ 3BG5A 3V8LA 2XGEA 3ASOH 3TDZC 2PZVA 2MFZA 1BNEA 3VSYA 5E79C 1W01A 4S04A 1FYLA 4V2FA 3K2ZA 4RDUA 2XGXA 3U21A 1ZK8A 2EV6A 2XUBA 1BNIA 1UCIA 3KIIA 2EINH 5F08A 2R4GA 4KZ1A 5AYSC 2DQLA 1YIJI 2XSOB 4RZMA 1BRSA 2IAIA 3BNDA 4F93B 3EUAA 1GMQA 3V8JA 4UUSB 2I8DA 4PGGA 2FBHA 2PG4A 3U97A 2F5WA 3QU6A 5AIPA 1JUSA 2Y48A 2MF7A 4OVMA 2WOHA 2E19A 2K54A 5CVVA 1MJ9A 3I563 3CPW2 1BOBA 2CK3H 1X1CA 2Q2EB 4ENMA 2CFGA 4Z2YA 4N0BA 1T8IA 3M8EA 1MD0A
chains in the Genus database with same CATH topology
2P05A 3OX9A 2WGOA 4MEIA 2XSHB 1NB5I 2JDIH 4LEHA 3MG3A 2Y73A 3NV0A 3V98A 3NHXA 3S27A 3B4OA 5IEOA 5AIHA 4AKYA 1Q40B 2W0QA 1K9M4 4AEQA 1T5YA 3N8BA 3BNEA 1LXEA 3I553 3CCQ3 3CMA3 5AIGA 1M1K4 4TX4A 1KSIA 1J2BA 1N5HA 1ULJB 3NBRA 3PCRA 1W4NA 3PXMA 1FGRA 1N5PA 1YHQ3 3CCV3 5KP4A 1DYUA 1Z1SA 2HMKB 1JB2A 1F8NA 5TGNA 2P09A 2RCDA 3RGRA 2BT3A 4N6LA 2CIUA 4O02B 3SXXA 3V99A 1WTHA 2GBWB 4XDVA 2F99A 2ZDJA 3T8UA 4WP5A 2YFJB 3AMOB 1PFPA 1OHOA 5AEUB 1UI8A 3Q90A 1JNQA 3FLJA 1R4CA 3JVCA 1IQYA 3M8CA 3IJEB 3SOAA 1W6CA 3CCL3 3EN1B 4FCMA 4G1MB 1C7HA 1IVUA 3CCU3 3ROBA 1W6GA 4HM2B 3RGAA 2CFWA 3NM7A 3F9SA 2OOVC 4RBNA 2OTL3 5KP1A 4JRFA 1GY7A 1CEWI 1ZX2A 1JV2B 3BNBA 3NV0B 4N6UA 3WODG 3ER7A 5BVBA 3LTAA 3DUKA 4N6V0 5EQLA 2CFLA 3G8ZA 4WWUC 2Z6BA 2W03A 1NDOB 4H3UA 2OWPA 4H61A 5IERA 3BLZA 3S67A 3G16A 3UB1A 4AKZA 1JB4A 1W5ZA 3F14A 3DM8A 3K0ZA 1WMNA 4N6MA 6STDA 1IVVA 1LVNA 1V74A 3BB9A 3SLUA 2QA43 4EV5A 4EYCA 2BMQB 3CC43 1A67A 3WOEB 4Q53A 1NJI4 2JQ5A 4U13A 1VQ93 1Y4KA 1M9GA 1NWWA 4LMIA 4EXRA 3MYTA 3FZWA 3NBBA 3CC23 1Q40A 4R9KA 4L8OA 1YJ93 2FGTA 3CCE3 2E2TA 1AV4A 5IENA 3WDGB 2GU3A 1FA3A 1RKYA 3FF0A 1QMAA 2HMLB 1D6UA 4K61A 4N6NB 1N8QA 4O2HA 5EVHA 1OCVA 2CH9A 5IG5A 3OW22 3UL5A 1VQ63 3X3YA 3KN4A 3LH4A 5DREA 1TU5A 3OXAA 1W6YA 2IMJA 2IUKA 2L4VA 1VQ53 5AEWB 3A76A 1O7WB 4RZMA 3MSOA 4FR9A 2O9UX 1GY6A 4HBRA 2GBXB 3CCM3 4WYKA 1GYBA 1W02A 4K90B 4FCZA 4N6OB 2GEYA 1WMOA 2B1XB 1Q7Y4 1ROVA 4HVNA 2UX0A 3IPTA 1UI7A 2RSXA 4QWTA 2C10A 1D6YA 1OUNA 3QRDA 4N6TA 3KFQC 1IQ8A 2R4IA 2CG0A 3E99A 2A15A 2HMNB 1TFOA 2W6JH 4JF8A 1KQS2 3KKGA 1O7MB 1S5AA 2CC3A 2P0MA 3DMCA 5CK6A 4L8PA 5D82A 4WFOA 4XDWA 4MJDA 1IT7A 1VQM3 1IT8A 1ZO2A 3JUOA 4X2HA 1YIT3 2Z76A 2WOFA 1MNLA 3EJVA 2CHCA 4ZM8A 3LMLA 3NBJA 2P38A 3CC73 1TIJA 3EN8A 2INXA 3DXOA 1A2VA 2W04A 3MKIA 3OWYA 2IUJA 1K8A4 3EB8A 3X40A 1YIJ3 3I0YA 1ULIB 1AR0A 3BNCA 3EBTA 1IV9A 4KFDA 2CWTA 3F8HA 1M1XB 2STDA 5I97A 1YI23 1Q824 2CWUA 5AIIA 4LZIA 3GWRA 3H51A 4XB5A 1CYUA 3H3HA 1M904 4HM4B 1O7PB 3S5CA 1IU7A 2LYXA 3DGMA 1Q814 3HIIA 4WYKB 4HZ9B 1FGQA 1FGMA 1NU3A 1DMMA 2CWVA 2GXFA 1EKMA 5ELJA 3V92A 1VQP3 4KFEA 1OGXA 4HYZA 1YJN3 1E3VA 3WA3A 4IIAA 4EBGA 1VQL3 2XEPA 3EX9A 4LSOA 3EF8A 3JUQA 3CD63 5AIFA 4FMDA 4BTYA 4HJLB 3PS8A 3MPHA 2YFLB 3X42A 1UUVB 4GL6A 3B4PA 7STDA 2XR8B 3LTDA 1HKXA 1JN5A 4FMBA 4K1UA 3FGYA 3GZYB 2QEX3 4KVHA 5CF2A 3G6E3 2XGLA 1G96A 2RFRA 1SJWA 2FXTA 4XM4A 3KSED 1Q42A 1QALA 4J8TA 1JJ22 1JB5A 4N3VA 5IEPA 1OH0A 4OK0A 1VQN3 1Q864 4HKVB 2OTJ3 5IW9A 1W2B2 2W2CA 1QVF2 3Q1CA 2OQEC 2QIYA 3G4S3 4STDA 4BTXA 2BMRB 1N9JA 1O7HB 2CFDA 1S723 1WNHA 3S29A 4HM3B 3LTBA 4FMCA 3JUNA 1VQ43 5CF1A 2CG1A 3K9MC 4IPBA 1TP6A 1VZZA 5STDA 2OOVA 1IK3A 3CU3A 2Z77A 5IG0A 1ROAA 1SIHA 1SIIA 2F98A 2W56B 3F8XA 3SEDA 4J9AA 3MG2A 3CPOA 1RN7A 4HM1B 1RRHA 4HZBB 1AVLA 1U8CB 3G0KA 3MHEA 2C11A 2SBLA 4XBYA 3N9HA 3SVAA 3DGNA 3CCR3 1YGEA 3RDEA 3LTCA 3D9RA 5DRVA 1K41A 2CFKA 3FG3A 4K1VA 3EHCA 1IQXA 2XF3A 1JN5B 1ISKA 2E2VA 3D3LA 2PNCA 2BMOB 3HI7A 4EV2A 3B7CA 1NB3I 2RGQA 1W2ZA 1CQSA 5D83A 5KP3A 1VQK3 2WO0A 1OPYA 4ORLA 4L7KA 1A2KA 3DGLA 1K734 3U1WA 3MG1A 3F7SA 3F7XA 3KE7A 4CCVA 1VQ73 1O7GB 3FG4A 1OHPA 1W7CA 1WMPA 1VQO3 5JPUA 3FKAA 2ZL8A 5JBSA 1DMQA 2K0MA 1OACA 3Q2PA 2XFTA 1LOXA 3CCS3 1EQKA 4R9LA 4LGQA 3LZAA 3WOFB 3NX0A 2CW9A 2FNQA 4HM8B 3G713 3NQZA 5FW5A 2V1LA 2F86B 1OGZA 3GZXB 2XFSA 4MMZB 1TUHA 4O3VA 4O8SA 1IVWA 3FF2A 4EC6A 3LT8A 3K63A 2M7OA 3UJMA 4KFFA 3JUPA 2ML5A 3LOYA 2Q07A 4HM7B 5LC6A 3STDA 2XGNA 3HX8A 1YJW3 3N54B 5G2GA 3X41A 1N9EA 1E3RA 3K7CA 4RNZA 5HGRA 3K5TA 4IT7A 3SX1A 1FGTA 4NREA 3CNXA 1STDA 1NO3A 1WQLB 2CKFB 4MMXB 1KWIA 3KZTA 3UL6A 3MWZA 1DVCA 1JRQA 3CME3 2BHMA 1DVDA 1IV7A 1QAKA 4OUQA 4GB5A 3TDGA 1RJOA 3EE1A 3NXJA 1FUWA 1K28A 1QJGA 1UUWB 4WHAA 1RRLA 2YX9A 3CXC2 2Z7AA 5IG3A 5BXQA 2W56A 2MC8A 4HM5B 2D42A 1VQ83 3HIGA 1U5OA 3OWSA 2HMMB 1EG9B 1W00A 8CHOA 1OHSA 3FH1A 2KRTA 3EC9A 1OF5A 3CNMA 2ML6A 5FGOA 1EA2A 3B8LA 4X2OA 5IG4A 4R4KA 4CDLA 3F40A 1MOLA 3DZLA 3T8NA 4FMAA 2YFIB 3WMDA 1STFI 2BNGA 1GY5A 3GRDA 1HU9A 2W9QA 3JUMA 1YVBI 1GD3A 3HK4A 1O7NB 1AVKA 3VGNA 2IA7A 4RNYA 4BTWA 4NHFA 1QVG2 1L5GB 1KC84 3NUVA 4MMYB 3L0RA 3UNLA 3OV4A 5AI1A 3KSPA 1JKGA 1SPUA 1PU4A 3ECFA 4HM6B 3OWUA 2D1WA 4XBXA 3J7Yd 2I9WA 2KXGA 3WA2X 5IF6A 1GD4A 1SQWA 3FCSB 3PGBA 1ASKA 2P0XA 1A90A 1D6ZA 1IDPA 2GEXA 4FCJA 4R80A 3FG1A 3PYJA 2HMJB 2XH9A 3X3ZA 5A0OB 1KD14 1GS3A 3IMAB 3S28A 3GZRA 2LQVA 3NM2A 3VF1A 4R1KA 2O3OA 2GU1A 1OF5B 3GZBA 2B24B 3EBYA 1N8R4 3PZWA 1UW1A 2HMOB 3ALAA 5CXOA 1E97A 2OQEA 4PEJA 3GAXA 5AYRB 5CLKA 2WGQA 3DGOA 4I4KA 2QGUA 2KCDA 5JPPA 2E2UA 5EEOA 5ELUA 1DMNA 3LT9A 2Y74A 2PZVA 4XBTA 2W9PA 3SOYA 1TFKA 3LYGA 3NQYA 3VSYA 1W01A 3LXUX 3QK9A 5AYSC 4KZ1A 3X3XA 3KIIA 1JKGB 1CYVA 5D81A 3PCSA 2XSOB 3BNDA 3AMOA 1IVXA 3CCJ3 2BO9B 3O8YA 3FSDA 3U97A 2OCTA 2MF7A 4OVMA 1QAFA 2WOHA 3DY5A 3T0UA 3I563 2K54A 2XRXB 3CPW2 2CK3H 3EQQB 3HZPA 1US1A 2CFGA 1FGOA 1LNHA 1BUQA 5LC7A 4HM0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OX9 A;  2XSH B;  4LEH A;  3MG3 A;  3NV0 A;  3NHX A;  3B4O A;  5IEO A;  5AIH A;  1Q40 B;  5AIG A;  1ULJ B;  3NBR A;  5KP4 A;  1Z1S A;  2HMK B;  1JB2 A;  5TGN A;  2RCD A;  3RGR A;  2GBW B;  4XDV A;  2F99 A;  3T8U A;  4WP5 A;  2YFJ B;  1OHO A;  5AEU B;  3Q90 A;  3FLJ A;  3M8C A;  3SOA A;  4FCM A;  3EN1 B;  1C7H A;  3ROB A;  4HM2 B;  3RGA A;  3F9S A;  5KP1 A;  1GY7 A;  1ZX2 A;  5BVB A;  3NV0 B;  3ER7 A;  3DUK A;  3G8Z A;  4WWU C;  1NDO B;  4H3U A;  2OWP A;  5IER A;  3BLZ A;  3G16 A;  1JB4 A;  3F14 A;  3DM8 A;  3K0Z A;  6STD A;  3BB9 A;  2BMQ B;  4Q53 A;  2JQ5 A;  4U13 A;  1NWW A;  4LMI A;  3MYT A;  3FZW A;  1Q40 A;  4R9K A;  4L8O A;  5IEN A;  3FF0 A;  1QMA A;  2HML B;  5EVH A;  1OCV A;  5IG5 A;  5DRE A;  3OXA A;  1W6Y A;  2IMJ A;  5AEW B;  3A76 A;  1O7W B;  4RZM A;  3MSO A;  1GY6 A;  2GBX B;  4WYK A;  1GYB A;  1W02 A;  2GEY A;  2B1X B;  4HVN A;  2UX0 A;  3IPT A;  1OUN A;  2R4I A;  3E99 A;  2A15 A;  2HMN B;  3KKG A;  1O7M B;  1S5A A;  5CK6 A;  3DMC A;  4L8P A;  5D82 A;  4XDW A;  4MJD A;  1ZO2 A;  3JUO A;  4X2H A;  2Z76 A;  3EJV A;  2CHC A;  3EN8 A;  2INX A;  3DXO A;  3MKI A;  3OWY A;  3I0Y A;  1ULI B;  1AR0 A;  3EBT A;  3F8H A;  2STD A;  5AII A;  3GWR A;  3H51 A;  4XB5 A;  3H3H A;  4HM4 B;  1O7P B;  3S5C A;  4WYK B;  4HZ9 B;  1NU3 A;  1DMM A;  2GXF A;  1OGX A;  1E3V A;  4IIA A;  3EX9 A;  3EF8 A;  3JUQ A;  5AIF A;  4HJL B;  2YFL B;  1UUV B;  7STD A;  3B4P A;  2XR8 B;  1HKX A;  1JN5 A;  4K1U A;  3FGY A;  3GZY B;  4KVH A;  5CF2 A;  2RFR A;  1SJW A;  4XM4 A;  1Q42 A;  4J8T A;  1JB5 A;  4N3V A;  5IEP A;  1OH0 A;  4HKV B;  2W2C A;  2QIY A;  4STD A;  2BMR B;  1O7H B;  4HM3 B;  3JUN A;  5CF1 A;  1TP6 A;  1VZZ A;  5STD A;  3CU3 A;  2Z77 A;  5IG0 A;  2F98 A;  3F8X A;  3SED A;  4J9A A;  3MG2 A;  3CPO A;  4HM1 B;  4HZB B;  3G0K A;  3MHE A;  4XBY A;  3D9R A;  5DRV A;  1K41 A;  4K1V A;  3EHC A;  1JN5 B;  1ISK A;  2BMO B;  3B7C A;  2RGQ A;  1CQS A;  5D83 A;  5KP3 A;  1OPY A;  4ORL A;  4L7K A;  1A2K A;  3MG1 A;  3F7S A;  3F7X A;  3KE7 A;  1O7G B;  1OHP A;  5JPU A;  3FKA A;  1DMQ A;  4R9L A;  4LGQ A;  3LZA A;  4HM8 B;  5FW5 A;  2F86 B;  1OGZ A;  3GZX B;  1TUH A;  3FF2 A;  3UJM A;  3JUP A;  3STD A;  4HM7 B;  3HX8 A;  5G2G A;  1E3R A;  3K7C A;  5HGR A;  3CNX A;  1STD A;  1WQL B;  2CKF B;  3KZT A;  4OUQ A;  4GB5 A;  3NXJ A;  1QJG A;  1UUW B;  2Z7A A;  5IG3 A;  5BXQ A;  4HM5 B;  1U5O A;  3OWS A;  2HMM B;  1EG9 B;  1W00 A;  8CHO A;  1OHS A;  3FH1 A;  3EC9 A;  1OF5 A;  3CNM A;  1EA2 A;  3B8L A;  4X2O A;  5IG4 A;  4CDL A;  3F40 A;  3DZL A;  3T8N A;  2YFI B;  3WMD A;  2BNG A;  1GY5 A;  3GRD A;  3JUM A;  3HK4 A;  1O7N B;  3VGN A;  3NUV A;  3UNL A;  3OV4 A;  5AI1 A;  3KSP A;  1JKG A;  3ECF A;  4HM6 B;  3OWU A;  4XBX A;  2I9W A;  5IF6 A;  1ASK A;  4FCJ A;  1IDP A;  2GEX A;  2HMJ B;  1GS3 A;  3GZR A;  3NM2 A;  4R1K A;  1OF5 B;  3GZB A;  2B24 B;  3EBY A;  2HMO B;  5CXO A;  1E97 A;  4PEJ A;  5CLK A;  4I4K A;  2QGU A;  5JPP A;  1DMN A;  2PZV A;  4XBT A;  3SOY A;  3LYG A;  3VSY A;  1W01 A;  1JKG B;  5D81 A;  2XSO B;  3FSD A;  4OVM A;  2K54 A;  2XRX B;  3EQQ B;  3HZP A;  1BUQ A;  4HM0 B; 
#chains in the Genus database with same CATH topology
 3CQZ J;  3TOB A;  2R7S A;  4FE4 A;  2XSH B;  1NB5 I;  3BR3 A;  4LEH A;  2NVT J;  2VKH A;  2R5Y B;  2M45 A;  5GPC A;  4OIP F;  3V98 A;  2LF8 A;  3RPU D;  4KIT B;  5AIH A;  3WG9 A;  5HDG A;  2GLO A;  4OAZ A;  1BRH A;  2I5U A;  4QPQ A;  1T5Y A;  1FYS A;  4II2 A;  3I55 3;  1M1K 4;  4P1W A;  1JHF A;  2R7Q A;  1J2B A;  1BUJ A;  3BTC A;  1N5H A;  3PCR A;  4BH9 A;  3PXM A;  3LL7 A;  2IYJ A;  1YHQ 3;  3CCV 3;  1IXS B;  1ZYR F;  2DA5 A;  5EJC A;  3BU4 A;  3ZOB A;  2HMK B;  2VBX A;  2D1H A;  2XPU A;  3FDY A;  4HW0 A;  2DMU A;  3MFK A;  3CJT B;  1VQN I;  3SZP A;  3QP5 A;  4PSW A;  5GTH C;  3D5I A;  3SXX A;  1WJC A;  3V99 A;  1UMQ A;  3CZ6 A;  1B4A A;  2YSR A;  3HHH A;  4MEY F;  3OYF A;  1I0V A;  1YGW A;  4RAY A;  4Y17 A;  1QNT A;  2E2H J;  4LOC A;  3G4S I;  3T8U A;  2HS5 A;  3VYR B;  3H5A A;  4E7Z A;  1JJ6 C;  3R0J A;  5FKL A;  2K85 A;  2VJJ A;  5AEU B;  1S72 I;  2L1S A;  3NRV A;  2JN6 A;  1XSD A;  2DA2 A;  1B2M A;  5DCF A;  5ICC A;  3OSF A;  1DQU A;  3JVC A;  4A3J J;  3MZY A;  4NB5 A;  3CCL 3;  2JQ7 A;  4RA2 A;  1RN4 A;  1P4X A;  2M9H A;  2OD5 A;  2UUZ A;  1RLS A;  4UVA A;  1JHH A;  3PFY A;  3CCU 3;  3ROB A;  3F21 A;  3DTE A;  3DTK A;  4M6X A;  1HC8 A;  4NC7 A;  2OOV C;  1DP3 A;  4XLN F;  4PJJ A;  3WHC A;  4DGW B;  1ZX2 A;  2PMH A;  2LK2 A;  3IH3 A;  3M4O J;  3Q5F A;  3BNB A;  5BVB A;  2P6S A;  3WOD G;  2HQA A;  1I8V A;  1FC3 A;  2CFL A;  4EJO A;  4BNC A;  3F8M A;  4WWU C;  4ZYE A;  4BEH A;  2F5E A;  1XGN A;  3FBN B;  2HOA A;  5M3M J;  2L4A A;  3RPU A;  5D5V B;  4Q4Z F;  2R7R A;  4BDY A;  3OYG A;  3ELK A;  1YE9 A;  2JMW A;  3G16 A;  3UB1 A;  5FJ8 J;  3SQN A;  4N6M A;  6STD A;  2MC4 A;  4CGZ A;  4OIN F;  1AHD P;  4KT3 B;  5DS9 A;  2B63 J;  3BB9 A;  3L2V A;  2BMQ B;  2OQG A;  1FOW A;  2E7W A;  2TDX A;  3ZQH A;  4BJT A;  2HOT A;  4IL6 C;  5LGU A;  3FBI B;  2ZO4 A;  1NJI 4;  1K83 J;  4LMI A;  1GV5 A;  4EXR A;  4RAF A;  3MYT A;  1PDN C;  2W57 A;  2X1E A;  3GWZ A;  2R7V A;  2C4B A;  2UXN A;  3NBB A;  4R9K A;  2K40 A;  4UVC A;  1I1G A;  2HYF A;  3FWE A;  2DAO A;  2EFP A;  2QKM B;  3F72 A;  5IT9 Z;  4PFP A;  1RKY A;  3KYL A;  1QMA A;  4A93 J;  2PQ8 A;  2F2E A;  3G71 I;  4N6N B;  5IT9 K;  1VI0 A;  2HWV A;  2XAQ A;  3HKZ N;  4U7D A;  5FB2 A;  1RSN A;  2JPB A;  5KNL A;  5EEG A;  4N9I A;  4RB2 C;  3UL5 A;  4ESF A;  2F5F A;  3KN4 A;  5DRE A;  5D6F A;  3C2G A;  2VPR A;  2X9D A;  3Q3S A;  2IUK A;  2L4V A;  1VQ5 3;  1JKQ C;  4LG3 A;  1T33 A;  2Q0O A;  2XGD A;  1YJW I;  2CX0 A;  1FUS A;  3A01 A;  4HBR A;  1RKT A;  2MBF A;  1Z3X A;  2VN2 A;  3ZRG A;  1SVL A;  1WI3 A;  2OCE A;  1W02 A;  1XS9 A;  4K90 B;  2PI0 A;  2H0I A;  3DGY A;  2W85 A;  4AIK A;  3I71 A;  3ZMT A;  2GEY A;  3QU3 A;  5LRR A;  1FBS A;  1Q7Y 4;  1AKH B;  1IRX A;  4BBR J;  3O3K A;  4IZZ A;  2P5V A;  3LSH A;  1Z6T A;  2JRM A;  2VJ4 A;  4KMU X;  1QBJ A;  4HF0 A;  2GIV A;  4I2O A;  3BR0 A;  2AQF A;  1B2S A;  1R1V A;  1WQ2 A;  2NS8 A;  3IAM 2;  3GVA A;  3BTL A;  1D6Y A;  2WV0 A;  3FXQ A;  2Y0M A;  5FRO A;  3K7A J;  4A3K J;  2HZD A;  5HDN A;  3PIO F;  4JOM A;  3E99 A;  3HPH A;  3KYC B;  3LSP A;  2HMN B;  3GTQ J;  1KQS 2;  3QYE A;  3KKG A;  4L8P A;  5D82 A;  4WFO A;  4HBL A;  3J81 Z;  4GSP A;  1RN1 A;  1MBF A;  2R41 A;  3KIO A;  3CLQ A;  5DDG A;  3OYH A;  3K4L A;  2BGC A;  1ZG1 A;  2LBF A;  1JKO C;  2BOL A;  1MNL A;  4ZM8 A;  2YUS A;  3BQZ A;  3OYI A;  5LEK A;  2Q8K A;  1K6Y A;  4HDU A;  2Y9Z A;  2W04 A;  3E6B A;  2HGC A;  5DUK A;  5FO5 A;  3I0Y A;  3D5R C;  3AG4 H;  5HVQ C;  5E20 A;  3L9F A;  1N75 A;  4LIT A;  5AII A;  4KT6 A;  1CYU A;  5B1A H;  3H3H A;  2YX4 A;  2VT2 A;  3DF8 A;  4IQJ A;  1YRN B;  4E7L A;  3LSI A;  1QZZ A;  4ENK A;  4R8H A;  4EEF G;  2M8E A;  3J80 Z;  1Y1V J;  2VKE A;  2X85 A;  2ID6 A;  5F27 A;  2ZHX B;  3ZQI A;  2CWV A;  2GXF A;  3P5J A;  4R1H A;  3RZD J;  2FU4 A;  3ASN H;  1UCJ A;  4ZDP A;  3AG3 H;  3I9V 2;  4BGD A;  1VQL 3;  3KZZ A;  1TQM A;  1HDD C;  1UB9 A;  1S6L A;  2KF6 A;  4N4O B;  1MKM A;  1JTX A;  5KAI C;  3BG6 A;  2A05 A;  4BY7 J;  2CW7 A;  3X42 A;  3K10 A;  1OCP A;  3QOE A;  2PEX A;  3JRG A;  1BN5 A;  2ESN A;  2ME0 A;  2UXX A;  3FGY A;  3GZY B;  3G6E 3;  3Q0V A;  1G96 A;  2E5Z A;  3K4N A;  4P9F A;  3CTA A;  3IH2 A;  1HW1 A;  5HOD A;  3KSE D;  2BY0 A;  4MGR A;  2HU9 A;  2DDB A;  2ZJP F;  4OMY A;  2XPV A;  3OYN A;  2STW A;  2X6O A;  4ILF A;  1X1U A;  3BRO A;  2OTJ 3;  5IW9 A;  3WTZ A;  1RNT A;  1FW7 A;  1UST A;  5HLG A;  2HOS A;  2K9Q A;  4G6Q A;  3TED A;  2JSP A;  3ZQQ A;  5H6R A;  1V5E A;  1T0F A;  1N9J A;  4F3Q A;  3OYK A;  3NAU A;  4EMS A;  1KYZ A;  1EV7 A;  3HOX J;  1D1C A;  2BHZ A;  3OYL A;  2XHK A;  1T08 B;  3ERE D;  4NBQ A;  3H3V K;  2A69 F;  2XRL A;  1ACI A;  1VQ4 3;  2DMQ A;  2XSJ C;  4BL3 A;  1BI1 A;  1WWX A;  1QA6 A;  3A2K A;  1IV6 A;  1VZZ A;  1WHU A;  3OR2 C;  1B8I A;  3CJQ B;  3DP7 A;  3I58 A;  5K7Z A;  1BRJ A;  4UNO A;  2HR3 A;  2EZI A;  1LDK B;  1SIH A;  1SII A;  3F8X A;  3SED A;  4G7O F;  2X1D A;  4XLF A;  3JRD A;  4OU0 A;  1RN7 A;  2WB1 A;  4XSZ F;  4HOH A;  1HXD A;  3CCJ I;  1FYK A;  1U8C B;  1V58 A;  3G0K A;  4LMY A;  4DYQ A;  3LTC A;  3D9R A;  5DRV A;  1OCC H;  3CMM A;  1AQZ A;  3MZH A;  1RKW A;  2W48 A;  1RGA A;  2XF3 A;  1YX5 A;  3HL2 A;  2MG4 A;  4CO8 A;  1ISK A;  2E2V A;  1V55 H;  4B3A A;  5GAE J;  3OL4 A;  3HI7 A;  2DFI A;  2QYO A;  1B2U A;  2WAF A;  4CCM A;  3HC7 A;  1DUX C;  5HLT A;  3HOV J;  1OYI A;  1ON1 A;  4E7J A;  1REP C;  1WGX A;  5HS9 A;  3H5N A;  3HXL A;  4L7K A;  4M9S A;  1A2K A;  1K73 4;  3C2B A;  1RUO A;  3DPT A;  3FG4 A;  1WMP A;  5FFX A;  3GEZ A;  3FKA A;  2H6C A;  1MJB A;  4B48 A;  5D5W B;  3CCQ I;  5JBS A;  3CUO A;  3ZMV A;  2YU3 A;  3IKV A;  1EEJ A;  1J0R A;  2XFT A;  3K1N A;  1XGS A;  2VQC A;  3WOF B;  2CH0 A;  2HYG D;  3NX0 A;  2HMM B;  4W97 A;  3ZQF A;  5EEA A;  1SFO J;  2JK3 A;  3BY6 A;  4HM8 B;  1Q7H A;  2EA2 A;  2M2E A;  2NVX J;  4W1U A;  2JWT A;  3IWF A;  2E34 A;  1ITY A;  1B2X A;  2E71 A;  3M7G A;  1OLT A;  3EDP A;  1W5S A;  2NRA C;  4WXH A;  4B1R A;  4EC6 A;  2Z33 A;  3N97 A;  1VFC A;  1IRG A;  4CZC A;  3LOY A;  1ZLK A;  1TNS A;  2QQB A;  1GMR A;  4HV5 A;  1RTU A;  3VOD A;  2DYR H;  3N54 B;  1B2Z A;  2R7Z J;  2M4G A;  1RGG A;  1BOA A;  2JUG A;  4JX4 A;  3WTU C;  3FX3 A;  2HVS A;  4BHP A;  1FEX A;  6RNT A;  1R00 A;  2LRD A;  1O3T A;  5F6F A;  5JVG F;  1APL C;  2FNP A;  3K5T A;  4IT7 A;  3BDD A;  2KPM A;  4GCV A;  3N4M A;  1WH5 A;  2GIZ A;  2NXN B;  4YEJ A;  1WQL B;  3CME 3;  2IXS A;  3CF5 F;  1KWI A;  3KZT A;  3ESW B;  3UL6 A;  5FGM A;  3DBL B;  3P9K A;  1SFK A;  3RTR A;  1L0O C;  2Y30 A;  2F4O B;  3LAP A;  3Q0W A;  4S0H B;  4E7H A;  2LRE A;  2ZXI A;  3EE1 A;  3NXJ A;  1QJG A;  2EJR A;  1G0T A;  1UUW B;  3TDG A;  1WVR A;  2YX9 A;  5KVR A;  1KU3 A;  4ZDL A;  2NVQ J;  1E3H A;  4RS8 A;  1ZH5 A;  5IG3 A;  1XDS A;  3HUG A;  1VQ8 3;  3CUQ B;  1U5O A;  4MQ9 F;  1R49 A;  3CDL A;  2FBI A;  4XON A;  5B1B H;  1J09 A;  1LUJ B;  3PO2 J;  1EG9 B;  2VXZ A;  1W00 A;  2XAS A;  5D5X B;  8CHO A;  5D4S A;  2KRT A;  4HNV A;  2RC4 A;  5JVT A;  1HLV A;  1OF5 A;  2V9K A;  2X6X A;  3QYB A;  4PZJ A;  4DYR A;  1Z67 A;  3BZC A;  1QZE A;  2FEZ A;  4XKC A;  1SFX A;  1FMV A;  5E3O A;  3OSG A;  3PJR A;  3AL0 B;  3OOU A;  1GDT A;  2VQG A;  3GTG J;  2DA1 A;  3OOP A;  2ZXW H;  3S2D J;  3PL8 A;  3GRD A;  1IJW C;  3AG2 H;  1T39 A;  3GFJ A;  1EF4 A;  3HG9 A;  3LA2 A;  1U5T A;  1SMT A;  1IV8 A;  3CC2 I;  1MSE C;  3KET A;  5L3F A;  2M87 A;  1QPI A;  1ETQ A;  2IA7 A;  3H92 A;  2HXI A;  3CLO A;  2IJL A;  3KZI C;  2IS6 A;  4NHF A;  2WAQ N;  1QVG 2;  1JUP A;  1ZGJ A;  3OS2 A;  2X0L A;  1KC8 4;  1BIR A;  1UCL A;  3L7W A;  3UNL A;  5M19 A;  1YW7 A;  4F55 A;  4M9Z A;  3C1D A;  4HLX A;  5EYR A;  3TW6 A;  1BA5 A;  1X3Z B;  1PU4 A;  4HM6 B;  4AVP A;  3K4K A;  3HZJ A;  2D1W A;  4XBX A;  3J7Y d;  4MTE A;  4WK8 F;  4M9X A;  1GMP A;  1O7F A;  4UUS A;  2I9W A;  2DMN A;  3WA2 X;  5IF6 A;  3B02 A;  3FCS B;  1UG2 A;  4BQN A;  1ZN2 A;  2P0X A;  1YQA A;  4CXF A;  3ZQL A;  1A90 A;  1FT9 A;  1MWS A;  1AOY A;  2YX7 A;  3QOP A;  3HIF A;  2HDD A;  2GEX A;  2Q2E A;  4S05 A;  3FG1 A;  1WCM J;  4RGR A;  2V9P A;  3CCM I;  2P5L C;  5LD2 C;  5D8L B;  2L9V A;  5LGT A;  1W36 C;  2V1D A;  3JTG A;  5A0O B;  2K5C A;  3DH2 A;  2F5V A;  3UKG A;  3W3C A;  2KIU A;  2W82 A;  2BZT A;  4C2U A;  3KP2 A;  4R1K A;  2DLL A;  5HLH A;  1WSU A;  2R5Y A;  3O6B B;  5K7H A;  3ZCO A;  3ZMD A;  1N8R 4;  5FD5 A;  3U2R A;  4CCK A;  3F0C A;  3ZMZ A;  5AIQ A;  4A3C J;  2L4M A;  1UW1 A;  2OQE A;  2ME6 A;  1RUN A;  1LDD A;  4BE1 A;  5M3F J;  1T98 A;  3FMQ A;  3DGO A;  4IEJ A;  4L9N A;  2QGU A;  2KCD A;  4DJA A;  4L9J A;  1BRN L;  5JPP A;  3BZK A;  1HBX G;  1DMN A;  3E97 A;  4DBQ A;  2Y74 A;  4A12 A;  2ACJ A;  1YFH A;  3IRR A;  2RBI A;  1XGO A;  1HOM A;  3OMY A;  4XLA A;  1FP2 A;  3DTI A;  4XBT A;  2CUF A;  2ISY A;  3LYG A;  2YPR A;  1Q1V A;  3K2A A;  1SFE A;  1X2M A;  3JAM Z;  1ZEL A;  3KEY A;  4DYC A;  3ZG0 A;  4HX7 A;  3X3X A;  5LHG A;  3F22 A;  1JKG B;  3CP2 A;  1Z91 A;  3ERM A;  1CYV A;  3NAR A;  4E70 A;  4YFK F;  3E7L A;  1LVA A;  1IVX A;  4JX5 A;  1YI2 I;  2P0W A;  3VYS B;  1HDP A;  2MGQ A;  2IBD A;  5E8G A;  3FSD A;  3H5R A;  1AWC A;  3HGY A;  1JXS A;  5EF6 A;  1R5H A;  1UCR A;  1OPC A;  2XDV A;  4F52 A;  4QLC U;  3EQQ B;  5E18 F;  1F9N A;  1US1 A;  1WJB A;  1ZRF A;  4HAA A;  1BUQ A;  4HNU A;  4P9U A;  5LC7 A;  5BMZ A;  1ORK A;  2P05 A;  2MD0 A;  3S2H J;  4MEI A;  1ZR2 A;  1P92 A;  3BIR A;  3FK6 A;  4G12 A;  2GZW A;  4AKY A;  1S7O A;  2H1K A;  1Q40 B;  4UXN A;  2CQ7 A;  2W0Q A;  2NYX A;  1LE8 B;  4Y13 A;  5FRM A;  2K4B A;  3RDI A;  1K9M 4;  5J6X A;  4BQA A;  3V7R A;  5H20 A;  1LXE A;  5AIG A;  4I76 A;  2FQ3 A;  3R60 A;  4I99 C;  4JBA A;  2QEX I;  1X1D A;  1ULJ B;  3NBR A;  1FGR A;  1N5P A;  1SD4 A;  1NTC A;  4E4H A;  2VOP A;  1Z1S A;  2DPD A;  1XMK A;  5TGN A;  3PNY A;  3L09 A;  1IRZ A;  4G94 A;  4XLE A;  4WXD A;  1BI3 A;  1E0E A;  2LKS A;  4ZDO A;  2HTS A;  4PGH A;  2RCD A;  2CIU A;  4O02 B;  3RGR A;  2EWN A;  2G7U A;  1ZHF A;  3BT9 A;  4C3H J;  4LG0 B;  3KLO A;  1GSP A;  4NPB A;  2GBW B;  2WV1 A;  1LVK A;  1QO0 D;  5JI6 A;  1GXP A;  2KDO A;  1BNF A;  5IPA A;  3QPS A;  3MN2 A;  4LK0 F;  1PFP A;  3ABT A;  5GTI C;  1OHO A;  3FK7 A;  2BXZ A;  3ZGK A;  4IHV A;  4CDG A;  4HEA 2;  1T0F C;  4M73 A;  3Q90 A;  4NNJ A;  1RDS A;  2PJR B;  1UEL B;  2EFO A;  2O3F A;  3GX4 X;  4BHC A;  5GSP A;  2P7C B;  3U1D A;  3M8C A;  4UV9 A;  1W6C A;  1U2W A;  5B3S H;  1JT6 A;  3V7C A;  3G3Z A;  4IPA A;  3REO A;  3H3U A;  2DMP A;  3S8P A;  5BU4 A;  1IVU A;  5IOZ A;  1Z6R A;  4JX6 A;  4RMN A;  1TRQ A;  2DO7 A;  4HM2 B;  4QSH A;  3TL4 X;  4A3E J;  2CFW A;  4JYK A;  4ZJZ A;  1LDJ A;  4N4N B;  5IT3 A;  2FML A;  4RBN A;  2OTL 3;  5F1R A;  1UHS A;  1RGH A;  4JRF A;  1GY7 A;  4EV0 A;  3R0A A;  3DEU A;  4HZF A;  5D5U B;  3E6M A;  1B59 A;  2LKP A;  5EQL A;  3HTS B;  4N6V 0;  1NDO B;  1HW5 A;  1ZRE A;  4A69 C;  2QF7 A;  1FBQ A;  4D5F A;  4EJU A;  3BLZ A;  3S67 A;  5EZG A;  1AKH A;  3K0Z A;  1YS6 A;  3GO5 A;  5E1Z B;  3AGN A;  3IUO A;  4FE7 A;  1VQK I;  2MLK A;  2A6E F;  3H35 A;  1V74 A;  4EV5 A;  2E1C A;  3BG9 A;  4EYC A;  1R6R A;  2L0K A;  1A67 A;  1VQ7 I;  2HI3 A;  2OUM A;  2JQ5 A;  1VQ9 3;  4G6T B;  1NK3 P;  1VQO I;  2EIM H;  1RET A;  1TP4 A;  2BYV E;  2DDA A;  4G7H F;  1BW6 A;  3LOC A;  4YFX F;  1JBT A;  2DK5 A;  1YJ9 3;  1O4X A;  2V1U A;  3WDG B;  2Y9Y A;  3RPQ A;  4BL2 A;  4ZYA A;  2HML B;  1QVU A;  1RCK A;  4A3I J;  1N8Q A;  4O2H A;  6GSP A;  1OYY A;  1YW8 A;  4CCO A;  2CH9 A;  1DPR A;  2M30 A;  2XB5 A;  3LH4 A;  3RQI A;  3OXA A;  1FP1 D;  3W2A A;  2FA5 A;  2QEN A;  1ZGW A;  2ETH A;  1TZL A;  2W7N A;  4CJN A;  2PMZ A;  2Z16 A;  1FOX A;  1R58 A;  1W7P B;  2XAG A;  1TWG J;  5FRN A;  4I7H A;  3MSO A;  4A3B J;  3V4G A;  2LLK A;  1P4A A;  1E2X A;  1CGP A;  5ERI A;  2R5Z A;  4Q47 A;  1T6S A;  3IHU A;  4CUG A;  1I2E A;  4BE0 A;  4CZZ A;  2A61 A;  3JTH A;  3SDG A;  4E7I A;  3WU2 C;  4HST A;  1UAA A;  1LOV A;  2B1X B;  1GT0 C;  3R4K A;  2UX0 A;  3DLA A;  1W0T A;  3IPT A;  2JPC A;  2VKV A;  1JUM A;  3E0J B;  5TRD A;  4QWT A;  1U78 A;  1OUN A;  2XB0 X;  2BU4 A;  2BXY A;  3FXM A;  5CQG A;  3LWF A;  4NDL A;  5J1Y A;  4N6T A;  1IQ8 A;  2IGK A;  2R4I A;  2W24 A;  4QTR A;  1Z7L A;  4CH7 A;  5LGN A;  1A35 A;  2W6J H;  4JF8 A;  2FSW A;  2VJ5 A;  1O7M B;  1S5A A;  3DMC A;  1ETW A;  3K1M A;  4DQ2 A;  2D2W A;  2IEK A;  1IT7 A;  4GHO A;  1VQM 3;  4XRM A;  1IT8 A;  1ZO2 A;  3JUO A;  1ULY A;  2F4Y A;  3ABU A;  1P9Q C;  3K0L A;  3IKT A;  1K78 B;  3VOE A;  1WPK A;  3NBJ A;  4IKF A;  2IY2 A;  2R7D A;  3UR3 C;  2P38 A;  1TIJ A;  1ZGX A;  3EN8 A;  2INX A;  3GFI A;  1A2V A;  2R7O A;  2CQN A;  4MEX F;  3GBG A;  4ZZD A;  2R7F A;  2EFW A;  3LFU A;  3T0Y A;  1YIJ 3;  3MKL A;  5FLV A;  1ROV A;  4M6Y A;  3BNC A;  3IH4 A;  1A2P A;  1IV9 A;  5CPR B;  4KFD A;  2CWT A;  1M1X B;  1Q82 4;  3M3Y J;  3I4M J;  1OJL A;  3WTT C;  3GWR A;  3WE2 A;  4KIC A;  2IS2 A;  2LG4 A;  1O7P B;  3LAJ A;  1SEU A;  1R4Y A;  3NWT A;  1Q81 4;  1ODD A;  1GHC A;  2L01 A;  5TJJ A;  3K4B A;  4KN4 X;  1F4K A;  4MLO A;  1BBY A;  3T5X A;  3VB2 A;  3C3W A;  4EJW A;  3FZV A;  4DZP A;  5FKN A;  3WU1 B;  1OGX A;  1TQP A;  4KFE A;  4IIA A;  2QM3 A;  5J40 A;  2VC1 A;  4I6Z A;  1W4M A;  1BSB A;  4XRS A;  2XIG A;  3V8K A;  2M5W A;  5M5W J;  4LSO A;  3DWL E;  1QVT A;  2MAB A;  1MMS A;  4L5J A;  3S2W A;  3F6O A;  3PS8 A;  2QSH X;  5C44 J;  2XR8 B;  4K1U A;  1X19 A;  5K7F A;  1W36 D;  5CF2 A;  2A6T A;  3IRQ A;  2Y0S N;  2FOW A;  2KF4 A;  2RFR A;  2RKH A;  1SJW A;  2FXT A;  2FOK A;  2BVL A;  4XM4 A;  1TRP A;  1RZ4 A;  1JJ2 2;  1QAL A;  1JB5 A;  3I59 A;  4N3V A;  5IEP A;  4UUT A;  4OK0 A;  1VQN 3;  4R79 A;  1FSE A;  4U7B A;  4HDV A;  4XOR A;  5GAG J;  3L1P A;  4O3M A;  1ETK A;  4IJA A;  1W2B 2;  5J47 A;  2O0Y A;  2KKO A;  2OQE C;  1UHW A;  1V3F A;  1S7E A;  3QYF A;  4M74 A;  4KMF A;  3O8G A;  1MH4 A;  4LFU A;  3TO7 A;  2QIY A;  3G4S 3;  3ML6 A;  4AYB N;  2E1M B;  4BTX A;  4GO1 A;  3FKJ A;  2P8T A;  2CFD A;  1IO2 A;  1S72 3;  4EQQ A;  1V57 A;  3S29 A;  4HM3 B;  4KIS A;  3GTJ J;  1G8X A;  3L2U A;  4RM2 A;  2KIQ A;  1F36 A;  1TWC J;  2XF5 A;  4FMC A;  3HSF A;  1BGS A;  2DBB A;  3E6D A;  4J19 A;  5LBQ A;  2CG1 A;  4IPB A;  3OL3 A;  1R4M B;  2UV1 A;  5STD A;  3K1P A;  1SD5 A;  1STZ A;  3RKY A;  4YRV A;  1IK3 A;  2L7Z A;  4GYI A;  3EYI A;  1XX5 A;  1DP7 P;  4A3L J;  5IG0 A;  4UB6 C;  1BJZ A;  5L3D A;  2W56 B;  3HOH A;  1DGW Y;  1DDN A;  2KF3 A;  2JA2 A;  3CPO A;  4HM1 B;  3SYU A;  1ETY A;  1ZTR A;  2E36 A;  4UHT A;  5EEH A;  1H8A C;  2VUM J;  2H94 A;  1I2G A;  2R7W A;  1X1P A;  3MHE A;  4XBY A;  3SVA A;  1XGM A;  1HST A;  2KQR A;  3IC7 A;  3RCO A;  1J9I A;  4RGX A;  1CF7 B;  1MND A;  2QBY B;  4PJM A;  2MH9 A;  3M8J A;  1P2F A;  1P7J A;  3JR9 A;  1G02 A;  3EHC A;  2F48 A;  3G1O A;  1Z7U A;  3FMR A;  1Q1H A;  3B73 A;  2A3S A;  2KHM A;  2TCT A;  2PNC A;  2IA2 A;  2CV0 A;  3H36 A;  1N25 A;  4DNC A;  3HDD A;  2DXI A;  1NB3 I;  3TQN A;  1I3F A;  1W2Z A;  2ZSH B;  1G3S A;  1CQS A;  5KP3 A;  2WO0 A;  2HPM A;  2CMP A;  4LYL B;  4L0Y B;  3OR1 C;  2KZG A;  1LQM B;  5A2Q K;  2JZY A;  2XV4 S;  3GLX A;  1Z21 A;  3MG1 A;  1XTA A;  4UV8 A;  3F7X A;  1O7G B;  1W7C A;  5LFA A;  3CUQ A;  3I4N J;  2ICW G;  4C9Y A;  2GBY A;  3CMA I;  5IP9 J;  3ABK H;  1OAC A;  3Q2P A;  2L54 A;  1LOX A;  9RNT A;  1OQY A;  4LGQ A;  1QZY A;  2XAF A;  4BQO A;  4C2M J;  1SAR A;  3JW4 A;  2GA2 A;  1OIS A;  4K2E A;  1X1X A;  2XF6 A;  3GTO J;  2RNJ A;  4Y7N J;  3G71 3;  2KIF A;  5B5E C;  4XLP F;  1OGZ A;  2F86 B;  1I3A A;  1XSX A;  3HOY J;  1FSH A;  3HPG A;  1SD7 A;  2VE8 A;  3GCM A;  1IVW A;  3FF2 A;  2E60 A;  1BM9 A;  1XPX A;  2M7O A;  4U0V A;  3ZQG A;  1LFP A;  4LGW A;  2ML5 A;  1MZB A;  3HSE A;  3STD A;  4UVB A;  2XGN A;  3HX8 A;  1YJW 3;  1JT0 A;  3DXJ F;  1QGP A;  4PK4 A;  3JRC A;  3M1C A;  2R93 J;  2JUC A;  4M71 A;  5EGO A;  2FRH A;  1NG6 A;  2ZFU A;  3K7C A;  1MMN A;  2QSF X;  5ILU A;  1GVD A;  2M7B A;  4RNZ A;  1R1T A;  2KLO A;  1AU7 A;  4MNU A;  1M1E B;  1FGT A;  4NRE A;  2D1V A;  3HOU J;  3BTJ A;  2MD5 A;  3SEQ A;  4DKI A;  2FXA A;  2LP0 A;  2CKF B;  4MMX B;  2OJE D;  5CQE A;  3TO6 A;  5C4J J;  2R0Q C;  1DVC A;  2HDW A;  1IV7 A;  3JSP A;  1PUE E;  1I3I A;  4UY8 I;  1K28 A;  1LKX A;  4AU7 A;  1D1B A;  1FMW A;  1RRL A;  4WHA A;  2A68 F;  2Z7A A;  4WWC A;  4U0W A;  2VE9 A;  2G7H A;  2K9N A;  2EBI A;  3HIG A;  2LDU A;  2DT6 A;  4GYG A;  3X2Q H;  3VYU B;  3OYJ A;  4F92 B;  2CRG A;  1R23 A;  3A03 A;  3LMM A;  3H9J A;  3PO3 J;  4Y52 J;  3FH1 A;  2B7E A;  3L2R A;  4IRG A;  2F5M A;  4Q48 A;  1V5G A;  3R6S A;  1GV2 A;  1SD6 A;  2GWR A;  4I0B A;  1B72 A;  2VON A;  4HF1 A;  1XMX A;  3CNM A;  2OV7 A;  4XIC A;  3B8L A;  4X2O A;  5IG4 A;  2QA4 I;  2VBY A;  4RAZ A;  2AO9 A;  3F40 A;  1MOL A;  3OIP A;  1BC8 C;  3CC4 I;  2O03 A;  1ZQ3 P;  1STF I;  4BJ6 C;  2BNG A;  5LLQ A;  1GY5 A;  1HU9 A;  2CU7 A;  5BS6 A;  3AFH A;  3K70 D;  3DLL F;  2M8G X;  1YVB I;  2GXA A;  4BL0 B;  1GD3 A;  3HK4 A;  1LNW A;  1TT5 B;  5DD8 A;  1QU3 A;  2JA5 J;  1KQ8 A;  3E1S A;  1AVK A;  2KAA A;  2AAD A;  2W4S A;  3CCE I;  3GFM A;  4FIS A;  4WXC A;  1H88 C;  1G3T A;  1O3Q A;  1IN4 A;  1EJ9 A;  3D0S A;  3ONQ A;  1HKS A;  1SVO A;  3DBR B;  3HRU A;  3JSO A;  3L0R A;  4MMY B;  2LTP A;  2VL8 A;  5AI1 A;  3HBL A;  4WF2 A;  4ENN A;  4GGG A;  3T1B A;  3KSP A;  2HZT A;  1JKG A;  3SFI A;  5K5R A;  5M1A A;  1PVE A;  2L7M P;  1SFU A;  1VQ6 I;  4XSX F;  3EUK L;  1BI0 A;  3DFG A;  1SQW A;  5C4X J;  1QPM A;  2BY2 A;  1KU2 A;  4BE2 A;  3E5X A;  2OZU A;  4OIO F;  1ZG5 A;  1YTY A;  5F0F A;  2FD5 A;  2XAU A;  3BPV A;  3PYJ A;  2XH9 A;  1CQT A;  3X3Z A;  1W0U A;  1KD1 4;  4N9H A;  1WRJ A;  2PJP A;  1I2F A;  4XRS G;  2L2O A;  2X1C A;  4M3D A;  5CVJ A;  3IMA B;  2OA4 A;  4WCG A;  2LQV A;  3M8F A;  2QSG X;  2Z2S B;  2GU1 A;  1WJE A;  3DQV C;  2B24 B;  3MEX A;  2CX1 A;  3OIO A;  4CYC B;  2CV1 A;  4BAY A;  1TNT A;  1ZRC A;  5CYV A;  2HMO B;  3MCZ A;  1ZAO A;  4ETS A;  1LE8 A;  3GAX A;  3VWB A;  1RPW A;  4FAS D;  2WGQ A;  1XD7 A;  5E3M A;  2OU2 A;  4KIF A;  2W84 A;  3HTU A;  1VZ0 A;  5EG0 B;  4MFE A;  1I6X A;  2E2U A;  4JQF A;  5EEO A;  1ZAR A;  1IN7 A;  2CJJ A;  4BBS J;  1Y0N A;  4D0P A;  2NVU B;  5GAH J;  1YIT I;  2XKO A;  1TFK A;  2R3S A;  3QAH A;  3TBI A;  2IRF G;  1RGC A;  3CC7 I;  1XCB A;  2KMU A;  2LR8 A;  1FWZ A;  4LG0 A;  3QK9 A;  1H9T A;  1P7I A;  1QRY A;  2H27 A;  2UGI A;  5BOX A;  5D81 A;  5RNT A;  2ZME B;  1XDU A;  4EW5 A;  2ADU A;  4WX9 A;  3DKX A;  3CCJ 3;  1LQ1 A;  5IP6 A;  4M72 A;  1MMD A;  3O8Y A;  4RBO A;  5CKT A;  4HX8 A;  2PJR A;  2GA1 A;  4ABZ A;  3Q9V A;  4V2G A;  4G7Z F;  1HSJ A;  2NNY A;  1G3W A;  4L5I A;  3DY5 A;  2YU9 J;  4L9T A;  4H4K C;  1JZO A;  1BOX A;  1FGO A;  4YIR X;  4HM0 B;  2BEO A;  4Y33 A;  5L3E A;  3OX9 A;  1VQP I;  2DTR A;  1X4P A;  1YJN I;  3Q0U A;  2JDI H;  2COB A;  5ICE A;  2STT A;  3S3M A;  2RNG A;  1S3J A;  3F6V A;  4AIJ A;  3CD6 I;  3G1L A;  2XPW A;  4OWR B;  1GOY A;  3BNE A;  2N8G A;  4AEQ A;  3CCQ 3;  4G9Y A;  5HOO A;  3OIQ A;  1B6A A;  2M3A A;  1WJD A;  1MW7 A;  3P9C A;  5ICF A;  4ASN A;  1KSI A;  2RVC A;  2AS5 F;  5L3B A;  5KP4 A;  2FF4 A;  4UB8 C;  2DOF A;  1DYU A;  3M9A A;  3J7Y J;  1JB2 A;  1F8N A;  1VQQ A;  4Y3O A;  5CLS A;  2BBY A;  5FFZ A;  1ONV A;  1EA3 A;  1PUF B;  1Y8R B;  2P09 A;  1BC7 C;  3OWT A;  2BT3 A;  1A6I A;  4DBR A;  1U9O A;  3S15 J;  1GLN A;  4ANJ A;  1RGF A;  1RNB A;  3F8N A;  1MBE A;  4FET A;  1R36 A;  2JJ7 A;  2DW4 A;  4J01 A;  3D1N I;  4HQE A;  4YG2 F;  2BY3 A;  3D4A A;  1IXC A;  2ZDJ A;  2K02 A;  2QUF A;  4BKX A;  2H0G A;  3AMO B;  1U8B A;  3FXL A;  1IF1 A;  1BL0 A;  4FX0 A;  4B47 A;  1T2H A;  2K3F A;  3HRS A;  1SAN A;  1UI8 A;  3AG1 H;  2WY7 Q;  4BDZ A;  1JNQ A;  3FLJ A;  1Y56 A;  1R4C A;  1WJ5 A;  1XMA A;  2ZNY A;  2L9R A;  3G1M A;  3IJE B;  1S8N A;  3HJE A;  2X51 A;  2WA0 A;  1KON A;  2JVH A;  4D1Q A;  1C7H A;  4FCM A;  1G3Y A;  4KT5 C;  4G1M B;  1JE8 A;  4PUS A;  1X1A A;  5F1J A;  4O5V A;  1W6G A;  3SEZ A;  5J8F A;  2XSD C;  3RGA A;  5D8K B;  3F9S A;  3H9G A;  2Z9O A;  1JBS A;  2H6B A;  1Z9C A;  1CEW I;  3TO9 A;  4RLQ A;  1JV2 B;  3NV0 B;  4LJZ F;  2ZNZ A;  5K5Q A;  3LTA A;  4XRF A;  3PNT A;  3DUK A;  2Y75 A;  3CCR I;  2H0H A;  2Z6B A;  1TLH B;  2NVY J;  4LLG F;  1J7K A;  3JRB A;  1DE3 A;  2OWP A;  4H61 A;  5IER A;  1RR7 A;  1X3U A;  3BLY A;  4XR6 A;  1ERD A;  3MMY B;  1UGI A;  1MIJ A;  5M5Y J;  4EGZ A;  2MC3 A;  4U88 A;  3IL2 A;  4AKZ A;  4C3I J;  1JB4 A;  4IX7 A;  3BP8 A;  1W5Z A;  3F14 A;  3QQA A;  3GW2 A;  1D0Y A;  2P81 A;  1IVV A;  5E3L A;  2VI6 A;  3BOQ A;  1LNI A;  2XAJ A;  1Y6I A;  1E3O C;  2O8K A;  2XC7 A;  2NAZ A;  2VPL A;  1MMA A;  2ZC2 A;  5AON A;  3K4M A;  3R61 A;  3WG7 H;  1AA7 A;  1MBK A;  4ZH4 F;  4AM3 A;  4Q53 A;  1R22 A;  1NWW A;  3CES A;  3FIS A;  3AHW A;  3QRF F;  4ITV A;  2ESH A;  2UZK A;  3CUQ C;  2G0E A;  4M3B A;  3CC2 3;  3OYD A;  2LH9 A;  4U0Y A;  1X1W A;  5J1R A;  4A0X A;  1YNV X;  6PAX A;  3RSN A;  2LSO A;  2DT7 B;  3FXJ A;  3PUF A;  3CCS I;  3I3L A;  1KA8 A;  2KIM A;  5IP7 J;  3J7Z I;  5IEN A;  1FOK A;  1FA3 A;  2ELH A;  3KP6 A;  1LOW A;  4KFC A;  3FF0 A;  1D3Y A;  4EM2 A;  4A6D A;  2ZJ2 A;  7RNT A;  4ZTJ A;  5EVH A;  1OCV A;  2GOM A;  4B09 A;  3OS1 A;  4NUB A;  4NQW B;  3MZ8 A;  3LA3 A;  3LNQ A;  3OW2 2;  5ILS A;  1I0X A;  3SHF A;  2VC0 A;  1MGT A;  2IMJ A;  3KFW X;  3TP0 A;  3SZG A;  2LF7 A;  4YII A;  4A2U A;  4I02 A;  2WB1 N;  3A76 A;  2FQ4 A;  3PQK A;  4FR9 A;  4ZYH A;  2O9U X;  1GY6 A;  4HV6 A;  1MSF C;  3CCM 3;  4XN3 A;  3S3O A;  2DT5 A;  3WTS C;  1UFM A;  2OCC H;  4N6O B;  1V5F A;  2K9L A;  1ZR4 A;  1Y39 A;  4NC8 A;  1FTT A;  4XOP A;  3GLL A;  3OV8 A;  2VLA A;  1IC8 A;  2EZL A;  5D6E A;  2VOD A;  4IXA A;  1HYF A;  2C10 A;  2LD5 A;  2DA4 A;  1HQC A;  1X1B A;  4XLH A;  1MWR A;  2BVM A;  4M3E A;  1Q9E A;  3KYD B;  2A15 A;  2ECC A;  2KIS A;  2CC3 A;  3WOD F;  2P0M A;  3AHS A;  3LFK A;  4XDW A;  4MJD A;  3HOT A;  3KCC A;  1YS7 A;  4M3G A;  1UG0 A;  1T2K A;  4BU2 A;  1ETX A;  1X58 A;  3LSJ A;  1TQI A;  3W6V A;  3GTP J;  3DCF A;  4B8X A;  3TKY A;  1B8I B;  2Z76 A;  4X2H A;  3ZQ7 A;  3E3V A;  4EJT A;  1F1Z A;  2EB7 A;  3PSI A;  2LY9 A;  1BNJ A;  2BIR A;  3BR2 A;  3DXO A;  3MKI A;  3OWY A;  1E3P A;  3EB8 A;  5M5X J;  2EPF A;  5CVI A;  2FE3 A;  2D45 A;  4IHY A;  3GTK J;  1AR0 A;  4BU4 A;  3EBT A;  2M1B A;  2P6T A;  2STD A;  5I97 A;  1YI2 3;  3VYT B;  4OAY A;  2ZJQ F;  3I54 A;  2CWU A;  5JR3 A;  2ELK A;  1BSD A;  2HQN A;  3S16 J;  1M90 4;  3A4C A;  1LRA A;  4BS9 A;  1KYW A;  1N77 A;  4HAM A;  5TIS C;  3BR1 A;  4XL9 A;  3S5C A;  1FUW A;  3I53 A;  4CCL A;  3RKQ A;  4CHU A;  2LYX A;  3DGM A;  4WYK B;  4HZ9 B;  1G2H A;  1FGM A;  2WTE A;  1R5I D;  3V92 A;  2IT0 A;  4ZYD A;  4LD5 A;  3F8C A;  4Y4R A;  3K6G A;  1X3W B;  2EIJ H;  4PDK A;  5K1Y A;  1U0J A;  3VDX A;  1D1A A;  1S7A A;  5F64 A;  4EBG A;  2XEP A;  1XCV A;  1TTY A;  3EX9 A;  3EF8 A;  2LKX A;  1BAN A;  4F7Z A;  2Z99 A;  4HJL B;  1O57 A;  2WAD A;  2ZSI B;  3QPL A;  1CF7 A;  2RRE A;  2QBY A;  1UUV B;  3B4P A;  7STD A;  3KLN A;  1JTY A;  1RRJ A;  1BJA A;  5DYM A;  2QEX 3;  3I64 A;  2XGL A;  4HRI A;  4FCY A;  1F5T A;  2CFX A;  3KZY A;  5JLX A;  2CUZ A;  5HDK A;  4IRH A;  1Q42 A;  4J8T A;  2DU9 A;  4TV7 A;  2MA3 A;  3CO6 C;  4A3D J;  2V9V A;  1C0W A;  1LFU P;  3COA C;  1MBH A;  5K5O A;  2KDZ A;  5L3C A;  1DET A;  1QVF 2;  3Q1C A;  2AXT C;  2HOH A;  2E5N A;  3PIP F;  4D7N A;  1ZRD A;  4XKV A;  1YVS A;  3OYE A;  2VOO A;  1WNH A;  2BY1 A;  1A04 A;  3LA7 A;  2FMY A;  2KZV A;  4RB0 A;  4CYD A;  2IW5 A;  3K70 C;  2KRC A;  2P7V B;  3BWG A;  5IY5 H;  2WAE A;  3ZPL A;  3KX2 A;  4BXF A;  4A3M J;  2A07 F;  2VT3 A;  3HKZ A;  3JUN A;  3M1E A;  5CF1 A;  3K9M C;  2O6G E;  5KCM A;  4XID A;  4XNF A;  4I09 A;  4FTH A;  3IAS 2;  3E5Q A;  4HX4 A;  1YX3 A;  1HW2 A;  2EZH A;  3GZN B;  2EH3 A;  2HFH A;  5LRS A;  1IRF A;  1TBX A;  4PFO A;  2LY1 A;  3ROU A;  3J7A Y;  1PJR A;  4PJN A;  2FBK A;  3G73 A;  3N9H A;  3BG3 A;  1PYV A;  2K9M A;  2VBW A;  3CJN A;  4JK1 X;  3QPT A;  1K41 A;  3I56 I;  1MGW A;  2CFK A;  3FG3 A;  4K1V A;  1YYV A;  4MO7 A;  1IQX A;  1UUG B;  4GXO A;  2EK5 A;  1I50 J;  1FPQ A;  4XQF A;  5H6Q A;  5DM6 F;  4X6A J;  1JN5 B;  1MWU A;  4XMY A;  2V6C A;  1PYL A;  4E7K A;  3PUB A;  1YRN A;  3OYM A;  1YG2 A;  4A0Y A;  1SAX A;  3D79 A;  4E6K G;  2XAH A;  2GXG A;  5D83 A;  4RGS A;  1VQK 3;  2GOX B;  1WKM A;  3HB9 A;  1TL8 A;  2XGC A;  2KRF A;  2IP2 A;  3I4P A;  2DFF A;  3DGL A;  1LPQ A;  1B9M A;  1FNN A;  3F7S A;  4A5N A;  4XN0 A;  3ZN1 A;  2COM A;  1FTZ A;  1J75 A;  3H9Q A;  4CCV A;  4ZYG A;  1VQO 3;  5JPU A;  3BC8 A;  3DPU A;  1YO5 C;  4IRI A;  3I55 I;  1K61 A;  1E17 A;  2FNA A;  1DPU A;  1MNE A;  1FJL A;  2E7X A;  1X2N A;  1YHQ I;  3S32 A;  3CCV I;  4Q5S F;  4R9L A;  1EQK A;  2K7L A;  1EKE A;  2K9S A;  1D0Z A;  4IOC F;  1D5V A;  3TP3 A;  1L3L A;  1FZU A;  3FKI J;  3WGI A;  3ABM H;  2DOD A;  4BAC A;  5FW5 A;  4P96 A;  2XFS A;  1IN5 A;  4BYY A;  3GYH X;  1EH6 A;  4B4C A;  1MH3 A;  5DCM B;  4O3V A;  4NC6 A;  3Q3F A;  3S1R J;  3D5G A;  1V54 H;  5D4R A;  3LT8 A;  2LY2 A;  2DCE A;  2LOO A;  4GDF A;  1BIB A;  3NWS A;  4MHG A;  4BJ5 C;  5IOY A;  1NHA A;  3M07 A;  3MVP A;  4OOI A;  2L7F P;  3CCL I;  2MSY A;  4ESJ A;  3TOA A;  2NOJ B;  2VBZ A;  1U5T C;  2ZFW A;  4XKW A;  4QIW N;  3CCU I;  4X1E A;  1A36 A;  4CSW A;  3CNX A;  4KDP A;  1TTO A;  1KU7 A;  1STD A;  3GXO A;  1NO3 A;  2BW3 B;  1JRQ A;  1QAK A;  4OUQ A;  3GFL A;  3HRT A;  4GB5 A;  3KE2 A;  4EGY A;  2IA0 A;  1BSC A;  4I0A A;  4L5E A;  2QLZ A;  3S1N J;  4A6E A;  2F4I A;  5BXQ A;  1D5Y A;  2MC8 A;  1IDY A;  1P4W A;  1H89 C;  4C2T A;  3CP8 A;  1H0M A;  1T95 A;  2CGP A;  2DA7 A;  1FUT A;  3K69 A;  1OHS A;  1WZ2 A;  2VQL A;  1EH7 A;  2ECB A;  2VAS A;  2IS1 A;  3JRF A;  3HOZ J;  1D8J A;  1TT0 A;  1KZH A;  2D5V A;  1IYY A;  4IF4 A;  3EC9 A;  3BZ6 A;  1EA2 A;  2YR2 A;  3LSK A;  4CYC A;  2MH2 A;  4DZJ A;  1RI7 A;  3S1Q J;  2IGO A;  4R4K A;  4PSX A;  3MD2 A;  3DZL A;  4FMA A;  3G2B A;  3EPZ A;  2JRT A;  3L2Q A;  1FYM A;  2YFI B;  3T8N A;  3IWZ A;  1O3R A;  3WTY C;  5F0C A;  1RIO H;  1PY3 A;  2UWM A;  3KCH A;  5EG0 A;  3B6A A;  3QWL A;  3CO7 C;  2XF7 A;  5IYD J;  2VKD A;  1O7N B;  4NHJ A;  1BNS A;  4XKB A;  3T8T A;  5JFR A;  1JI8 A;  3VGN A;  1MDM B;  4RNY A;  1OCT C;  1T3B A;  1BI2 A;  4BUP A;  2P5K A;  3H0D A;  1B20 A;  4BTW A;  5BNG A;  2DA3 A;  4RB1 A;  9ANT A;  1MWT A;  3BQY A;  1L5G B;  2GXB A;  2OF7 A;  2CQK A;  4PJ0 C;  3ABL H;  2MLG A;  4A3G J;  3EUH A;  4RAG A;  1K7A A;  4KNY A;  1SPU A;  2OC6 A;  2TRT A;  3ECF A;  2ZME A;  3WHO A;  2QZ8 A;  3HGG A;  2E35 A;  2ISZ A;  2KXG A;  3FXO A;  2I10 A;  1GD4 A;  2QWW A;  3PNV A;  2CG4 A;  1VQ5 I;  1FY7 A;  2KFD A;  3PGB A;  1S29 A;  2W25 A;  1B27 A;  2EZK A;  2OPT A;  4BXU A;  2SAR A;  1USS A;  2F6C A;  1J5Y A;  1G4D A;  3RKX A;  2LMD A;  4R80 A;  2HMJ B;  1GS3 A;  3GSP A;  1QHH D;  1DU6 A;  3S28 A;  3WE3 A;  3VFZ A;  3GZR A;  1TW3 A;  3NM2 A;  2VQH A;  1V4R A;  2ZB9 A;  2O3O A;  3K4C A;  1S9H A;  3FHN A;  5J8C A;  3F3X A;  3EBY A;  1HKT A;  2DFH A;  1ZGA A;  2Z5U A;  4MFD A;  5GP9 A;  3IV5 A;  2MYS A;  7GSP A;  3LQR A;  3JRI A;  1IDZ A;  1E97 A;  4C3J J;  3N05 A;  2ELJ A;  4PEJ A;  5AYR B;  3DU5 A;  5CLK A;  4HF2 A;  5A2Q Z;  4HYE A;  3KP7 A;  5GPA A;  4I4K A;  4HA8 A;  2EFQ A;  2DQR A;  3MAJ A;  1U3E M;  3WGH A;  2HQR A;  4CA0 A;  1SC7 A;  3SFZ A;  5E1W A;  4MIM A;  1MMG A;  2H09 A;  4V19 K;  2K3D A;  1PUF A;  4HOB A;  4IHT A;  2W9P A;  5E17 F;  3AAF A;  3SOY A;  3AGO A;  4EAT A;  1BAO A;  1FIP A;  3NQY A;  2HDC A;  3KPH A;  1RGE A;  2K4J A;  5DUI A;  3WTW C;  3LXU X;  3ZFZ A;  2KF5 A;  1DU0 A;  4HNT A;  2MW8 A;  5L3G A;  2HNH A;  1K79 A;  3OY9 A;  2J8X B;  2GAU A;  4M6V A;  2ZKZ A;  1BW5 A;  2EIK H;  1LQG C;  3PCS A;  4RNT A;  3MQ0 A;  3AMO A;  4FX4 A;  5CJ9 A;  3HOW J;  2E1M C;  3OYA A;  1O3S A;  2BO9 B;  2OCT A;  3VPR A;  1QAF A;  2RQQ A;  2AQE A;  1OFC X;  1RES A;  2PMZ N;  3T0U A;  1XG1 A;  2XRX B;  5ILV A;  2O9L A;  4M3F A;  3HZP A;  5TGT A;  1A31 A;  3RZO J;  5G1L A;  1LNH A;  5GAD J;  2V7F A;  2LYC A;  2WGO A;  3L2C A;  3DKW A;  1BSA A;  2BHY A;  3MG3 A;  2Y73 A;  2HEO A;  1B9N A;  1I6H J;  1OKR A;  3H1C A;  4RGU A;  4J00 A;  1PP8 F;  3NV0 A;  5BPI A;  3NHX A;  3B4O A;  3S27 A;  5IEO A;  1I70 A;  1VQL I;  1KU9 A;  3JRA A;  3V7S A;  1NK2 P;  2NS0 A;  2L7K A;  2OZ6 A;  4EJV A;  4HLY A;  3J81 K;  3N8B A;  3BTI A;  2M0M A;  3CMA 3;  3GME A;  1Z77 A;  4AUX A;  1TC3 C;  4TX4 A;  1BR2 A;  3G6E I;  5CVU A;  1VTN C;  1W4N A;  4KIB A;  3SDB A;  4AIH A;  4RLF A;  2DN0 A;  4L9V A;  5FLX Z;  1QHG A;  3DEW A;  3GTL J;  1BNG A;  5G1K A;  2DPU A;  4DW6 A;  5FLX K;  1IN6 A;  4N6L A;  4EM0 B;  2R7U A;  2OTJ I;  2V79 A;  1SMY F;  2RQP A;  1LFB A;  1WTH A;  2V1N A;  3W2W A;  4XDV A;  1KQ0 A;  2QQ9 A;  2R92 J;  2O8X A;  2F99 A;  2HVQ A;  4LK1 F;  3TGN A;  4KIG A;  4WP5 A;  2YFJ B;  5FLM J;  3DPL C;  5DD4 A;  1YW9 A;  2R5Z B;  3A0H C;  2J5P A;  2B9S A;  3RKW A;  2WAQ A;  3J80 K;  3F8B A;  2EFN A;  1FLI A;  2RV8 A;  1IQY A;  4DIQ A;  1EUI C;  4GFB A;  3SOA A;  2QCO A;  3O8H A;  5LHI A;  4A0Z A;  5HOH A;  2CSO A;  1POG A;  3FXU A;  2FJ1 A;  3PM1 A;  3ZMU A;  1VQ4 I;  3EN1 B;  2BE5 F;  2O5R A;  4LB6 B;  3DV8 A;  3OS0 A;  3WR2 A;  3KP3 A;  3WU0 A;  2IGM A;  2LC2 A;  4NQW A;  3NM7 A;  2H1L A;  1SAU A;  4X0G A;  4ESB A;  5KP1 A;  2R7T A;  1ETV A;  1Y8Q B;  3U9G A;  4YEL A;  5B66 C;  4BXX J;  4N6U A;  3ER7 A;  4KN7 X;  2RGV A;  4ENJ A;  4J5G A;  3G8Z A;  3NEU A;  5J3L A;  3GZ5 A;  2KRH A;  2W03 A;  1IZ1 A;  1R7J A;  3QPH A;  1GUU A;  5DV5 A;  3LSG A;  4A3F J;  4H3U A;  1K6O A;  1ON2 A;  3HOS A;  3HYI A;  3S3N A;  3FM5 A;  1PP7 U;  1BRK A;  2CW8 A;  4D9J A;  4YFN F;  1OCR H;  3J7A O;  3DM8 A;  1WMN A;  4UUV A;  4I98 B;  1BVI A;  4DOZ A;  3WHB A;  1R9T J;  1OMI A;  1ETO A;  3V42 A;  1LVN A;  1WI9 A;  2Q1Z B;  2B0L A;  1B21 A;  2K86 A;  5F0H A;  1LOY A;  3SLU A;  2QA4 3;  2RNT A;  3CC4 3;  1I3Q J;  1OR7 A;  1NH3 A;  2CV2 A;  3WOE B;  1HKQ A;  4U13 A;  1Y4K A;  1M9G A;  4B44 A;  4HPQ A;  3FZW A;  2L3D A;  1Y0U A;  2V1X A;  3OYB A;  3W6J B;  4I01 A;  2GSP A;  5J4V A;  1Q40 A;  4MQV A;  4L8O A;  2EV0 A;  1UHM A;  2X6Y A;  2FGT A;  2P4W A;  3CCE 3;  1EH8 A;  2W1O A;  2E2T A;  4FHT A;  2WBM A;  1AV4 A;  1UJ8 A;  3BR6 A;  2GU3 A;  3BCB A;  1VF9 A;  1I1S A;  4B43 A;  4IHW A;  3MKY B;  1QQI A;  1T56 A;  2KL4 A;  3B6C A;  1D6U A;  4K61 A;  4BQQ A;  2DA6 A;  1XN7 A;  3I0T A;  1IG7 A;  1YLF A;  1UDI I;  5IG5 A;  3EYY A;  2K27 A;  3QOD A;  4OMZ A;  1VQ6 3;  3GUD A;  3X3Y A;  2GM4 A;  4LB5 A;  4HQM A;  1TU5 A;  2DI3 A;  2Z1D A;  3ZQC A;  1W6Y A;  2Y2Z A;  5FKM A;  3W2V A;  5AEW B;  5BQT A;  1O7W B;  2V26 A;  1VND A;  2W00 A;  2X4H A;  2ZXJ A;  3LSM A;  2HKX A;  4BEH B;  4CCN A;  4P55 A;  4RM3 A;  3ZR8 X;  4AVZ A;  4ZTF A;  1BRG A;  2GBX B;  1JKP C;  4WYK A;  1GYB A;  1J2X A;  3I59 B;  5DEQ A;  4FCZ A;  3WTV C;  3ECH A;  1MBG A;  2VIX A;  4LLN A;  1WMO A;  1U6G A;  4HVN A;  5HNF A;  5CVR A;  3CME I;  2PLY A;  1UI7 A;  2RSX A;  1LB2 A;  2CQX A;  3FIW A;  1FOY A;  1R5G A;  1RHL A;  1NG7 A;  2JTV A;  4C30 A;  3QRD A;  1XC5 A;  1XSV A;  2IS4 A;  3KFQ C;  4XOT A;  2J5O A;  2CW0 F;  4KYW A;  2CG0 A;  1HA8 A;  1W7P D;  1TFO A;  1VQ8 I;  5EZH A;  2HVR A;  5CK6 A;  1JBR A;  2JVG A;  3A0B C;  5ICG A;  1OCO H;  2C6Y A;  3ZG5 A;  4LIU A;  2KP6 A;  2M4K A;  3PSF A;  3TMO A;  4AC0 A;  5E8I A;  3CF2 A;  3SJM A;  1YIT 3;  1FBU A;  4CIC A;  2WOF A;  2PX9 A;  1YIO A;  3WGG A;  3K9T A;  2CHC A;  3EJV A;  1Z05 A;  2R7X A;  2CUJ A;  4AD9 A;  3LML A;  3RI4 A;  3L2W A;  3CC7 3;  1KQ9 A;  3ZXS A;  3FMS A;  3EET A;  3RJP A;  1MNM C;  1BSE A;  1K8A 4;  2IUJ A;  1ZG3 A;  3GF2 A;  3X40 A;  4PJL A;  5BPD A;  2IA1 A;  1ULI B;  3LSR A;  3VSL A;  3F8H A;  1D8K A;  2X6W A;  3FM3 A;  3HM5 A;  3K4J A;  2PMU A;  4LZI A;  3H51 A;  4XB5 A;  1VQ7 3;  1IW7 F;  2PBI A;  4FT8 A;  1UZC A;  4HM4 B;  5ED4 A;  2RN7 A;  3RIR A;  3CDH A;  3VEP A;  3URP A;  3A01 B;  5FKK A;  1IUY A;  1IU7 A;  5HLI A;  4MTD A;  3HII A;  4KA4 A;  1ENH A;  1FGQ A;  1NU3 A;  3CDI A;  1W5T A;  5HS7 A;  1DMM A;  2EQR A;  5ELJ A;  2DTZ A;  1EKM A;  1VQP 3;  3EUH C;  2K3P A;  4A5M A;  4HYZ A;  2IVM A;  3DKY A;  3H3Z A;  1O7L A;  1YJN 3;  5J1U A;  1E3V A;  5BIR A;  4FQG A;  3WA3 A;  2DMT A;  2HYJ A;  2ZME C;  2XRN A;  2VB6 A;  5F04 A;  3DEE A;  1SVM A;  3C18 A;  2O61 A;  4D7M A;  3AKZ A;  1BRI A;  5KHD A;  2CS3 A;  3RQ4 A;  2ZXH A;  3JUQ A;  3FXK A;  1A6Q A;  3CD6 3;  1MGR A;  1GOU A;  3F23 A;  4FMD A;  5AIF A;  4BTY A;  5KK1 A;  3MPH A;  2NOG A;  2E2J J;  2YFL B;  3CJR B;  1JZD A;  4GL6 A;  2DK8 A;  3HHG A;  4U87 A;  3LTD A;  1HKX A;  1JN5 A;  1WFX A;  4FMB A;  2Y31 A;  4KVH A;  1RC9 A;  5E1X A;  2QVO A;  1W7P A;  1ZKG A;  2RDP A;  4F91 B;  1HF0 A;  3KP5 A;  2LBF B;  2ZBK A;  1OH0 A;  2LVS A;  1Q86 4;  2F5D A;  1JKR C;  4EM1 A;  4HKV B;  4IHX A;  2CQQ A;  2O7O A;  3FHZ A;  2W2C A;  3I5U A;  5DM7 F;  4STD A;  3BJO A;  2OQR A;  1XB4 A;  5EGO B;  2BMR B;  1T2I A;  1O7H B;  2PFB A;  2HOE A;  3OYC A;  1GOV A;  2M7A A;  3MKZ A;  3LTB A;  1A5J A;  2IGN A;  1F43 A;  4J5K A;  1LEA A;  2XKP A;  3BPX A;  3E5U A;  4KUM A;  1JGS A;  4IOA F;  1TP6 A;  5E3N A;  1LJ9 A;  5HNH A;  1Z0X A;  1AY7 A;  3NQO A;  1G6N A;  2QKL B;  4LLL A;  2OOV A;  5DCM A;  1K78 A;  1IN8 A;  3CU3 A;  2Z77 A;  1ROA A;  2F98 A;  2L5Q A;  3LST A;  2OAZ A;  5JHF A;  4J9A A;  3RYP A;  1R71 A;  3MG2 A;  3SXY A;  4XK4 A;  3EQL F;  3C2H A;  3D5L A;  2A5Y B;  2HTJ A;  1I39 A;  1RRH A;  4HZB B;  4L18 B;  1AVL A;  4LIV A;  2C11 A;  3AL0 C;  2SBL A;  3CCR 3;  3DGN A;  3CCY A;  1YGE A;  3RDE A;  1B1B A;  2VXD A;  1MJA A;  2CO5 A;  4EVI A;  4QWQ A;  3CMY A;  3F8F A;  1B72 B;  3SZT A;  3A02 A;  2EV5 A;  2XRO A;  4OIQ F;  4CPK A;  2F56 A;  3FF5 A;  3D3L A;  4IVN A;  2DYS H;  4YIF A;  2BMO B;  3B7C A;  4EV2 A;  2FUG 2;  2BW3 A;  2RGQ A;  4O6J A;  1TWA J;  1FZP B;  2RAE A;  2V6E A;  2DOE A;  1OPY A;  2E1N A;  4ORL A;  1FIA A;  3U1W A;  4Y15 A;  3KE7 A;  2DJI A;  3LQQ A;  5IYB J;  1B3S A;  1W5C C;  2G9W A;  2HQ5 A;  1IXR C;  5LEJ A;  1OHP A;  1HCR A;  2WC2 A;  2E2I J;  1GXQ A;  4HG2 A;  3ZN0 A;  1T38 A;  1RNL A;  5FD6 A;  2QQA A;  4RB3 C;  3VSK A;  2ZL8 A;  1DGR M;  1DMQ A;  2K0M A;  5M18 A;  3C7J A;  2F5C A;  2UUG C;  2JA7 J;  4XLC A;  3CCS 3;  3JRE A;  3RYR A;  3LZA A;  4HSR A;  1RGL A;  5JHU A;  1U8R A;  3HRM A;  2CW9 A;  3JAM K;  3GZ6 A;  1LEB A;  1WJA A;  3IP4 B;  2FNQ A;  4PCQ A;  4ZC3 A;  3T8R A;  1ZS7 A;  3RNT A;  3NQZ A;  2V1L A;  2DFE A;  1BR4 A;  2A6H F;  4IHS A;  3GZX B;  4MMZ B;  2CFO A;  3BJ6 A;  3ECO A;  1TUH A;  1IUF A;  5JLW A;  5DTD A;  4O8S A;  1X1Y A;  2DOA A;  1RMS A;  3KEO A;  3K63 A;  2H8W A;  2Y69 H;  3DU6 A;  3JUP A;  4KFF A;  1CH0 A;  3UJM A;  2DJN A;  5LC6 A;  2Q07 A;  4HM7 B;  1D0X A;  1MDM A;  3S1M J;  5G2G A;  4JP0 A;  3ZMS A;  3X41 A;  1N9E A;  4XM3 A;  3P7N A;  1E3R A;  3KEQ A;  3BCA A;  5HGR A;  3JRH A;  2KJC A;  3HSR A;  4IO9 F;  3E6C C;  2KT0 A;  3MWM A;  1J59 A;  2X48 A;  3D5S C;  2OBP A;  1TJD A;  3W6K B;  3SX1 A;  4BY1 J;  2AHQ A;  1BR1 A;  4XBF A;  2PN6 A;  2QQ8 A;  2ZCW A;  2JA6 J;  3MWZ A;  5IYC J;  1DVD A;  2BHM A;  2OTL I;  1RJO A;  1N78 A;  2KJB A;  5HS8 A;  4CCJ A;  1UCK A;  3CXC 2;  4OIR F;  3UNG C;  2W56 A;  4KJZ A;  1Y1W J;  3BR5 A;  4HM5 B;  2D42 A;  3DBH B;  1TWH J;  3OWS A;  2JT1 A;  2M34 A;  2Y0S A;  1P6R A;  4H0E A;  1MBJ A;  1IGN A;  1TW2 A;  1R1U A;  2VJI A;  1RCL A;  2FX0 A;  5FGO A;  2ML6 A;  2NS7 A;  3MKW B;  4E7S A;  4GRI A;  5J4Y A;  1BIA A;  2A5W A;  3P9I A;  4CDL A;  2M0C A;  2H8R A;  3ISP A;  3O2P E;  1I27 A;  3TDU C;  3WMD A;  3S93 A;  3FXR A;  3SYT A;  4AYB A;  1VQ9 I;  1OR7 C;  3BG7 A;  2HXO A;  4D5C A;  3QP6 A;  4ZZL A;  2JA8 J;  2W9Q A;  1K4T A;  3JUM A;  3S17 J;  1UGH I;  2JSC A;  1YJ9 I;  2GQQ A;  1RGK A;  1BNR A;  4L0Z B;  2L9N A;  1C54 A;  2LNB A;  5EDN A;  4P5O A;  2HPI A;  2XVC A;  1IAW A;  1WJF A;  2CUE A;  8RNT A;  1HZ1 A;  3NUV A;  3ULQ B;  1JJ8 C;  1S5L C;  4Z6Y A;  3L00 A;  3OV4 A;  2EIL H;  1G59 A;  3HEF A;  2EA4 A;  2F4M B;  3F9K A;  5C3E J;  4B3X A;  4QPO A;  3BJA A;  3OWU A;  1OYW A;  2V4J C;  4G6D A;  4ON0 A;  2E1O A;  2BV6 A;  1JGG A;  5KAF C;  3A1Y A;  3JCU C;  3GTM J;  4BIR A;  2AAE A;  3TW7 A;  3U1K A;  5LHH A;  1OCZ H;  1ASK A;  4I5Q A;  1H9G A;  3PFI A;  1Z3Y A;  1I5Z A;  4BHB A;  1D6Z A;  1KGS A;  3HUG B;  1IDP A;  1TWF J;  4FCJ A;  2LFB A;  2NNN A;  1FX7 A;  2Z3Y A;  1X4O A;  2IPQ X;  5FKO A;  3WTX C;  1U9N A;  3PQJ A;  1K4S A;  1WH7 A;  3S14 J;  2AXL A;  3VF1 A;  1W1W E;  1GVJ A;  1RR8 C;  1OF5 B;  1Z1D A;  3GZB A;  1NNV A;  1ZLJ A;  3PZW A;  2CWE A;  4IQ4 A;  4AID A;  2L02 A;  3ALA A;  5CXO A;  3ZP5 A;  1YOV B;  4AWX B;  2ZA4 A;  2WY8 Q;  2YS9 A;  1R4N B;  3Q9S A;  5H2F C;  2WWY A;  2HKO A;  4G8X A;  1BU4 A;  4II3 A;  2ID3 A;  3KP4 A;  1U5T B;  2L9S A;  5ELU A;  3LT9 A;  2CYY A;  2ZJR F;  1VQM I;  3A5E A;  3H0G J;  3BG5 A;  3V8L A;  2XGE A;  3ASO H;  3TDZ C;  2PZV A;  2MFZ A;  1BNE A;  3VSY A;  5E79 C;  1W01 A;  4S04 A;  1FYL A;  4V2F A;  3K2Z A;  4RDU A;  2XGX A;  3U21 A;  1ZK8 A;  2EV6 A;  2XUB A;  1BNI A;  1UCI A;  3KII A;  2EIN H;  5F08 A;  2R4G A;  4KZ1 A;  5AYS C;  2DQL A;  1YIJ I;  2XSO B;  4RZM A;  1BRS A;  2IAI A;  3BND A;  4F93 B;  3EUA A;  1GMQ A;  3V8J A;  4UUS B;  2I8D A;  4PGG A;  2FBH A;  2PG4 A;  3U97 A;  2F5W A;  3QU6 A;  5AIP A;  1JUS A;  2Y48 A;  2MF7 A;  4OVM A;  2WOH A;  2E19 A;  2K54 A;  5CVV A;  1MJ9 A;  3I56 3;  3CPW 2;  1BOB A;  2CK3 H;  1X1C A;  2Q2E B;  4ENM A;  2CFG A;  4Z2Y A;  4N0B A;  1T8I A;  3M8E A;  1MD0 A; 
#chains in the Genus database with same CATH homology
 2P05 A;  3OX9 A;  2WGO A;  4MEI A;  2XSH B;  1NB5 I;  2JDI H;  4LEH A;  3MG3 A;  2Y73 A;  3NV0 A;  3V98 A;  3NHX A;  3S27 A;  3B4O A;  5IEO A;  5AIH A;  4AKY A;  1Q40 B;  2W0Q A;  1K9M 4;  4AEQ A;  1T5Y A;  3N8B A;  3BNE A;  1LXE A;  3I55 3;  3CCQ 3;  3CMA 3;  5AIG A;  1M1K 4;  4TX4 A;  1KSI A;  1J2B A;  1N5H A;  1ULJ B;  3NBR A;  3PCR A;  1W4N A;  3PXM A;  1FGR A;  1N5P A;  1YHQ 3;  3CCV 3;  5KP4 A;  1DYU A;  1Z1S A;  2HMK B;  1JB2 A;  1F8N A;  5TGN A;  2P09 A;  2RCD A;  3RGR A;  2BT3 A;  4N6L A;  2CIU A;  4O02 B;  3SXX A;  3V99 A;  1WTH A;  2GBW B;  4XDV A;  2F99 A;  2ZDJ A;  3T8U A;  4WP5 A;  2YFJ B;  3AMO B;  1PFP A;  1OHO A;  5AEU B;  1UI8 A;  3Q90 A;  1JNQ A;  3FLJ A;  1R4C A;  3JVC A;  1IQY A;  3M8C A;  3IJE B;  3SOA A;  1W6C A;  3CCL 3;  3EN1 B;  4FCM A;  4G1M B;  1C7H A;  1IVU A;  3CCU 3;  3ROB A;  1W6G A;  4HM2 B;  3RGA A;  2CFW A;  3NM7 A;  3F9S A;  2OOV C;  4RBN A;  2OTL 3;  5KP1 A;  4JRF A;  1GY7 A;  1CEW I;  1ZX2 A;  1JV2 B;  3BNB A;  3NV0 B;  4N6U A;  3WOD G;  3ER7 A;  5BVB A;  3LTA A;  3DUK A;  4N6V 0;  5EQL A;  2CFL A;  3G8Z A;  4WWU C;  2Z6B A;  2W03 A;  1NDO B;  4H3U A;  2OWP A;  4H61 A;  5IER A;  3BLZ A;  3S67 A;  3G16 A;  3UB1 A;  4AKZ A;  1JB4 A;  1W5Z A;  3F14 A;  3DM8 A;  3K0Z A;  1WMN A;  4N6M A;  6STD A;  1IVV A;  1LVN A;  1V74 A;  3BB9 A;  3SLU A;  2QA4 3;  4EV5 A;  4EYC A;  2BMQ B;  3CC4 3;  1A67 A;  3WOE B;  4Q53 A;  1NJI 4;  2JQ5 A;  4U13 A;  1VQ9 3;  1Y4K A;  1M9G A;  1NWW A;  4LMI A;  4EXR A;  3MYT A;  3FZW A;  3NBB A;  3CC2 3;  1Q40 A;  4R9K A;  4L8O A;  1YJ9 3;  2FGT A;  3CCE 3;  2E2T A;  1AV4 A;  5IEN A;  3WDG B;  2GU3 A;  1FA3 A;  1RKY A;  3FF0 A;  1QMA A;  2HML B;  1D6U A;  4K61 A;  4N6N B;  1N8Q A;  4O2H A;  5EVH A;  1OCV A;  2CH9 A;  5IG5 A;  3OW2 2;  3UL5 A;  1VQ6 3;  3X3Y A;  3KN4 A;  3LH4 A;  5DRE A;  1TU5 A;  3OXA A;  1W6Y A;  2IMJ A;  2IUK A;  2L4V A;  1VQ5 3;  5AEW B;  3A76 A;  1O7W B;  4RZM A;  3MSO A;  4FR9 A;  2O9U X;  1GY6 A;  4HBR A;  2GBX B;  3CCM 3;  4WYK A;  1GYB A;  1W02 A;  4K90 B;  4FCZ A;  4N6O B;  2GEY A;  1WMO A;  2B1X B;  1Q7Y 4;  1ROV A;  4HVN A;  2UX0 A;  3IPT A;  1UI7 A;  2RSX A;  4QWT A;  2C10 A;  1D6Y A;  1OUN A;  3QRD A;  4N6T A;  3KFQ C;  1IQ8 A;  2R4I A;  2CG0 A;  3E99 A;  2A15 A;  2HMN B;  1TFO A;  2W6J H;  4JF8 A;  1KQS 2;  3KKG A;  1O7M B;  1S5A A;  2CC3 A;  2P0M A;  3DMC A;  5CK6 A;  4L8P A;  5D82 A;  4WFO A;  4XDW A;  4MJD A;  1IT7 A;  1VQM 3;  1IT8 A;  1ZO2 A;  3JUO A;  4X2H A;  1YIT 3;  2Z76 A;  2WOF A;  1MNL A;  3EJV A;  2CHC A;  4ZM8 A;  3LML A;  3NBJ A;  2P38 A;  3CC7 3;  1TIJ A;  3EN8 A;  2INX A;  3DXO A;  1A2V A;  2W04 A;  3MKI A;  3OWY A;  2IUJ A;  1K8A 4;  3EB8 A;  3X40 A;  1YIJ 3;  3I0Y A;  1ULI B;  1AR0 A;  3BNC A;  3EBT A;  1IV9 A;  4KFD A;  2CWT A;  3F8H A;  1M1X B;  2STD A;  5I97 A;  1YI2 3;  1Q82 4;  2CWU A;  5AII A;  4LZI A;  3GWR A;  3H51 A;  4XB5 A;  1CYU A;  3H3H A;  1M90 4;  4HM4 B;  1O7P B;  3S5C A;  1IU7 A;  2LYX A;  3DGM A;  1Q81 4;  3HII A;  4WYK B;  4HZ9 B;  1FGQ A;  1FGM A;  1NU3 A;  1DMM A;  2CWV A;  2GXF A;  1EKM A;  5ELJ A;  3V92 A;  1VQP 3;  4KFE A;  1OGX A;  4HYZ A;  1YJN 3;  1E3V A;  3WA3 A;  4IIA A;  4EBG A;  1VQL 3;  2XEP A;  3EX9 A;  4LSO A;  3EF8 A;  3JUQ A;  3CD6 3;  5AIF A;  4FMD A;  4BTY A;  4HJL B;  3PS8 A;  3MPH A;  2YFL B;  3X42 A;  1UUV B;  4GL6 A;  3B4P A;  7STD A;  2XR8 B;  3LTD A;  1HKX A;  1JN5 A;  4FMB A;  4K1U A;  3FGY A;  3GZY B;  2QEX 3;  4KVH A;  5CF2 A;  3G6E 3;  2XGL A;  1G96 A;  2RFR A;  1SJW A;  2FXT A;  4XM4 A;  3KSE D;  1Q42 A;  1QAL A;  4J8T A;  1JJ2 2;  1JB5 A;  4N3V A;  5IEP A;  1OH0 A;  4OK0 A;  1VQN 3;  1Q86 4;  4HKV B;  2OTJ 3;  5IW9 A;  1W2B 2;  2W2C A;  1QVF 2;  3Q1C A;  2OQE C;  2QIY A;  3G4S 3;  4STD A;  4BTX A;  2BMR B;  1N9J A;  1O7H B;  2CFD A;  1S72 3;  1WNH A;  3S29 A;  4HM3 B;  3LTB A;  4FMC A;  3JUN A;  1VQ4 3;  5CF1 A;  2CG1 A;  3K9M C;  4IPB A;  1TP6 A;  1VZZ A;  5STD A;  2OOV A;  1IK3 A;  3CU3 A;  2Z77 A;  5IG0 A;  1ROA A;  1SIH A;  1SII A;  2F98 A;  2W56 B;  3F8X A;  3SED A;  4J9A A;  3MG2 A;  3CPO A;  1RN7 A;  4HM1 B;  1RRH A;  4HZB B;  1AVL A;  1U8C B;  3G0K A;  3MHE A;  2C11 A;  2SBL A;  4XBY A;  3N9H A;  3SVA A;  3DGN A;  3CCR 3;  1YGE A;  3RDE A;  3LTC A;  3D9R A;  5DRV A;  1K41 A;  2CFK A;  3FG3 A;  4K1V A;  3EHC A;  1IQX A;  2XF3 A;  1JN5 B;  1ISK A;  2E2V A;  3D3L A;  2PNC A;  2BMO B;  3HI7 A;  4EV2 A;  3B7C A;  1NB3 I;  2RGQ A;  1W2Z A;  1CQS A;  5D83 A;  5KP3 A;  1VQK 3;  2WO0 A;  1OPY A;  4ORL A;  4L7K A;  1A2K A;  3DGL A;  1K73 4;  3U1W A;  3MG1 A;  3F7S A;  3F7X A;  3KE7 A;  4CCV A;  1VQ7 3;  1O7G B;  3FG4 A;  1OHP A;  1W7C A;  1WMP A;  1VQO 3;  5JPU A;  3FKA A;  2ZL8 A;  5JBS A;  1DMQ A;  2K0M A;  1OAC A;  3Q2P A;  2XFT A;  1LOX A;  3CCS 3;  1EQK A;  4R9L A;  4LGQ A;  3LZA A;  3WOF B;  3NX0 A;  2CW9 A;  2FNQ A;  4HM8 B;  3G71 3;  3NQZ A;  5FW5 A;  2V1L A;  2F86 B;  1OGZ A;  3GZX B;  2XFS A;  4MMZ B;  1TUH A;  4O3V A;  4O8S A;  1IVW A;  3FF2 A;  4EC6 A;  3LT8 A;  3K63 A;  2M7O A;  3UJM A;  4KFF A;  3JUP A;  2ML5 A;  3LOY A;  2Q07 A;  4HM7 B;  5LC6 A;  3STD A;  2XGN A;  3HX8 A;  1YJW 3;  3N54 B;  5G2G A;  3X41 A;  1N9E A;  1E3R A;  3K7C A;  4RNZ A;  5HGR A;  3K5T A;  4IT7 A;  3SX1 A;  1FGT A;  4NRE A;  3CNX A;  1STD A;  1NO3 A;  1WQL B;  2CKF B;  4MMX B;  1KWI A;  3KZT A;  3UL6 A;  3MWZ A;  1DVC A;  1JRQ A;  3CME 3;  2BHM A;  1DVD A;  1IV7 A;  1QAK A;  4OUQ A;  4GB5 A;  3TDG A;  1RJO A;  3EE1 A;  3NXJ A;  1FUW A;  1K28 A;  1QJG A;  1UUW B;  4WHA A;  1RRL A;  2YX9 A;  3CXC 2;  2Z7A A;  5IG3 A;  5BXQ A;  2W56 A;  2MC8 A;  4HM5 B;  2D42 A;  1VQ8 3;  3HIG A;  1U5O A;  3OWS A;  2HMM B;  1EG9 B;  1W00 A;  8CHO A;  1OHS A;  3FH1 A;  2KRT A;  3EC9 A;  1OF5 A;  3CNM A;  2ML6 A;  5FGO A;  1EA2 A;  3B8L A;  4X2O A;  5IG4 A;  4R4K A;  4CDL A;  3F40 A;  1MOL A;  3DZL A;  3T8N A;  4FMA A;  2YFI B;  3WMD A;  1STF I;  2BNG A;  1GY5 A;  3GRD A;  1HU9 A;  2W9Q A;  3JUM A;  1YVB I;  1GD3 A;  3HK4 A;  1O7N B;  1AVK A;  3VGN A;  2IA7 A;  4RNY A;  4BTW A;  4NHF A;  1QVG 2;  1L5G B;  1KC8 4;  3NUV A;  4MMY B;  3L0R A;  3UNL A;  3OV4 A;  5AI1 A;  3KSP A;  1JKG A;  1SPU A;  1PU4 A;  3ECF A;  4HM6 B;  3OWU A;  2D1W A;  4XBX A;  3J7Y d;  2I9W A;  2KXG A;  3WA2 X;  5IF6 A;  1GD4 A;  1SQW A;  3FCS B;  3PGB A;  1ASK A;  2P0X A;  1A90 A;  1D6Z A;  1IDP A;  2GEX A;  4FCJ A;  4R80 A;  3FG1 A;  3PYJ A;  2HMJ B;  2XH9 A;  3X3Z A;  5A0O B;  1KD1 4;  1GS3 A;  3IMA B;  3S28 A;  3GZR A;  2LQV A;  3NM2 A;  3VF1 A;  4R1K A;  2O3O A;  2GU1 A;  1OF5 B;  3GZB A;  2B24 B;  3EBY A;  1N8R 4;  3PZW A;  1UW1 A;  2HMO B;  3ALA A;  5CXO A;  1E97 A;  2OQE A;  4PEJ A;  3GAX A;  5AYR B;  5CLK A;  2WGQ A;  3DGO A;  4I4K A;  2QGU A;  2KCD A;  5JPP A;  2E2U A;  5EEO A;  5ELU A;  1DMN A;  3LT9 A;  2Y74 A;  2PZV A;  4XBT A;  2W9P A;  3SOY A;  1TFK A;  3LYG A;  3NQY A;  3VSY A;  1W01 A;  3LXU X;  3QK9 A;  5AYS C;  4KZ1 A;  3X3X A;  3KII A;  1JKG B;  1CYV A;  5D81 A;  3PCS A;  2XSO B;  3BND A;  3AMO A;  1IVX A;  3CCJ 3;  2BO9 B;  3O8Y A;  3FSD A;  3U97 A;  2OCT A;  2MF7 A;  4OVM A;  1QAF A;  2WOH A;  3DY5 A;  3T0U A;  3I56 3;  2K54 A;  2XRX B;  3CPW 2;  2CK3 H;  3EQQ B;  3HZP A;  1US1 A;  2CFG A;  1FGO A;  1LNH A;  1BUQ A;  5LC7 A;  4HM0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...