2QGUA

Three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
ADAQATVKTAVDDVLATIKGDPDLRGGNLQKVFQLVDQKIVPRADFKRTTQIAMGRFWSQATPEQQQQIQDGFKSLLIRTYAGALANVRNQTVAYKPFRAAADDTDVVVRSTVNNNGEPVALDYRVEKSPNGWKVYDINISGLWLSETYKNQFADVISKRGGVGGLVQFLDERNAQLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the phospholipid-binding protein from Ralstonia solanacearum Q8XV73_RALSQ in complex with a phospholipid at the resolution 1.53 A.
rcsb
source organism Ralstonia solanacearum
molecule tags Structural genomics, unknown function
molecule keywords Probable signal peptide protein
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05494 MlaC MlaC protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A phospholipid-binding protein 2qguA02
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qguA01
1JKGA 3GZXB 3EQQB 1DMQA 1IDPA 4WYKB 3K0ZA 5D82A 1Q42A 1JKGB 1K41A 1QMAA 2F98A 3UJMA 5DRVA 3EBYA 1C7HA 2STDA 4XDWA 5CK6A 3WMDA 1JB4A 4HJLB 4HKVB 3BB9A 1GS3A 1Q40A 3FF0A 4HM3B 2GBWB 3H51A 4HZ9B 3EF8A 1VZZA 3H3HA 3FLJA 1EG9B 1NU3A 3GZBA 1W6YA 3OWYA 4WP5A 4Q53A 2GEYA 3FGYA 4FCJA 4XDVA 3JUOA 3T8NA 3G0KA 3NM2A 4L8OA 3DMCA 4XBYA 3B8LA 2XSHB 4XM4A 4PEJA 5JPUA 1SJWA 2GBXB 3KSPA 2Z7AA 3HX8A 1TP6A 3F7XA 3OXAA 2HMKB 3NUVA 2XR8B 3OWUA 5AIHA 3S5CA 1NDOB 2OWPA 3OV4A 5AIIA 5DREA 2GXFA 3DM8A 1ZX2A 3F7SA 1GY6A 4MJDA 4LEHA 1WQLB 4GB5A 5BXQA 3FH1A 1BUQA 2B1XB 3I0YA 8CHOA 3F9SA 3FKAA 1E3VA 2CKFB 3KE7A 5KP4A 2RGQA 3CU3A 5AIGA 4CDLA 3GZYB 5G2GA 4WYKA 5AEUB 5CF1A 2F86B 2R4IA 3F40A 1GYBA 3G8ZA 4OUQA 1ISKA 1OUNA 4HM0B 4XBXA 4HVNA 3EHCA 1OCVA 5IG0A 2INXA 1JB5A 3B4OA 2HMMB 5HGRA 1ASKA 3EBTA 2RFRA 3ER7A 3UNLA 5KP1A 5KP3A 3SOAA 5EVHA 1S5AA 1ULIB 4HM2B 4K1UA 4HM7B 3EN8A 1GY5A 2BMRB 3OX9A 3OWSA 4HM4B 2BNGA 1OHOA 3EJVA 2CHCA 3HZPA 3IPTA 3D9RA 4J9AA 2YFIB 1O7NB 3MG3A 4HM6B 3NBRA 1JN5B 1OF5A 3DXOA 3B7CA 3LZAA 5JPPA 2XSOB 4HM8B 5IG5A 1ZO2A 3A76A 1JB2A 1OH0A 3GZRA 4H3UA 3CNXA 3VGNA 5IENA 5STDA 3M8CA 1ULJB 1TUHA 1O7MB 2HMJB 2QGUA 3MSOA 3GRDA 3MYTA 1U5OA 2K54A 3SOYA 3EN1B 3STDA 5CLKA 4OVMA 3NXJA 4L7KA 1O7GB 3KZTA 2A15A 2JQ5A 3T8UA 1W00A 1OGZA 4XBTA 5IEOA 3JUPA 3MG2A 1O7HB 1CQSA 3NHXA 1GY7A 4I4KA 4J8TA 5IERA 3B4PA 3GWRA 5D81A 2HMOB 1OHPA 3MKIA 5AEWB 1O7WB 1UUWB 1E3RA 2UX0A 1STDA 4KVHA 4XB5A 4LMIA 1EA2A 4HM1B 7STDA 3CPOA 3FF2A 3Q90A 1OGXA 4HM5B 5IG4A 1A2KA 2I9WA 1Z1SA 3JUMA 5D83A 3RGAA 4WWUC 4X2HA 2Z76A 3KKGA 1AR0A 3LYGA 2XRXB 3NV0B 1NWWA 1Q40B 3NV0A 5CF2A 1W01A 4IIAA 3ECFA 4ORLA 3BLZA 1OHSA 2HMLB 1OPYA 1W02A 1DMMA 1QJGA 3HK4A 1UUVB 3EC9A 3MHEA 4K1VA 2Z77A 2BMOB 4N3VA 4RZMA 1HKXA 6STDA 4STDA 2W2CA 2RCDA 3F8XA 4HZBB 4R9LA 3JUNA 5IF6A 2BMQB 5BVBA 3K7CA 1JN5A 1OF5B 2GEXA 3EX9A 3FSDA 3SEDA 2B24B 3RGRA 5IG3A 5IEPA 4FCMA 2YFJB 5AIFA 3JUQA 1DMNA 2YFLB 3DUKA 3F14A 4LGQA 4R9KA 3F8HA 1O7PB 3CNMA 4L8PA 3ROBA 3G16A 5CXOA 4U13A 3DZLA 5AI1A 5TGNA 2F99A 2HMNB 2IMJA 2PZVA 3E99A 3MG1A 4X2OA 5FW5A 3VSYA 4R1KA 1E97A 2QIYA 3FZWA
chains in the Genus database with same CATH superfamily
1SARA 3DGYA 3EQQB 1CH0A 3HKZN 3TOAA 1GDTA 3MCZA 3K70C 2HR3A 1NH3A 4RB0A 2EJRA 4UY8I 4G12A 3KZYA 1YIT3 3J7AY 3IH3A 3ESWB 4XKWA 3EF8A 1JKQC 1RKWA 1Z0XA 2E7XA 5DUKA 1UCJA 2KF4A 3CCR3 3GWZA 3L0RA 4O2HA 2GEYA 3FGYA 3T8NA 2DMUA 5KNLA 4DBRA 2DOFA 2VC0A 3ZQQA 2UWMA 1YGWA 2F5MA 3SXYA 4BGDA 3SZTA 2IY2A 3SZGA 1GLNA 2JRTA 2ZXIA 3NUVA 2XR8B 1BIRA 3K0LA 3PNVA 4KDPA 3F7SA 2EA2A 5LD2C 3I0YA 1BNIA 1R49A 4ZDOA 3CCV3 4N6MA 1YJ93 3QPLA 3CJQB 3F9KA 1TWCJ 3I553 2XV4S 3I0TA 4BIRA 3HIGA 1VTNC 1FYKA 4N9IA 4E70A 4RLFA 1GYBA 3QYEA 3QRDA 1ZKGA 2ZJRF 3EHCA 2V1UA 1EA3A 2O8XA 2W48A 5F27A 2EFWA 3DQVC 3C3WA 1OACA 4HDUA 3UL6A 2UXXA 2P0XA 1VQP3 2RV8A 1QPIA 1LNWA 1S6LA 2HKXA 3F8CA 4DZPA 2JT1A 4XQFA 3TP3A 4G94A 5DTDA 5ILVA 3F22A 4BE0A 4AC0A 4U7BA 1S72I 1FSHA 1MOLA 3NX0A 2DYRH 1JN5B 2E2UA 5KCMA 2I8DA 3GO5A 2R93J 2QA43 2UV1A 1MNEA 1H9TA 2IGNA 1VNDA 1OH0A 1A67A 1XDUA 2H1LA 1UFMA 4MTEA 1BOXA 1YS6A 4CO8A 1MWRA 2GAUA 2B7EA 3B73A 1KWIA 4FE4A 3B02A 2VQLA 1WPKA 4O8SA 1O7GB 4F52A 3CMAI 3BJ6A 4ZC3A 2KF6A 1RRLA 2VI6A 2Z3YA 4II2A 2STWA 3LSIA 1LOXA 3FF5A 2DI3A 4MFEA 3RTRA 5TJJA 2FMYA 4G9YA 4XB5A 3L2WA 3K2AA 4MLOA 3A01B 1OYYA 4Y3OA 1HSJA 5FKKA 1LOWA 3R6SA 3P9IA 3IL2A 5D83A 1NO3A 2NOJB 3X41A 1BNGA 2W56B 2W4SA 1U6GA 3W6VA 1IU7A 2QM3A 2HMLB 3S67A 4DNCA 1D6YA 4YIIA 2Y9YA 2WB1N 2EB7A 1BU4A 3ERED 1JTXA 4B47A 2GEXA 5ILUA 3F8MA 2NYXA 2FXTA 3TO7A 5HS7A 2K85A 3I59B 2F5CA 2UXNA 2OZUA 1OCZH 4J00A 2P0MA 5EF6A 4B3XA 3OYKA 1N9JA 2CWTA 4WFOA 2P38A 1I27A 1RESA 3I53A 1FMWA 3CCQ3 3KFWX 4EM1A 2PQ8A 2VKHA 3WG7H 2XAGA 3FZWA 4GSPA 1UI8A 4LIUA 3AMOB 3Q3FA 2F98A 2D1WA 2OCEA 2HQNA 1MZBA 6GSPA 2CX1A 2A69F 3CJRB 3BB9A 5F0CA 2GM4A 1GS3A 1QVG2 4KT6A 5IT9Z 1NK3P 3GTMJ 1E17A 2W9QA 5BQTA 1NU3A 4M3BA 1TL8A 3BTCA 5LGTA 1GVDA 1STZA 4WP5A 4ZZDA 1VQ73 5ICEA 2OTL3 3NBJA 4QTRA 4JX6A 1K78A 3NWSA 4RGUA 1HW1A 3K4LA 2H1KA 3KP4A 1DUXC 4CYCB 1VQNI 2NOGA 2HPIA 4W97A 1U0JA 5M5XJ 2RVCA 1MSEC 1TRPA 1WQLB 1RJOA 6PAXA 3SFZA 3G2BA 1VQ5I 2KRCA 3BC8A 5ED4A 1ETOA 2VIXA 4ZTFA 2IA1A 2XSJC 1VQN3 4CDLA 3GZYB 4BL0B 2BO9B 4KICA 5HLTA 5H2FC 5IP7J 2HOTA 4OIPF 1Q814 2PMHA 3G1LA 4Y15A 1YLFA 4AWXB 3TW7A 2CUEA 3L00A 1ZG5A 3DU5A 2BXYA 3KX2A 1NNVA 5A0OB 1NHAA 1JKRC 4NBQA 4KN7X 4N6V0 3J81Z 2CV2A 1R1TA 4BTYA 4UV8A 5B3SH 4PJMA 5FRNA 1FLIA 5HDKA 3I4NJ 1FGMA 2XKOA 1GY5A 3W3CA 2Y30A 2CV0A 1FPQA 2BYVE 1IUFA 2BHZA 4ZJZA 3EJVA 4B8XA 2HWVA 3F23A 3B6CA 1TWHJ 4I02A 5D6FA 5DD8A 1BOAA 2H6BA 1U8RA 1JB2A 4UB8C 1GHCA 5IP9J 3GVAA 1ULJB 3HG9A 1O7MB 1KU2A 2ZNZA 2DK8A 5E3NA 1JBRA 1GV2A 5L3FA 2GZWA 3S1NJ 2KDZA 3HEFA 2FQ4A 3RKYA 2A6EF 1I50J 3HZJA 3GTKJ 4N0BA 4BTWA 4YFKF 2A6HF 4IEJA 3TL4X 1KONA 2QQ8A 3CCVI 1SQWA 1BNRA 2CQNA 3MKIA 2A5WA 2RNJA 2EFOA 3K6GA 4LGWA 2K9MA 4JRFA 1EA2A 3SX1A 1U5TA 2KJBA 3WE2A 3LSTA 1K7AA 1N78A 1FGTA 2ML5A 2F4OB 3Q90A 4MEYF 1KZHA 1R5GA 1TQPA 1AR0A 4Y4RA 1LUJB 1A04A 3A4CA 3U21A 1PP7U 1UG0A 2OCCH 3HBLA 1UHMA 4R80A 3V7SA 1WFXA 3LSGA 1RTUA 3MHEA 4N3VA 6STDA 3K4BA 3CCJ3 3V98A 1XCVA 3AFHA 2K02A 3DEEA 4M6VA 4A0YA 4R9LA 5BVBA 1FSEA 1G3WA 1YITI 2PI0A 5D4SA 1HW2A 2CWEA 1Z9CA 4EJTA 1WMOA 3OYJA 2DJIA 4LYLB 2FUG2 3LTDA 5IG3A 5FB2A 1BSBA 1EH6A 1R4CA 2H94A 4ZH4F 2ID6A 4R9KA 2L7ZA 3G16A 4II3A 3V7RA 4ESBA 2E35A 5AI1A 1IXSB 2IMJA 2E1MC 3C1DA 4EJOA 3LTCA 1VQ93 1ZREA 1E97A 4MMZB 4MMYB 4HX7A 1DMQA 3K0ZA 4XICA 1QMAA 2L4VA 2LFBA 1D0XA 2XUBA 3BU4A 2FBHA 5CK6A 3N05A 1S8NA 1JBSA 2G7HA 4HJLB 2ESHA 1IVWA 4B44A 3E3VA 3HKZA 3K9TA 1VQ9I 2W6JH 2HDDA 2WAQA 3FG3A 4HV5A 1IVVA 4G6QA 2FBKA 1OR7C 3LSRA 2E2JJ 1AU7A 5B66C 1FYMA 3MZ8A 1HXDA 2W85A 2WWYA 1IN8A 2GIZA 1LB2A 1T5YA 1IRXA 1T33A 3FHZA 2JRMA 2HOSA 3GZ5A 4PSXA 2GLOA 5K5QA 4M73A 2HMKB 4KZ1A 3O6BB 2OWPA 4RGXA 1B72B 4EGYA 4ESFA 4LEHA 1HZ1A 1BM9A 1IV9A 4RNTA 3GW2A 2BT3A 1T3BA 1R7JA 2BHMA 1TWFJ 4L9NA 3REOA 1XG1A 1KU3A 2KCDA 4CCJA 1ULYA 2VB6A 2OBPA 4P1WA 3FG1A 5GTIC 4EC6A 4UNOA 2ELKA 4BUPA 2Z33A 2HI3A 1F9NA 1YIJ3 2XGDA 4AVZA 4IF4A 2PJRB 3ML6A 3CCM3 2CU7A 2XDVA 3TGNA 1ZRDA 2FQ3A 4R4KA 3SVAA 2X48A 3KLOA 5TRDA 4EJUA 1G02A 2JK3A 3QYBA 2QBYB 2H27A 4CICA 3IP4B 1T38A 1ITYA 3OYMA 1K9M4 2VC1A 1CQTA 3U97A 3VYRB 2M9HA 3H9GA 1X58A 2LNBA 5DCMA 3GZRA 2E7WA 1AHDP 3N8BA 3OL4A 5CQEA 5DS9A 3LL7A 3ZMTA 3HOZJ 1R4YA 2CFLA 2O9LA 4LLNA 2BV6A 3FXOA 2XAQA 4OMYA 3E6MA 4MQVA 2A15A 1U9NA 2DBBA 3CUQC 1LFPA 2HDCA 3MG2A 4RMNA 4IPBA 4BBSJ 2OQEA 1G0TA 2EV5A 9ANTA 2Z1DA 1N75A 2Y31A 2KIMA 4RAFA 4RM3A 4G6TB 1R71A 4H0EA 2LREA 4GRIA 2P6TA 4PFPA 1OQYA 3ZCOA 2V6CA 2ZMEA 3LSMA 2I9WA 3ZQFA 2J8XB 2FA5A 2E36A 3Q5FA 4NPBA 1TT0A 1TWAJ 4AM3A 8RNTA 3DF8A 3IH4A 3M1EA 2LY9A 1B2ZA 2VKEA 3SQNA 1AVKA 2EA4A 1H9GA 2KL4A 4RZMA 1Q824 2HFHA 3NRVA 3L7WA 5JHFA 4W1UA 5GPCA 2KF3A 2F48A 2MSYA 1RKTA 4FMDA 2VOOA 1RN7A 4E7IA 5CVVA 2MH9A 1FC3A 1QZEA 2TRTA 1R58A 2JA8J 2KRFA 1DYUA 2CUZA 4DYCA 2YFLB 3OYEA 1B3SA 1G3TA 2FGTA 4RAGA 4Y52J 4F93B 2X4HA 5ICCA 2F99A 4M3EA 3I4PA 1BI0A 4V2FA 3H0DA 3S29A 5D82A 2KPMA 4G8XA 1Q9EA 5L3DA 5LHGA 2XF6A 1X1WA 2VBZA 3Q1CA 1FIAA 2V9PA 2VE9A 1C7HA 1T2HA 3QAHA 3OYGA 1VF9A 3AG4H 2OAZA 2R5YA 1YS7A 2HYGD 2WOHA 4D7NA 1WJAA 2X6WA 2VJJA 1VQ63 2L54A 2DJNA 4HNVA 4WHAA 3MPHA 2IT0A 2BW3A 2Z16A 2CW9A 4U7DA 1BRHA 4RB3C 4Q48A 2M30A 3VYUB 1FZUA 2VQGA 4JX4A 4EV5A 1UCIA 3LA2A 2LQVA 3KSPA 4RNYA 2M87A 2WY7Q 4KJZA 1IQ8A 3DEWA 1JHFA 4A93J 2Z6BA 1OYWA 3FH1A 1WGXA 2E5NA 5FLXZ 1MW7A 4IQJA 4A3GJ 3FCSB 1BSEA 2D1HA 3LT9A 1DU6A 1B6AA 1QO0D 5AIGA 2DMQA 4Y7NJ 2B63J 2R4IA 3WHOA 1NJI4 4A3KJ 4GGGA 2ECBA 2ELJA 2NVTJ 4HX4A 2GXFA 4O3VA 1I8VA 1Z77A 5EEOA 1J75A 3OR2C 1VQO3 2VKDA 5KVRA 5HGRA 1O3SA 3CLQA 3EBTA 1RGGA 1H89C 5J40A 1VQKI 1IG7A 5F0FA 4CHUA 1B21A 3SDBA 4HM7B 3OX9A 1HDPA 3LA7A 2XGXA 2IJLA 5BMZA 3DEUA 5LC7A 1U9OA 2DFHA 2P5LC 3PFYA 2XVCA 4UVBA 3FXUA 2M8EA 3RQ4A 4E4HA 1YIJI 3CD6I 1HA8A 2LYCA 1LKXA 2EIMH 3OV8A 1HF0A 3ABKH 3BPVA 3SOYA 1K4TA 5FROA 1U5OA 3UR3C 4CYDA 1RN4A 1D5VA 3CCE3 1KU7A 1P9QC 4MO7A 3CCS3 3VB2A 2BGCA 3WTZA 5E8GA 2ICWG 3RNTA 4FASD 4AKYA 1RR7A 5GTHC 3QP5A 1GY7A 2ZCWA 4J01A 1N5PA 3FXRA 1RDSA 2BIRA 4E7LA 4OMZA 2CFGA 3B4PA 1X1XA 1QGPA 4ILFA 3ECOA 3V8KA 3G713 3GFIA 3QOPA 1JNQA 3JRHA 3CCL3 4AU7A 5EG0A 1ZGJA 1OKRA 2FOKA 1RR8C 2R7ZJ 3OYDA 3QRFF 4YEJA 2CYYA 4QWQA 2R5YB 2WV1A 3ZQHA 1UDII 2O6GE 1TIJA 2ZJPF 3MZYA 4ENMA 3AHWA 3S1QJ 1U2WA 2LKPA 3SDGA 4M6YA 1IK3A 3J81K 3D4AA 3V4GA 2CFKA 1FBQA 3ERMA 1ZLJA 3U1WA 3X3YA 3KZIC 1FGQA 2RQPA 4PJ0C 2NVUB 1RIOH 2CIUA 5IEPA 3ZFZA 1IDYA 3ELKA 4Q4ZF 3JUQA 3FXKA 2JN6A 1Z05A 4DYQA 1V58A 4LGQA 1SVMA 2BY3A 2RREA 2E2HJ 4RM2A 1L5GB 4N6OB 4HX8A 1USSA 2PZVA 4WWCA 3JRDA 2V1NA 1W0TA 4NC8A 1IXCA 3GZBA 2O5RA 3K1MA 4HV6A 1VQLI 1JKGB 1K41A 5J4VA 1K6OA 2VL8A 2VOPA 2JUCA 4HYEA 2DTZA 1JB4A 3UKGA 2FNPA 1RPWA 2Y2ZA 2E71A 5J8FA 1OCCH 4ENKA 2GA2A 1JZDA 2IP2A 1YRNB 1MBJA 1A2PA 3DWLE 3HC7A 2X6XA 1RGKA 3CP8A 1MGWA 1JRQA 3OWYA 1AKHB 2PG4A 1XDSA 1MIJA 4RDUA 2DA7A 1V74A 1IVUA 1SIHA 4M72A 4CH7A 2IRFG 2CQQA 1X1AA 1OYIA 2MW8A 2CC3A 1LE8B 1SD4A 1YJW3 1MJAA 3ZN1A 1R23A 1BGSA 2JWTA 4GB5A 2VJ4A 1F5TA 3VSLA 2VBXA 5F0HA 2VT3A 1LVNA 3KCCA 4ON0A 3OL3A 1VQM3 2GBYA 3JAMZ 4CCNA 5KP4A 3CU3A 3WHBA 1XB4A 3GXOA 1ZG3A 5DCMB 5AEUB 3BG5A 4ZYDA 2AO9A 4GL6A 1MBFA 3RDEA 1LPQA 3SYTA 1N9EA 1M1K4 3OSGA 3PCRA 4XLEA 2QBYA 2YS9A 2EIJH 3PQJA 4F7ZA 3S15J 3DKWA 4QPQA 4RGRA 2GWRA 4BL3A 1RGHA 2ZA4A 5LRRA 2FSWA 3S93A 2CH0A 1OHOA 2CHCA 3HZPA 1GD4A 2H8WA 3LMMA 3BR0A 1PVEA 2CG0A 3EE1A 2KDOA 3ZQLA 1S5LC 2F6CA 4NHJA 1I3IA 3SXXA 2LY1A 3PQKA 3L9FA 5STDA 2IW5A 2D42A 5L3BA 1TUHA 1YX3A 1EF4A 4LK1F 1DDNA 3I3LA 3M3YJ 4IXAA 2BBYA 5CLKA 1FT9A 2M1BA 1K4SA 3DLAA 1B72A 1MJ9A 2W1OA 4LMYA 3L2RA 2ME0A 1NTCA 3KIOA 1K6YA 1UELB 2L0KA 3K4MA 1XS9A 4J8TA 1DGRM 1ODDA 2WA0A 4NC6A 5C44J 1UI7A 1VQQA 5BU4A 3RIRA 1M1XB 4FMBA 4LMIA 4A3MJ 3H36A 4HM5B 1JTYA 5DEQA 2VJ5A 1YTYA 4N6LA 2PMUA 3KEQA 2M5WA 4I76A 5KAFC 5BPDA 1QU3A 4I2OA 4NDLA 3TOBA 3AHSA 2KRHA 4BXXJ 3DV8A 3Q0VA 5F08A 2PMZA 4IO9F 2BMOB 1R4NB 4MEXF 1YHQI 3KEOA 4YRVA 4UV9A 3MKYB 3I4MJ 3X42A 5HOOA 2DW4A 5CVUA 5FD5A 1WRJA 5EEHA 2XAHA 3ZMSA 1DPRA 5D8KB 3D5LA 2XFSA 1DMNA 1QPMA 4A6DA 4BL2A 4K90B 2QQ9A 3B6AA 3QU3A 4U13A 3MD2A 4OIOF 1BW5A 4ABZA 3Q9SA 1LJ9A 4OAYA 4IX7A 2CQ7A 1X2NA 2YUSA 1Q1VA 3AGNA 1DQUA 4C3IJ 3N4MA 4GXOA 4CPKA 4KFDA 4C2TA 4A0ZA 4P96A 4X0GA 1OJLA 1X1YA 2V26A 4M74A 1HSTA 3DKXA 1BR4A 2IAIA 2ZJ2A 1MGRA 3A5EA 2QKMB 1JGSA 1TFOA 3H51A 4HZ9B 1X4OA 3ZRGA 5HODA 1RKYA 1BIAA 1EKEA 4HSRA 3KFQC 3K7AJ 5J8CA 1X1BA 1LFBA 3JUOA 3OYLA 1FW7A 4FETA 2EILH 1SVOA 2GA1A 4AIJA 1RGAA 2Q2EB 2Z99A 1VI0A 2PX9A 2ZSHB 2MGQA 4YIFA 4BDZA 5K1YA 3FK6A 2ZBKA 1BRGA 4H61A 2E60A 5RNTA 1E0EA 4MNUA 3VFZA 4KITB 2XH9A 4WCGA 3S2DJ 5J3LA 2L1SA 3O2PE 4F92B 1QAFA 2G9WA 2MA3A 5L3CA 4A5NA 4KMFA 2A68F 2EZIA 4F91B 3T0UA 2G7UA 3QODA 4IKFA 3V92A 2WAEA 3CTAA 4I6ZA 1LQ1A 3OS2A 1WMNA 3KEYA 5DM6F 1MNDA 2INXA 1JKOC 3AL0B 4OIQF 1GOYA 1RGLA 5G1KA 2PNCA 2LC2A 1ULIB 1X4PA 3F8BA 1QHHD 4XN3A 3EB8A 1Y39A 4HM4B 4J9AA 4IJAA 3VWBA 3CMYA 1TQMA 2EZKA 4BYYA 3A02A 1A35A 1D6ZA 2CH9A 1V55H 3VPRA 1G6NA 1JKPC 4KISA 2LK2A 3GYHX 2AHQA 2R4GA 1XMKA 2JA5J 1JZOA 1ROAA 3DKYA 2IS1A 2XRNA 2RNTA 1FGRA 3ALAA 4XBFA 1M1EB 4BJ6C 4L7KA 3SLUA 2KIFA 5EGOB 2Y69H 5FFZA 3BG7A 3F21A 2E1CA 2L9NA 4EJVA 3DGNA 2B0LA 1S7OA 2XGLA 1LVAA 3GWRA 3D1NI 1IQYA 3DPUA 4HNUA 5D81A 1WKMA 2RN7A 2CW0F 1IW7F 3DH2A 3AAFA 5M1AA 4LOCA 5HLHA 4HF0A 3IKTA 3JSOA 2FBIA 1XX5A 2KZVA 3GFLA 3CD63 2A3SA 3C2GA 1S29A 2XGNA 3D5IA 4BBRJ 2AAEA 4IIAA 4EEFG 1A6IA 1B4AA 2K7LA 1T39A 4N4NB 1HDDC 1I39A 4BHCA 1RNLA 2LKSA 1QZZA 3A1YA 2STTA 1O7LA 3OY9A 1VQOI 4FCMA 1MMNA 2JJ7A 4XONA 2X1DA 2ZKZA 3ZG0A 1RSNA 1HW5A 1T0FA 3MFKA 2PJRA 3G1OA 3QPHA 3G71I 2ESNA 3I59A 3BR5A 4X2OA 3MVPA 5M5YJ 5ICFA 2ZB9A 1T98A 1IJWC 1J2BA 1YX5A 1RGEA 1BW6A 1F4KA 3KLNA 5DRVA 1RLSA 2LY2A 3WODF 3DGLA 3BR3A 3F8FA 2XROA 2WGOA 1T95A 1Y8RB 2VKVA 3VYTB 5IOZA 1HBXG 1DVDA 5GADJ 3BR6A 2ZFUA 4XSZF 3KP3A 2HTSA 3H0GJ 1O3RA 2TDXA 3HOYJ 3S14J 5H6RA 1FWZA 4DGWB 2MBFA 4B1RA 4B43A 4EW5A 3A01A 4KIBA 4EVIA 5KP1A 1ZYRF 3TEDA 1MWTA 4Y33A 2X85A 3DBRB 1WQ2A 1XPXA 3Q9VA 1N8QA 2DFEA 4LLGF 5C4XJ 3S5CA 2XPUA 2DPDA 3PL8A 2A6TA 5DYMA 4BAYA 4LB6B 1ROVA 3HUGA 1R00A 2L4AA 1BRSA 9RNTA 5FO5A 1TZLA 5LC6A 2VT2A 1LEAA 2F5VA 3E6CC 2KMUA 2W84A 4JX5A 1CGPA 4BNCA 2ZHXB 4AUXA 3HRMA 2LSOA 4BS9A 2PLYA 5LEJA 3FBNB 3BG6A 3PGBA 2FD5A 3TDUC 2WOFA 4XBXA 1G4DA 2RSXA 4XK4A 2XSDC 1PUFA 4A3CJ 3OOUA 4LLLA 1SPUA 4A0XA 2K86A 1D5YA 3ZR8X 3I58A 5IT3A 2VUMJ 1TWGJ 2KQRA 3HJEA 3GCMA 3L09A 1E3HA 4UB6C 5EVHA 3FM3A 4KIGA 2HOHA 1GT0C 1QBJA 3VGNA 3OWSA 1TTYA 5FD6A 2E1NA 4V2GA 2Y74A 4BQQA 5FKOA 2GXBA 1SIIA 3GEZA 3B7CA 4C3HJ 2XSOB 2VBYA 5IW9A 1D1BA 3F72A 2IPQX 3R60A 2EPFA 1UGHI 2JZYA 5IENA 2VQCA 5E3OA 1FZPB 1LXEA 3JTHA 4BU2A 1T8IA 1T2IA 3MSOA 1D0ZA 3FIWA 3KP2A 3PS8A 5B5EC 3PXMA 3IKVA 2DCEA 2R7QA 2BY2A 1W00A 4LD5A 4XBTA 1SD5A 1U5TB 3EQLF 3QOEA 1OHPA 4I0BA 1V5GA 3M4OJ 3M7GA 2P8TA 2UUZA 4A3EJ 2R92J 1VZ0A 1ZN2A 2CRGA 2CG1A 4YFNF 2KIUA 3H9QA 2KF5A 3H5RA 3HUGB 1BN5A 4F55A 4LB5A 1QJGA 1IN6A 3CDLA 1BC8C 4D5FA 1VQ6I 2ZXHA 4DBQA 5IF6A 3FHNA 2BMQB 4PGGA 1ONVA 1D3YA 3PSFA 3T5XA 5IY5H 3HOUJ 2JTVA 2GOMA 2CQKA 5D6EA 3V7CA 1S7EA 4Z6YA 3ZG5A 1XMAA 1LFUP 4R1HA 3KETA 1DE3A 1ISKA 1W2ZA 3K4KA 4J5KA 3ZMUA 4ZYGA 1IO2A 1Z3XA 1I3AA 3J7Yd 1V5EA 2NVXJ 3E99A 4R1KA 4A3IJ 1K28A 1RRHA 3S17J 1OPCA 3K1NA 3HRTA 3LOYA 5F04A 2IA2A 4FR9A 1UB9A 2OF7A 1RUOA 1JT6A 5HS9A 4Q5SF 5E18F 5K7FA 3IJEB 2NNYA 4AIHA 2EK5A 2HZDA 5DUIA 2IYJA 5J4YA 2BXZA 3ECHA 3ZQ7A 1ON1A 3PIOF 5DDGA 1V3FA 4XL9A 3D3LA 1MNMC 3BTJA 4U87A 1VQMI 3WGHA 5CPRB 2HQ5A 3BG9A 1K78B 3OYHA 1YJ9I 2X1EA 3BQYA 1PY3A 3URPA 3M1CA 4NUBA 2O9UX 3OW22 1XGMA 3F7XA 4A69C 2VLAA 1YGEA 5EYRA 2X51A 1W4MA 3AG3H 2COMA 3WHCA 3J7AO 3VYSB 1U78A 1JV2B 3UNGC 5HNFA 1RGCA 3ZQGA 1T0FC 3IV5A 1BRKA 1ENHA 2B1XB 3PNYA 2DMNA 4HF1A 2H09A 3BQZA 1RHLA 1B2XA 2IUJA 3ULQB 2WB1A 2K9SA 2JSPA 3E5QA 4Y13A 1MGTA 1WZ2A 4OU0A 1OMIA 1WMPA 1FP2A 2AQEA 3D0SA 3KYDB 1JBTA 1GMRA 3M8FA 1EEJA 2G0EA 1LQGC 2R7DA 3WMDA 3JW4A 5EEAA 1OFCX 4PK4A 3NQYA 2LYXA 4U0VA 1J7KA 3WTTC 3A76A 1D8JA 2I10A 4CCLA 1W5SA 3Q0WA 4XRSG 5F1JA 1SVLA 1MWSA 5DD4A 1L0OC 2COBA 2XGEA 1P7JA 2QGUA 2YSRA 4YFXF 3CZ6A 2HMJB 3KP7A 5D4RA 1Z7LA 2Y48A 3GUDA 3VODA 3ROUA 3SHFA 3EUHC 3K2ZA 3CDHA 2Z5UA 1TBXA 1ZAOA 1TJDA 2XFTA 2WBMA 1AQZA 1R4MB 5AONA 2CFXA 2DA6A 3IRQA 1YJNI 1UW1A 2UGIA 4KVHA 4CDGA 1BOBA 5JVTA 1VQ83 1ZG1A 2MABA 2P6SA 1LNHA 3M8JA 5HS8A 3WODG 3JRAA 4N6TA 3HPHA 5TISC 2BU4A 1IT7A 3KKGA 2CK3H 2SARA 3K4NA 1SD7A 3BT9A 4A3JJ 1Z67A 3DFGA 4WK8F 5FRMA 1DMMA 1BBYA 2Z77A 2L7KA 3M07A 1IN4A 2XRLA 3NEUA 2K3DA 4XIDA 2PEXA 2Q2EA 3U9GA 1JN5A 3EX9A 4XLAA 4EMSA 1G3YA 4K2EA 3SEDA 4RNZA 2EFPA 5DCFA 4MHGA 4A3BJ 3HOWJ 5HOHA 2DA2A 3RKWA 4JOMA 3HOXJ 5AIPA 3LMLA 2W82A 4CUGA 1NG6A 4DQ2A 3FXJA 3KYLA 3CC2I 5FGOA 5ICGA 4P55A 3BLYA 4E7HA 1IDPA 1SAUA 2MF7A 4IRGA 4IPAA 2C11A 3PJRA 1TFKA 4HKVB 2V1DA 3EETA 3J80Z 4ZTJA 5BIRA 1TU5A 1D0YA 3CC23 2JVGA 2R7XA 2CW7A 2LVSA 1GVJA 5KAIC 1KYWA 5EJCA 3GSPA 1IRZA 4ZDLA 2HXOA 3FMSA 2K4JA 3MEXA 4ZM8A 1HQCA 1FBUA 1ZELA 3EYYA 3IWFA 3NARA 3LT8A 3S3MA 5AYRB 2CG4A 1PUFB 4ETSA 4L8OA 3SFIA 2QYOA 2CW8A 1IZ1A 4AYBN 1SJWA 1P4AA 4M71A 3HX8A 5D5WB 3OXAA 5ELJA 5C3EJ 5AIIA 2X1CA 1S723 1MMGA 2ECCA 1BL0A 2OJED 1DGWY 2NVYJ 1HCRA 5IPAA 1W6CA 3PO3J 1FTZA 2PBIA 3HRUA 3J7ZI 8CHOA 1GD3A 1R1UA 2HQAA 1HKSA 3NM7A 3DP7A 2DLLA 4AD9A 3WTVC 1Z7UA 3ONQA 4FCZA 3WA3A 4ENNA 1X1CA 2IS4A 1BIBA 1TW3A 2K4BA 3U2RA 4HM0B 1OISA 4IQ4A 5HLIA 1OCVA 1SC7A 1YO5C 2DA5A 4CSWA 2LTPA 4PJLA 4CZZA 3DBHB 2VN2A 1N77A 5H20A 2R7SA 1NB5I 1G59A 2KIQA 2RAEA 3QPTA 1QVUA 2L3DA 4PFOA 4HQEA 3A2KA 1ZLKA 1D6UA 1J5YA 2BNGA 4M9XA 4BDYA 2Q0OA 1TC3C 1P6RA 3TO6A 2IA7A 1KQ9A 3FM5A 1WTHA 2CMPA 2K9NA 4D0PA 1ETYA 3IWZA 3T8RA 2SBLA 3EUHA 3LFKA 3GRDA 1YI2I 1GMQA 3EN1B 1W5TA 1ZR2A 1MDMB 3PIPF 1QVF2 1Z21A 4KYWA 2GIVA 3FISA 2AS5F 1FUTA 1X3WB 1CQSA 1KYZA 4I4KA 3L1PA 3BNEA 2F2EA 3RSNA 1F8NA 2HMOB 3IMAB 2NNNA 3BY6A 1V4RA 1YE9A 1UUWB 3AGOA 1H88C 4WXHA 2HVRA 3BG3A 2OOVA 1D1CA 3ZMDA 1PYVA 3FF2A 3DY5A 4R8HA 4WWUC 1G96A 4NHFA 2R7RA 1BRIA 1NWWA 1W01A 2HTJA 4ORLA 3VOEA 2IS6A 2V6EA 1B2SA 3CMEI 3EC9A 1EH8A 4I98B 5IYDJ 2XEPA 5KK1A 1IAWA 4STDA 2ID3A 3G3ZA 1WJFA 4LFUA 4EQQA 3CCYA 2B24B 3WR2A 1FYSA 1IQXA 3FK7A 2D2WA 3F3XA 4FTHA 4O3MA 3KN4A 4XRMA 3H3VK 2K27A 2CO5A 5EGOA 4LSOA 4I01A 4RBOA 3I9V2 3SEQA 4LG0B 5LEKA 4OIRF 1EJ9A 3BJOA 5FFXA 1N5HA 3JREA 1KU9A 1W5ZA 1QHGA 1TP4A 2QIYA 1JKGA 2YX9A 3ZP5A 4HBRA 2ZC2A 5GSPA 3CMA3 2OZ6A 2R41A 3BTLA 3JRFA 3C2BA 2CFWA 1FX7A 1LDKB 2E5ZA 2JA2A 2QSFX 3BPXA 3HYIA 1YI23 1I6XA 4PDKA 3RI4A 3G1MA 5GAGJ 2FNQA 1Q40A 4HM3B 2MC3A 4EATA 1X1DA 4DZJA 1X3ZB 3WGIA 1VZZA 1EG9B 3M8EA 1JXSA 1C54A 4BXUA 2KKOA 4Q53A 1PFPA 2NS7A 1CYVA 3W2WA 4IHSA 2QQAA 5JPUA 2J5OA 5CQGA 3FWEA 3B8LA 3OIPA 1MMDA 1ORKA 2IXSA 3HIIA 3TMOA 1VQ43 2AQFA 4XSXF 5AIHA 1P2FA 2EFQA 3FXMA 4RA2A 2KRTA 1S9HA 2Y0SA 2DQLA 2ZXWH 2YPRA 2KJCA 3A03A 4HQMA 2CKFB 3F0CA 4C2MJ 2FU4A 2RGQA 1VQ4I 2CUFA 1KA8A 5EG0B 2F86B 4OUQA 2XASA 2LP0A 3EUKL 3KP6A 1FMVA 2F5EA 4OAZA 1UCLA 5EQLA 1WI9A 4E6KG 2IVMA 5IYBJ 2K0MA 4M3FA 2NRAC 3B4OA 4BHPA 3TP0A 3UNLA 3H1CA 2UUGC 5CYVA 1S5AA 3KSED 1XCBA 1GOUA 3NQZA 2EBIA 1KSIA 3J80K 4ZYAA 1SMTA 1JI8A 1R6RA 2R7WA 1SFKA 5E17F 1ZO2A 1FP1D 3HHGA 1HU9A 3VDXA 3TBIA 2CJJA 3M8CA 3CCQI 3MQ0A 3STDA 3GZ6A 4HBLA 2NS8A 4DJAA 4HYZA 2CFOA 3FBIB 5M3FJ 1V57A 4M3GA 1IXRC 2NXNB 1U8BA 3MWZA 5D5VB 1Y56A 4I99C 5E1XA 4QIWN 1LEBA 5JHUA 1FGOA 2HDWA 2RBIA 2MLKA 5AEWB 1JUMA 3G6E3 3T0YA 1XTAA 5E20A 1REPC 1JUSA 4I5QA 2CV1A 1Z1SA 5EZHA 5BNGA 3JUMA 3IRRA 3KE2A 2M8GX 4X2HA 2OUMA 4AIDA 3R4KA 2Q1ZB 4LIVA 3X40A 3TQNA 2RC4A 2L2OA 2QUFA 1I6HJ 3HK4A 4FE7A 5IYCJ 4B3AA 4YG2F 4KNYA 2L7FP 2RQQA 3E5XA 1AOYA 4JYKA 2IGMA 1W7PA 5LGUA 1US1A 4K61A 1VQL3 1IYYA 1IGNA 4A3LJ 2OV7A 1RRJA 3JRIA 2ZL8A 4KFCA 1JJ8C 2M0MA 3CDIA 1APLC 4L8PA 3CF5F 3Q0UA 3PZWA 4P9UA 2VPLA 5BPIA 2MD5A 5LGNA 1H0MA 4L5JA 2HMNB 4OOIA 1XMXA 1Y0UA 5FW5A 4IZZA 3GMEA 3SYUA 1ZH5A 4B48A 4TX4A 3UJMA 2CSOA 2V79A 4JK1X 3IAS2 2DA4A 5AIQA 4KT5C 2RNGA 1MKMA 3TDZC 4ASNA 2WO0A 5K7ZA 2KT0A 3MN2A 3I64A 1K79A 4HOBA 5CJ9A 3KZZA 1Y0NA 3H3HA 1SMYF 2DOAA 3PSIA 2E1MB 2FX0A 3PUFA 3L2UA 5BS6A 5JLXA 4IT7A 1WH7A 2MFZA 3HPGA 3DMCA 1PJRA 3EPZA 2GBXB 4UUTA 1QAKA 3WE3A 4HAAA 3KPHA 1KQ0A 4XLCA 5TGTA 1TP6A 2LBFB 2DPUA 5DREA 5FJ8J 5A2QK 3TO9A 2EZHA 3QK9A 4MJDA 3ZXSA 4NQWA 3PYJA 4FQGA 4IHVA 3MKLA 2M7OA 1RETA 1BI2A 3F9SA 2BE5F 4FX4A 1YG2A 1E3VA 1I3FA 2CUJA 4L9VA 3OYIA 4CCKA 3W2VA 1LE8A 2K3FA 3J7YJ 3KIIA 3TDGA 3OOPA 1RNBA 1YW9A 3LQRA 2E2IJ 3CUOA 1AY7A 5CF1A 2DMPA 1P92A 2BHYA 2TCTA 1AKHA 2VBWA 2CWVA 5LLQA 3GTJJ 3JRGA 2FOWA 3ER7A 1FOXA 3SZPA 3R0JA 2WGQA 4E7KA 1UCRA 1YRNA 2M34A 3PNTA 4KUMA 1SAXA 2M4KA 3DTEA 3BR1A 5DV5A 2ELHA 4BTXA 3HTSB 1OF5A 3LZAA 4AEQA 1QZYA 1POGA 1AVLA 3CMMA 4BE1A 1BNFA 2WV0A 1K83J 4UUSB 5CVJA 5EEGA 3OYFA 3N97A 2R5ZA 1PDNC 2CS3A 3PO2J 3JSPA 3T8TA 2L5QA 3I54A 4Z2YA 4BACA 3KZTA 1EQKA 4PJNA 4BQNA 4FCYA 2OA4A 1O7HB 1UHSA 2OQRA 4LK0F 3A0BC 2DDAA 4HPQA 1ZRFA 5E79C 2E19A 2D5VA 1GXPA 1JJ6C 3HOVJ 4L9JA 2KFDA 3GX4X 4I0AA 2HYJA 2PMZN 3CJTB 3LH4A 3NAUA 3RCOA 3LYGA 1XGNA 2O3FA 4GO1A 1BNSA 2RGVA 1EUIC 3CUQB 1B1BA 2F5FA 4I7HA 4K1VA 1ZHFA 2OQGA 2HKOA 4S0HB 1LVKA 1PYLA 1QVTA 3DPLC 3JUNA 2ISYA 3GLLA 4E7SA 1KC84 3GTOJ 1J59A 4FX0A 4IHWA 1YQAA 3RDIA 3CC7I 1BSCA 4A5MA 3F14A 1P7IA 1B8IA 4FMAA 5GAEJ 4PZJA 1BANA 3GTPJ 2HVQA 3OYCA 5DM7F 4XKBA 1WVRA 2XAJA 3GTGJ 2RKHA 4NNJA 3CC73 4X1EA 2ADUA 4D9JA 3RPUA 1Q42A 3EBYA 1OR7A 4O02B 2QCOA 3CF2A 2XGCA 1NG7A 4EJWA 2GBWB 5EDNA 5H6QA 1QA6A 1X3UA 2M2EA 5E1ZB 4BY7J 4HW0A 2KXGA 3H5AA 3BOQA 2JMWA 2L02A 4RS8A 4AVPA 1WJ5A 3O8GA 4GCVA 3HOHA 4ZYEA 4L9TA 3GTLJ 4E7JA 3S2WA 3ZMZA 3HOTA 2XSHB 1W0UA 3E0JB 1XSDA 4KIFA 4N4OB 1ZGAA 1YIOA 2XIGA 3WU2C 1BRJA 2Q07A 5JVGF 2Z7AA 2JA6J 1EKMA 4OWRB 3ZPLA 2CQXA 3AG1H 2JQ7A 1NDOB 2JDIH 4HOHA 5FKMA 1T6SA 1FOYA 2PJPA 3DGOA 1X2MA 1DVCA 1AWCA 3TW6A 2DN0A 2YR2A 4HZFA 4WF2A 5F6FA 3CME3 3KE7A 3M9AA 7GSPA 1K734 3ZN0A 2JPBA 4G7HF 3G8ZA 3F40A 3F8NA 1UJ8A 1D8KA 2EZLA 5E8IA 5HNHA 4WX9A 3NQOA 2FXAA 2P7CB 4CGZA 5IG0A 4MQ9F 5LHHA 2K3PA 3EYIA 5EZGA 5ERIA 2K40A 3C7JA 4BJ5C 2OU2A 2BW3B 3CPW2 2BY0A 2M0CA 1K61A 2QSHX 2Z2SB 4GYGA 3CCLI 4BQOA 3H5NA 1FYLA 3GAXA 2F4YA 3LAPA 3OYAA 3P9CA 1QRYA 3JCUC 4XM4A 3IPTA 1O7NB 4HM6B 3NBRA 3DBLB 3D79A 2Y75A 1VFCA 1JT0A 3CNXA 3H9JA 3DLLF 3HSRA 4CCMA 2L01A 3FKIJ 3WU1B 3RZOJ 1IRGA 5LRSA 4DKIA 2K54A 2R3SA 2WAQN 3ABLH 4A12A 1B27A 1MMSA 2IBDA 2P05A 3IUOA 1OGZA 3WGGA 5IEOA 4XKVA 1FTTA 1MH3A 1Z3YA 3MKZA 3HL2A 2C10A 3NHXA 4MEIA 1EV7A 4M9ZA 4YELA 1IV6A 1FUWA 2QLZA 1JHHA 2A07F 3CCUI 4MMXB 1VQK3 3ZMVA 2ACJA 1IT8A 2DTRA 5M18A 3CPOA 1OGXA 2MD0A 1WI3A 1ZRCA 2DK5A 3FXQA 1DP3A 1XSXA 3LSJA 2XRXB 3RQIA 2WC2A 1HKTA 3CESA 4PCQA 4L0ZB 3QPSA 5G2GA 2KISA 1UUVB 2ZMEB 3G4S3 1OLTA 4F3QA 5B1BH 3MAJA 3IHUA 2ETHA 2VXDA 4CYCA 3F8XA 4HZBB 1P4WA 1MD0A 4D7MA 1H8AC 2W7NA 1FOKA 1PP8F 4BY1J 3R0AA 3W6KB 1IRFA 5L3GA 3QQAA 1HYFA 1PUEE 3JAMK 3U1KA 3K63A 5HVQC 2ZNYA 3FMRA 6RNTA 7RNTA 3H35A 2C6YA 3BDDA 3BCAA 2HS5A 3FDYA 5CXOA 3OMYA 2V7FA 3E6DA 2DOEA 3ZQIA 2LOOA 3D5RC 2O61A 1FBSA 3LSPA 1P4XA 4XMYA 5JLWA 4BHBA 1G2HA 1Y8QB 2W25A 1S7AA 3AMOA 2FNAA 2QENA 2QKLB 2KHMA 4WYKB 1YNVX 1Q864 1JGGA 1CEWI 2XAFA 5I97A 1VQ53 2STDA 2W57A 1ETQA 3H92A 1TRQA 2GU1A 2O3OA 3BNCA 2MC4A 3NBBA 4D5CA 1XN7A 3S1RJ 1DPUA 1WSUA 3PCSA 5M19A 4J5GA 1Z6TA 2QEXI 3LSKA 3FLJA 3X3XA 3PM1A 3I563 1O7FA 3NM2A 2GU3A 5LFAA 2M4GA 3BWGA 1BSDA 2LF7A 3HDDA 3OYBA 4IOAF 3S8PA 2K9LA 1WWXA 4L5IA 1O3TA 2NVQJ 4CCVA 3ASNH 1FJLA 2ME6A 2FE3A 2FEZA 4BQAA 2P7VB 2DA3A 3BZCA 2F4MB 4FHTA 4XRFA 3BIRA 3FKAA 5CKTA 3W6JB 5JFRA 3FKJA 4UUSA 4U0YA 3K5TA 1ERDA 3ABTA 2XC7A 4CCOA 3CQZJ 3G73A 1BA5A 4WYKA 2DQRA 2JA7J 1XGOA 4A2UA 4A3FJ 3EUAA 3V99A 2DDBA 4RBNA 3GF2A 2VODA 1T08B 5ILSA 1JB5A 3GLXA 3IC7A 1S3JA 4BJTA 4DIQA 4GFBA 4IL6C 5C4JJ 3WTYC 1B9NA 2PN6A 3HM5A 3ZQCA 1YHQ3 2X6OA 2BMRB 1K8A4 3CCSI 1GSPA 1YJWI 1MH4A 1XGSA 1DP7P 2CWUA 4KFEA 2OOVC 3HOSA 4EM2A 5D5XB 1EH7A 2KLOA 3D5SC 3E1SA 4H3UA 2DT5A 2HGCA 4D1QA 1BRNL 4UVCA 3CC43 3BZ6A 4QSHA 2F4IA 2M45A 4HG2A 1A31A 2V1LA 3S32A 3QU6A 2E2TA 2EIKH 4AIKA 4M9SA 5CVRA 4ZZLA 1C0WA 1O57A 2L4MA 5AYSC 1L3LA 3HRSA 3Q3SA 4PJJA 3S3OA 3P5JA 2R7TA 3HHHA 5IERA 2A5YB 2JPCA 2ZFWA 1Z6RA 4XLPF 5GAHJ 2DT7B 1TLHB 3CLOA 4N9HA 1W36D 2BEOA 1I3QJ 1A36A 1E3RA 3K4CA 1ZGXA 2UX0A 1V5FA 3O8HA 3OS0A 1QALA 1UCKA 2KAAA 2OTJI 5M5WJ 1A2KA 3ABMH 3PFIA 3HTUA 3RGAA 1IUYA 2OPTA 2QF7A 1VQ7I 2Y73A 3WTWC 1YW8A 2DMTA 1KQS2 3ECFA 2EV0A 4L5EA 2QWWA 1TNSA 1OHSA 4LZIA 3OWTA 3LWFA 3HGGA 2W2CA 2RCDA 4MGRA 3CO6C 4ANJA 1GMPA 1B2UA 3OIQA 3FMQA 3I71A 4RLQA 2X0LA 1BJAA 2LH9A 1J9IA 4MFDA 3MMYB 5E1WA 2QVOA 2W0QA 2YFJB 1T56A 3BCBA 1ETVA 1QQIA 1WJDA 3R61A 4EV2A 2MLGA 2XF7A 3CNMA 3HIFA 1VQ8I 5TGNA 2E1OA 1FUSA 3MWMA 3VSYA 4KT3B 2GXGA 4PGHA 5FLXK 3GZXB 4C30A 2K5CA 3F6VA 5FKNA 4AKZA 3LA3A 1NB3I 5F64A 1D1AA 1UMQA 4QLCU 1FNNA 1W7CA 1Y6IA 5J1YA 1UAAA 3FF0A 4RGSA 4EYCA 1X1UA 1R22A 1RC9A 3VSKA 1W6YA 5K5OA 4HA8A 1OCTC 3G0KA 5K7HA 4MTDA 1Z91A 1SEUA 3S1MJ 1A5JA 1W1WE 4XOTA 5CVIA 1LRAA 1TW2A 2BY1A 2DYSH 3WG9A 3ZOBA 1FIPA 5LHIA 2N8GA 2OTJ3 1I2FA 3UL5A 4Q47A 3DTIA 5HDGA 3DM8A 5BXQA 3HSFA 3LNQA 3AL0C 1RNTA 4ZDPA 1HC8A 5HDNA 1BC7C 4XN0A 1O4XA 4Y17A 2W24A 1LQMB 4G7ZF 4EM0B 5E3LA 2VONA 2W03A 3LTBA 3I5UA 5A2QZ 3AKZA 1YOVB 2EH3A 1W5CC 1XC5A 3PUBA 4HAMA 2GQQA 4KA4A 2QA4I 3DGMA 3CXC2 1E2XA 4S04A 3GFJA 3S2HJ 2VQHA 2LDUA 5FGMA 1B8IB 1ASKA 2W00A 1YVSA 2RFRA 1LOYA 4GHOA 5JBSA 1CYUA 5JI6A 5KP3A 3A0HC 2P81A 1I1SA 1TNTA 3DTKA 5G1LA 3QP6A 4XBYA 2ZMEC 3K69A 3JRCA 1KD14 3JRBA 1R36A 1B9MA 2YFIB 3BNBA 3MG3A 3LXUX 2HZTA 4UUVA 2DAOA 1ZTRA 2K9QA 2B9SA 3UB1A 4NC7A 1UHWA 3O3KA 3ZGKA 2OQEC 3WU0A 3W2AA 3ABUA 3CUQA 3L2VA 2P09A 3IH2A 4OVMA 2WTEA 1MSFC 2LG4A 2DU9A 2JQ5A 3T8UA 1N8R4 2LMDA 3LOCA 1SFXA 3K1PA 5L3EA 4ENJA 2AXLA 2XF3A 1I70A 3X2QH 2IS2A 2FMLA 1A90A 2LR8A 4XRSA 1U3EM 2VPRA 4IHXA 4FISA 2OCTA 2I5UA 4TV7A 3OYNA 1Z1DA 1BSAA 1YW7A 4HNTA 3CCEI 5KHDA 1LOVA 2QZ8A 2YX4A 4XR6A 4CJNA 4XLHA 1ACIA 5D8LB 1OCPA 2FF4A 1RCKA 2IUKA 3K70D 2MC8A 3MZHA 1RCLA 2IGKA 1Q40B 2W56A 5CF2A 4LITA 1FEXA 4UVAA 2D1VA 1IF1A 2H8RA 3G6EI 2R5ZB 2F56A 1W2B2 2LD5A 2QSGX 1V54H 5GPAA 1STFI 3E6BA 3G4SI 2W04A 1B2MA 2DFFA 3DCFA 2GOXB 2QQBA 1OF5B 1MMAA 2A05A 1A2VA 5FKLA 2ML6A 1MBEA 2MG4A 4J19A 1F36A 3EDPA 3COAC 2OC6A 1MBGA 4HLXA 3ROBA 3S27A 2X9DA 3CC4I 1Y1VJ 1BI1A 2P4WA 4BE2A 4IRIA 2KZGA 3MG1A 1MJBA 2HU9A 2R7FA 4U88A 1T2KA 3BR2A 2HNHA 2VXZA 3JVCA 1JJ22 2H0HA 2YX7A 4IRHA 4DYRA 4LJZF 4XKCA 2V9VA 1B59A 1BVIA 1HKQA 4XDWA 2P5VA 1LDDA 3S16J 4XOPA 2YU3A 3HB9A 4GYIA 4BXFA 4FT8A 4KFFA 4NQWB 3OSFA 4JBAA 1E3OC 3F6OA 3GZNB 3U1DA 1IVXA 2H0GA 3X3ZA 1LNIA 2VJIA 1I2EA 1CF7B 5D5UB 2LBFA 3E7LA 4ZYHA 2GXAA 4FCJA 1J09A 4IVNA 2JVHA 4L18B 2L9SA 2R7UA 4PEJA 2ZO4A 4IOCF 3S3NA 3OWUA 3HI7A 3OV4A 1I0XA 1IV8A 3E97A 2NS0A 4AYBA 2XKPA 4N6NB 4MIMA 4V19K 2LF8A 3IAM2 3GTQJ 1AA7A 1ZK8A 5HLGA 1R5HA 4JP0A 3V42A 4WXDA 3S28A 4EBGA 1QNTA 3L2CA 4NB5A 2OD5A 5LBQA 2CGPA 1NK2P 4H4KC 1N25A 3WTSC 1HLVA 3WA2X 5FLVA 2R0QC 2E2VA 4BEHA 1JE8A 1FOWA 4HEA2 1BR1A 2EWNA 2HMMB 3TKYA 1GOVA 2WAFA 3P9KA 2BZTA 3SEZA 4CXFA 1MNLA 1WNHA 3RKXA 3HGYA 3SOAA 4C9YA 4K1UA 1E3PA 2P0WA 4RB1A 2XPWA 4HDVA 3ASOH 3RKQA 3WOFB 4A3DJ 1W7PB 1GUUA 1TT5B 2IA0A 1U5TC 2Q8KA 1W4NA 3HSEA 4BH9A 1SFUA 5JPPA 3JR9A 3H3ZA 3KCHA 3RYRA 1I5ZA 4QPOA 3E5UA 3K10A 5BOXA 3RYPA 3QYFA 1WJBA 3V8JA 3C2HA 3RPQA 3NXJA 1GXQA 3WDGB 1UGIA 2F5DA 4EGZA 1O3QA 3RZDJ 2BVMA 5JR3A 1SD6A 2EQRA 4BEHB 2V1XA 1M904 1G8XA 1Q1HA 3AG2H 2V9KA 4M3DA 4NREA 1J0RA 1R1VA 3FX3A 2AXTC 5M3MJ 4HM1B 1OCOH 4HLYA 4OINF 4I09A 2C4BA 2CX0A 1FY7A 5IG4A 4DOZA 2XB0X 1UZCA 2EINH 1RUNA 1ETWA 2KP6A 1IV7A 1SFOJ 2BOLA 2O7OA 4JF8A 2J5PA 3NV0B 1ZGWA 4BU4A 1RI7A 3BP8A 1BNJA 4CA0A 1UUGB 3BLZA 1FA3A 1LDJA 1OPYA 3DPTA 3SJMA 4ITVA 4G7OF 1Q7Y4 3LAJA 1I0VA 1ON2A 2DODA 3C18A 1HKXA 1ZS7A 2IEKA 1X19A 3N9HA 1BUJA 1IDZA 1W7PD 3ISPA 3JTGA 3K7CA 2RDPA 4KMUX 4WXCA 4HF2A 4B09A 3OS1A 1KQ8A 4LG3A 3RGRA 1G3SA 1WJCA 2MH2A 1CF7A 2WY8Q 1R5ID 3LFUA 5AIFA 4IHTA 3WTUC 1W6GA 4GDFA 1UG2A 3DUKA 4HSTA 1BAOA 3K4JA 2LLKA 3OR1C 3MKWB 2ZXJA 1W36C 4EXRA 2HQRA 4G6DA 2XAUA 3P7NA 2UZKA 2WADA 4DW6A 2HVSA 3DU6A 1ETXA 2A61A 2XHKA 5K5RA 1KGSA 2O8KA 4HRIA 1PU4A 2LRDA 3RJPA 1IC8A 1SANA 2IGOA 2D45A 1Q7HA 4OK0A 4XORA 3HXLA 2EFNA 4EV0A 1A6QA 4BKXA 2H6CA 5IT9K 2DA1A 2JSCA 2XB5A 1MBKA 2X6YA 2XPVA 4O5VA 1MWUA 2O0YA 4N6UA 2MYSA 5F1RA 4XDVA 4RAZA 4B4CA 2HPMA 4KN4X 3I55I 5B1AH 3WTXC 2DO7A 1DU0A 1WHUA 3V8LA 1B20A 4QWTA 1BI3A 1WJEA 4XLFA 2F5WA 1ZARA 2HXIA 1ZX2A 3BROA 1GY6A 3BNDA 1IN7A 1RGFA 1BUQA 2E34A 3N54B 1U8CB 1Y4KA 3I56I 3O8YA 2L9VA 2VE8A 4UXNA 4C2UA 1DETA 4X6AJ 2W9PA 3FG4A 2R7OA 2M7AA 2R7VA 2EV6A 5J1RA 1OUNA 5CLSA 2NAZA 1SFEA 2DFIA 4HVNA 3CCRI 2FJ1A 4O6JA 3VEPA 3LQQA 2FRHA 3GBGA 4LG0A 2HYFA 3KYCB 2Y0MA 1F43A 3WOEB 1AV4A 4C3JJ 1USTA 1R9TJ 4HM2B 1ETKA 1X1PA 1M9GA 1YJN3 2JUGA 3EN8A 7STDA 2ZSIB 5J1UA 1I2GA 5IOYA 4RB2C 3D5GA 1BR2A 3D9RA 4YIRX 2M7BA 3NWTA 4JQFA 3CO7C 3DXOA 1YVBI 3K9MC 4HM8B 3QWLA 4XNFA 5IG5A 1RMSA 3CCMI 2OTLI 2YU9J 1GV5A 4P5OA 3MYTA 4E7ZA 1F1ZA 1I1GA 1YYVA 2Z9OA 2AADA 2XF5A 1RN1A 4G1MB 2HOEA 4P9FA 4CZCA 3BTIA 2ZDJA 4PSWA 4PUSA 2QEX3 3JUPA 2Y9ZA 1XD7A 4ESJA 1VQPI 1OCRH 4R79A 1HOMA 1BJZA 2GSPA 3CJNA 2DXIA 1O7WB 3FZVA 1WH5A 1STDA 3KP5A 1BNEA 3RPUD 1Y1WJ 4M6XA 2V4JC 4L0YB 3GFMA 3BZKA 3CP2A 4UHTA 1MDMA 2CFDA 2BVLA 2Z76A 4FMCA 3LTAA 2Y0SN 3NV0A 2PFBA 1YFHA 1JUPA 5FLMJ 2P5KA 1ZQ3P 3VF1A 3CCU3 2M3AA 1W02A 2LKXA 2HOAA 5J6XA 4S05A 2HEOA 3CCJI 1TTOA 1TQIA 1ZR4A 3Q2PA 3OIOA 2L7MP 3T1BA 4XM3A 2ZJQF 1J2XA 3FSDA 4U0WA 5IP6A 2VASA 1XSVA 2L9RA 3BJAA 5GP9A 1RZ4A 5E3MA 1MBHA 5ELUA 4RAYA 2O03A 3F8HA 1O7PB 2ISZA 3LSHA 4XLNF 2H0IA 2DT6A 3DZLA 1WCMJ 5J47A 3L2QA 1IN5A 3DXJF 3FXLA 3H3UA 4A6EA 4IHYA
chains in the Genus database with same CATH topology
3AMOA 3EQQB 1IDPA 4WYKB 2MF7A 1Q864 1JKGB 1K41A 1CEWI 5I97A 1VQ53 2STDA 3NBBA 2C11A 1JB4A 1TFKA 2GU1A 2O3OA 3BNCA 4HKVB 1TU5A 1YIT3 3CC23 3PCSA 3EF8A 3CCR3 3FLJA 3L0RA 4O2HA 1JRQA 3OWYA 4ZM8A 3X3XA 5AYRB 2GEYA 3FGYA 3LT8A 3T8NA 3I563 3NM2A 2GU3A 4L8OA 1SJWA 1V74A 3HX8A 1IVUA 1SIHA 3OXAA 3NUVA 2XR8B 5ELJA 2CC3A 5AIIA 1YJW3 1S723 3F7SA 4CCVA 4GB5A 1W6CA 3I0YA 8CHOA 1LVNA 1VQM3 3FKAA 3CCV3 1GD3A 4N6MA 1YJ93 5KP4A 3NM7A 3CU3A 3K5TA 3I553 4FCZA 3WA3A 3HIGA 4WYKA 5AEUB 1GYBA 4GL6A 3QRDA 3RDEA 4HM0B 4RBNA 1N9EA 3V99A 1M1K4 3PCRA 3EHCA 1OCVA 1JB5A 1OACA 1VQP3 2P0XA 1NB5I 1K8A4 1YHQ3 2BMRB 1D6UA 1OHOA 2BNGA 2CHCA 3HZPA 1MOLA 1GD4A 4KFEA 2CWUA 3NX0A 1JN5B 2E2UA 2OOVC 2CG0A 3EE1A 2IA7A 3SXXA 2QA43 1OH0A 1WTHA 4H3UA 1A67A 5STDA 2D42A 1TUHA 2SBLA 3CC43 1KWIA 3GRDA 2V1LA 3EN1B 5CLKA 2E2TA 4O8SA 1O7GB 1QVF2 5AYSC 1RRLA 1CQSA 5IERA 4I4KA 4J8TA 1LOXA 3BNEA 1F8NA 2HMOB 3IMAB 1UUWB 1E3RA 1UI7A 2UX0A 4XB5A 2OOVA 1M1XB 4FMBA 1QALA 4LMIA 3FF2A 4HM5B 1A2KA 3DY5A 5D83A 3RGAA 4WWUC 1G96A 1NO3A 4N6LA 4NHFA 3X41A 2Y73A 2W56B 1NWWA 1W01A 1KQS2 1IU7A 3ECFA 4ORLA 1OHSA 2HMLB 4LZIA 3S67A 1D6YA 3EC9A 2BMOB 2XEPA 4STDA 2W2CA 2RCDA 3X42A 2GEXA 2FXTA 2B24B 1IQXA 2W0QA 3KN4A 2YFJB 2P0MA 2XFSA 4EV2A 1N9JA 1DMNA 4WFOA 2P38A 4LSOA 3CNMA 4K90B 3CCQ3 4U13A 5TGNA 1N5HA 3VSYA 1W5ZA 2QIYA 2YX9A 1JKGA 3FZWA 3GZXB 4HBRA 3CMA3 1UI8A 3AMOB 4AKZA 2F98A 4KFDA 2CFWA 2D1WA 1NB3I 1YI23 1W7CA 2FNQA 3BB9A 1QVG2 1GS3A 1Q40A 3FF0A 4HM3B 1TFOA 4EYCA 3H51A 4HZ9B 1VZZA 1RKYA 2W9QA 1EG9B 1NU3A 1W6YA 3KFQC 4Q53A 1PFPA 4WP5A 1CYVA 1VQ73 3JUOA 2OTL3 3G0KA 3NBJA 5JPUA 3B8LA 3HIIA 1VQ43 2OTJ3 3UL5A 5AIHA 4H61A 2KRTA 3DM8A 5BXQA 1WQLB 1RJOA 2XH9A 1QAFA 2CKFB 2RGQA 2W03A 1VQN3 3LTBA 4CDLA 3GZYB 3T0UA 2BO9B 2F86B 4OUQA 1Q814 3V92A 5EQLA 1WMNA 2INXA 2K0MA 3DGMA 3CXC2 3B4OA 1ASKA 5A0OB 2RFRA 3UNLA 5JBSA 1CYUA 4N6V0 5KP3A 2PNCA 4BTYA 1S5AA 1ULIB 3EB8A 1FGMA 1GY5A 3KSED 4HM4B 4XBYA 3EJVA 4J9AA 1KD14 3BNBA 3NQZA 2YFIB 1KSIA 3MG3A 3LXUX 1D6ZA 2CH9A 1ZO2A 1ROAA 1JB2A 1HU9A 3UB1A 2OQEC 1FGRA 3ALAA 3M8CA 1ULJB 1O7MB 2P09A 3STDA 4HYZA 4OVMA 4L7KA 3SLUA 2JQ5A 3T8UA 1N8R4 3DGNA 2XF3A 3MWZA 4BTWA 2XGLA 1SQWA 1FGOA 3GWRA 1IQYA 5D81A 1A90A 5AEWB 3MKIA 2OCTA 3G6E3 4JRFA 3SX1A 1EA2A 3Q90A 2ML5A 1FGTA 1Z1SA 3JUMA 2IUKA 4X2HA 2MC8A 1AR0A 3CD63 1Q40B 2W56A 5CF2A 2XGNA 4IIAA 3X40A 3HK4A 3MHEA 6STDA 4N3VA 3CCJ3 1STFI 3V98A 2W04A 4R9LA 5BVBA 1OF5B 1WMOA 4K61A 1US1A 1VQL3 1A2VA 3LTDA 5IG3A 4FCMA 2ML6A 1R4CA 2ZL8A 4R9KA 4L8PA 3ROBA 3S27A 3G16A 3PZWA 5AI1A 2IMJA 2HMNB 3MG1A 4X2OA 1W2B2 3LTCA 5FW5A 1VQ93 1J2BA 1E97A 4MMZB 4MMYB 3JVCA 1JJ22 1DMQA 4TX4A 3K0ZA 3UJMA 1QMAA 2L4VA 5DRVA 4XDWA 3DGLA 5CK6A 4HJLB 2WGOA 2WO0A 4KFFA 1DVDA 1IVWA 2W6JH 1IVXA 3FG3A 3H3HA 1IVVA 3X3ZA 4FCJA 4IT7A 5KP1A 3DMCA 4PEJA 2GBXB 1N8QA 1QAKA 1T5YA 1TP6A 4KZ1A 2HMKB 3HI7A 3OWUA 3S5CA 5DREA 2OWPA 1ROVA 3OV4A 3QK9A 4MJDA 4LEHA 3PYJA 5LC6A 2M7OA 4N6NB 3F9SA 1IV9A 1E3VA 4EBGA 2BT3A 3S28A 3TDGA 3KIIA 2BHMA 5CF1A 2KCDA 3PGBA 2WOFA 3WA2X 3FG1A 4XBXA 2RSXA 4EC6A 2E2VA 1SPUA 1YIJ3 2CWVA 2HMMB 1WNHA 3CCM3 1MNLA 3ER7A 4R4KA 2WGQA 5EVHA 3SOAA 4K1UA 3SVAA 3VGNA 3OWSA 3WOFB 1W4NA 2Y74A 4BTXA 1OF5A 1SIIA 1K9M4 3B7CA 3U97A 3LZAA 4AEQA 2XSOB 5JPPA 1AVLA 5IW9A 3GZRA 5IENA 3N8BA 1LXEA 2CFLA 3MSOA 3PS8A 3NXJA 3PXMA 3WDGB 3KZTA 2A15A 1EQKA 1W00A 4XBTA 3MG2A 1O7HB 2OQEA 4IPBA 1OHPA 1M904 4NREA 4HM1B 5IG4A 2I9WA 2CG1A 1IV7A 3LH4A 4JF8A 3LYGA 3NV0B 3BLZA 1FA3A 1OPYA 4K1VA 1QJGA 1AVKA 1Q7Y4 4RZMA 1HKXA 3N9HA 1Q824 3JUNA 5IF6A 2BMQB 3K7CA 1KC84 4FMDA 1RN7A 3RGRA 1DYUA 5AIFA 1W6GA 3DUKA 2YFLB 3F14A 1ISKA 1W2ZA 4FMAA 4EXRA 2FGTA 3J7Yd 2F99A 3E99A 4R1KA 3CC73 3S29A 1K28A 1RRHA 5D82A 1Q42A 3LOYA 3Q1CA 1PU4A 4FR9A 3EBYA 1C7HA 4O02B 4OK0A 3IJEB 2WOHA 2GBWB 1VQ63 2KXGA 4WHAA 3MPHA 2CW9A 4N6UA 3D3LA 4XDVA 2XSHB 4EV5A 3KSPA 2LQVA 4RNYA 2Q07A 2O9UX 2Z7AA 3OW22 4QWTA 3F7XA 1IQ8A 1EKMA 1YGEA 1NDOB 2JDIH 2GXFA 1JV2B 1ZX2A 1GY6A 2CWTA 2Z6BA 3BNDA 3DGOA 3FH1A 1BUQA 3N54B 1DVCA 1U8CB 2B1XB 3FCSB 3CME3 3LT9A 1Y4KA 3O8YA 3KE7A 2W9PA 1K734 3FG4A 5AIGA 2IUJA 2R4IA 3G8ZA 3F40A 1NJI4 1OUNA 4HVNA 4O3VA 5IG0A 5EEOA 1WMPA 1VQO3 5HGRA 3CPW2 3EBTA 3WOEB 1AV4A 4HM2B 1M9GA 4HM7B 3GAXA 1YJN3 3EN8A 7STDA 3OX9A 4XM4A 3WMDA 3IPTA 3D9RA 5LC7A 1O7NB 4HM6B 3NBRA 3UL6A 3DXOA 3K9MC 3NQYA 1YVBI 4HM8B 2LYXA 5IG5A 3A76A 3CNXA 2HMJB 2QGUA 3SOYA 3MYTA 1U5OA 2K54A 3CCE3 4G1MB 3CCS3 2P05A 2ZDJA 1OGZA 2XFTA 5IEOA 2QEX3 2C10A 3JUPA 4AKYA 3NHXA 4R80A 4MEIA 1GY7A 1N5PA 1FUWA 3B4PA 2CFGA 1O7WB 4MMXB 3G713 1JNQA 1STDA 1UW1A 4KVHA 3CCL3 1VQK3 1IT8A 3CPOA 1VQ83 1OGXA 1LNHA 3WODG 2CFDA 4N6TA 2Z76A 3KKGA 1IT7A 3LTAA 4FMCA 2XRXB 3NV0A 2CK3H 3CCU3 3VF1A 1TIJA 1W02A 1DMMA 5G2GA 1UUVB 3G4S3 2Z77A 3F8XA 1IK3A 4HZBB 2CFKA 3Q2PA 3U1WA 3X3YA 1JN5A 3EX9A 1FGQA 3FSDA 3SEDA 4RNZA 2CIUA 5IEPA 3K63A 3JUQA 5ELUA 4LGQA 3F8HA 1O7PB 3LMLA 5CXOA 1L5GB 3DZLA 4N6OB 2PZVA 5FGOA 3GZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKG A;  3GZX B;  3EQQ B;  1DMQ A;  1IDP A;  4WYK B;  3K0Z A;  5D82 A;  1Q42 A;  1JKG B;  1K41 A;  1QMA A;  2F98 A;  3UJM A;  5DRV A;  3EBY A;  1C7H A;  2STD A;  4XDW A;  5CK6 A;  3WMD A;  1JB4 A;  4HJL B;  4HKV B;  3BB9 A;  1GS3 A;  1Q40 A;  3FF0 A;  4HM3 B;  2GBW B;  3H51 A;  4HZ9 B;  3EF8 A;  1VZZ A;  3H3H A;  3FLJ A;  1EG9 B;  1NU3 A;  3GZB A;  1W6Y A;  3OWY A;  4WP5 A;  4Q53 A;  2GEY A;  3FGY A;  4FCJ A;  4XDV A;  3JUO A;  3T8N A;  3G0K A;  3NM2 A;  4L8O A;  3DMC A;  4XBY A;  3B8L A;  2XSH B;  4XM4 A;  4PEJ A;  5JPU A;  1SJW A;  2GBX B;  3KSP A;  2Z7A A;  3HX8 A;  1TP6 A;  3F7X A;  3OXA A;  2HMK B;  3NUV A;  2XR8 B;  3OWU A;  5AIH A;  3S5C A;  1NDO B;  2OWP A;  3OV4 A;  5AII A;  5DRE A;  2GXF A;  3DM8 A;  1ZX2 A;  3F7S A;  1GY6 A;  4MJD A;  4LEH A;  1WQL B;  4GB5 A;  5BXQ A;  3FH1 A;  1BUQ A;  2B1X B;  3I0Y A;  8CHO A;  3F9S A;  3FKA A;  1E3V A;  2CKF B;  3KE7 A;  5KP4 A;  2RGQ A;  3CU3 A;  5AIG A;  4CDL A;  3GZY B;  5G2G A;  4WYK A;  5AEU B;  5CF1 A;  2F86 B;  2R4I A;  3F40 A;  1GYB A;  3G8Z A;  4OUQ A;  1ISK A;  1OUN A;  4HM0 B;  4XBX A;  4HVN A;  3EHC A;  1OCV A;  5IG0 A;  2INX A;  1JB5 A;  3B4O A;  2HMM B;  5HGR A;  1ASK A;  3EBT A;  2RFR A;  3ER7 A;  3UNL A;  5KP1 A;  5KP3 A;  3SOA A;  5EVH A;  1S5A A;  1ULI B;  4HM2 B;  4K1U A;  4HM7 B;  3EN8 A;  1GY5 A;  2BMR B;  3OX9 A;  3OWS A;  4HM4 B;  2BNG A;  1OHO A;  3EJV A;  2CHC A;  3HZP A;  3IPT A;  3D9R A;  4J9A A;  2YFI B;  1O7N B;  3MG3 A;  4HM6 B;  3NBR A;  1JN5 B;  1OF5 A;  3DXO A;  3B7C A;  3LZA A;  5JPP A;  2XSO B;  4HM8 B;  5IG5 A;  1ZO2 A;  3A76 A;  1JB2 A;  1OH0 A;  3GZR A;  4H3U A;  3CNX A;  3VGN A;  5IEN A;  5STD A;  3M8C A;  1ULJ B;  1TUH A;  1O7M B;  2HMJ B;  2QGU A;  3MSO A;  3GRD A;  3MYT A;  1U5O A;  2K54 A;  3SOY A;  3EN1 B;  3STD A;  5CLK A;  4OVM A;  3NXJ A;  4L7K A;  1O7G B;  3KZT A;  2A15 A;  2JQ5 A;  3T8U A;  1W00 A;  1OGZ A;  4XBT A;  5IEO A;  3JUP A;  3MG2 A;  1O7H B;  1CQS A;  3NHX A;  1GY7 A;  4I4K A;  4J8T A;  5IER A;  3B4P A;  3GWR A;  5D81 A;  2HMO B;  1OHP A;  3MKI A;  5AEW B;  1O7W B;  1UUW B;  1E3R A;  2UX0 A;  1STD A;  4KVH A;  4XB5 A;  4LMI A;  1EA2 A;  4HM1 B;  7STD A;  3CPO A;  3FF2 A;  3Q90 A;  1OGX A;  4HM5 B;  5IG4 A;  1A2K A;  2I9W A;  1Z1S A;  3JUM A;  5D83 A;  3RGA A;  4WWU C;  4X2H A;  2Z76 A;  3KKG A;  1AR0 A;  3LYG A;  2XRX B;  3NV0 B;  1NWW A;  1Q40 B;  3NV0 A;  5CF2 A;  1W01 A;  4IIA A;  3ECF A;  4ORL A;  3BLZ A;  1OHS A;  2HML B;  1OPY A;  1W02 A;  1DMM A;  1QJG A;  3HK4 A;  1UUV B;  3EC9 A;  3MHE A;  4K1V A;  2Z77 A;  2BMO B;  4N3V A;  4RZM A;  1HKX A;  6STD A;  4STD A;  2W2C A;  2RCD A;  3F8X A;  4HZB B;  4R9L A;  3JUN A;  5IF6 A;  2BMQ B;  5BVB A;  3K7C A;  1JN5 A;  1OF5 B;  2GEX A;  3EX9 A;  3FSD A;  3SED A;  2B24 B;  3RGR A;  5IG3 A;  5IEP A;  4FCM A;  2YFJ B;  5AIF A;  3JUQ A;  1DMN A;  2YFL B;  3DUK A;  3F14 A;  4LGQ A;  4R9K A;  3F8H A;  1O7P B;  3CNM A;  4L8P A;  3ROB A;  3G16 A;  5CXO A;  4U13 A;  3DZL A;  5AI1 A;  5TGN A;  2F99 A;  2HMN B;  2IMJ A;  2PZV A;  3E99 A;  3MG1 A;  4X2O A;  5FW5 A;  3VSY A;  4R1K A;  1E97 A;  2QIY A;  3FZW A; 
#chains in the Genus database with same CATH topology
 1SAR A;  3DGY A;  3EQQ B;  1CH0 A;  3HKZ N;  3TOA A;  1GDT A;  3MCZ A;  3K70 C;  2HR3 A;  1NH3 A;  4RB0 A;  2EJR A;  4UY8 I;  4G12 A;  3KZY A;  1YIT 3;  3J7A Y;  3IH3 A;  3ESW B;  4XKW A;  3EF8 A;  1JKQ C;  1RKW A;  1Z0X A;  2E7X A;  5DUK A;  1UCJ A;  2KF4 A;  3CCR 3;  3GWZ A;  3L0R A;  4O2H A;  2GEY A;  3FGY A;  3T8N A;  2DMU A;  5KNL A;  4DBR A;  2DOF A;  2VC0 A;  3ZQQ A;  2UWM A;  1YGW A;  2F5M A;  3SXY A;  4BGD A;  3SZT A;  2IY2 A;  3SZG A;  1GLN A;  2JRT A;  2ZXI A;  3NUV A;  2XR8 B;  1BIR A;  3K0L A;  3PNV A;  4KDP A;  3F7S A;  2EA2 A;  5LD2 C;  3I0Y A;  1BNI A;  1R49 A;  4ZDO A;  3CCV 3;  4N6M A;  1YJ9 3;  3QPL A;  3CJQ B;  3F9K A;  1TWC J;  3I55 3;  2XV4 S;  3I0T A;  4BIR A;  3HIG A;  1VTN C;  1FYK A;  4N9I A;  4E70 A;  4RLF A;  1GYB A;  3QYE A;  3QRD A;  1ZKG A;  2ZJR F;  3EHC A;  2V1U A;  1EA3 A;  2O8X A;  2W48 A;  5F27 A;  2EFW A;  3DQV C;  3C3W A;  1OAC A;  4HDU A;  3UL6 A;  2UXX A;  2P0X A;  1VQP 3;  2RV8 A;  1QPI A;  1LNW A;  1S6L A;  2HKX A;  3F8C A;  4DZP A;  2JT1 A;  4XQF A;  3TP3 A;  4G94 A;  5DTD A;  5ILV A;  3F22 A;  4BE0 A;  4AC0 A;  4U7B A;  1S72 I;  1FSH A;  1MOL A;  3NX0 A;  2DYR H;  1JN5 B;  2E2U A;  5KCM A;  2I8D A;  3GO5 A;  2R93 J;  2QA4 3;  2UV1 A;  1MNE A;  1H9T A;  2IGN A;  1VND A;  1OH0 A;  1A67 A;  1XDU A;  2H1L A;  1UFM A;  4MTE A;  1BOX A;  1YS6 A;  4CO8 A;  1MWR A;  2GAU A;  2B7E A;  3B73 A;  1KWI A;  4FE4 A;  3B02 A;  2VQL A;  1WPK A;  4O8S A;  1O7G B;  4F52 A;  3CMA I;  3BJ6 A;  4ZC3 A;  2KF6 A;  1RRL A;  2VI6 A;  2Z3Y A;  4II2 A;  2STW A;  3LSI A;  1LOX A;  3FF5 A;  2DI3 A;  4MFE A;  3RTR A;  5TJJ A;  2FMY A;  4G9Y A;  4XB5 A;  3L2W A;  3K2A A;  4MLO A;  3A01 B;  1OYY A;  4Y3O A;  1HSJ A;  5FKK A;  1LOW A;  3R6S A;  3P9I A;  3IL2 A;  5D83 A;  1NO3 A;  2NOJ B;  3X41 A;  1BNG A;  2W56 B;  2W4S A;  1U6G A;  3W6V A;  1IU7 A;  2QM3 A;  2HML B;  3S67 A;  4DNC A;  1D6Y A;  4YII A;  2Y9Y A;  2WB1 N;  2EB7 A;  1BU4 A;  3ERE D;  1JTX A;  4B47 A;  2GEX A;  5ILU A;  3F8M A;  2NYX A;  2FXT A;  3TO7 A;  5HS7 A;  2K85 A;  3I59 B;  2F5C A;  2UXN A;  2OZU A;  1OCZ H;  4J00 A;  2P0M A;  5EF6 A;  4B3X A;  3OYK A;  1N9J A;  2CWT A;  4WFO A;  2P38 A;  1I27 A;  1RES A;  3I53 A;  1FMW A;  3CCQ 3;  3KFW X;  4EM1 A;  2PQ8 A;  2VKH A;  3WG7 H;  2XAG A;  3FZW A;  4GSP A;  1UI8 A;  4LIU A;  3AMO B;  3Q3F A;  2F98 A;  2D1W A;  2OCE A;  2HQN A;  1MZB A;  6GSP A;  2CX1 A;  2A69 F;  3CJR B;  3BB9 A;  5F0C A;  2GM4 A;  1GS3 A;  1QVG 2;  4KT6 A;  5IT9 Z;  1NK3 P;  3GTM J;  1E17 A;  2W9Q A;  5BQT A;  1NU3 A;  4M3B A;  1TL8 A;  3BTC A;  5LGT A;  1GVD A;  1STZ A;  4WP5 A;  4ZZD A;  1VQ7 3;  5ICE A;  2OTL 3;  3NBJ A;  4QTR A;  4JX6 A;  1K78 A;  3NWS A;  4RGU A;  1HW1 A;  3K4L A;  2H1K A;  3KP4 A;  1DUX C;  4CYC B;  1VQN I;  2NOG A;  2HPI A;  4W97 A;  1U0J A;  5M5X J;  2RVC A;  1MSE C;  1TRP A;  1WQL B;  1RJO A;  6PAX A;  3SFZ A;  3G2B A;  1VQ5 I;  2KRC A;  3BC8 A;  5ED4 A;  1ETO A;  2VIX A;  4ZTF A;  2IA1 A;  2XSJ C;  1VQN 3;  4CDL A;  3GZY B;  4BL0 B;  2BO9 B;  4KIC A;  5HLT A;  5H2F C;  5IP7 J;  2HOT A;  4OIP F;  1Q81 4;  2PMH A;  3G1L A;  4Y15 A;  1YLF A;  4AWX B;  3TW7 A;  2CUE A;  3L00 A;  1ZG5 A;  3DU5 A;  2BXY A;  3KX2 A;  1NNV A;  5A0O B;  1NHA A;  1JKR C;  4NBQ A;  4KN7 X;  4N6V 0;  3J81 Z;  2CV2 A;  1R1T A;  4BTY A;  4UV8 A;  5B3S H;  4PJM A;  5FRN A;  1FLI A;  5HDK A;  3I4N J;  1FGM A;  2XKO A;  1GY5 A;  3W3C A;  2Y30 A;  2CV0 A;  1FPQ A;  2BYV E;  1IUF A;  2BHZ A;  4ZJZ A;  3EJV A;  4B8X A;  2HWV A;  3F23 A;  3B6C A;  1TWH J;  4I02 A;  5D6F A;  5DD8 A;  1BOA A;  2H6B A;  1U8R A;  1JB2 A;  4UB8 C;  1GHC A;  5IP9 J;  3GVA A;  1ULJ B;  3HG9 A;  1O7M B;  1KU2 A;  2ZNZ A;  2DK8 A;  5E3N A;  1JBR A;  1GV2 A;  5L3F A;  2GZW A;  3S1N J;  2KDZ A;  3HEF A;  2FQ4 A;  3RKY A;  2A6E F;  1I50 J;  3HZJ A;  3GTK J;  4N0B A;  4BTW A;  4YFK F;  2A6H F;  4IEJ A;  3TL4 X;  1KON A;  2QQ8 A;  3CCV I;  1SQW A;  1BNR A;  2CQN A;  3MKI A;  2A5W A;  2RNJ A;  2EFO A;  3K6G A;  4LGW A;  2K9M A;  4JRF A;  1EA2 A;  3SX1 A;  1U5T A;  2KJB A;  3WE2 A;  3LST A;  1K7A A;  1N78 A;  1FGT A;  2ML5 A;  2F4O B;  3Q90 A;  4MEY F;  1KZH A;  1R5G A;  1TQP A;  1AR0 A;  4Y4R A;  1LUJ B;  1A04 A;  3A4C A;  3U21 A;  1PP7 U;  1UG0 A;  2OCC H;  3HBL A;  1UHM A;  4R80 A;  3V7S A;  1WFX A;  3LSG A;  1RTU A;  3MHE A;  4N3V A;  6STD A;  3K4B A;  3CCJ 3;  3V98 A;  1XCV A;  3AFH A;  2K02 A;  3DEE A;  4M6V A;  4A0Y A;  4R9L A;  5BVB A;  1FSE A;  1G3W A;  1YIT I;  2PI0 A;  5D4S A;  1HW2 A;  2CWE A;  1Z9C A;  4EJT A;  1WMO A;  3OYJ A;  2DJI A;  4LYL B;  2FUG 2;  3LTD A;  5IG3 A;  5FB2 A;  1BSB A;  1EH6 A;  1R4C A;  2H94 A;  4ZH4 F;  2ID6 A;  4R9K A;  2L7Z A;  3G16 A;  4II3 A;  3V7R A;  4ESB A;  2E35 A;  5AI1 A;  1IXS B;  2IMJ A;  2E1M C;  3C1D A;  4EJO A;  3LTC A;  1VQ9 3;  1ZRE A;  1E97 A;  4MMZ B;  4MMY B;  4HX7 A;  1DMQ A;  3K0Z A;  4XIC A;  1QMA A;  2L4V A;  2LFB A;  1D0X A;  2XUB A;  3BU4 A;  2FBH A;  5CK6 A;  3N05 A;  1S8N A;  1JBS A;  2G7H A;  4HJL B;  2ESH A;  1IVW A;  4B44 A;  3E3V A;  3HKZ A;  3K9T A;  1VQ9 I;  2W6J H;  2HDD A;  2WAQ A;  3FG3 A;  4HV5 A;  1IVV A;  4G6Q A;  2FBK A;  1OR7 C;  3LSR A;  2E2J J;  1AU7 A;  5B66 C;  1FYM A;  3MZ8 A;  1HXD A;  2W85 A;  2WWY A;  1IN8 A;  2GIZ A;  1LB2 A;  1T5Y A;  1IRX A;  1T33 A;  3FHZ A;  2JRM A;  2HOS A;  3GZ5 A;  4PSX A;  2GLO A;  5K5Q A;  4M73 A;  2HMK B;  4KZ1 A;  3O6B B;  2OWP A;  4RGX A;  1B72 B;  4EGY A;  4ESF A;  4LEH A;  1HZ1 A;  1BM9 A;  1IV9 A;  4RNT A;  3GW2 A;  2BT3 A;  1T3B A;  1R7J A;  2BHM A;  1TWF J;  4L9N A;  3REO A;  1XG1 A;  1KU3 A;  2KCD A;  4CCJ A;  1ULY A;  2VB6 A;  2OBP A;  4P1W A;  3FG1 A;  5GTI C;  4EC6 A;  4UNO A;  2ELK A;  4BUP A;  2Z33 A;  2HI3 A;  1F9N A;  1YIJ 3;  2XGD A;  4AVZ A;  4IF4 A;  2PJR B;  3ML6 A;  3CCM 3;  2CU7 A;  2XDV A;  3TGN A;  1ZRD A;  2FQ3 A;  4R4K A;  3SVA A;  2X48 A;  3KLO A;  5TRD A;  4EJU A;  1G02 A;  2JK3 A;  3QYB A;  2QBY B;  2H27 A;  4CIC A;  3IP4 B;  1T38 A;  1ITY A;  3OYM A;  1K9M 4;  2VC1 A;  1CQT A;  3U97 A;  3VYR B;  2M9H A;  3H9G A;  1X58 A;  2LNB A;  5DCM A;  3GZR A;  2E7W A;  1AHD P;  3N8B A;  3OL4 A;  5CQE A;  5DS9 A;  3LL7 A;  3ZMT A;  3HOZ J;  1R4Y A;  2CFL A;  2O9L A;  4LLN A;  2BV6 A;  3FXO A;  2XAQ A;  4OMY A;  3E6M A;  4MQV A;  2A15 A;  1U9N A;  2DBB A;  3CUQ C;  1LFP A;  2HDC A;  3MG2 A;  4RMN A;  4IPB A;  4BBS J;  2OQE A;  1G0T A;  2EV5 A;  9ANT A;  2Z1D A;  1N75 A;  2Y31 A;  2KIM A;  4RAF A;  4RM3 A;  4G6T B;  1R71 A;  4H0E A;  2LRE A;  4GRI A;  2P6T A;  4PFP A;  1OQY A;  3ZCO A;  2V6C A;  2ZME A;  3LSM A;  2I9W A;  3ZQF A;  2J8X B;  2FA5 A;  2E36 A;  3Q5F A;  4NPB A;  1TT0 A;  1TWA J;  4AM3 A;  8RNT A;  3DF8 A;  3IH4 A;  3M1E A;  2LY9 A;  1B2Z A;  2VKE A;  3SQN A;  1AVK A;  2EA4 A;  1H9G A;  2KL4 A;  4RZM A;  1Q82 4;  2HFH A;  3NRV A;  3L7W A;  5JHF A;  4W1U A;  5GPC A;  2KF3 A;  2F48 A;  2MSY A;  1RKT A;  4FMD A;  2VOO A;  1RN7 A;  4E7I A;  5CVV A;  2MH9 A;  1FC3 A;  1QZE A;  2TRT A;  1R58 A;  2JA8 J;  2KRF A;  1DYU A;  2CUZ A;  4DYC A;  2YFL B;  3OYE A;  1B3S A;  1G3T A;  2FGT A;  4RAG A;  4Y52 J;  4F93 B;  2X4H A;  5ICC A;  2F99 A;  4M3E A;  3I4P A;  1BI0 A;  4V2F A;  3H0D A;  3S29 A;  5D82 A;  2KPM A;  4G8X A;  1Q9E A;  5L3D A;  5LHG A;  2XF6 A;  1X1W A;  2VBZ A;  3Q1C A;  1FIA A;  2V9P A;  2VE9 A;  1C7H A;  1T2H A;  3QAH A;  3OYG A;  1VF9 A;  3AG4 H;  2OAZ A;  2R5Y A;  1YS7 A;  2HYG D;  2WOH A;  4D7N A;  1WJA A;  2X6W A;  2VJJ A;  1VQ6 3;  2L54 A;  2DJN A;  4HNV A;  4WHA A;  3MPH A;  2IT0 A;  2BW3 A;  2Z16 A;  2CW9 A;  4U7D A;  1BRH A;  4RB3 C;  4Q48 A;  2M30 A;  3VYU B;  1FZU A;  2VQG A;  4JX4 A;  4EV5 A;  1UCI A;  3LA2 A;  2LQV A;  3KSP A;  4RNY A;  2M87 A;  2WY7 Q;  4KJZ A;  1IQ8 A;  3DEW A;  1JHF A;  4A93 J;  2Z6B A;  1OYW A;  3FH1 A;  1WGX A;  2E5N A;  5FLX Z;  1MW7 A;  4IQJ A;  4A3G J;  3FCS B;  1BSE A;  2D1H A;  3LT9 A;  1DU6 A;  1B6A A;  1QO0 D;  5AIG A;  2DMQ A;  4Y7N J;  2B63 J;  2R4I A;  3WHO A;  1NJI 4;  4A3K J;  4GGG A;  2ECB A;  2ELJ A;  2NVT J;  4HX4 A;  2GXF A;  4O3V A;  1I8V A;  1Z77 A;  5EEO A;  1J75 A;  3OR2 C;  1VQO 3;  2VKD A;  5KVR A;  5HGR A;  1O3S A;  3CLQ A;  3EBT A;  1RGG A;  1H89 C;  5J40 A;  1VQK I;  1IG7 A;  5F0F A;  4CHU A;  1B21 A;  3SDB A;  4HM7 B;  3OX9 A;  1HDP A;  3LA7 A;  2XGX A;  2IJL A;  5BMZ A;  3DEU A;  5LC7 A;  1U9O A;  2DFH A;  2P5L C;  3PFY A;  2XVC A;  4UVB A;  3FXU A;  2M8E A;  3RQ4 A;  4E4H A;  1YIJ I;  3CD6 I;  1HA8 A;  2LYC A;  1LKX A;  2EIM H;  3OV8 A;  1HF0 A;  3ABK H;  3BPV A;  3SOY A;  1K4T A;  5FRO A;  1U5O A;  3UR3 C;  4CYD A;  1RN4 A;  1D5V A;  3CCE 3;  1KU7 A;  1P9Q C;  4MO7 A;  3CCS 3;  3VB2 A;  2BGC A;  3WTZ A;  5E8G A;  2ICW G;  3RNT A;  4FAS D;  4AKY A;  1RR7 A;  5GTH C;  3QP5 A;  1GY7 A;  2ZCW A;  4J01 A;  1N5P A;  3FXR A;  1RDS A;  2BIR A;  4E7L A;  4OMZ A;  2CFG A;  3B4P A;  1X1X A;  1QGP A;  4ILF A;  3ECO A;  3V8K A;  3G71 3;  3GFI A;  3QOP A;  1JNQ A;  3JRH A;  3CCL 3;  4AU7 A;  5EG0 A;  1ZGJ A;  1OKR A;  2FOK A;  1RR8 C;  2R7Z J;  3OYD A;  3QRF F;  4YEJ A;  2CYY A;  4QWQ A;  2R5Y B;  2WV1 A;  3ZQH A;  1UDI I;  2O6G E;  1TIJ A;  2ZJP F;  3MZY A;  4ENM A;  3AHW A;  3S1Q J;  1U2W A;  2LKP A;  3SDG A;  4M6Y A;  1IK3 A;  3J81 K;  3D4A A;  3V4G A;  2CFK A;  1FBQ A;  3ERM A;  1ZLJ A;  3U1W A;  3X3Y A;  3KZI C;  1FGQ A;  2RQP A;  4PJ0 C;  2NVU B;  1RIO H;  2CIU A;  5IEP A;  3ZFZ A;  1IDY A;  3ELK A;  4Q4Z F;  3JUQ A;  3FXK A;  2JN6 A;  1Z05 A;  4DYQ A;  1V58 A;  4LGQ A;  1SVM A;  2BY3 A;  2RRE A;  2E2H J;  4RM2 A;  1L5G B;  4N6O B;  4HX8 A;  1USS A;  2PZV A;  4WWC A;  3JRD A;  2V1N A;  1W0T A;  4NC8 A;  1IXC A;  3GZB A;  2O5R A;  3K1M A;  4HV6 A;  1VQL I;  1JKG B;  1K41 A;  5J4V A;  1K6O A;  2VL8 A;  2VOP A;  2JUC A;  4HYE A;  2DTZ A;  1JB4 A;  3UKG A;  2FNP A;  1RPW A;  2Y2Z A;  2E71 A;  5J8F A;  1OCC H;  4ENK A;  2GA2 A;  1JZD A;  2IP2 A;  1YRN B;  1MBJ A;  1A2P A;  3DWL E;  3HC7 A;  2X6X A;  1RGK A;  3CP8 A;  1MGW A;  1JRQ A;  3OWY A;  1AKH B;  2PG4 A;  1XDS A;  1MIJ A;  4RDU A;  2DA7 A;  1V74 A;  1IVU A;  1SIH A;  4M72 A;  4CH7 A;  2IRF G;  2CQQ A;  1X1A A;  1OYI A;  2MW8 A;  2CC3 A;  1LE8 B;  1SD4 A;  1YJW 3;  1MJA A;  3ZN1 A;  1R23 A;  1BGS A;  2JWT A;  4GB5 A;  2VJ4 A;  1F5T A;  3VSL A;  2VBX A;  5F0H A;  2VT3 A;  1LVN A;  3KCC A;  4ON0 A;  3OL3 A;  1VQM 3;  2GBY A;  3JAM Z;  4CCN A;  5KP4 A;  3CU3 A;  3WHB A;  1XB4 A;  3GXO A;  1ZG3 A;  5DCM B;  5AEU B;  3BG5 A;  4ZYD A;  2AO9 A;  4GL6 A;  1MBF A;  3RDE A;  1LPQ A;  3SYT A;  1N9E A;  1M1K 4;  3OSG A;  3PCR A;  4XLE A;  2QBY A;  2YS9 A;  2EIJ H;  3PQJ A;  4F7Z A;  3S15 J;  3DKW A;  4QPQ A;  4RGR A;  2GWR A;  4BL3 A;  1RGH A;  2ZA4 A;  5LRR A;  2FSW A;  3S93 A;  2CH0 A;  1OHO A;  2CHC A;  3HZP A;  1GD4 A;  2H8W A;  3LMM A;  3BR0 A;  1PVE A;  2CG0 A;  3EE1 A;  2KDO A;  3ZQL A;  1S5L C;  2F6C A;  4NHJ A;  1I3I A;  3SXX A;  2LY1 A;  3PQK A;  3L9F A;  5STD A;  2IW5 A;  2D42 A;  5L3B A;  1TUH A;  1YX3 A;  1EF4 A;  4LK1 F;  1DDN A;  3I3L A;  3M3Y J;  4IXA A;  2BBY A;  5CLK A;  1FT9 A;  2M1B A;  1K4S A;  3DLA A;  1B72 A;  1MJ9 A;  2W1O A;  4LMY A;  3L2R A;  2ME0 A;  1NTC A;  3KIO A;  1K6Y A;  1UEL B;  2L0K A;  3K4M A;  1XS9 A;  4J8T A;  1DGR M;  1ODD A;  2WA0 A;  4NC6 A;  5C44 J;  1UI7 A;  1VQQ A;  5BU4 A;  3RIR A;  1M1X B;  4FMB A;  4LMI A;  4A3M J;  3H36 A;  4HM5 B;  1JTY A;  5DEQ A;  2VJ5 A;  1YTY A;  4N6L A;  2PMU A;  3KEQ A;  2M5W A;  4I76 A;  5KAF C;  5BPD A;  1QU3 A;  4I2O A;  4NDL A;  3TOB A;  3AHS A;  2KRH A;  4BXX J;  3DV8 A;  3Q0V A;  5F08 A;  2PMZ A;  4IO9 F;  2BMO B;  1R4N B;  4MEX F;  1YHQ I;  3KEO A;  4YRV A;  4UV9 A;  3MKY B;  3I4M J;  3X42 A;  5HOO A;  2DW4 A;  5CVU A;  5FD5 A;  1WRJ A;  5EEH A;  2XAH A;  3ZMS A;  1DPR A;  5D8K B;  3D5L A;  2XFS A;  1DMN A;  1QPM A;  4A6D A;  4BL2 A;  4K90 B;  2QQ9 A;  3B6A A;  3QU3 A;  4U13 A;  3MD2 A;  4OIO F;  1BW5 A;  4ABZ A;  3Q9S A;  1LJ9 A;  4OAY A;  4IX7 A;  2CQ7 A;  1X2N A;  2YUS A;  1Q1V A;  3AGN A;  1DQU A;  4C3I J;  3N4M A;  4GXO A;  4CPK A;  4KFD A;  4C2T A;  4A0Z A;  4P96 A;  4X0G A;  1OJL A;  1X1Y A;  2V26 A;  4M74 A;  1HST A;  3DKX A;  1BR4 A;  2IAI A;  2ZJ2 A;  1MGR A;  3A5E A;  2QKM B;  1JGS A;  1TFO A;  3H51 A;  4HZ9 B;  1X4O A;  3ZRG A;  5HOD A;  1RKY A;  1BIA A;  1EKE A;  4HSR A;  3KFQ C;  3K7A J;  5J8C A;  1X1B A;  1LFB A;  3JUO A;  3OYL A;  1FW7 A;  4FET A;  2EIL H;  1SVO A;  2GA1 A;  4AIJ A;  1RGA A;  2Q2E B;  2Z99 A;  1VI0 A;  2PX9 A;  2ZSH B;  2MGQ A;  4YIF A;  4BDZ A;  5K1Y A;  3FK6 A;  2ZBK A;  1BRG A;  4H61 A;  2E60 A;  5RNT A;  1E0E A;  4MNU A;  3VFZ A;  4KIT B;  2XH9 A;  4WCG A;  3S2D J;  5J3L A;  2L1S A;  3O2P E;  4F92 B;  1QAF A;  2G9W A;  2MA3 A;  5L3C A;  4A5N A;  4KMF A;  2A68 F;  2EZI A;  4F91 B;  3T0U A;  2G7U A;  3QOD A;  4IKF A;  3V92 A;  2WAE A;  3CTA A;  4I6Z A;  1LQ1 A;  3OS2 A;  1WMN A;  3KEY A;  5DM6 F;  1MND A;  2INX A;  1JKO C;  3AL0 B;  4OIQ F;  1GOY A;  1RGL A;  5G1K A;  2PNC A;  2LC2 A;  1ULI B;  1X4P A;  3F8B A;  1QHH D;  4XN3 A;  3EB8 A;  1Y39 A;  4HM4 B;  4J9A A;  4IJA A;  3VWB A;  3CMY A;  1TQM A;  2EZK A;  4BYY A;  3A02 A;  1A35 A;  1D6Z A;  2CH9 A;  1V55 H;  3VPR A;  1G6N A;  1JKP C;  4KIS A;  2LK2 A;  3GYH X;  2AHQ A;  2R4G A;  1XMK A;  2JA5 J;  1JZO A;  1ROA A;  3DKY A;  2IS1 A;  2XRN A;  2RNT A;  1FGR A;  3ALA A;  4XBF A;  1M1E B;  4BJ6 C;  4L7K A;  3SLU A;  2KIF A;  5EGO B;  2Y69 H;  5FFZ A;  3BG7 A;  3F21 A;  2E1C A;  2L9N A;  4EJV A;  3DGN A;  2B0L A;  1S7O A;  2XGL A;  1LVA A;  3GWR A;  3D1N I;  1IQY A;  3DPU A;  4HNU A;  5D81 A;  1WKM A;  2RN7 A;  2CW0 F;  1IW7 F;  3DH2 A;  3AAF A;  5M1A A;  4LOC A;  5HLH A;  4HF0 A;  3IKT A;  3JSO A;  2FBI A;  1XX5 A;  2KZV A;  3GFL A;  3CD6 3;  2A3S A;  3C2G A;  1S29 A;  2XGN A;  3D5I A;  4BBR J;  2AAE A;  4IIA A;  4EEF G;  1A6I A;  1B4A A;  2K7L A;  1T39 A;  4N4N B;  1HDD C;  1I39 A;  4BHC A;  1RNL A;  2LKS A;  1QZZ A;  3A1Y A;  2STT A;  1O7L A;  3OY9 A;  1VQO I;  4FCM A;  1MMN A;  2JJ7 A;  4XON A;  2X1D A;  2ZKZ A;  3ZG0 A;  1RSN A;  1HW5 A;  1T0F A;  3MFK A;  2PJR A;  3G1O A;  3QPH A;  3G71 I;  2ESN A;  3I59 A;  3BR5 A;  4X2O A;  3MVP A;  5M5Y J;  5ICF A;  2ZB9 A;  1T98 A;  1IJW C;  1J2B A;  1YX5 A;  1RGE A;  1BW6 A;  1F4K A;  3KLN A;  5DRV A;  1RLS A;  2LY2 A;  3WOD F;  3DGL A;  3BR3 A;  3F8F A;  2XRO A;  2WGO A;  1T95 A;  1Y8R B;  2VKV A;  3VYT B;  5IOZ A;  1HBX G;  1DVD A;  5GAD J;  3BR6 A;  2ZFU A;  4XSZ F;  3KP3 A;  2HTS A;  3H0G J;  1O3R A;  2TDX A;  3HOY J;  3S14 J;  5H6R A;  1FWZ A;  4DGW B;  2MBF A;  4B1R A;  4B43 A;  4EW5 A;  3A01 A;  4KIB A;  4EVI A;  5KP1 A;  1ZYR F;  3TED A;  1MWT A;  4Y33 A;  2X85 A;  3DBR B;  1WQ2 A;  1XPX A;  3Q9V A;  1N8Q A;  2DFE A;  4LLG F;  5C4X J;  3S5C A;  2XPU A;  2DPD A;  3PL8 A;  2A6T A;  5DYM A;  4BAY A;  4LB6 B;  1ROV A;  3HUG A;  1R00 A;  2L4A A;  1BRS A;  9RNT A;  5FO5 A;  1TZL A;  5LC6 A;  2VT2 A;  1LEA A;  2F5V A;  3E6C C;  2KMU A;  2W84 A;  4JX5 A;  1CGP A;  4BNC A;  2ZHX B;  4AUX A;  3HRM A;  2LSO A;  4BS9 A;  2PLY A;  5LEJ A;  3FBN B;  3BG6 A;  3PGB A;  2FD5 A;  3TDU C;  2WOF A;  4XBX A;  1G4D A;  2RSX A;  4XK4 A;  2XSD C;  1PUF A;  4A3C J;  3OOU A;  4LLL A;  1SPU A;  4A0X A;  2K86 A;  1D5Y A;  3ZR8 X;  3I58 A;  5IT3 A;  2VUM J;  1TWG J;  2KQR A;  3HJE A;  3GCM A;  3L09 A;  1E3H A;  4UB6 C;  5EVH A;  3FM3 A;  4KIG A;  2HOH A;  1GT0 C;  1QBJ A;  3VGN A;  3OWS A;  1TTY A;  5FD6 A;  2E1N A;  4V2G A;  2Y74 A;  4BQQ A;  5FKO A;  2GXB A;  1SII A;  3GEZ A;  3B7C A;  4C3H J;  2XSO B;  2VBY A;  5IW9 A;  1D1B A;  3F72 A;  2IPQ X;  3R60 A;  2EPF A;  1UGH I;  2JZY A;  5IEN A;  2VQC A;  5E3O A;  1FZP B;  1LXE A;  3JTH A;  4BU2 A;  1T8I A;  1T2I A;  3MSO A;  1D0Z A;  3FIW A;  3KP2 A;  3PS8 A;  5B5E C;  3PXM A;  3IKV A;  2DCE A;  2R7Q A;  2BY2 A;  1W00 A;  4LD5 A;  4XBT A;  1SD5 A;  1U5T B;  3EQL F;  3QOE A;  1OHP A;  4I0B A;  1V5G A;  3M4O J;  3M7G A;  2P8T A;  2UUZ A;  4A3E J;  2R92 J;  1VZ0 A;  1ZN2 A;  2CRG A;  2CG1 A;  4YFN F;  2KIU A;  3H9Q A;  2KF5 A;  3H5R A;  3HUG B;  1BN5 A;  4F55 A;  4LB5 A;  1QJG A;  1IN6 A;  3CDL A;  1BC8 C;  4D5F A;  1VQ6 I;  2ZXH A;  4DBQ A;  5IF6 A;  3FHN A;  2BMQ B;  4PGG A;  1ONV A;  1D3Y A;  3PSF A;  3T5X A;  5IY5 H;  3HOU J;  2JTV A;  2GOM A;  2CQK A;  5D6E A;  3V7C A;  1S7E A;  4Z6Y A;  3ZG5 A;  1XMA A;  1LFU P;  4R1H A;  3KET A;  1DE3 A;  1ISK A;  1W2Z A;  3K4K A;  4J5K A;  3ZMU A;  4ZYG A;  1IO2 A;  1Z3X A;  1I3A A;  3J7Y d;  1V5E A;  2NVX J;  3E99 A;  4R1K A;  4A3I J;  1K28 A;  1RRH A;  3S17 J;  1OPC A;  3K1N A;  3HRT A;  3LOY A;  5F04 A;  2IA2 A;  4FR9 A;  1UB9 A;  2OF7 A;  1RUO A;  1JT6 A;  5HS9 A;  4Q5S F;  5E18 F;  5K7F A;  3IJE B;  2NNY A;  4AIH A;  2EK5 A;  2HZD A;  5DUI A;  2IYJ A;  5J4Y A;  2BXZ A;  3ECH A;  3ZQ7 A;  1ON1 A;  3PIO F;  5DDG A;  1V3F A;  4XL9 A;  3D3L A;  1MNM C;  3BTJ A;  4U87 A;  1VQM I;  3WGH A;  5CPR B;  2HQ5 A;  3BG9 A;  1K78 B;  3OYH A;  1YJ9 I;  2X1E A;  3BQY A;  1PY3 A;  3URP A;  3M1C A;  4NUB A;  2O9U X;  3OW2 2;  1XGM A;  3F7X A;  4A69 C;  2VLA A;  1YGE A;  5EYR A;  2X51 A;  1W4M A;  3AG3 H;  2COM A;  3WHC A;  3J7A O;  3VYS B;  1U78 A;  1JV2 B;  3UNG C;  5HNF A;  1RGC A;  3ZQG A;  1T0F C;  3IV5 A;  1BRK A;  1ENH A;  2B1X B;  3PNY A;  2DMN A;  4HF1 A;  2H09 A;  3BQZ A;  1RHL A;  1B2X A;  2IUJ A;  3ULQ B;  2WB1 A;  2K9S A;  2JSP A;  3E5Q A;  4Y13 A;  1MGT A;  1WZ2 A;  4OU0 A;  1OMI A;  1WMP A;  1FP2 A;  2AQE A;  3D0S A;  3KYD B;  1JBT A;  1GMR A;  3M8F A;  1EEJ A;  2G0E A;  1LQG C;  2R7D A;  3WMD A;  3JW4 A;  5EEA A;  1OFC X;  4PK4 A;  3NQY A;  2LYX A;  4U0V A;  1J7K A;  3WTT C;  3A76 A;  1D8J A;  2I10 A;  4CCL A;  1W5S A;  3Q0W A;  4XRS G;  5F1J A;  1SVL A;  1MWS A;  5DD4 A;  1L0O C;  2COB A;  2XGE A;  1P7J A;  2QGU A;  2YSR A;  4YFX F;  3CZ6 A;  2HMJ B;  3KP7 A;  5D4R A;  1Z7L A;  2Y48 A;  3GUD A;  3VOD A;  3ROU A;  3SHF A;  3EUH C;  3K2Z A;  3CDH A;  2Z5U A;  1TBX A;  1ZAO A;  1TJD A;  2XFT A;  2WBM A;  1AQZ A;  1R4M B;  5AON A;  2CFX A;  2DA6 A;  3IRQ A;  1YJN I;  1UW1 A;  2UGI A;  4KVH A;  4CDG A;  1BOB A;  5JVT A;  1VQ8 3;  1ZG1 A;  2MAB A;  2P6S A;  1LNH A;  3M8J A;  5HS8 A;  3WOD G;  3JRA A;  4N6T A;  3HPH A;  5TIS C;  2BU4 A;  1IT7 A;  3KKG A;  2CK3 H;  2SAR A;  3K4N A;  1SD7 A;  3BT9 A;  4A3J J;  1Z67 A;  3DFG A;  4WK8 F;  5FRM A;  1DMM A;  1BBY A;  2Z77 A;  2L7K A;  3M07 A;  1IN4 A;  2XRL A;  3NEU A;  2K3D A;  4XID A;  2PEX A;  2Q2E A;  3U9G A;  1JN5 A;  3EX9 A;  4XLA A;  4EMS A;  1G3Y A;  4K2E A;  3SED A;  4RNZ A;  2EFP A;  5DCF A;  4MHG A;  4A3B J;  3HOW J;  5HOH A;  2DA2 A;  3RKW A;  4JOM A;  3HOX J;  5AIP A;  3LML A;  2W82 A;  4CUG A;  1NG6 A;  4DQ2 A;  3FXJ A;  3KYL A;  3CC2 I;  5FGO A;  5ICG A;  4P55 A;  3BLY A;  4E7H A;  1IDP A;  1SAU A;  2MF7 A;  4IRG A;  4IPA A;  2C11 A;  3PJR A;  1TFK A;  4HKV B;  2V1D A;  3EET A;  3J80 Z;  4ZTJ A;  5BIR A;  1TU5 A;  1D0Y A;  3CC2 3;  2JVG A;  2R7X A;  2CW7 A;  2LVS A;  1GVJ A;  5KAI C;  1KYW A;  5EJC A;  3GSP A;  1IRZ A;  4ZDL A;  2HXO A;  3FMS A;  2K4J A;  3MEX A;  4ZM8 A;  1HQC A;  1FBU A;  1ZEL A;  3EYY A;  3IWF A;  3NAR A;  3LT8 A;  3S3M A;  5AYR B;  2CG4 A;  1PUF B;  4ETS A;  4L8O A;  3SFI A;  2QYO A;  2CW8 A;  1IZ1 A;  4AYB N;  1SJW A;  1P4A A;  4M71 A;  3HX8 A;  5D5W B;  3OXA A;  5ELJ A;  5C3E J;  5AII A;  2X1C A;  1S72 3;  1MMG A;  2ECC A;  1BL0 A;  2OJE D;  1DGW Y;  2NVY J;  1HCR A;  5IPA A;  1W6C A;  3PO3 J;  1FTZ A;  2PBI A;  3HRU A;  3J7Z I;  8CHO A;  1GD3 A;  1R1U A;  2HQA A;  1HKS A;  3NM7 A;  3DP7 A;  2DLL A;  4AD9 A;  3WTV C;  1Z7U A;  3ONQ A;  4FCZ A;  3WA3 A;  4ENN A;  1X1C A;  2IS4 A;  1BIB A;  1TW3 A;  2K4B A;  3U2R A;  4HM0 B;  1OIS A;  4IQ4 A;  5HLI A;  1OCV A;  1SC7 A;  1YO5 C;  2DA5 A;  4CSW A;  2LTP A;  4PJL A;  4CZZ A;  3DBH B;  2VN2 A;  1N77 A;  5H20 A;  2R7S A;  1NB5 I;  1G59 A;  2KIQ A;  2RAE A;  3QPT A;  1QVU A;  2L3D A;  4PFO A;  4HQE A;  3A2K A;  1ZLK A;  1D6U A;  1J5Y A;  2BNG A;  4M9X A;  4BDY A;  2Q0O A;  1TC3 C;  1P6R A;  3TO6 A;  2IA7 A;  1KQ9 A;  3FM5 A;  1WTH A;  2CMP A;  2K9N A;  4D0P A;  1ETY A;  3IWZ A;  3T8R A;  2SBL A;  3EUH A;  3LFK A;  3GRD A;  1YI2 I;  1GMQ A;  3EN1 B;  1W5T A;  1ZR2 A;  1MDM B;  3PIP F;  1QVF 2;  1Z21 A;  4KYW A;  2GIV A;  3FIS A;  2AS5 F;  1FUT A;  1X3W B;  1CQS A;  1KYZ A;  4I4K A;  3L1P A;  3BNE A;  2F2E A;  3RSN A;  1F8N A;  2HMO B;  3IMA B;  2NNN A;  3BY6 A;  1V4R A;  1YE9 A;  1UUW B;  3AGO A;  1H88 C;  4WXH A;  2HVR A;  3BG3 A;  2OOV A;  1D1C A;  3ZMD A;  1PYV A;  3FF2 A;  3DY5 A;  4R8H A;  4WWU C;  1G96 A;  4NHF A;  2R7R A;  1BRI A;  1NWW A;  1W01 A;  2HTJ A;  4ORL A;  3VOE A;  2IS6 A;  2V6E A;  1B2S A;  3CME I;  3EC9 A;  1EH8 A;  4I98 B;  5IYD J;  2XEP A;  5KK1 A;  1IAW A;  4STD A;  2ID3 A;  3G3Z A;  1WJF A;  4LFU A;  4EQQ A;  3CCY A;  2B24 B;  3WR2 A;  1FYS A;  1IQX A;  3FK7 A;  2D2W A;  3F3X A;  4FTH A;  4O3M A;  3KN4 A;  4XRM A;  3H3V K;  2K27 A;  2CO5 A;  5EGO A;  4LSO A;  4I01 A;  4RBO A;  3I9V 2;  3SEQ A;  4LG0 B;  5LEK A;  4OIR F;  1EJ9 A;  3BJO A;  5FFX A;  1N5H A;  3JRE A;  1KU9 A;  1W5Z A;  1QHG A;  1TP4 A;  2QIY A;  1JKG A;  2YX9 A;  3ZP5 A;  4HBR A;  2ZC2 A;  5GSP A;  3CMA 3;  2OZ6 A;  2R41 A;  3BTL A;  3JRF A;  3C2B A;  2CFW A;  1FX7 A;  1LDK B;  2E5Z A;  2JA2 A;  2QSF X;  3BPX A;  3HYI A;  1YI2 3;  1I6X A;  4PDK A;  3RI4 A;  3G1M A;  5GAG J;  2FNQ A;  1Q40 A;  4HM3 B;  2MC3 A;  4EAT A;  1X1D A;  4DZJ A;  1X3Z B;  3WGI A;  1VZZ A;  1EG9 B;  3M8E A;  1JXS A;  1C54 A;  4BXU A;  2KKO A;  4Q53 A;  1PFP A;  2NS7 A;  1CYV A;  3W2W A;  4IHS A;  2QQA A;  5JPU A;  2J5O A;  5CQG A;  3FWE A;  3B8L A;  3OIP A;  1MMD A;  1ORK A;  2IXS A;  3HII A;  3TMO A;  1VQ4 3;  2AQF A;  4XSX F;  5AIH A;  1P2F A;  2EFQ A;  3FXM A;  4RA2 A;  2KRT A;  1S9H A;  2Y0S A;  2DQL A;  2ZXW H;  2YPR A;  2KJC A;  3A03 A;  4HQM A;  2CKF B;  3F0C A;  4C2M J;  2FU4 A;  2RGQ A;  1VQ4 I;  2CUF A;  1KA8 A;  5EG0 B;  2F86 B;  4OUQ A;  2XAS A;  2LP0 A;  3EUK L;  3KP6 A;  1FMV A;  2F5E A;  4OAZ A;  1UCL A;  5EQL A;  1WI9 A;  4E6K G;  2IVM A;  5IYB J;  2K0M A;  4M3F A;  2NRA C;  3B4O A;  4BHP A;  3TP0 A;  3UNL A;  3H1C A;  2UUG C;  5CYV A;  1S5A A;  3KSE D;  1XCB A;  1GOU A;  3NQZ A;  2EBI A;  1KSI A;  3J80 K;  4ZYA A;  1SMT A;  1JI8 A;  1R6R A;  2R7W A;  1SFK A;  5E17 F;  1ZO2 A;  1FP1 D;  3HHG A;  1HU9 A;  3VDX A;  3TBI A;  2CJJ A;  3M8C A;  3CCQ I;  3MQ0 A;  3STD A;  3GZ6 A;  4HBL A;  2NS8 A;  4DJA A;  4HYZ A;  2CFO A;  3FBI B;  5M3F J;  1V57 A;  4M3G A;  1IXR C;  2NXN B;  1U8B A;  3MWZ A;  5D5V B;  1Y56 A;  4I99 C;  5E1X A;  4QIW N;  1LEB A;  5JHU A;  1FGO A;  2HDW A;  2RBI A;  2MLK A;  5AEW B;  1JUM A;  3G6E 3;  3T0Y A;  1XTA A;  5E20 A;  1REP C;  1JUS A;  4I5Q A;  2CV1 A;  1Z1S A;  5EZH A;  5BNG A;  3JUM A;  3IRR A;  3KE2 A;  2M8G X;  4X2H A;  2OUM A;  4AID A;  3R4K A;  2Q1Z B;  4LIV A;  3X40 A;  3TQN A;  2RC4 A;  2L2O A;  2QUF A;  1I6H J;  3HK4 A;  4FE7 A;  5IYC J;  4B3A A;  4YG2 F;  4KNY A;  2L7F P;  2RQQ A;  3E5X A;  1AOY A;  4JYK A;  2IGM A;  1W7P A;  5LGU A;  1US1 A;  4K61 A;  1VQL 3;  1IYY A;  1IGN A;  4A3L J;  2OV7 A;  1RRJ A;  3JRI A;  2ZL8 A;  4KFC A;  1JJ8 C;  2M0M A;  3CDI A;  1APL C;  4L8P A;  3CF5 F;  3Q0U A;  3PZW A;  4P9U A;  2VPL A;  5BPI A;  2MD5 A;  5LGN A;  1H0M A;  4L5J A;  2HMN B;  4OOI A;  1XMX A;  1Y0U A;  5FW5 A;  4IZZ A;  3GME A;  3SYU A;  1ZH5 A;  4B48 A;  4TX4 A;  3UJM A;  2CSO A;  2V79 A;  4JK1 X;  3IAS 2;  2DA4 A;  5AIQ A;  4KT5 C;  2RNG A;  1MKM A;  3TDZ C;  4ASN A;  2WO0 A;  5K7Z A;  2KT0 A;  3MN2 A;  3I64 A;  1K79 A;  4HOB A;  5CJ9 A;  3KZZ A;  1Y0N A;  3H3H A;  1SMY F;  2DOA A;  3PSI A;  2E1M B;  2FX0 A;  3PUF A;  3L2U A;  5BS6 A;  5JLX A;  4IT7 A;  1WH7 A;  2MFZ A;  3HPG A;  3DMC A;  1PJR A;  3EPZ A;  2GBX B;  4UUT A;  1QAK A;  3WE3 A;  4HAA A;  3KPH A;  1KQ0 A;  4XLC A;  5TGT A;  1TP6 A;  2LBF B;  2DPU A;  5DRE A;  5FJ8 J;  5A2Q K;  3TO9 A;  2EZH A;  3QK9 A;  4MJD A;  3ZXS A;  4NQW A;  3PYJ A;  4FQG A;  4IHV A;  3MKL A;  2M7O A;  1RET A;  1BI2 A;  3F9S A;  2BE5 F;  4FX4 A;  1YG2 A;  1E3V A;  1I3F A;  2CUJ A;  4L9V A;  3OYI A;  4CCK A;  3W2V A;  1LE8 A;  2K3F A;  3J7Y J;  3KII A;  3TDG A;  3OOP A;  1RNB A;  1YW9 A;  3LQR A;  2E2I J;  3CUO A;  1AY7 A;  5CF1 A;  2DMP A;  1P92 A;  2BHY A;  2TCT A;  1AKH A;  2VBW A;  2CWV A;  5LLQ A;  3GTJ J;  3JRG A;  2FOW A;  3ER7 A;  1FOX A;  3SZP A;  3R0J A;  2WGQ A;  4E7K A;  1UCR A;  1YRN A;  2M34 A;  3PNT A;  4KUM A;  1SAX A;  2M4K A;  3DTE A;  3BR1 A;  5DV5 A;  2ELH A;  4BTX A;  3HTS B;  1OF5 A;  3LZA A;  4AEQ A;  1QZY A;  1POG A;  1AVL A;  3CMM A;  4BE1 A;  1BNF A;  2WV0 A;  1K83 J;  4UUS B;  5CVJ A;  5EEG A;  3OYF A;  3N97 A;  2R5Z A;  1PDN C;  2CS3 A;  3PO2 J;  3JSP A;  3T8T A;  2L5Q A;  3I54 A;  4Z2Y A;  4BAC A;  3KZT A;  1EQK A;  4PJN A;  4BQN A;  4FCY A;  2OA4 A;  1O7H B;  1UHS A;  2OQR A;  4LK0 F;  3A0B C;  2DDA A;  4HPQ A;  1ZRF A;  5E79 C;  2E19 A;  2D5V A;  1GXP A;  1JJ6 C;  3HOV J;  4L9J A;  2KFD A;  3GX4 X;  4I0A A;  2HYJ A;  2PMZ N;  3CJT B;  3LH4 A;  3NAU A;  3RCO A;  3LYG A;  1XGN A;  2O3F A;  4GO1 A;  1BNS A;  2RGV A;  1EUI C;  3CUQ B;  1B1B A;  2F5F A;  4I7H A;  4K1V A;  1ZHF A;  2OQG A;  2HKO A;  4S0H B;  1LVK A;  1PYL A;  1QVT A;  3DPL C;  3JUN A;  2ISY A;  3GLL A;  4E7S A;  1KC8 4;  3GTO J;  1J59 A;  4FX0 A;  4IHW A;  1YQA A;  3RDI A;  3CC7 I;  1BSC A;  4A5M A;  3F14 A;  1P7I A;  1B8I A;  4FMA A;  5GAE J;  4PZJ A;  1BAN A;  3GTP J;  2HVQ A;  3OYC A;  5DM7 F;  4XKB A;  1WVR A;  2XAJ A;  3GTG J;  2RKH A;  4NNJ A;  3CC7 3;  4X1E A;  2ADU A;  4D9J A;  3RPU A;  1Q42 A;  3EBY A;  1OR7 A;  4O02 B;  2QCO A;  3CF2 A;  2XGC A;  1NG7 A;  4EJW A;  2GBW B;  5EDN A;  5H6Q A;  1QA6 A;  1X3U A;  2M2E A;  5E1Z B;  4BY7 J;  4HW0 A;  2KXG A;  3H5A A;  3BOQ A;  2JMW A;  2L02 A;  4RS8 A;  4AVP A;  1WJ5 A;  3O8G A;  4GCV A;  3HOH A;  4ZYE A;  4L9T A;  3GTL J;  4E7J A;  3S2W A;  3ZMZ A;  3HOT A;  2XSH B;  1W0U A;  3E0J B;  1XSD A;  4KIF A;  4N4O B;  1ZGA A;  1YIO A;  2XIG A;  3WU2 C;  1BRJ A;  2Q07 A;  5JVG F;  2Z7A A;  2JA6 J;  1EKM A;  4OWR B;  3ZPL A;  2CQX A;  3AG1 H;  2JQ7 A;  1NDO B;  2JDI H;  4HOH A;  5FKM A;  1T6S A;  1FOY A;  2PJP A;  3DGO A;  1X2M A;  1DVC A;  1AWC A;  3TW6 A;  2DN0 A;  2YR2 A;  4HZF A;  4WF2 A;  5F6F A;  3CME 3;  3KE7 A;  3M9A A;  7GSP A;  1K73 4;  3ZN0 A;  2JPB A;  4G7H F;  3G8Z A;  3F40 A;  3F8N A;  1UJ8 A;  1D8K A;  2EZL A;  5E8I A;  5HNH A;  4WX9 A;  3NQO A;  2FXA A;  2P7C B;  4CGZ A;  5IG0 A;  4MQ9 F;  5LHH A;  2K3P A;  3EYI A;  5EZG A;  5ERI A;  2K40 A;  3C7J A;  4BJ5 C;  2OU2 A;  2BW3 B;  3CPW 2;  2BY0 A;  2M0C A;  1K61 A;  2QSH X;  2Z2S B;  4GYG A;  3CCL I;  4BQO A;  3H5N A;  1FYL A;  3GAX A;  2F4Y A;  3LAP A;  3OYA A;  3P9C A;  1QRY A;  3JCU C;  4XM4 A;  3IPT A;  1O7N B;  4HM6 B;  3NBR A;  3DBL B;  3D79 A;  2Y75 A;  1VFC A;  1JT0 A;  3CNX A;  3H9J A;  3DLL F;  3HSR A;  4CCM A;  2L01 A;  3FKI J;  3WU1 B;  3RZO J;  1IRG A;  5LRS A;  4DKI A;  2K54 A;  2R3S A;  2WAQ N;  3ABL H;  4A12 A;  1B27 A;  1MMS A;  2IBD A;  2P05 A;  3IUO A;  1OGZ A;  3WGG A;  5IEO A;  4XKV A;  1FTT A;  1MH3 A;  1Z3Y A;  3MKZ A;  3HL2 A;  2C10 A;  3NHX A;  4MEI A;  1EV7 A;  4M9Z A;  4YEL A;  1IV6 A;  1FUW A;  2QLZ A;  1JHH A;  2A07 F;  3CCU I;  4MMX B;  1VQK 3;  3ZMV A;  2ACJ A;  1IT8 A;  2DTR A;  5M18 A;  3CPO A;  1OGX A;  2MD0 A;  1WI3 A;  1ZRC A;  2DK5 A;  3FXQ A;  1DP3 A;  1XSX A;  3LSJ A;  2XRX B;  3RQI A;  2WC2 A;  1HKT A;  3CES A;  4PCQ A;  4L0Z B;  3QPS A;  5G2G A;  2KIS A;  1UUV B;  2ZME B;  3G4S 3;  1OLT A;  4F3Q A;  5B1B H;  3MAJ A;  3IHU A;  2ETH A;  2VXD A;  4CYC A;  3F8X A;  4HZB B;  1P4W A;  1MD0 A;  4D7M A;  1H8A C;  2W7N A;  1FOK A;  1PP8 F;  4BY1 J;  3R0A A;  3W6K B;  1IRF A;  5L3G A;  3QQA A;  1HYF A;  1PUE E;  3JAM K;  3U1K A;  3K63 A;  5HVQ C;  2ZNY A;  3FMR A;  6RNT A;  7RNT A;  3H35 A;  2C6Y A;  3BDD A;  3BCA A;  2HS5 A;  3FDY A;  5CXO A;  3OMY A;  2V7F A;  3E6D A;  2DOE A;  3ZQI A;  2LOO A;  3D5R C;  2O61 A;  1FBS A;  3LSP A;  1P4X A;  4XMY A;  5JLW A;  4BHB A;  1G2H A;  1Y8Q B;  2W25 A;  1S7A A;  3AMO A;  2FNA A;  2QEN A;  2QKL B;  2KHM A;  4WYK B;  1YNV X;  1Q86 4;  1JGG A;  1CEW I;  2XAF A;  5I97 A;  1VQ5 3;  2STD A;  2W57 A;  1ETQ A;  3H92 A;  1TRQ A;  2GU1 A;  2O3O A;  3BNC A;  2MC4 A;  3NBB A;  4D5C A;  1XN7 A;  3S1R J;  1DPU A;  1WSU A;  3PCS A;  5M19 A;  4J5G A;  1Z6T A;  2QEX I;  3LSK A;  3FLJ A;  3X3X A;  3PM1 A;  3I56 3;  1O7F A;  3NM2 A;  2GU3 A;  5LFA A;  2M4G A;  3BWG A;  1BSD A;  2LF7 A;  3HDD A;  3OYB A;  4IOA F;  3S8P A;  2K9L A;  1WWX A;  4L5I A;  1O3T A;  2NVQ J;  4CCV A;  3ASN H;  1FJL A;  2ME6 A;  2FE3 A;  2FEZ A;  4BQA A;  2P7V B;  2DA3 A;  3BZC A;  2F4M B;  4FHT A;  4XRF A;  3BIR A;  3FKA A;  5CKT A;  3W6J B;  5JFR A;  3FKJ A;  4UUS A;  4U0Y A;  3K5T A;  1ERD A;  3ABT A;  2XC7 A;  4CCO A;  3CQZ J;  3G73 A;  1BA5 A;  4WYK A;  2DQR A;  2JA7 J;  1XGO A;  4A2U A;  4A3F J;  3EUA A;  3V99 A;  2DDB A;  4RBN A;  3GF2 A;  2VOD A;  1T08 B;  5ILS A;  1JB5 A;  3GLX A;  3IC7 A;  1S3J A;  4BJT A;  4DIQ A;  4GFB A;  4IL6 C;  5C4J J;  3WTY C;  1B9N A;  2PN6 A;  3HM5 A;  3ZQC A;  1YHQ 3;  2X6O A;  2BMR B;  1K8A 4;  3CCS I;  1GSP A;  1YJW I;  1MH4 A;  1XGS A;  1DP7 P;  2CWU A;  4KFE A;  2OOV C;  3HOS A;  4EM2 A;  5D5X B;  1EH7 A;  2KLO A;  3D5S C;  3E1S A;  4H3U A;  2DT5 A;  2HGC A;  4D1Q A;  1BRN L;  4UVC A;  3CC4 3;  3BZ6 A;  4QSH A;  2F4I A;  2M45 A;  4HG2 A;  1A31 A;  2V1L A;  3S32 A;  3QU6 A;  2E2T A;  2EIK H;  4AIK A;  4M9S A;  5CVR A;  4ZZL A;  1C0W A;  1O57 A;  2L4M A;  5AYS C;  1L3L A;  3HRS A;  3Q3S A;  4PJJ A;  3S3O A;  3P5J A;  2R7T A;  3HHH A;  5IER A;  2A5Y B;  2JPC A;  2ZFW A;  1Z6R A;  4XLP F;  5GAH J;  2DT7 B;  1TLH B;  3CLO A;  4N9H A;  1W36 D;  2BEO A;  1I3Q J;  1A36 A;  1E3R A;  3K4C A;  1ZGX A;  2UX0 A;  1V5F A;  3O8H A;  3OS0 A;  1QAL A;  1UCK A;  2KAA A;  2OTJ I;  5M5W J;  1A2K A;  3ABM H;  3PFI A;  3HTU A;  3RGA A;  1IUY A;  2OPT A;  2QF7 A;  1VQ7 I;  2Y73 A;  3WTW C;  1YW8 A;  2DMT A;  1KQS 2;  3ECF A;  2EV0 A;  4L5E A;  2QWW A;  1TNS A;  1OHS A;  4LZI A;  3OWT A;  3LWF A;  3HGG A;  2W2C A;  2RCD A;  4MGR A;  3CO6 C;  4ANJ A;  1GMP A;  1B2U A;  3OIQ A;  3FMQ A;  3I71 A;  4RLQ A;  2X0L A;  1BJA A;  2LH9 A;  1J9I A;  4MFD A;  3MMY B;  5E1W A;  2QVO A;  2W0Q A;  2YFJ B;  1T56 A;  3BCB A;  1ETV A;  1QQI A;  1WJD A;  3R61 A;  4EV2 A;  2MLG A;  2XF7 A;  3CNM A;  3HIF A;  1VQ8 I;  5TGN A;  2E1O A;  1FUS A;  3MWM A;  3VSY A;  4KT3 B;  2GXG A;  4PGH A;  5FLX K;  3GZX B;  4C30 A;  2K5C A;  3F6V A;  5FKN A;  4AKZ A;  3LA3 A;  1NB3 I;  5F64 A;  1D1A A;  1UMQ A;  4QLC U;  1FNN A;  1W7C A;  1Y6I A;  5J1Y A;  1UAA A;  3FF0 A;  4RGS A;  4EYC A;  1X1U A;  1R22 A;  1RC9 A;  3VSK A;  1W6Y A;  5K5O A;  4HA8 A;  1OCT C;  3G0K A;  5K7H A;  4MTD A;  1Z91 A;  1SEU A;  3S1M J;  1A5J A;  1W1W E;  4XOT A;  5CVI A;  1LRA A;  1TW2 A;  2BY1 A;  2DYS H;  3WG9 A;  3ZOB A;  1FIP A;  5LHI A;  2N8G A;  2OTJ 3;  1I2F A;  3UL5 A;  4Q47 A;  3DTI A;  5HDG A;  3DM8 A;  5BXQ A;  3HSF A;  3LNQ A;  3AL0 C;  1RNT A;  4ZDP A;  1HC8 A;  5HDN A;  1BC7 C;  4XN0 A;  1O4X A;  4Y17 A;  2W24 A;  1LQM B;  4G7Z F;  4EM0 B;  5E3L A;  2VON A;  2W03 A;  3LTB A;  3I5U A;  5A2Q Z;  3AKZ A;  1YOV B;  2EH3 A;  1W5C C;  1XC5 A;  3PUB A;  4HAM A;  2GQQ A;  4KA4 A;  2QA4 I;  3DGM A;  3CXC 2;  1E2X A;  4S04 A;  3GFJ A;  3S2H J;  2VQH A;  2LDU A;  5FGM A;  1B8I B;  1ASK A;  2W00 A;  1YVS A;  2RFR A;  1LOY A;  4GHO A;  5JBS A;  1CYU A;  5JI6 A;  5KP3 A;  3A0H C;  2P81 A;  1I1S A;  1TNT A;  3DTK A;  5G1L A;  3QP6 A;  4XBY A;  2ZME C;  3K69 A;  3JRC A;  1KD1 4;  3JRB A;  1R36 A;  1B9M A;  2YFI B;  3BNB A;  3MG3 A;  3LXU X;  2HZT A;  4UUV A;  2DAO A;  1ZTR A;  2K9Q A;  2B9S A;  3UB1 A;  4NC7 A;  1UHW A;  3O3K A;  3ZGK A;  2OQE C;  3WU0 A;  3W2A A;  3ABU A;  3CUQ A;  3L2V A;  2P09 A;  3IH2 A;  4OVM A;  2WTE A;  1MSF C;  2LG4 A;  2DU9 A;  2JQ5 A;  3T8U A;  1N8R 4;  2LMD A;  3LOC A;  1SFX A;  3K1P A;  5L3E A;  4ENJ A;  2AXL A;  2XF3 A;  1I70 A;  3X2Q H;  2IS2 A;  2FML A;  1A90 A;  2LR8 A;  4XRS A;  1U3E M;  2VPR A;  4IHX A;  4FIS A;  2OCT A;  2I5U A;  4TV7 A;  3OYN A;  1Z1D A;  1BSA A;  1YW7 A;  4HNT A;  3CCE I;  5KHD A;  1LOV A;  2QZ8 A;  2YX4 A;  4XR6 A;  4CJN A;  4XLH A;  1ACI A;  5D8L B;  1OCP A;  2FF4 A;  1RCK A;  2IUK A;  3K70 D;  2MC8 A;  3MZH A;  1RCL A;  2IGK A;  1Q40 B;  2W56 A;  5CF2 A;  4LIT A;  1FEX A;  4UVA A;  2D1V A;  1IF1 A;  2H8R A;  3G6E I;  2R5Z B;  2F56 A;  1W2B 2;  2LD5 A;  2QSG X;  1V54 H;  5GPA A;  1STF I;  3E6B A;  3G4S I;  2W04 A;  1B2M A;  2DFF A;  3DCF A;  2GOX B;  2QQB A;  1OF5 B;  1MMA A;  2A05 A;  1A2V A;  5FKL A;  2ML6 A;  1MBE A;  2MG4 A;  4J19 A;  1F36 A;  3EDP A;  3COA C;  2OC6 A;  1MBG A;  4HLX A;  3ROB A;  3S27 A;  2X9D A;  3CC4 I;  1Y1V J;  1BI1 A;  2P4W A;  4BE2 A;  4IRI A;  2KZG A;  3MG1 A;  1MJB A;  2HU9 A;  2R7F A;  4U88 A;  1T2K A;  3BR2 A;  2HNH A;  2VXZ A;  3JVC A;  1JJ2 2;  2H0H A;  2YX7 A;  4IRH A;  4DYR A;  4LJZ F;  4XKC A;  2V9V A;  1B59 A;  1BVI A;  1HKQ A;  4XDW A;  2P5V A;  1LDD A;  3S16 J;  4XOP A;  2YU3 A;  3HB9 A;  4GYI A;  4BXF A;  4FT8 A;  4KFF A;  4NQW B;  3OSF A;  4JBA A;  1E3O C;  3F6O A;  3GZN B;  3U1D A;  1IVX A;  2H0G A;  3X3Z A;  1LNI A;  2VJI A;  1I2E A;  1CF7 B;  5D5U B;  2LBF A;  3E7L A;  4ZYH A;  2GXA A;  4FCJ A;  1J09 A;  4IVN A;  2JVH A;  4L18 B;  2L9S A;  2R7U A;  4PEJ A;  2ZO4 A;  4IOC F;  3S3N A;  3OWU A;  3HI7 A;  3OV4 A;  1I0X A;  1IV8 A;  3E97 A;  2NS0 A;  4AYB A;  2XKP A;  4N6N B;  4MIM A;  4V19 K;  2LF8 A;  3IAM 2;  3GTQ J;  1AA7 A;  1ZK8 A;  5HLG A;  1R5H A;  4JP0 A;  3V42 A;  4WXD A;  3S28 A;  4EBG A;  1QNT A;  3L2C A;  4NB5 A;  2OD5 A;  5LBQ A;  2CGP A;  1NK2 P;  4H4K C;  1N25 A;  3WTS C;  1HLV A;  3WA2 X;  5FLV A;  2R0Q C;  2E2V A;  4BEH A;  1JE8 A;  1FOW A;  4HEA 2;  1BR1 A;  2EWN A;  2HMM B;  3TKY A;  1GOV A;  2WAF A;  3P9K A;  2BZT A;  3SEZ A;  4CXF A;  1MNL A;  1WNH A;  3RKX A;  3HGY A;  3SOA A;  4C9Y A;  4K1U A;  1E3P A;  2P0W A;  4RB1 A;  2XPW A;  4HDV A;  3ASO H;  3RKQ A;  3WOF B;  4A3D J;  1W7P B;  1GUU A;  1TT5 B;  2IA0 A;  1U5T C;  2Q8K A;  1W4N A;  3HSE A;  4BH9 A;  1SFU A;  5JPP A;  3JR9 A;  3H3Z A;  3KCH A;  3RYR A;  1I5Z A;  4QPO A;  3E5U A;  3K10 A;  5BOX A;  3RYP A;  3QYF A;  1WJB A;  3V8J A;  3C2H A;  3RPQ A;  3NXJ A;  1GXQ A;  3WDG B;  1UGI A;  2F5D A;  4EGZ A;  1O3Q A;  3RZD J;  2BVM A;  5JR3 A;  1SD6 A;  2EQR A;  4BEH B;  2V1X A;  1M90 4;  1G8X A;  1Q1H A;  3AG2 H;  2V9K A;  4M3D A;  4NRE A;  1J0R A;  1R1V A;  3FX3 A;  2AXT C;  5M3M J;  4HM1 B;  1OCO H;  4HLY A;  4OIN F;  4I09 A;  2C4B A;  2CX0 A;  1FY7 A;  5IG4 A;  4DOZ A;  2XB0 X;  1UZC A;  2EIN H;  1RUN A;  1ETW A;  2KP6 A;  1IV7 A;  1SFO J;  2BOL A;  2O7O A;  4JF8 A;  2J5P A;  3NV0 B;  1ZGW A;  4BU4 A;  1RI7 A;  3BP8 A;  1BNJ A;  4CA0 A;  1UUG B;  3BLZ A;  1FA3 A;  1LDJ A;  1OPY A;  3DPT A;  3SJM A;  4ITV A;  4G7O F;  1Q7Y 4;  3LAJ A;  1I0V A;  1ON2 A;  2DOD A;  3C18 A;  1HKX A;  1ZS7 A;  2IEK A;  1X19 A;  3N9H A;  1BUJ A;  1IDZ A;  1W7P D;  3ISP A;  3JTG A;  3K7C A;  2RDP A;  4KMU X;  4WXC A;  4HF2 A;  4B09 A;  3OS1 A;  1KQ8 A;  4LG3 A;  3RGR A;  1G3S A;  1WJC A;  2MH2 A;  1CF7 A;  2WY8 Q;  1R5I D;  3LFU A;  5AIF A;  4IHT A;  3WTU C;  1W6G A;  4GDF A;  1UG2 A;  3DUK A;  4HST A;  1BAO A;  3K4J A;  2LLK A;  3OR1 C;  3MKW B;  2ZXJ A;  1W36 C;  4EXR A;  2HQR A;  4G6D A;  2XAU A;  3P7N A;  2UZK A;  2WAD A;  4DW6 A;  2HVS A;  3DU6 A;  1ETX A;  2A61 A;  2XHK A;  5K5R A;  1KGS A;  2O8K A;  4HRI A;  1PU4 A;  2LRD A;  3RJP A;  1IC8 A;  1SAN A;  2IGO A;  2D45 A;  1Q7H A;  4OK0 A;  4XOR A;  3HXL A;  2EFN A;  4EV0 A;  1A6Q A;  4BKX A;  2H6C A;  5IT9 K;  2DA1 A;  2JSC A;  2XB5 A;  1MBK A;  2X6Y A;  2XPV A;  4O5V A;  1MWU A;  2O0Y A;  4N6U A;  2MYS A;  5F1R A;  4XDV A;  4RAZ A;  4B4C A;  2HPM A;  4KN4 X;  3I55 I;  5B1A H;  3WTX C;  2DO7 A;  1DU0 A;  1WHU A;  3V8L A;  1B20 A;  4QWT A;  1BI3 A;  1WJE A;  4XLF A;  2F5W A;  1ZAR A;  2HXI A;  1ZX2 A;  3BRO A;  1GY6 A;  3BND A;  1IN7 A;  1RGF A;  1BUQ A;  2E34 A;  3N54 B;  1U8C B;  1Y4K A;  3I56 I;  3O8Y A;  2L9V A;  2VE8 A;  4UXN A;  4C2U A;  1DET A;  4X6A J;  2W9P A;  3FG4 A;  2R7O A;  2M7A A;  2R7V A;  2EV6 A;  5J1R A;  1OUN A;  5CLS A;  2NAZ A;  1SFE A;  2DFI A;  4HVN A;  3CCR I;  2FJ1 A;  4O6J A;  3VEP A;  3LQQ A;  2FRH A;  3GBG A;  4LG0 A;  2HYF A;  3KYC B;  2Y0M A;  1F43 A;  3WOE B;  1AV4 A;  4C3J J;  1UST A;  1R9T J;  4HM2 B;  1ETK A;  1X1P A;  1M9G A;  1YJN 3;  2JUG A;  3EN8 A;  7STD A;  2ZSI B;  5J1U A;  1I2G A;  5IOY A;  4RB2 C;  3D5G A;  1BR2 A;  3D9R A;  4YIR X;  2M7B A;  3NWT A;  4JQF A;  3CO7 C;  3DXO A;  1YVB I;  3K9M C;  4HM8 B;  3QWL A;  4XNF A;  5IG5 A;  1RMS A;  3CCM I;  2OTL I;  2YU9 J;  1GV5 A;  4P5O A;  3MYT A;  4E7Z A;  1F1Z A;  1I1G A;  1YYV A;  2Z9O A;  2AAD A;  2XF5 A;  1RN1 A;  4G1M B;  2HOE A;  4P9F A;  4CZC A;  3BTI A;  2ZDJ A;  4PSW A;  4PUS A;  2QEX 3;  3JUP A;  2Y9Z A;  1XD7 A;  4ESJ A;  1VQP I;  1OCR H;  4R79 A;  1HOM A;  1BJZ A;  2GSP A;  3CJN A;  2DXI A;  1O7W B;  3FZV A;  1WH5 A;  1STD A;  3KP5 A;  1BNE A;  3RPU D;  1Y1W J;  4M6X A;  2V4J C;  4L0Y B;  3GFM A;  3BZK A;  3CP2 A;  4UHT A;  1MDM A;  2CFD A;  2BVL A;  2Z76 A;  4FMC A;  3LTA A;  2Y0S N;  3NV0 A;  2PFB A;  1YFH A;  1JUP A;  5FLM J;  2P5K A;  1ZQ3 P;  3VF1 A;  3CCU 3;  2M3A A;  1W02 A;  2LKX A;  2HOA A;  5J6X A;  4S05 A;  2HEO A;  3CCJ I;  1TTO A;  1TQI A;  1ZR4 A;  3Q2P A;  3OIO A;  2L7M P;  3T1B A;  4XM3 A;  2ZJQ F;  1J2X A;  3FSD A;  4U0W A;  5IP6 A;  2VAS A;  1XSV A;  2L9R A;  3BJA A;  5GP9 A;  1RZ4 A;  5E3M A;  1MBH A;  5ELU A;  4RAY A;  2O03 A;  3F8H A;  1O7P B;  2ISZ A;  3LSH A;  4XLN F;  2H0I A;  2DT6 A;  3DZL A;  1WCM J;  5J47 A;  3L2Q A;  1IN5 A;  3DXJ F;  3FXL A;  3H3U A;  4A6E A;  4IHY A; 
#chains in the Genus database with same CATH homology
 3AMO A;  3EQQ B;  1IDP A;  4WYK B;  2MF7 A;  1Q86 4;  1JKG B;  1K41 A;  1CEW I;  5I97 A;  1VQ5 3;  2STD A;  3NBB A;  2C11 A;  1JB4 A;  1TFK A;  2GU1 A;  2O3O A;  3BNC A;  4HKV B;  1TU5 A;  1YIT 3;  3CC2 3;  3PCS A;  3EF8 A;  3CCR 3;  3FLJ A;  3L0R A;  4O2H A;  1JRQ A;  3OWY A;  4ZM8 A;  3X3X A;  5AYR B;  2GEY A;  3FGY A;  3LT8 A;  3T8N A;  3I56 3;  3NM2 A;  2GU3 A;  4L8O A;  1SJW A;  1V74 A;  3HX8 A;  1IVU A;  1SIH A;  3OXA A;  3NUV A;  2XR8 B;  5ELJ A;  2CC3 A;  5AII A;  1YJW 3;  1S72 3;  3F7S A;  4CCV A;  4GB5 A;  1W6C A;  3I0Y A;  8CHO A;  1LVN A;  1VQM 3;  3FKA A;  3CCV 3;  1GD3 A;  4N6M A;  1YJ9 3;  5KP4 A;  3NM7 A;  3CU3 A;  3K5T A;  3I55 3;  4FCZ A;  3WA3 A;  3HIG A;  4WYK A;  5AEU B;  1GYB A;  4GL6 A;  3QRD A;  3RDE A;  4HM0 B;  4RBN A;  1N9E A;  3V99 A;  1M1K 4;  3PCR A;  3EHC A;  1OCV A;  1JB5 A;  1OAC A;  1VQP 3;  2P0X A;  1NB5 I;  1K8A 4;  1YHQ 3;  2BMR B;  1D6U A;  1OHO A;  2BNG A;  2CHC A;  3HZP A;  1MOL A;  1GD4 A;  4KFE A;  2CWU A;  3NX0 A;  1JN5 B;  2E2U A;  2OOV C;  2CG0 A;  3EE1 A;  2IA7 A;  3SXX A;  2QA4 3;  1OH0 A;  1WTH A;  4H3U A;  1A67 A;  5STD A;  2D42 A;  1TUH A;  2SBL A;  3CC4 3;  1KWI A;  3GRD A;  2V1L A;  3EN1 B;  5CLK A;  2E2T A;  4O8S A;  1O7G B;  1QVF 2;  5AYS C;  1RRL A;  1CQS A;  5IER A;  4I4K A;  4J8T A;  1LOX A;  3BNE A;  1F8N A;  2HMO B;  3IMA B;  1UUW B;  1E3R A;  1UI7 A;  2UX0 A;  4XB5 A;  2OOV A;  1M1X B;  4FMB A;  1QAL A;  4LMI A;  3FF2 A;  4HM5 B;  1A2K A;  3DY5 A;  5D83 A;  3RGA A;  4WWU C;  1G96 A;  1NO3 A;  4N6L A;  4NHF A;  3X41 A;  2Y73 A;  2W56 B;  1NWW A;  1W01 A;  1KQS 2;  1IU7 A;  3ECF A;  4ORL A;  1OHS A;  2HML B;  4LZI A;  3S67 A;  1D6Y A;  3EC9 A;  2BMO B;  2XEP A;  4STD A;  2W2C A;  2RCD A;  3X42 A;  2GEX A;  2FXT A;  2B24 B;  1IQX A;  2W0Q A;  3KN4 A;  2YFJ B;  2P0M A;  2XFS A;  4EV2 A;  1N9J A;  1DMN A;  4WFO A;  2P38 A;  4LSO A;  3CNM A;  4K90 B;  3CCQ 3;  4U13 A;  5TGN A;  1N5H A;  3VSY A;  1W5Z A;  2QIY A;  2YX9 A;  1JKG A;  3FZW A;  3GZX B;  4HBR A;  3CMA 3;  1UI8 A;  3AMO B;  4AKZ A;  2F98 A;  4KFD A;  2CFW A;  2D1W A;  1NB3 I;  1YI2 3;  1W7C A;  2FNQ A;  3BB9 A;  1QVG 2;  1GS3 A;  1Q40 A;  3FF0 A;  4HM3 B;  1TFO A;  4EYC A;  3H51 A;  4HZ9 B;  1VZZ A;  1RKY A;  2W9Q A;  1EG9 B;  1NU3 A;  1W6Y A;  3KFQ C;  4Q53 A;  1PFP A;  4WP5 A;  1CYV A;  1VQ7 3;  3JUO A;  2OTL 3;  3G0K A;  3NBJ A;  5JPU A;  3B8L A;  3HII A;  1VQ4 3;  2OTJ 3;  3UL5 A;  5AIH A;  4H61 A;  2KRT A;  3DM8 A;  5BXQ A;  1WQL B;  1RJO A;  2XH9 A;  1QAF A;  2CKF B;  2RGQ A;  2W03 A;  1VQN 3;  3LTB A;  4CDL A;  3GZY B;  3T0U A;  2BO9 B;  2F86 B;  4OUQ A;  1Q81 4;  3V92 A;  5EQL A;  1WMN A;  2INX A;  2K0M A;  3DGM A;  3CXC 2;  3B4O A;  1ASK A;  5A0O B;  2RFR A;  3UNL A;  5JBS A;  1CYU A;  4N6V 0;  5KP3 A;  2PNC A;  4BTY A;  1S5A A;  1ULI B;  3EB8 A;  1FGM A;  1GY5 A;  3KSE D;  4HM4 B;  4XBY A;  3EJV A;  4J9A A;  1KD1 4;  3BNB A;  3NQZ A;  2YFI B;  1KSI A;  3MG3 A;  3LXU X;  1D6Z A;  2CH9 A;  1ZO2 A;  1ROA A;  1JB2 A;  1HU9 A;  3UB1 A;  2OQE C;  1FGR A;  3ALA A;  3M8C A;  1ULJ B;  1O7M B;  2P09 A;  3STD A;  4HYZ A;  4OVM A;  4L7K A;  3SLU A;  2JQ5 A;  3T8U A;  1N8R 4;  3DGN A;  2XF3 A;  3MWZ A;  4BTW A;  2XGL A;  1SQW A;  1FGO A;  3GWR A;  1IQY A;  5D81 A;  1A90 A;  5AEW B;  3MKI A;  2OCT A;  3G6E 3;  4JRF A;  3SX1 A;  1EA2 A;  3Q90 A;  2ML5 A;  1FGT A;  1Z1S A;  3JUM A;  2IUK A;  4X2H A;  2MC8 A;  1AR0 A;  3CD6 3;  1Q40 B;  2W56 A;  5CF2 A;  2XGN A;  4IIA A;  3X40 A;  3HK4 A;  3MHE A;  6STD A;  4N3V A;  3CCJ 3;  1STF I;  3V98 A;  2W04 A;  4R9L A;  5BVB A;  1OF5 B;  1WMO A;  4K61 A;  1US1 A;  1VQL 3;  1A2V A;  3LTD A;  5IG3 A;  4FCM A;  2ML6 A;  1R4C A;  2ZL8 A;  4R9K A;  4L8P A;  3ROB A;  3S27 A;  3G16 A;  3PZW A;  5AI1 A;  2IMJ A;  2HMN B;  3MG1 A;  4X2O A;  1W2B 2;  3LTC A;  5FW5 A;  1VQ9 3;  1J2B A;  1E97 A;  4MMZ B;  4MMY B;  3JVC A;  1JJ2 2;  1DMQ A;  4TX4 A;  3K0Z A;  3UJM A;  1QMA A;  2L4V A;  5DRV A;  4XDW A;  3DGL A;  5CK6 A;  4HJL B;  2WGO A;  2WO0 A;  4KFF A;  1DVD A;  1IVW A;  2W6J H;  1IVX A;  3FG3 A;  3H3H A;  1IVV A;  3X3Z A;  4FCJ A;  4IT7 A;  5KP1 A;  3DMC A;  4PEJ A;  2GBX B;  1N8Q A;  1QAK A;  1T5Y A;  1TP6 A;  4KZ1 A;  2HMK B;  3HI7 A;  3OWU A;  3S5C A;  5DRE A;  2OWP A;  1ROV A;  3OV4 A;  3QK9 A;  4MJD A;  4LEH A;  3PYJ A;  5LC6 A;  2M7O A;  4N6N B;  3F9S A;  1IV9 A;  1E3V A;  4EBG A;  2BT3 A;  3S28 A;  3TDG A;  3KII A;  2BHM A;  5CF1 A;  2KCD A;  3PGB A;  2WOF A;  3WA2 X;  3FG1 A;  4XBX A;  2RSX A;  4EC6 A;  2E2V A;  1SPU A;  1YIJ 3;  2CWV A;  2HMM B;  1WNH A;  3CCM 3;  1MNL A;  3ER7 A;  4R4K A;  2WGQ A;  5EVH A;  3SOA A;  4K1U A;  3SVA A;  3VGN A;  3OWS A;  3WOF B;  1W4N A;  2Y74 A;  4BTX A;  1OF5 A;  1SII A;  1K9M 4;  3B7C A;  3U97 A;  3LZA A;  4AEQ A;  2XSO B;  5JPP A;  1AVL A;  5IW9 A;  3GZR A;  5IEN A;  3N8B A;  1LXE A;  2CFL A;  3MSO A;  3PS8 A;  3NXJ A;  3PXM A;  3WDG B;  3KZT A;  2A15 A;  1EQK A;  1W00 A;  4XBT A;  3MG2 A;  1O7H B;  2OQE A;  4IPB A;  1OHP A;  1M90 4;  4NRE A;  4HM1 B;  5IG4 A;  2I9W A;  2CG1 A;  1IV7 A;  3LH4 A;  4JF8 A;  3LYG A;  3NV0 B;  3BLZ A;  1FA3 A;  1OPY A;  4K1V A;  1QJG A;  1AVK A;  1Q7Y 4;  4RZM A;  1HKX A;  3N9H A;  1Q82 4;  3JUN A;  5IF6 A;  2BMQ B;  3K7C A;  1KC8 4;  4FMD A;  1RN7 A;  3RGR A;  1DYU A;  5AIF A;  1W6G A;  3DUK A;  2YFL B;  3F14 A;  1ISK A;  1W2Z A;  4FMA A;  4EXR A;  2FGT A;  3J7Y d;  2F99 A;  3E99 A;  4R1K A;  3CC7 3;  3S29 A;  1K28 A;  1RRH A;  5D82 A;  1Q42 A;  3LOY A;  3Q1C A;  1PU4 A;  4FR9 A;  3EBY A;  1C7H A;  4O02 B;  4OK0 A;  3IJE B;  2WOH A;  2GBW B;  1VQ6 3;  2KXG A;  4WHA A;  3MPH A;  2CW9 A;  4N6U A;  3D3L A;  4XDV A;  2XSH B;  4EV5 A;  3KSP A;  2LQV A;  4RNY A;  2Q07 A;  2O9U X;  2Z7A A;  3OW2 2;  4QWT A;  3F7X A;  1IQ8 A;  1EKM A;  1YGE A;  1NDO B;  2JDI H;  2GXF A;  1JV2 B;  1ZX2 A;  1GY6 A;  2CWT A;  2Z6B A;  3BND A;  3DGO A;  3FH1 A;  1BUQ A;  3N54 B;  1DVC A;  1U8C B;  2B1X B;  3FCS B;  3CME 3;  3LT9 A;  1Y4K A;  3O8Y A;  3KE7 A;  2W9P A;  1K73 4;  3FG4 A;  5AIG A;  2IUJ A;  2R4I A;  3G8Z A;  3F40 A;  1NJI 4;  1OUN A;  4HVN A;  4O3V A;  5IG0 A;  5EEO A;  1WMP A;  1VQO 3;  5HGR A;  3CPW 2;  3EBT A;  3WOE B;  1AV4 A;  4HM2 B;  1M9G A;  4HM7 B;  3GAX A;  1YJN 3;  3EN8 A;  7STD A;  3OX9 A;  4XM4 A;  3WMD A;  3IPT A;  3D9R A;  5LC7 A;  1O7N B;  4HM6 B;  3NBR A;  3UL6 A;  3DXO A;  3K9M C;  3NQY A;  1YVB I;  4HM8 B;  2LYX A;  5IG5 A;  3A76 A;  3CNX A;  2HMJ B;  2QGU A;  3SOY A;  3MYT A;  1U5O A;  2K54 A;  3CCE 3;  4G1M B;  3CCS 3;  2P05 A;  2ZDJ A;  1OGZ A;  2XFT A;  5IEO A;  2QEX 3;  2C10 A;  3JUP A;  4AKY A;  3NHX A;  4R80 A;  4MEI A;  1GY7 A;  1N5P A;  1FUW A;  3B4P A;  2CFG A;  1O7W B;  4MMX B;  3G71 3;  1JNQ A;  1STD A;  1UW1 A;  4KVH A;  3CCL 3;  1VQK 3;  1IT8 A;  3CPO A;  1VQ8 3;  1OGX A;  1LNH A;  3WOD G;  2CFD A;  4N6T A;  2Z76 A;  3KKG A;  1IT7 A;  3LTA A;  4FMC A;  2XRX B;  3NV0 A;  2CK3 H;  3CCU 3;  3VF1 A;  1TIJ A;  1W02 A;  1DMM A;  5G2G A;  1UUV B;  3G4S 3;  2Z77 A;  3F8X A;  1IK3 A;  4HZB B;  2CFK A;  3Q2P A;  3U1W A;  3X3Y A;  1JN5 A;  3EX9 A;  1FGQ A;  3FSD A;  3SED A;  4RNZ A;  2CIU A;  5IEP A;  3K63 A;  3JUQ A;  5ELU A;  4LGQ A;  3F8H A;  1O7P B;  3LML A;  5CXO A;  1L5G B;  3DZL A;  4N6O B;  2PZV A;  5FGO A;  3GZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...