2QGUA

Three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
ADAQATVKTAVDDVLATIKGDPDLRGGNLQKVFQLVDQKIVPRADFKRTTQIAMGRFWSQATPEQQQQIQDGFKSLLIRTYAGALANVRNQTVAYKPFRAAADDTDVVVRSTVNNNGEPVALDYRVEKSPNGWKVYDINISGLWLSETYKNQFADVISKRGGVGGLVQFLDERNAQLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable signal peptide protein
publication title Three-dimensional structure of the phospholipid-binding protein from Ralstonia solanacearum Q8XV73_RALSQ in complex with a phospholipid at the resolution 1.53 A.
rcsb
source organism Ralstonia solanacearum
molecule tags Structural genomics, unknown function
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05494 MlaC MlaC protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A phospholipid-binding protein 2qguA02
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qguA01
5G2GA 3EJVA 4HM6B 3B7CA 3D9RA 3EX9A 3MKIA 3F7XA 5AI1A 3OXAA 3HZPA 4X2OA 5IG4A 1S5AA 2QIYA 4HM0B 5CK6A 2B24B 5DRVA 3BB9A 4STDA 3ROBA 3KKGA 3ECFA 3F8HA 4L7KA 4XBYA 8CHOA 2YFIB 3MG3A 3CNXA 3UJMA 5D83A 3EF8A 1GY5A 4HZ9B 2BMRB 3NBRA 1O7WB 4WYKB 2QGUA 3S5CA 4K1UA 3H3HA 2CKFB 2F99A 4U13A 4XM4A 3B4PA 5HGRA 4LEHA 4HZBB 3DM8A 2F86B 3G0KA 3HK4A 5CF1A 3OV4A 2GXFA 4H3UA 3WMDA 1STDA 2PZVA 3JUNA 1OF5A 1JN5B 1JKGA 2INXA 3F7SA 2IMJA 3MSOA 3KE7A 1ASKA 1NU3A 1W02A 3EBYA 2XRXB 3NV0A 3OWYA 1IDPA 3LZAA 2HMKB 1OHSA 1K41A 2HMLB 1DMQA 3FF2A 3H51A 5BVBA 5AIHA 4ORLA 3EN1B 4GB5A 3GZRA 1WQLB 1NDOB 5CXOA 2Z77A 1Q42A 1E3VA 2STDA 5IENA 5AIFA 2BMQB 5BXQA 5IG0A 2Z7AA 4XDVA 3OWSA 4J9AA 3FSDA 1DMNA 1W6YA 1SJWA 3EC9A 3K0ZA 1E3RA 1QJGA 5AEWB 1ZO2A 3E99A 1TUHA 1DMMA 2RFRA 6STDA 4N3VA 1U5OA 4KVHA 4WP5A 1O7MB 3MYTA 4HM1B 1E97A 5FW5A 4WYKA 3HX8A 5D82A 3I0YA 3NM2A 4L8OA 1GY6A 3GRDA 1GS3A 4K1VA 2GBXB 2R4IA 3FKAA 3K7CA 2F98A 3F40A 3LYGA 4R9KA 3SEDA 1ULIB 4RZMA 4HM4B 5AEUB 3NUVA 3KSPA 4LMIA 3A76A 1OGZA 3MHEA 1BUQA 1VZZA 4OVMA 2YFJB 5KP3A 1GY7A 1JN5A 1JB5A 3DUKA 3VGNA 1OHPA 3VSYA 5CF2A 5IERA 1OCVA 2Z76A 1Q40B 2I9WA 3F9SA 1CQSA 2GEXA 1JB4A 3NHXA 4HM2B 4LGQA 2BNGA 3MG2A 4HM8B 5KP1A 1UUWB 5EVHA 2A15A 1OPYA 2XSHB 1Z1SA 1OGXA 4MJDA 3STDA 4J8TA 1AR0A 3BLZA 5AIIA 3OWUA 2CHCA 2GEYA 3RGRA 2HMJB 5IEOA 3IPTA 3CPOA 3NXJA 2B1XB 3FH1A 4WWUC 2XR8B 1A2KA 1GYBA 2HMNB 4IIAA 3CU3A 2RGQA 4X2HA 3F14A 1OHOA 1EG9B 4Q53A 5IG3A 5IF6A 4I4KA 4HM7B 4HM3B 3T8UA 3DXOA 4XBTA 5STDA 3CNMA 1C7HA 3GWRA 1HKXA 3RGAA 4FCJA 3DMCA 4HKVB 3F8XA 3GZYB 2HMOB 7STDA 3EBTA 2JQ5A 3FGYA 4HVNA 1O7HB 2RCDA 1TP6A 1UUVB 2YFLB 4HM5B 1Q40A 3UNLA 3FZWA 3B8LA 1JB2A 3OX9A 5DREA 1ULJB 3T8NA 3M8CA 4R1KA 1O7GB 2UX0A 4XB5A 2OWPA 1O7NB 3JUOA 4OUQA 3EQQB 3FLJA 1W00A 1NWWA 4R9LA 3JUQA 1OH0A 5CLKA 3MG1A 3JUMA 3G16A 1OUNA 4XBXA 4PEJA 4XDWA 5D81A 3SOYA 1ISKA 2HMMB 3GZXB 5AIGA 4L8PA 3B4OA 2BMOB 1ZX2A 3EHCA 5TGNA 3EN8A 4HJLB 4CDLA 5JPUA 1QMAA 3DZLA 4FCMA 3FF0A 3G8ZA 1W01A 3SOAA 3GZBA 2K54A 1EA2A 5IG5A 3KZTA 1OF5B 3JUPA 5JPPA 1JKGB 1O7PB 3ER7A 3Q90A 5KP4A 2W2CA 2XSOB 5IEPA 3NV0B 2GBWB
chains in the Genus database with same CATH superfamily
2NYXA 4XR6A 3A0BC 2K3PA 1GSPA 3GXOA 3CESA 2C4BA 3FF5A 4RAZA 2OZ6A 1TIJA 3GFMA 3ZRGA 5E3NA 1OYIA 1QZYA 1SEUA 1M904 3N54B 4E7JA 3V92A 2QYOA 3EX9A 2O3OA 5ILSA 2GAUA 2M0MA 5AI1A 3EYYA 1IXRC 2DODA 2W6JH 1ON2A 3OXAA 3HZPA 4LK1F 5IG4A 1B20A 1E0EA 1R4NB 1CGPA 4JF8A 1XN7A 2WTEA 3ZN1A 3OS2A 1IN7A 1YE9A 3AL0B 2R5YA 3LA3A 2EFWA 3H1CA 3LFUA 2HR3A 3RQIA 5IW9A 1EH6A 3LSPA 1R36A 4ZH4F 4HQEA 2DU9A 2YX4A 3HTSB 1N78A 3V99A 3R0AA 5CKTA 5J1RA 1BRHA 3RKXA 1VQP3 3J7ZI 2B24B 3OYKA 1IVVA 3V8JA 4FE7A 3K2ZA 1QA6A 1ETQA 4RGUA 2V6EA 3X3ZA 4G1MB 2FOKA 2XIGA 5KHDA 2LSOA 3B6AA 4D7MA 3JRDA 2R92J 2BY2A 2KFDA 1LNWA 4LIUA 4LK0F 4DBRA 1IAWA 4MEXF 3W2AA 2L7ZA 3C18A 2HVRA 1DVDA 3K6GA 4ZTJA 2MC8A 1R4CA 9RNTA 2JT1A 5L3GA 5C3EJ 3ECFA 3HDDA 4J5KA 4L7KA 1NB3I 2OAZA 3HRSA 3ZG0A 1WWXA 2VQLA 1TT5B 1I39A 3NRVA 1FWZA 3FMSA 4FQGA 1HA8A 2SARA 2O61A 3M9AA 1PUEE 2XDVA 8CHOA 1HLVA 2AHQA 2XGNA 3F6OA 2RQPA 3WTYC 3ESWB 1USSA 1IGNA 2W85A 1LVAA 3UJMA 1ROVA 1BNFA 1GY5A 3BY6A 3F6VA 5HS8A 3RDIA 1RIOH 2DMUA 1OCPA 2KP6A 4MEYF 1UDII 3PZWA 2IUJA 3RPQA 2HQAA 2Z2SB 3CCJI 5FJ8J 2PLYA 3AHWA 3KCCA 3SFZA 3BIRA 4K1UA 3GZNB 1O3SA 1SD7A 2OUMA 2BHZA 4E70A 3JRGA 3CCVI 1O3TA 1TC3C 2DXIA 5HGRA 2L9NA 4I7HA 2XFTA 1ODDA 1WMOA 2ETHA 3E5XA 4XKBA 4LEHA 4HZBB 2XASA 5HS9A 4LLNA 1NNVA 2ADUA 2H09A 4L9VA 1FUTA 4RLQA 4PK4A 4LG0B 2KF5A 4D1QA 3OV4A 5DM7F 3DLAA 4I98B 3HL2A 1E3HA 5C4XJ 2BZTA 1SQWA 1POGA 4L5IA 1RNTA 3WMDA 2MA3A 2BBYA 2FEZA 4RBOA 3AGOA 2EBIA 2QQBA 1MGTA 4XKVA 1NK3P 4RM3A 3QPSA 2VPRA 1KA8A 4RB3C 2VQCA 5IYCJ 4MMYB 2ML6A 1X1CA 1OF5A 4KITB 1WJ5A 1K6OA 1FBQA 2PG4A 2FNAA 2GOXB 1YQAA 1J7KA 2Q0OA 1BR1A 2ZMEA 1Q7HA 1FP1D 1Z0XA 2CFGA 2INXA 5M19A 2EK5A 1I0XA 1OMIA 3ZQQA 2IVMA 2VL8A 5GPAA 4ZJZA 1BC7C 1LNHA 5LLQA 5A2QK 5DUKA 2HGCA 4XLAA 4PFOA 4M3GA 2W7NA 1WZ2A 1IDPA 3LZAA 3C7JA 3LTAA 2R7VA 1RKYA 3DF8A 1VQ5I 4BXXJ 3K0LA 4N9HA 3OYDA 1MGRA 1H8AC 2ZC2A 5EEAA 1XGOA 2CSOA 4Q5SF 2ZDJA 2L4MA 3QODA 2TDXA 4FMCA 3AMOB 7RNTA 3HHGA 4DW6A 5FKNA 2CUJA 1TWFJ 3EYIA 3F72A 2DK8A 1IDYA 1E3VA 1T2HA 4RAFA 4DYRA 2QKMB 1W7CA 2STDA 2HOHA 5EYRA 2RBIA 4MQ9F 4MFDA 4ENKA 5FGMA 5HNHA 2X0LA 1LFPA 1S8NA 4P9FA 4FX0A 1FGOA 2E60A 2ELKA 2IS1A 5IPAA 2VBWA 1LPQA 2EIMH 4B43A 1OQYA 1QNTA 3JRHA 4J9AA 2WAFA 1OCTC 5D5UB 3JSOA 1W0TA 3CCLI 4EM1A 2CFXA 1RGFA 3EC9A 3LAPA 1STZA 3PSFA 1J75A 4HDUA 3BWGA 5KNLA 1RI7A 3HRTA 2L9RA 1QJGA 3AGNA 1FGTA 3GF2A 4KT6A 3VDXA 5HDGA 1TUHA 3R6SA 1HDPA 4N3VA 3K4NA 1SFEA 1C0WA 2WADA 3RQ4A 2DK5A 4KVHA 3G713 1I27A 2E34A 1O7MB 2R7UA 4HM1B 2FQ3A 3GTKJ 1TNSA 1ZYRF 4AD9A 1VTNC 2H27A 2BVMA 1AKHA 2GXGA 4HYEA 4JYKA 5C44J 3LOCA 1GS3A 3TDGA 1N8QA 4XLFA 4NQWB 4CUGA 2ZO4A 2ZNZA 1XGSA 2Y2ZA 4RB0A 3SYTA 4Q4ZF 1V57A 2HQ5A 1QZEA 2H8WA 4FETA 4R9KA 1OCZH 3KYCB 2C11A 3H3ZA 2HOAA 1RCLA 2NAZA 3CLQA 5F6FA 4LG0A 2DYRH 1MIJA 1FNNA 3FIWA 3A76A 1V5FA 3IWFA 2CYYA 2EB7A 3HTUA 3JR9A 2CWTA 4BIRA 4HDVA 3SXXA 2GXBA 2HI3A 1WI3A 4FCYA 2IUKA 5J3LA 4KA4A 4OVMA 2OCTA 2YFJB 2QWWA 3TDZC 1YG2A 2Y0MA 2O5RA 1GY7A 3FXUA 1SVMA 4HOHA 1DGRM 2BV6A 3VGNA 4IVNA 2MW8A 1EA3A 1P4AA 4PJMA 1TRPA 2F56A 2NVYJ 3UNGC 4RA2A 1N5PA 2BEOA 4ESBA 3AG3H 4C2UA 1P4WA 4HX4A 2NRAC 3FZVA 2I9WA 3N4MA 2VB6A 4XRSA 2F5CA 4ZDLA 4CICA 4DZPA 3CF5F 2LKSA 3QAHA 4HX8A 2X9DA 4F55A 5DS9A 1AA7A 4AC0A 1ZKGA 2VLAA 2ZL8A 2LOOA 1JE8A 5EJCA 2D42A 1JHHA 3GTOJ 3KFQC 3QRDA 4BTYA 2OTJ3 1U3EM 4GXOA 4MTEA 3CCM3 3H5RA 3NHXA 4F52A 1A2VA 4LGQA 2QBYB 5EF6A 4PZJA 2CH9A 2KDOA 4OWRB 3AMOA 2OPTA 5E1ZB 1ZLKA 1I2EA 4K61A 2VI6A 4A3JJ 3JCUC 1YIJI 4YFNF 2W56B 4HLYA 2XSHB 2HXIA 2K27A 3M1CA 1Z1SA 4UVBA 1S5LC 1ETOA 2DMQA 2JQ7A 4UVCA 5E3MA 3WTSC 5HOHA 2QVOA 3STDA 3CMYA 4UNOA 3OYBA 1D5VA 1MDMB 3B02A 1FMVA 3M07A 2GBYA 3D5SC 3HBLA 1P6RA 5F1RA 3S14J 1XGNA 5ICEA 3WU1B 2CHCA 3OWUA 4DYQA 4EJTA 3ZPLA 5CVVA 1LB2A 3WU2C 1B2XA 2A61A 3GMEA 2E1NA 3OY9A 2HMJB 4CH7A 1F43A 2KIQA 3DTEA 3CCU3 1HKQA 4A3GJ 2V4JC 4M72A 2VJIA 2Y75A 1KWIA 1UCIA 4DQ2A 1A5JA 3VSKA 3S2WA 2XR8B 2QUFA 1LOWA 3DTIA 4CSWA 3PIOF 1WPKA 1A2KA 3E6BA 1GYBA 1Y56A 3D4AA 3LSMA 3Q3SA 2GU1A 2HMNB 3CU3A 5M5XJ 3H35A 1RGKA 1O4XA 4DBQA 1ZQ3P 2FRHA 4A12A 1BNSA 1PFPA 2IGOA 3F14A 3CC43 1U6GA 2HTSA 3CCQI 2CFDA 5FLXZ 4YIRX 1F8NA 1STFI 1EUIC 1SFOJ 4G94A 3J7AO 1DP3A 2W24A 1CF7B 1A04A 5D4SA 4QWTA 1LUJB 5IF6A 1GLNA 2EV5A 3RKWA 4TX4A 2BW3B 3F3XA 2LD5A 1YIT3 2MD0A 2ID3A 3ZN0A 4HM7B 5DUIA 3BROA 1EQKA 3HZJA 2WA0A 4P55A 1ZS7A 2LY2A 2QQ9A 4YIFA 3AAFA 1SD6A 3DXOA 3VFZA 2ESHA 4B48A 1D1AA 2HZDA 1ZGJA 1I0VA 1BRJA 2VT3A 3RNTA 3KYLA 2JA8J 3OIPA 1Y0UA 1RR7A 4HKVB 3ZQHA 5G1KA 2Y69H 3F8XA 2F4YA 2LC2A 1PYVA 4BDYA 3FGYA 1FZPB 4FCZA 4L5JA 4CO8A 2R7XA 3MFKA 3DFGA 1SARA 5AIQA 2YFLB 1MGWA 2DPDA 5IYBJ 2FGTA 1JUMA 3G1MA 2P7VB 4OIRF 1IRGA 3W6VA 2LYCA 2IAIA 1FUWA 2ZXIA 1WGXA 3JW4A 1AQZA 1LEAA 2R41A 1YJW3 2DTRA 2K40A 1IT8A 2VBXA 2DJIA 1RGCA 3OX9A 1JBRA 2DT5A 3PL8A 1YHQI 2EZHA 5LHIA 3SZTA 1ULJB 4DKIA 2Z1DA 2P0WA 4U7DA 1DYUA 1IYYA 2UX0A 3X42A 4G7HF 2QBYA 3HSEA 5FKOA 1BJAA 1B9NA 5F64A 3L9FA 2IBDA 3K4CA 3OYLA 1ON1A 5GP9A 3CUQC 3RZOJ 3K4BA 3EQQB 1N25A 1UG0A 2W56A 5H20A 3V7RA 5D4RA 3KEQA 1REPC 2XGCA 3U97A 4CYDA 2FXAA 1FGMA 2DT7B 3DLLF 3K70C 4II2A 5LBQA 4ZYGA 2DQLA 5AONA 2W00A 2W03A 2CS3A 2XAFA 4O02B 5GTIC 5EQLA 4L9JA 1RESA 3ZMTA 1FYSA 4RM2A 3P5JA 2OD5A 3JRFA 1IXCA 5ICGA 3RTRA 2DOFA 3JUMA 2OTLI 4XBXA 2KF6A 1BIBA 4XDWA 1IN6A 2KKOA 3L2UA 1HCRA 3JSPA 2KF4A 1SMTA 1S7EA 4O3VA 4EVIA 1IJWC 1ISKA 4BHCA 4RNYA 2A3SA 4NDLA 3SEZA 1VQLI 1LDDA 3DU5A 2M8GX 2XAGA 3B4OA 1BI3A 3PUBA 3P9CA 3BNCA 4RGSA 3LMLA 3CCEI 2E1CA 3EHCA 1X1XA 1ZG1A 3ELKA 2DMTA 1W5TA 4XOTA 3TL4X 2B63J 3I4MJ 4XLHA 1QMAA 3CMA3 2MLGA 4A3IJ 3BTCA 3CJTB 4QPQA 4BXUA 2LF7A 3I53A 1M1EB 5E1WA 5JVGF 3S3NA 3PGBA 1M1K4 4D9JA 1CF7A 4OMZA 1HKTA 1Q9EA 3JVCA 1D1BA 1Z1DA 1ZR4A 1JTXA 1MMGA 2PQ8A 2X4HA 3PJRA 2C10A 4IHVA 1K4SA 3BDDA 2PJPA 5IYDJ 3SOAA 4IRHA 2H1LA 4FT8A 2RREA 2XPWA 4U0YA 1K4TA 4CJNA 4S0HB 5C4JJ 3A0HC 3C2GA 1X1WA 4WX9A 3ISPA 3G4S3 2DA7A 3RKYA 2LK2A 3E1SA 3U1DA 1OKRA 1LRAA 4LB6B 1K7AA 2NXNB 2R7TA 1HSJA 4V19K 2CG0A 2RC4A 1FP2A 1B8IB 1VQ83 3BZ6A 3OL3A 2F4IA 4UXNA 2QM3A 3JUPA 4BQQA 3DBRB 1TW3A 2ZJQF 2CV1A 3OL4A 2CQKA 4XMYA 3NWSA 1OCCH 1JKGB 1O7PB 3HOHA 5BOXA 3ER7A 3Q90A 1HBXG 4KFFA 4BTWA 3HHHA 1D3YA 4BJ6C 2JA5J 2W2CA 5K7ZA 2ZA4A 1FYMA 2IW5A 5IEPA 1G0TA 1YJ93 2JTVA 1N9EA 4N6MA 2EH3A 3WE3A 4Y3OA 2P5KA 2GBWB 5G2GA 3ZCOA 3GBGA 1W36D 1YI23 3S2DJ 4M6YA 5KAIC 3EJVA 3L0RA 2CQNA 4XNFA 1Y0NA 1ZG5A 2DPUA 2R7SA 4M71A 4PFPA 3B7CA 3D9RA 3FXOA 4A0ZA 4N6TA 1N77A 4NC8A 1BA5A 2NNNA 1YX5A 1DE3A 1K78B 3HRMA 3KP7A 5IP9J 1UHMA 1B21A 2MSYA 1LE8B 4BL2A 4ZYAA 4XRMA 1UJ8A 1WJAA 1ZARA 3OR1C 4U88A 5H2FC 1T3BA 1X1UA 4IPBA 2O3FA 1WNHA 4BTXA 1BAOA 4N4OB 2A07F 3AHSA 1B6AA 1J2BA 3OIQA 1RKTA 3NQZA 1BI2A 4OU0A 4PGHA 4HM0B 5CK6A 3BU4A 3LSTA 2COMA 2F5EA 4HPQA 1XSXA 2QEX3 5KVRA 3KYDB 3LT8A 3T5XA 2YSRA 1UAAA 3E6DA 1I6HJ 4BEHA 2STWA 1KONA 1MMSA 3X3XA 3BTIA 4XN3A 2W84A 4BQAA 1EEJA 3FG4A 3ROBA 1CYUA 3PXMA 1UHSA 1U5TB 3F8HA 4FASD 3DPLC 1VNDA 4RLFA 2W82A 3CME3 1W5CC 4Q47A 3OIOA 4M3DA 4JK1X 1BIAA 4Z2YA 2YFIB 3CUQB 1IW7F 3HB9A 2R0QC 1RGEA 2XC7A 2BXYA 3F21A 5D83A 2CFLA 3EF8A 2LVSA 3OYGA 3RDEA 4AYBN 1VQK3 1WVRA 4HZ9B 2R5ZA 1MBKA 3EB8A 3WA2X 2E1OA 1OJLA 1R1UA 3MQ0A 1TJDA 2QGUA 2HFHA 5AYRB 3S5CA 2PMZA 1PUFB 3X2QH 1D8KA 2CV0A 2WOFA 1MNEA 4ABZA 2GA1A 4A0XA 1SVLA 2VXZA 3Q9VA 2CFWA 1TWCJ 1UZCA 5D6FA 1JI8A 1SD4A 2XROA 1AVLA 4KISA 4M73A 3RPUD 1YOVB 2KCDA 2UXXA 2IGMA 3CP8A 3HEFA 3D5LA 5HDNA 4A3MJ 1DUXC 5M3FJ 2D5VA 5CF1A 1QU3A 2W1OA 2VKDA 3E3VA 4BNCA 1NB5I 1FOKA 2MBFA 2MGQA 4KDPA 2DYSH 1IC8A 5ELUA 4FTHA 1STDA 1ZAOA 4LJZF 1XMAA 5CQEA 5J47A 4U0VA 1VQOI 2RGVA 3PFYA 2N8GA 3BQZA 2L5QA 3GLLA 4BYYA 2CX1A 2OV7A 4R1HA 2KZVA 3LNQA 3RPUA 5J8CA 1JKGA 3MZYA 3TOBA 4EM2A 4M74A 4P1WA 4DGWB 3QK9A 1K8A4 3S93A 3CO7C 3PNYA 3REOA 2IA1A 3GZ5A 1LFBA 4HG2A 5TJJA 4AIHA 1NU3A 1XTAA 2L9SA 4QSHA 5D5WB 3IV5A 3IH2A 1RR8C 1W02A 1LJ9A 5FO5A 1VQ7I 2XRXB 5JR3A 1P7JA 3D5GA 4G6DA 3GTMJ 1IZ1A 1YGEA 2HMKB 5B66C 2A5WA 1OHSA 2E5NA 2IGKA 1H89C 4IRGA 2DFFA 5LGUA 1N5HA 3H3UA 3LT9A 4U87A 4ORLA 1K78A 2LQVA 3BNEA 3HJEA 3GO5A 1YRNB 3GZRA 3FXRA 1NDOB 1X1DA 3CCSI 2AQFA 1LE8A 1GD3A 2E2VA 5CXOA 1YW7A 4ZDPA 2H0GA 3LQRA 3QPLA 2JA6J 5J4YA 2JWTA 5F0CA 3WHOA 4CCVA 3K4LA 3FKIJ 2EILH 1Y39A 1F9NA 4JP0A 3SDGA 1WJDA 3EQLF 1FLIA 3JRAA 5JVTA 2GIZA 3IH4A 5BXQA 1V4RA 4BY1J 4IL6C 2K9LA 2K3DA 5IG0A 1XCBA 2Z7AA 4XDVA 1QALA 3V42A 2E2JJ 3M4OJ 4IZZA 1MSEC 1A36A 3G6EI 1DP7P 5LD2C 3OYMA 1RC9A 3HOVJ 3M1EA 3MZ8A 4PJLA 2XVCA 4HA8A 4B3XA 2PJRB 2VASA 3EPZA 4A3LJ 3J7YJ 1U5TA 2FUG2 5FD6A 3MKLA 3FG1A 4IOCF 1FBUA 2M34A 3K0ZA 5LEJA 4XLPF 1N75A 1OLTA 1QZZA 3LTBA 4OIPF 4IHTA 3CO6C 4FMDA 5AEWB 3BG7A 3CUQA 3S1RJ 1DMMA 2RFRA 1IDZA 3TGNA 1BR2A 2V26A 1FA3A 1ZHFA 1C54A 3KCHA 2EIKH 2FX0A 3F8NA 1ZN2A 2F5FA 7GSPA 3TO9A 4I01A 2KHMA 4HX7A 3LA7A 2KXGA 1CEWI 1IRFA 3MYTA 3CZ6A 5FW5A 2LY1A 5ERIA 2HVSA 4WFOA 5RNTA 3HX8A 5F1JA 5D82A 4CYCA 3L2CA 4S04A 1PUFA 4FE4A 2IS2A 2F5DA 1T2IA 3GVAA 3NM2A 1GY6A 3GRDA 4BJTA 2B0LA 3OS0A 3W6JB 3S3MA 2M7BA 3FXKA 1FGQA 4XKCA 2DMNA 3E6MA 1M9GA 4MHGA 2GBXB 3C2BA 2K9MA 2ZJ2A 4G8XA 4XRFA 2F98A 3F40A 1VQ93 2JA2A 3PNTA 1ULIB 4XK4A 2BVLA 5AEUB 3KSPA 1RHLA 2VKVA 4NC6A 1VQN3 3AG2H 3B73A 4PCQA 3BZKA 2V1LA 1LVKA 3DGYA 2BXZA 2VC1A 3QWLA 3CDHA 1BUQA 4EW5A 2M3AA 3F9KA 1JBSA 1QO0D 2Q2EB 2EFNA 1PP7U 5GPCA 4Y13A 2XB5A 4V2FA 1VQMI 5HNFA 2ZSIB 3VSLA 2GM4A 2WAQA 2RAEA 2Z99A 3I5UA 3RSNA 1FY7A 3DGNA 3QPHA 1YO5C 2HNHA 1FZUA 3E0JB 3WGIA 3ABUA 1KQ9A 2EZKA 1ZGAA 1U8BA 3R61A 3SDBA 3OV8A 1HQCA 4GRIA 4HRIA 2GOMA 4L18B 1RTUA 2Z76A 3CC73 2K4JA 4I0AA 2AAEA 1W7PB 3IC7A 1Q864 3FWEA 2XHKA 1G8XA 1G59A 4KIGA 5LFAA 1WH5A 1IUFA 2XV4S 2ZXJA 3OSGA 2VONA 4X6AJ 2LNBA 1ZGXA 3BR2A 1HW2A 2WOHA 4II3A 4BUPA 3O8YA 2FA5A 2R7QA 3K7AJ 4E7LA 1RN1A 1KD14 3PM1A 2EV0A 3J81Z 4WHAA 5CVUA 1YRNA 3GEZA 3PO2J 2BNGA 2F5MA 4LD5A 6RNTA 1YTYA 9ANTA 3ABKH 1W6CA 3DKYA 3JRIA 3BTLA 5EVHA 3CCYA 1L5GB 3WODG 3GUDA 2FU4A 1OPYA 4BY7J 3BG5A 4OAZA 3O2PE 3M8JA 3GTPJ 5LC6A 2ISYA 1I3AA 1DQUA 1I50J 3OYNA 1OGXA 2KRHA 1JUSA 2A5YB 1JJ6C 1T0FA 2DFHA 3BJ6A 1AR0A 2G7UA 1IUYA 4ITVA 2E2UA 1LOVA 4GFBA 2W25A 1GUUA 1TFKA 4RNTA 2ELJA 2PMUA 3BR6A 4OMYA 1NHAA 1QQIA 1FMWA 3SZGA 4U7BA 4RDUA 2P5LC 4CHUA 4O6JA 1IVUA 1HU9A 1UB9A 4NC7A 2BIRA 4XQFA 1MNMC 3BPVA 2PJRA 3TBIA 4GCVA 3WTWC 1T2KA 3HXLA 1RNLA 5IEOA 1X1PA 4N0BA 2BT3A 2QA4I 4XKWA 3CPOA 3DWLE 2VKEA 1HZ1A 2B1XB 1YFHA 3KX2A 2CW0F 5EEOA 1RUOA 4FISA 4N4NB 3B6CA 2IGNA 3CJRB 1MWSA 4N6OB 2P81A 3BNBA 2VE8A 2H0HA 1LXEA 2CUFA 1FPQA 3NM7A 3GTQJ 5E8GA 2CGPA 2P7CB 2RGQA 3QP5A 4Q48A 3PQKA 3ZQ7A 2BY3A 5FROA 1BSBA 1Z3YA 2WBMA 4J5GA 1LDKB 4XOPA 1YW9A 3ZMUA 3QQAA 3RIRA 4M9XA 1BI1A 2P0MA 5K5QA 1GXPA 1R1VA 3EDPA 1W0UA 2Y74A 4XONA 1HW5A 3H5NA 3L00A 4KN7X 3O8GA 1NO3A 1K734 5E1XA 3I553 2JPCA 1JT6A 1MBFA 5CVRA 1B72B 2K9NA 2XKPA 5FLXK 3PCSA 4IHWA 4I4KA 4JX4A 4CA0A 3OYJA 5J4VA 1LEBA 1JRQA 2AADA 3FXJA 2WWYA 1BVIA 4N6NB 2QSFX 3T8UA 4FX4A 1X58A 1EH7A 1PY3A 3WOEB 4IEJA 4XBTA 5STDA 2ID6A 2W57A 1WTHA 3CNMA 2DA4A 3COAC 4NUBA 1S723 3T8TA 1H9GA 1Z67A 2CQXA 2Q2EA 3LQQA 4EV2A 1FOWA 2OOVA 2MH2A 3DMCA 1O57A 3SFIA 3V7SA 3GZYB 2SBLA 2Z33A 2JQ5A 4BL0B 3R0JA 3ZMVA 2H94A 5EEHA 5DEQA 1T95A 5M1AA 2CUZA 2V1UA 4NNJA 3I563 1Q7Y4 3DCFA 4IPAA 2DQRA 3J80Z 1Q1VA 4LZIA 1VQPI 1NG7A 1W7PA 2E5ZA 3W2VA 2XB0X 2HQRA 4BACA 1MNLA 3UNLA 5G1LA 1RCKA 5BS6A 3HM5A 5DCFA 4R8HA 5IOYA 1JB2A 2Q07A 5DREA 2IXSA 2EFPA 1WSUA 3M8CA 1O7GB 2OQEC 2O8XA 2KRFA 5IT3A 3SXYA 3NX0A 4WP5A 1OISA 3I0TA 4MO7A 3QP6A 1XPXA 3HKZA 1O7NB 4HBLA 3HSRA 2NS8A 3N05A 2E1MC 5LRSA 2NS0A 5J40A 1KQ0A 4OUQA 5GAEJ 3LWFA 1JTYA 4PGGA 2V79A 1DGWY 3EUAA 3HPHA 1VQ63 1XDUA 3BJAA 1TL8A 2XFSA 3IMAB 3CCR3 3MCZA 4E4HA 4CZCA 2EIJH 4F7ZA 1V5EA 4R9LA 3WGGA 1HW1A 1T33A 3DU6A 2Y0SA 1T56A 3W6KB 2YU3A 3JREA 3CDIA 3VWBA 5ILUA 1EKMA 5CLKA 3HUGB 1WJFA 2VJ4A 3TOAA 5D5VB 3MG1A 4G9YA 3O3KA 4EGYA 1JGSA 3I4PA 4M3EA 1OUNA 1RN4A 3GTLJ 5D81A 3QOPA 1JKOC 1PDNC 2JDIH 3LMMA 2QSHX 2JSPA 5B5EC 2E35A 3GZXB 3J7Yd 2E36A 1S29A 3IP4B 4I6ZA 1JXSA 4EJUA 1UCJA 1NTCA 3L09A 3HIIA 4L8PA 1ZX2A 1WJCA 4PDKA 3KEOA 1B3SA 4X1EA 4C3IJ 3QU3A 1G3YA 4BE2A 3GSPA 3K4MA 1VF9A 3MPHA 3S1NJ 2BY0A 1SFXA 2DDBA 2L9VA 2XH9A 1BRIA 4LSOA 3EUHC 4EMSA 4HJLB 1IK3A 1RGHA 4JX6A 4BL3A 3DEEA 5J1UA 3A4CA 3DZLA 3ZGKA 3W2WA 3K1NA 3H9QA 1QRYA 4Y52J 1R71A 1YX3A 2GA2A 2IEKA 1PVEA 3TP3A 2P0XA 5FRNA 2OF7A 2K4BA 2XGEA 3VYUB 2B7EA 5ILVA 4AKYA 1U2WA 1VFCA 2KT0A 1RRJA 2EPFA 2VT2A 5F0FA 4RBNA 4WCGA 2CW8A 3LSRA 1CQTA 2A6HF 3TW7A 4ENMA 2VOPA 4GL6A 1BRGA 4L9NA 5GAGJ 5FD5A 3H0DA 1AWCA 3CC23 3MVPA 2X6XA 2XPUA 5D8KB 1QPIA 3QYEA 3RI4A 2KJCA 2D1VA 5M18A 1RNBA 4ILFA 3IL2A 3ZMDA 2LH9A 4NQWA 2ECCA 4UUTA 2YU9J 5E8IA 4P9UA 2ISZA 2UV1A 3JAMK 1A2PA 4BAYA 2O0YA 5H6QA 2LG4A 4EBGA 4H0EA 1BBYA 3IUOA 3HYIA 4EEFG 4IRIA 2KPMA 4F92B 5JFRA 5AIPA 1VQ43 3ASNH 2HOSA 1IRZA 4HM6B 3FHNA 2RNGA 2WO0A 5BMZA 2M9HA 1R4YA 4UVAA 1UELB 1Z9CA 2G7HA 2Z5UA 2XKOA 4LG3A 5IT9Z 2F5WA 4HYZA 4CDGA 3ZP5A 4KFEA 2H8RA 3F7XA 1ZG3A 2KRTA 3BCBA 3VPRA 4RNZA 1RGGA 1IN5A 1S5AA 2PN6A 2QIYA 3MKZA 1HKSA 1SFKA 3AKZA 4Y15A 4XN0A 4QLCU 1R49A 1I6XA 2CFOA 5E20A 5F04A 3DEWA 1SAUA 3G71I 2CWUA 4N6V0 4HSTA 1I1SA 4K2EA 1ETKA 1KYZA 2XRNA 1RSNA 1MMDA 1QBJA 3KFWX 4KICA 3K4JA 3DY5A 1FIAA 1MZBA 5LGNA 1SPUA 2YS9A 1XMKA 2R4GA 1V3FA 4EXRA 5BU4A 3KEYA 4XORA 4STDA 4ZZDA 1FOXA 1SD5A 4UUSB 2JJ7A 3KKGA 1RUNA 1OR7C 4A0YA 2LTPA 1JV2B 5ED4A 2Z6BA 2BGCA 5EZGA 3HGGA 3OW22 3U1WA 2E1MB 2W04A 1V54H 2FE3A 4ON0A 3BOQA 4N9IA 2JRTA 3H3VK 4A6EA 3R4KA 2ME6A 5ELJA 2DDAA 2VQHA 1B2SA 2FXTA 3M7GA 5KAFC 1ETWA 1HSTA 2J5OA 2JVHA 1V58A 2HYJA 2ZFWA 1YJN3 2Y31A 4UV9A 2BMRB 1MDMA 4XM3A 3U1KA 4H61A 4YIIA 1O7WB 1KU3A 3KZYA 2V9PA 4EGZA 1P92A 2WY7Q 3Q5FA 1UCRA 1MWTA 1X19A 4X0GA 3H3HA 2IJLA 1MBEA 5DD4A 3RZDJ 2F99A 3OYHA 3KE2A 4D5CA 2R7WA 4U13A 4XM4A 4B8XA 2Z9OA 1I2GA 3L2QA 1S7AA 1D6UA 3MN2A 4IO9F 3GFLA 1B4AA 1P2FA 3CD63 4DZJA 1WQ2A 1WRJA 5FLVA 1BSAA 1YYVA 1DVCA 3GTJJ 3DM8A 2OCEA 1FGRA 2F86B 3G0KA 3HOYJ 3LFKA 3X41A 1W4MA 4IQJA 2A69F 2M0CA 1D0XA 4I02A 2JMWA 5E3OA 2Z3YA 3T8RA 1K28A 3K63A 1T98A 4OOIA 2L7KA 4I76A 1G96A 4AUXA 1BOAA 4MGRA 3NEUA 3K69A 2OTJI 2L1SA 1WMNA 4ZM8A 4EV0A 1R1TA 2EA2A 3ERED 2IPQX 3CCMI 3D5IA 3DEUA 4D5FA 3JUNA 1MBHA 1QVG2 2DFEA 3GFJA 4GO1A 2ZB9A 1S9HA 2RVCA 3WODF 3GFIA 3QYFA 3ABTA 4NBQA 2M4KA 1D5YA 2QQ8A 1GV5A 2FBIA 3SZPA 4A69C 5K7FA 2P4WA 2IMJA 3E97A 1R22A 3H9GA 4RGRA 1O7FA 2F2EA 1ASKA 1AV4A 2BW3A 2XGXA 4AIJA 3P9KA 2K0MA 1R5HA 2OQGA 1FSEA 3FX3A 3TDUC 1L3LA 1BGSA 3S1QJ 1X1AA 1BNEA 4GHOA 3QU6A 1KYWA 4KT3B 2DOEA 1EF4A 5L3CA 4XSZF 1JUPA 2YPRA 5BPDA 1LQ1A 1DMQA 2HMLB 1OYWA 2W0QA 1TWAJ 3FF2A 4J19A 1T6SA 3OOPA 3DP7A 4KMFA 1YGWA 3HOUJ 2YX9A 1P7IA 3O8HA 3RYRA 3I64A 4GB5A 1R00A 1W6GA 1WQLB 3IHUA 4KN4X 4ANJA 3JAMZ 3CCUI 3V8KA 1IF1A 2DLLA 3FISA 4WK8F 3RCOA 1H88C 1Q42A 4M6XA 2QZ8A 1SIHA 4ENNA 2L3DA 1W5ZA 1LFUP 3DGLA 5IENA 2VC0A 1FYKA 2HYGD 5CLSA 1X3ZB 2JN6A 4YRVA 3SJMA 4E7IA 2CIUA 2OQRA 3WTTC 4LFUA 5AIFA 4IQ4A 1JGGA 2O9LA 2JSCA 1IV9A 4ZYDA 3DTKA 2K3FA 4MTDA 2L7MP 3DQVC 2BMQB 1KQ8A 3M8FA 3OWSA 3SLUA 3CC4I 2CX0A 4BHBA 1JJ8C 1K83J 1T5YA 1X4OA 1BRNL 2DA2A 5CYVA 1J2XA 1FBSA 2DO7A 2P5VA 4A5MA 4AIKA 3Q2PA 2ZMEC 3FSDA 1TQIA 1RDSA 1DMNA 4I0BA 3LXUX 2QF7A 3MKWB 3LL7A 2GIVA 3FMQA 1SJWA 1QVF2 1P4XA 2UUZA 1YITI 2RV8A 5CPRB 4CZZA 4BBSJ 2Y9YA 1VQQA 1E3RA 2PFBA 1ZO2A 4FMAA 3GWZA 2WAQN 3MD2A 6STDA 1L0OC 2M5WA 4MNUA 2QQAA 2V7FA 1OPCA 2IA0A 3K1MA 4IJAA 3D1NI 2HDWA 2HVQA 4OIQF 1GMPA 4R4KA 1FT9A 1MKMA 3A5EA 1B1BA 4CCLA 2DOAA 1E17A 4EATA 1ULYA 3NBBA 4HV6A 3ZQIA 1A67A 3ABMH 5HLIA 1F1ZA 1IQ8A 1BSCA 3T0UA 3I0YA 3GZ6A 1UMQA 3TO7A 4XLCA 3ML6A 2LKXA 4BQOA 2DA1A 5FLMJ 5DD8A 4AKZA 3VEPA 1RZ4A 5EG0B 4K1VA 3K7CA 3WTVC 1YS7A 2R4IA 3WDGB 3F8MA 4EV5A 2DA6A 2XAJA 4ASNA 3LYGA 3D3LA 3PIPF 3TEDA 3SEDA 2VPLA 2OBPA 1TTOA 4HM4B 4W1UA 3U2RA 4TV7A 2A6TA 4WWCA 3LTCA 1YJWI 4HV5A 1ENHA 1B2UA 5K5RA 1SC7A 2CK3H 3E5QA 4KIFA 4EM0B 1UGIA 3MHEA 2VOOA 3QYBA 5HLTA 2FD5A 3I58A 1VZZA 3HOSA 5DV5A 1JZDA 1GT0C 1NG6A 3WG9A 4PUSA 4EJOA 5FRMA 3CCJ3 2LLKA 3D5RC 1MJBA 5LHGA 4H4KC 1JB5A 1G02A 3X40A 3WHCA 3HOTA 4WXCA 3CCV3 3WHBA 1E3PA 2HYFA 4YEJA 1OHPA 3VSYA 1FW7A 3DKWA 5CF2A 1BOBA 2EZIA 5IERA 3URPA 4ZZLA 2XPVA 2VKHA 2HDDA 2CW9A 1OCVA 1KU2A 1ZRFA 2L01A 1Q824 3LTDA 4A3KJ 3TP0A 1T8IA 3CQZJ 2XSDC 2LFBA 3F9SA 1CQSA 1Q1HA 4MFEA 1ROAA 4I09A 2ZXWH 1Z91A 2ECBA 4IKFA 2GU3A 2M8EA 1IQXA 1KZHA 1JB4A 4KJZA 4XLNF 3GYHX 4HM2B 1MBGA 1B8IA 5B1AH 1ZRCA 3I3LA 2MF7A 3MG2A 3IAM2 4HM8B 2WY8Q 1N8R4 5KP1A 4HEA2 3DXJF 1UUWB 1APLC 3G2BA 3J7AY 3PUFA 1HC8A 5GADJ 1R5GA 1TT0A 3BR1A 3C3WA 3AG4H 4L5EA 5H6RA 5TGTA 5HODA 3J81K 1KQS2 3A02A 3LH4A 1WCMJ 2R93J 1TZLA 2RKHA 5GSPA 4HSRA 1BRKA 1GD4A 1USTA 4MJDA 1RETA 1Q814 5IOZA 2K85A 3EUKL 3OMYA 4EJWA 3BLZA 4ENJA 1VQ53 2QCOA 4C9YA 3WTUC 3VOEA 3CMAI 4AVPA 3F23A 1X3WB 2GEYA 4RB2C 5B1BH 2DAOA 5HS7A 2CMPA 2L2OA 1MNDA 4DIQA 1I70A 3RGRA 3S29A 4RS8A 3TW6A 3IKTA 4BDZA 4BE1A 1FSHA 2FBHA 4MLOA 3M3YJ 1LNIA 5BIRA 1I3QJ 2HQNA 3K4KA 1R58A 2OU2A 5GAHJ 1XSDA 3IPTA 1YLFA 2Q1ZB 4B47A 2GXAA 4JRFA 1U8RA 3FH1A 1O7LA 4BH9A 1MWUA 3FBIB 3N8BA 4WWUC 1JBTA 1A31A 1BNJA 3KP5A 3LSJA 4KNYA 3PSIA 5M3MJ 2ZBKA 3L7WA 3Q0VA 2FF4A 2DCEA 4P96A 3VYTB 3G4SI 3I4NJ 1BIRA 4IIAA 4X2HA 2QSGX 3CDLA 3FXMA 2MH9A 2HU9A 2AS5F 1VQ8I 4RB1A 3H5AA 4LLLA 3K70D 1MSFC 5TISC 2E7XA 2V9KA 2E2TA 1EG9B 2IT0A 1IU7A 4GYIA 1EKEA 1R4MB 5KCMA 3T0YA 1QGPA 1QHHD 1EH8A 2LF8A 4E7ZA 5EG0A 3CCL3 4HAAA 5HOOA 2UUGC 4IXAA 2ZHXB 1D1CA 1GV2A 4PJJA 3JRBA 1YJ9I 3KP2A 1TRQA 2D2WA 1YI2I 2WAEA 2E71A 4EQQA 4MMXB 3HKZN 5K1YA 1FEXA 4HM3B 2BE5F 2DT6A 3LSHA 2QLZA 5IP6A 2JVGA 2IYJA 4AVZA 5J6XA 1HKXA 5EEGA 3GWRA 1UI7A 4FR9A 3RGAA 1WJEA 2RNJA 2MC4A 4FCJA 5DDGA 1J09A 5ICFA 2UXNA 2HMOB 7STDA 3FMRA 1DPRA 5DTDA 3K9MC 3LAJA 1IT7A 2DJNA 2RCDA 2Y0SN 5E79C 2ACJA 2R3SA 4HLXA 5DCMB 4CGZA 1X4PA 4WXDA 1FX7A 1IN8A 1BR4A 3I71A 2LBFB 1J5YA 8RNTA 4NB5A 3SEQA 4QPOA 1Y1WJ 1SANA 3DH2A 3PYJA 3CLOA 2QEXI 2V1DA 1V5GA 2OC6A 1UUGB 4M9SA 2O7OA 4MIMA 1J59A 4IX7A 1TTYA 3O6BB 1G2HA 2DI3A 4RGXA 1ZH5A 3J80K 1EV7A 2KLOA 3T8NA 2R7ZJ 1BUJA 2BHMA 1BSEA 4YFKF 1FJLA 2XAQA 1Z3XA 1X3UA 4W97A 4BBRJ 1W2ZA 4PSXA 2HOEA 2XGDA 2OCCH 3JTHA 4CXFA 4DNCA 2Y48A 2HOTA 3BG6A 3IRQA 3CMEI 2D45A 1U8CB 3KN4A 3FLJA 1XD7A 2CU7A 2CWEA 2HTJA 3F22A 2ESNA 4XICA 1MH4A 2F4OB 4MQVA 1OACA 3D79A 3S8PA 3HPGA 2XF6A 2CV2A 1VQKI 1GOUA 2KL4A 2VJJA 2I8DA 1P9QC 4IHYA 2VJ5A 4OK0A 2XEPA 4NPBA 2NVQJ 4XBFA 2ZSHB 2WV0A 2GZWA 1S3JA 4A6DA 1A6IA 1G4DA 1Z6TA 1AKHB 1DU6A 3G16A 4Y7NJ 4CCNA 2ZXHA 1W5SA 2FMYA 4BGDA 3LSGA 2P05A 1B59A 2DW4A 4G7OF 3SHFA 2WB1A 5LHHA 1Y4KA 5CQGA 1A35A 5D6EA 1MBJA 2HMMB 2L7FP 3BCAA 1YVBI 3ZMSA 3H0GJ 5AIGA 1YIJ3 2HPIA 2DFIA 2M2EA 1PP8F 2KDZA 2BMOB 4MMZB 5KK1A 1IV6A 2RNTA 3SYUA 1AY7A 1NH3A 2M7AA 2X1DA 4WXHA 1R9TJ 2ICWG 1HYFA 3EN8A 4CDLA 1AU7A 5FKKA 4BU2A 3KLOA 1XX5A 4G6QA 3G3ZA 4F91B 3CJQB 3DKXA 3KP4A 1KU9A 3DV8A 1ERDA 2EINH 2XAUA 4JX5A 3GX4X 4AYBA 1SFUA 4IT7A 1ORKA 5EZHA 1QPMA 4G6TB 2GLOA 2I5UA 1RMSA 2FMLA 2K5CA 1XGMA 5ICCA 2CC3A 1LOYA 4I2OA 1D6YA 1W2B2 1V74A 1W01A 3FBNB 1LKXA 3GZBA 4OAYA 4P5OA 2G0EA 2AO9A 5F0HA 3EE1A 2X6WA 2P09A 3BG3A 3FK6A 3BP8A 3LSKA 5HLHA 2NS7A 1H9TA 2F5VA 1BI0A 4JQFA 2EA4A 1D6ZA 2AQEA 1CYVA 5IG5A 3S17J 2KIFA 2HWVA 3ERMA 5K5OA 2WV1A 3WA3A 2YX7A 4KUMA 3CCQ3 4LGWA 3RYPA 1TBXA 4BKXA 2P6SA 3RKQA 2NNYA 1MH3A 3K9TA 3P9IA 1F4KA 1EJ9A 2L0KA 1MMAA 3KETA 2L4AA 1JHFA 1RJOA 5DYMA 5D8LB 2OJED 3K1PA 4D0PA 1T38A 2JUGA 1IG7A 2VBYA 2LY9A 2L54A 5FFZA 2H1KA 4A2UA 5DCMA 1E2XA 2KIUA 5JHUA 2NOGA 2O6GE 3GTGJ 2Q8KA 1MW7A 4Y4RA 2LBFA 1UCLA 3NV0B 5JBSA 3VYSB 2LR8A 4Y17A 1ZELA 4BXFA 4XIDA 1K61A 4N6UA 2H6CA 1UHWA 1XDSA 4FMBA 2RSXA 2V1XA 1W7PD 2M7OA 3JRCA 1XCVA 1U78A 1UCKA 3OS1A 1PU4A 4HAMA 3MWMA 1GDTA 3BLYA 3DBHB 2EFOA 3MKIA 3V98A 2EJRA 2VXDA 1RKWA 4UUVA 4RAYA 2GQQA 1IRXA 4ESJA 2NVUB 2HDCA 4E6KG 1RGLA 4X2OA 3VB2A 2J5PA 2YUSA 3L2RA 5IT9K 3LOYA 1T08B 2QKLB 1GOVA 2HKOA 4O3MA 1I8VA 3E6CC 4IHXA 1OYYA 1X1YA 2M1BA 4GYGA 1Z05A 3V8LA 2UZKA 2F48A 2VN2A 3NARA 2WGOA 3S67A 2PEXA 3H9JA 3IAS2 1QVUA 3D0SA 5DRVA 4F3QA 3GLXA 2X1EA 2OZUA 3HSFA 2VUMJ 3BB9A 2IY2A 1GHCA 3E5UA 2R7RA 5A0OB 1YHQ3 2BYVE 3C2HA 3Q3FA 1IQYA 4PJ0C 3NWTA 4CCKA 3C1DA 3S28A 2FSWA 3PQJA 4ZTFA 3R60A 1DU0A 1IO2A 1MMNA 4JOMA 3ONQA 3U9GA 2ZCWA 3WG7H 3BG9A 2F6CA 2AXLA 4BJ5C 1TFOA 3ABLH 1VQ9I 1BM9A 4XBYA 2VODA 4CCMA 1ZGWA 3ZFZA 2CO5A 3IKVA 3MWZA 4HNVA 2O03A 1UFMA 5CVIA 2EWNA 4C3HJ 3SQNA 1H0MA 2PBIA 3CF2A 2STTA 2DMPA 4L9TA 1VQNI 2EZLA 3CNXA 3MG3A 4XLEA 2CH0A 1I3IA 3S16J 4XSXF 2RDPA 2IA7A 1TU5A 4KFCA 3NBRA 2NVTJ 5HLGA 4WYKB 3HIGA 5J1YA 2CKFB 1GVJA 1NJI4 5IP7J 4A3BJ 3S27A 3F0CA 1IXSB 1ZK8A 5E17F 3B4PA 3OR2C 3DPUA 2OTL3 3KIOA 1G3SA 2JA7J 4LLGF 3UKGA 1W36C 1BNRA 1VZ0A 3OYIA 4O8SA 3CC7I 3NBJA 2W9PA 2KQRA 1KC84 3HK4A 1WKMA 3FHZA 1YW8A 3A2KA 1VQL3 4ZYEA 2ELHA 4XL9A 4DYCA 2VE9A 2GXFA 4H3UA 3S1MJ 5E3LA 4C30A 3V4GA 3CCE3 4YFXF 4HW0A 1SIIA 2W9QA 1QVTA 2K9QA 2E19A 4ZYHA 5BQTA 2PZVA 2MD5A 3L2VA 1GXQA 3VODA 4ZDOA 1KU7A 1YVSA 4C2MJ 5JLWA 1ZRDA 3GCMA 3CJNA 5A2QZ 1JN5B 3NQYA 2K02A 1Y6IA 3F7SA 2Y73A 1TQPA 1XC5A 2DTZA 3KZIC 2M4GA 3ECOA 4Y33A 2BO9B 3MSOA 2A68F 3KE7A 1PJRA 3ZG5A 1B72A 4UV8A 2IRFG 1BC8C 4HNTA 2C6YA 3EBYA 3NV0A 1QHGA 2BY1A 2FBKA 4M3BA 3OWYA 1W4NA 1K41A 1IN4A 1UI8A 1BNIA 3A01B 2CG1A 2WGQA 2YR2A 1Y8QB 5M5WJ 1DETA 1LQGC 2IS4A 3H51A 6GSPA 5BVBA 3MKYB 1KSIA 3EN1B 5AIHA 1IVWA 1XB4A 1MJAA 4F93B 2KRCA 1FUSA 4CCJA 4ZC3A 2EQRA 4A3CJ 2Z77A 1SVOA 3HOWJ 4LIVA 2CW7A 5JLXA 1SAXA 4M3FA 4B3AA 4NHJA 3KZZA 3BZCA 5LRRA 2I10A 1JT0A 5M5YJ 1PYLA 2KZGA 2GWRA 1JKQC 1MJ9A 1X1BA 5D5XB 3HOZJ 3WOFB 3K2AA 3FM3A 4PSWA 2CQQA 4QWQA 4RMNA 1IVXA 2RN7A 4ETSA 3TMOA 3PCRA 1I2FA 1IV7A 1FOYA 3HI7A 4A3EJ 2COBA 3WE2A 2NVXJ 6PAXA 1W6YA 1XSVA 4E7KA 4EJVA 1U0JA 2TRTA 3F8FA 3I55I 1BW6A 1K9M4 3N9HA 1X2MA 2R7FA 1I3FA 4LMYA 2PMZN 2HZTA 2HEOA 3FDYA 2KJBA 3QPTA 5FB2A 4OINF 1BU4A 3E99A 4HBRA 4XRSG 2A6EF 5J8FA 4BE0A 4EYCA 3FKJA 3FXLA 3L1PA 3NAUA 2VQGA 1U5OA 1O3QA 2KAAA 1F36A 2CRGA 4HF1A 3H36A 2TCTA 3BR3A 3DGMA 1S72I 4LITA 2FNQA 1JJ22 2UGIA 4M9ZA 1E97A 4DOZA 2BHYA 1ACIA 1D8JA 5HVQC 2MC3A 1JKRC 4WYKA 4I5QA 3HUGA 2ZKZA 4B4CA 4R80A 2G9WA 4L8OA 3W3CA 2ZNYA 3ZR8X 3VYRB 4GGGA 2UWMA 3ZQLA 4HQMA 1J9IA 3FKAA 4HNUA 2HPMA 1TP4A 3I56I 4AM3A 3DPTA 5EGOB 5AYSC 1XMXA 4RZMA 1K79A 1HF0A 3NUVA 4J01A 2ZFUA 2XGLA 2JZYA 3T1BA 5F27A 4LMIA 1FTTA 3CMMA 2MABA 1OGZA 2KISA 1Y1VJ 2FOWA 2X48A 2FNPA 2CUEA 5BNGA 3F8CA 1YIOA 3UR3C 3ZOBA 4AWXB 1U5TC 4L0YB 3K5TA 4N6LA 1U9OA 5KP3A 1B2ZA 1JN5A 4A93J 4DJAA 3DUKA 4K90B 1ONVA 2Y30A 3CUOA 3OYEA 1V55H 2K86A 1LVNA 3QOEA 3OSFA 1VQ6I 1WJBA 2JPBA 2FQ4A 2BOLA 3I59B 2XRLA 3CCRI 1RN7A 4J00A 4LB5A 2IA2A 1Q40B 3ZXSA 2CQ7A 1XS9A 4C3JJ 1US1A 4BQNA 4B1RA 5JI6A 2A05A 2K7LA 3A01A 4E7SA 5CJ9A 1D0YA 1FIPA 1HXDA 3ZMZA 2GEXA 4BEHB 2W4SA 1LQMB 2HKXA 2BU4A 1VQO3 1OCOH 2D1HA 3CPW2 3HIFA 5CVJA 4O5VA 3ZQFA 1RPWA 5FFXA 4HF2A 3N97A 3H92A 3RJPA 3ECHA 2ML5A 4KT5C 2A15A 1B9MA 4FHTA 1WFXA 1F5TA 3BC8A 3Q0UA 1R23A 1VQ73 2M30A 3IJEB 2X1CA 1G3WA 2R5ZB 2IS6A 4J8TA 1N9JA 1IV8A 4D7NA 3FG3A 1YS6A 2EV6A 3U21A 1AOYA 5L3DA 5LEKA 4HOBA 2XF3A 5AIIA 2JRMA 3FXQA 4Z6YA 2X51A 3I9V2 5L3FA 1S7OA 1RGAA 4WF2A 4KZ1A 1BRSA 3HGYA 1ZR2A 2DA3A 3MEXA 1JNQA 3CCS3 1WH7A 3GW2A 3KPHA 2R7OA 3G73A 4BHPA 3MZHA 4KYWA 4GSPA 1TWGJ 5BPIA 1E3OC 1QAFA 1Z6RA 3EETA 2X6YA 3NXJA 4UB8C 2ME0A 4G12A 3ULQB 2Z16A 5DM6F 3S15J 3TO6A 1MD0A 1BOXA 3GAXA 1BJZA 1UGHI 1ZREA 3SX1A 3PNVA 4KIBA 4UB6C 4CPKA 1WMPA 2P8TA 3CTAA 3Q9SA 4AU7A 1Z7UA 3P7NA 1TQMA 4A3FJ 3CC2I 2PMHA 3BR5A 3KP3A 4C2TA 1M1XB 1BL0A 1OHOA 3G6E3 4AEQA 2LREA 1U9NA 4Q53A 3SVAA 4CCOA 5IY5H 1ETVA 2OQEA 4YG2F 1K6YA 2X6OA 5IG3A 4UUSA 1ETXA 4S05A 3NQOA 1FTZA 2X85A 2R7DA 2V9VA 5EGOA 1BANA 1AHDP 1AVKA 1YNVX 3A03A 1T0FC 3M8EA 3OWTA 4M6VA 3ROUA 1VQ4I 5E18F 3IH3A 1Y8RB 1CH0A 3Q0WA 3VF1A 3BT9A 4G7ZF 4E7HA 2DN0A 5GTHC 1C7HA 4UY8I 3QRFF 2LRDA 1Z7LA 3KIIA 4BU4A 2D1WA 3HG9A 1MOLA 3IWZA 3LSIA 3EBTA 5L3BA 1UG2A 1TWHJ 2IP2A 4A5NA 4HVNA 1O7HB 2VBZA 5FKLA 5B3SH 2O8KA 1GVDA 1D0ZA 3G1OA 1JKPC 3AL0C 1TP6A 1UUVB 2HS5A 2LDUA 3KLNA 3IRRA 1GOYA 3L2WA 4HM5B 2HXOA 3PFIA 3BJOA 3I59A 1JZOA 4KMUX 5HDKA 3S2HJ 2M87A 3FM5A 1Q40A 3K10A 2E7WA 1RRHA 2MFZA 2KMUA 4B09A 3FZWA 2WB1N 1X2NA 3B8LA 3ZQGA 4PJNA 1GMQA 1A90A 1TW2A 4IF4A 1G6NA 2K9SA 2B9SA 4R1KA 1OFCX 2JUCA 3WR2A 2V6CA 3ASOH 5JHFA 2LMDA 4I99C 4QIWN 1DPUA 3ALAA 1OCRH 1ZTRA 2XAHA 4XB5A 3X3YA 3EUHA 1RRLA 1VQM3 2PI0A 3BPXA 3HOXJ 3PO3J 2OWPA 3PS8A 5F08A 1RLSA 2E2HJ 2EFQA 2H6BA 3OYCA 4GDFA 3JUOA 4EC6A 3WU0A 4NHFA 3HRUA 2R5YB 3BNDA 2CFKA 4LYLB 3UL6A 1WI9A 5LC7A 2CG4A 3CP2A 1R5ID 4LOCA 4IOAF 1UW1A 1W00A 4OIOF 2Y9ZA 1YJNI 1HDDC 2XSJC 2ZJRF 1NK2P 1NWWA 4KFDA 2OOVC 2JK3A 2QENA 3JUQA 3WGHA 1OH0A 4CYCB 1BN5A 2VIXA 2AXTC 2KF3A 5EDNA 2O9UX 3TQNA 3BQYA 3WTXC 3CD6I 3DGOA 1ZLJA 3Q1CA 3MMYB 1KGSA 1BW5A 4PEJA 2DA5A 2CJJA 3SOYA 2L4VA 5FGOA 1Z21A 1B27A 1VI0A 1LDJA 5L3EA 4HF0A 2J8XB 2W48A 4O2HA 1I5ZA 2LP0A 2NOJB 2V1NA 4B44A 2P38A 3BTJA 2PX9A 2CWVA 4L0ZB 2KIMA 4BS9A 1W1WE 3AFHA 1GMRA 1ETYA 3I54A 2M45A 3FCSB 3MAJA 5TGNA 1J0RA 2PNCA 1BNGA 2P6TA 5JPUA 1WHUA 4A3DJ 2LKPA 2OA4A 1A6QA 2MLKA 5LGTA 4QTRA 2E2IJ 4JBAA 2L02A 2MG4A 1HOMA 2FJ1A 4YELA 1R7JA 3A1YA 3TKYA 4MEIA 3WTZA 4RAGA 4FCMA 3FF0A 3G8ZA 3UL5A 3FK7A 2QA43 4UHTA 1I1GA 5FKMA 3OYFA 4IHSA 1Z77A 1B2MA 5I97A 3S3OA 3AG1H 4ESFA 3KP6A 1T39A 1FYLA 1QAKA 2RQQA 1LOXA 1FC3A 2XF7A 3F8BA 2ZJPF 2H0IA 2K54A 1G3TA 3ZQCA 3KSED 3UB1A 4V2GA 1SMYF 2XUBA 3S32A 1EA2A 2GSPA 3V7CA 4U0WA 5K7HA 1R6RA 4R79A 3KZTA 1BSDA 1O3RA 1OF5B 3LA2A 3E7LA 2WC2A 3HC7A 3JTGA 5JPPA 4NREA 2F4MB 2ZMEB 1S6LA 2XF5A 3OOUA 3G1LA 2LYXA 5KP4A 3BR0A 3DBLB 1DDNA 1MWRA 2DBBA 1OR7A 4AIDA 4HZFA 1TNTA 1XG1A 3OYAA 2MYSA 1ITYA 2XSOB 1TLHB 5TRDA 3CXC2
chains in the Genus database with same CATH topology
5G2GA 1YI23 1VQ43 3EJVA 3L0RA 1TIJA 4HM6B 4N6UA 4FMBA 2RSXA 2WO0A 3B7CA 3D9RA 4N6TA 2M7OA 1M904 3N54B 1PU4A 3V92A 4HYZA 3EX9A 2O3OA 3MKIA 3F7XA 4KFEA 3V98A 2KRTA 5AI1A 4RNZA 2W6JH 3OXAA 3HZPA 4IPBA 4X2OA 5IG4A 1S5AA 1WNHA 4BTXA 3LOYA 4JF8A 2QIYA 5IW9A 1J2BA 3V99A 3NQZA 2CWUA 4N6V0 4HM0B 5CK6A 2WGOA 3S67A 2B24B 1VQP3 1IVVA 5DRVA 3X3ZA 3BB9A 2QEX3 4G1MB 3DY5A 3LT8A 1SPUA 1YHQ3 5A0OB 1IQYA 3S28A 3X3XA 4EXRA 4STDA 1DVDA 1CYUA 3FG4A 3ROBA 2MC8A 1R4CA 3KKGA 3PXMA 3ECFA 3F8HA 1TFOA 2Z6BA 1JV2B 1NB3I 4L7KA 4XBYA 3CME3 3OW22 3U1WA 2W04A 3MWZA 8CHOA 2YFIB 2XGLA 2XGNA 3MG3A 5ELJA 3CNXA 3UJMA 1ROVA 2CFLA 2FXTA 3EF8A 5D83A 1GY5A 3RDEA 1VQK3 4HZ9B 2IUJA 2IA7A 3PZWA 1TU5A 3EB8A 1YJN3 2BMRB 3NBRA 3WA2X 4H61A 1O7WB 4WYKB 2QGUA 3HIGA 4K1UA 5AYRB 3S5CA 3H3HA 2CKFB 2WOFA 1NJI4 2F99A 4U13A 3S27A 4XM4A 3B4PA 5HGRA 2OTL3 1D6UA 2CFWA 3CD63 1AVLA 2XFTA 1WMOA 4LEHA 4O8SA 4HZBB 3NBJA 1DVCA 3DM8A 3X41A 1FGRA 2F86B 2KCDA 2W9PA 3G0KA 1KC84 3HK4A 5CF1A 1VQL3 3OV4A 1K28A 2GXFA 4H3UA 3K63A 1NB5I 1SQWA 1G96A 3CCE3 3WMDA 1SIIA 1WMNA 1STDA 2W9QA 5ELUA 4ZM8A 2PZVA 3JUNA 1QVG2 4MMYB 2ML6A 1OF5A 1JN5B 3NQYA 1JKGA 2CFGA 2INXA 3F7SA 3QK9A 2Y73A 1K8A4 2BO9B 2IMJA 3MSOA 3KE7A 1ASKA 1NU3A 1AV4A 3CXC2 1LNHA 1W02A 2K0MA 3EBYA 2XRXB 3NV0A 3OWYA 1IDPA 3LZAA 1YGEA 2HMKB 3LTAA 1W4NA 1OHSA 1K41A 1RKYA 1UI8A 2CG1A 2WGQA 1N5HA 2HMLB 2W0QA 1DMQA 3FF2A 3H51A 3LT9A 5BVBA 1KSIA 4ORLA 3EN1B 2LQVA 5AIHA 1IVWA 3BNEA 2YX9A 4GB5A 2ZDJA 3GZRA 1W6GA 1NDOB 1WQLB 1GD3A 2E2VA 4FMCA 3AMOB 5CXOA 2Z77A 1Q42A 1SIHA 1W5ZA 4CCVA 1E3VA 1W7CA 2STDA 3DGLA 5IENA 2CIUA 5AIFA 3WOFB 1IV9A 2BMQB 5BXQA 5IG0A 2Z7AA 4XDVA 1QALA 3OWSA 3SLUA 1IVXA 1FGOA 1T5YA 3PCRA 1IV7A 3Q2PA 3HI7A 4J9AA 3FSDA 1DMNA 1W6YA 3LXUX 1SJWA 3EC9A 1QVF2 3FG1A 1K9M4 3N9HA 3K0ZA 1E3RA 1QJGA 3LTBA 4FMDA 5AEWB 1ZO2A 4FMAA 1FGTA 3E99A 1TUHA 1DMMA 2RFRA 4HBRA 6STDA 4OK0A 4EYCA 4N3VA 1FA3A 4R4KA 1U5OA 4KVHA 3G713 4WP5A 3DGMA 1O7MB 3MYTA 2KXGA 1CEWI 3NBBA 2FNQA 1JJ22 1A67A 4HM1B 1E97A 5FW5A 4WFOA 4WYKA 3HX8A 1IQ8A 5D82A 3T0UA 4R80A 3I0YA 3NM2A 4L8OA 1GY6A 3GRDA 4AKZA 1GS3A 3TDGA 1FGQA 1M9GA 1N8QA 4K1VA 2GBXB 2R4IA 3FKAA 3K7CA 3WDGB 4EV5A 2F98A 3F40A 3LYGA 1VQ93 3D3LA 4R9KA 5AYSC 3SEDA 1ULIB 4RZMA 2C11A 4HM4B 5AEUB 3NUVA 3KSPA 3LTCA 2CK3H 1VQN3 4LMIA 2V1LA 3A76A 1OGZA 3MHEA 2CWTA 1BUQA 1VZZA 3SXXA 3CCJ3 2IUKA 4OVMA 2OCTA 2YFJB 3K5TA 4N6LA 5KP3A 1GY7A 1JN5A 1JB5A 3DGNA 3X40A 3DUKA 3VGNA 4K90B 1OHPA 3CCV3 3VSYA 5CF2A 1LVNA 5IERA 1N5PA 2CW9A 1OCVA 1RN7A 2Z76A 3CC73 1Q824 3LTDA 1Q40B 2I9WA 1Q864 1US1A 3F9SA 1CQSA 2ZL8A 1ROAA 2D42A 3KFQC 3QRDA 2WOHA 2GEXA 2GU3A 3O8YA 4BTYA 2OTJ3 1IQXA 3CCM3 1KD14 1JB4A 3NHXA 1A2VA 1VQO3 4HM2B 4LGQA 4WHAA 3CPW2 2BNGA 2MF7A 3MG2A 4HM8B 2CH9A 1W6CA 1N8R4 3AMOA 5KP1A 4K61A 1UUWB 5EVHA 1L5GB 3WODG 2ML5A 2A15A 1OPYA 5LC6A 2W56B 1KQS2 2XSHB 3LH4A 1Z1SA 1OGXA 1GD4A 4MJDA 1VQ73 3IJEB 3STDA 1Q814 4J8TA 1N9JA 3FG3A 1AR0A 3BLZA 2E2UA 2XF3A 1VQ53 5AIIA 1TFKA 3OWUA 2CHCA 2GEYA 1HU9A 1IVUA 3RGRA 4KZ1A 3S29A 2HMJB 1JNQA 3CCS3 3CCU3 5IEOA 2BT3A 3IPTA 1KWIA 1QAFA 3CPOA 3NXJA 2B1XB 4JRFA 3FH1A 5EEOA 4WWUC 3N8BA 2XR8B 4N6OB 1A2KA 3GAXA 1GYBA 3BNBA 1LXEA 3SX1A 3NM7A 2GU1A 2HMNB 4IIAA 3CU3A 1WMPA 2RGQA 4X2HA 1PFPA 3F14A 3CC43 1OHOA 1M1XB 2CFDA 1F8NA 2E2TA 3G6E3 4AEQA 1EG9B 1STFI 4Q53A 3SVAA 2P0MA 1IU7A 2OQEA 2Y74A 3CCL3 5IG3A 4QWTA 5IF6A 1NO3A 1K734 3I553 1YIT3 4TX4A 3PCSA 4I4KA 1AVKA 4HM7B 1EQKA 1JRQA 4MMXB 4N6NB 4HM3B 3T8UA 3VF1A 3DXOA 3WOEB 4XBTA 5STDA 1WTHA 3CNMA 1C7HA 3GWRA 1HKXA 4FR9A 3RGAA 1UI7A 1S723 4EV2A 3KIIA 2OOVA 4FCJA 2D1WA 3DMCA 4HKVB 1MOLA 3F8XA 3GZYB 2SBLA 2HMOB 7STDA 3EBTA 2JQ5A 3K9MC 3FGYA 4HVNA 1IT7A 1O7HB 4FCZA 2RCDA 1TP6A 1UUVB 2YFLB 4HM5B 3I563 2FGTA 1Q7Y4 4LZIA 1Q40A 1RRHA 3UNLA 1MNLA 1FUWA 3FZWA 3PYJA 1YJW3 3B8LA 2Q07A 1IT8A 1JB2A 3OX9A 5DREA 1A90A 1ULJB 3T8NA 3M8CA 4R1KA 2BHMA 1DYUA 1O7GB 2OQEC 2UX0A 3NX0A 3ALAA 3X42A 4XB5A 1VQM3 3X3YA 1RRLA 1W2ZA 2OWPA 1O7NB 3PS8A 4EC6A 3JUOA 1U8CB 3KN4A 4OUQA 4NHFA 3EQQB 3FLJA 3BNDA 2W56A 3U97A 2CFKA 3UL6A 1VQ63 1FGMA 2XFSA 3IMAB 5LC7A 1OACA 3CCR3 1UW1A 1W00A 1NWWA 2W03A 4R9LA 2XEPA 4KFDA 2OOVC 4O02B 5EQLA 3JUQA 1EKMA 1OH0A 5CLKA 3MG1A 3JUMA 3G16A 2O9UX 3DGOA 1OUNA 4XBXA 3Q1CA 4PEJA 4XDWA 5D81A 2P05A 2JDIH 3SOYA 4O3VA 1ISKA 1Y4KA 2L4VA 5FGOA 4RNYA 2HMMB 4O2HA 3J7Yd 3GZXB 1YVBI 2P38A 5AIGA 1YIJ3 4L8PA 3HIIA 3B4OA 2CWVA 2BMOB 1ZX2A 4MMZB 3BNCA 3MPHA 3LMLA 3EHCA 2XH9A 3FCSB 4LSOA 5TGNA 3EN8A 2PNCA 4HJLB 4CDLA 5JPUA 1IK3A 1QMAA 3CMA3 3DZLA 3PGBA 4IT7A 1M1K4 3JVCA 4MEIA 2P0XA 4FCMA 3FF0A 3G8ZA 3UL5A 2QA43 2CC3A 2C10A 1D6YA 1W2B2 1V74A 4AKYA 1W01A 3SOAA 3GZBA 5I97A 3EE1A 2P09A 4RBNA 1QAKA 1LOXA 2K54A 1D6ZA 3G4S3 3KSED 3UB1A 1EA2A 4GL6A 1CYVA 5IG5A 2CG0A 3KZTA 1VQ83 3WA3A 3CC23 1OF5B 3CCQ3 3JUPA 5JPPA 1JKGB 4NREA 1O7PB 2LYXA 3ER7A 3Q90A 4KFFA 4BTWA 1RJOA 5KP4A 2W2CA 2XSOB 5IEPA 1YJ93 4EBGA 1N9EA 4N6MA 3NV0B 5JBSA 2GBWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G2G A;  3EJV A;  4HM6 B;  3B7C A;  3D9R A;  3EX9 A;  3MKI A;  3F7X A;  5AI1 A;  3OXA A;  3HZP A;  4X2O A;  5IG4 A;  1S5A A;  2QIY A;  4HM0 B;  5CK6 A;  2B24 B;  5DRV A;  3BB9 A;  4STD A;  3ROB A;  3KKG A;  3ECF A;  3F8H A;  4L7K A;  4XBY A;  8CHO A;  2YFI B;  3MG3 A;  3CNX A;  3UJM A;  5D83 A;  3EF8 A;  1GY5 A;  4HZ9 B;  2BMR B;  3NBR A;  1O7W B;  4WYK B;  2QGU A;  3S5C A;  4K1U A;  3H3H A;  2CKF B;  2F99 A;  4U13 A;  4XM4 A;  3B4P A;  5HGR A;  4LEH A;  4HZB B;  3DM8 A;  2F86 B;  3G0K A;  3HK4 A;  5CF1 A;  3OV4 A;  2GXF A;  4H3U A;  3WMD A;  1STD A;  2PZV A;  3JUN A;  1OF5 A;  1JN5 B;  1JKG A;  2INX A;  3F7S A;  2IMJ A;  3MSO A;  3KE7 A;  1ASK A;  1NU3 A;  1W02 A;  3EBY A;  2XRX B;  3NV0 A;  3OWY A;  1IDP A;  3LZA A;  2HMK B;  1OHS A;  1K41 A;  2HML B;  1DMQ A;  3FF2 A;  3H51 A;  5BVB A;  5AIH A;  4ORL A;  3EN1 B;  4GB5 A;  3GZR A;  1WQL B;  1NDO B;  5CXO A;  2Z77 A;  1Q42 A;  1E3V A;  2STD A;  5IEN A;  5AIF A;  2BMQ B;  5BXQ A;  5IG0 A;  2Z7A A;  4XDV A;  3OWS A;  4J9A A;  3FSD A;  1DMN A;  1W6Y A;  1SJW A;  3EC9 A;  3K0Z A;  1E3R A;  1QJG A;  5AEW B;  1ZO2 A;  3E99 A;  1TUH A;  1DMM A;  2RFR A;  6STD A;  4N3V A;  1U5O A;  4KVH A;  4WP5 A;  1O7M B;  3MYT A;  4HM1 B;  1E97 A;  5FW5 A;  4WYK A;  3HX8 A;  5D82 A;  3I0Y A;  3NM2 A;  4L8O A;  1GY6 A;  3GRD A;  1GS3 A;  4K1V A;  2GBX B;  2R4I A;  3FKA A;  3K7C A;  2F98 A;  3F40 A;  3LYG A;  4R9K A;  3SED A;  1ULI B;  4RZM A;  4HM4 B;  5AEU B;  3NUV A;  3KSP A;  4LMI A;  3A76 A;  1OGZ A;  3MHE A;  1BUQ A;  1VZZ A;  4OVM A;  2YFJ B;  5KP3 A;  1GY7 A;  1JN5 A;  1JB5 A;  3DUK A;  3VGN A;  1OHP A;  3VSY A;  5CF2 A;  5IER A;  1OCV A;  2Z76 A;  1Q40 B;  2I9W A;  3F9S A;  1CQS A;  2GEX A;  1JB4 A;  3NHX A;  4HM2 B;  4LGQ A;  2BNG A;  3MG2 A;  4HM8 B;  5KP1 A;  1UUW B;  5EVH A;  2A15 A;  1OPY A;  2XSH B;  1Z1S A;  1OGX A;  4MJD A;  3STD A;  4J8T A;  1AR0 A;  3BLZ A;  5AII A;  3OWU A;  2CHC A;  2GEY A;  3RGR A;  2HMJ B;  5IEO A;  3IPT A;  3CPO A;  3NXJ A;  2B1X B;  3FH1 A;  4WWU C;  2XR8 B;  1A2K A;  1GYB A;  2HMN B;  4IIA A;  3CU3 A;  2RGQ A;  4X2H A;  3F14 A;  1OHO A;  1EG9 B;  4Q53 A;  5IG3 A;  5IF6 A;  4I4K A;  4HM7 B;  4HM3 B;  3T8U A;  3DXO A;  4XBT A;  5STD A;  3CNM A;  1C7H A;  3GWR A;  1HKX A;  3RGA A;  4FCJ A;  3DMC A;  4HKV B;  3F8X A;  3GZY B;  2HMO B;  7STD A;  3EBT A;  2JQ5 A;  3FGY A;  4HVN A;  1O7H B;  2RCD A;  1TP6 A;  1UUV B;  2YFL B;  4HM5 B;  1Q40 A;  3UNL A;  3FZW A;  3B8L A;  1JB2 A;  3OX9 A;  5DRE A;  1ULJ B;  3T8N A;  3M8C A;  4R1K A;  1O7G B;  2UX0 A;  4XB5 A;  2OWP A;  1O7N B;  3JUO A;  4OUQ A;  3EQQ B;  3FLJ A;  1W00 A;  1NWW A;  4R9L A;  3JUQ A;  1OH0 A;  5CLK A;  3MG1 A;  3JUM A;  3G16 A;  1OUN A;  4XBX A;  4PEJ A;  4XDW A;  5D81 A;  3SOY A;  1ISK A;  2HMM B;  3GZX B;  5AIG A;  4L8P A;  3B4O A;  2BMO B;  1ZX2 A;  3EHC A;  5TGN A;  3EN8 A;  4HJL B;  4CDL A;  5JPU A;  1QMA A;  3DZL A;  4FCM A;  3FF0 A;  3G8Z A;  1W01 A;  3SOA A;  3GZB A;  2K54 A;  1EA2 A;  5IG5 A;  3KZT A;  1OF5 B;  3JUP A;  5JPP A;  1JKG B;  1O7P B;  3ER7 A;  3Q90 A;  5KP4 A;  2W2C A;  2XSO B;  5IEP A;  3NV0 B;  2GBW B; 
#chains in the Genus database with same CATH topology
 2NYX A;  4XR6 A;  3A0B C;  2K3P A;  1GSP A;  3GXO A;  3CES A;  2C4B A;  3FF5 A;  4RAZ A;  2OZ6 A;  1TIJ A;  3GFM A;  3ZRG A;  5E3N A;  1OYI A;  1QZY A;  1SEU A;  1M90 4;  3N54 B;  4E7J A;  3V92 A;  2QYO A;  3EX9 A;  2O3O A;  5ILS A;  2GAU A;  2M0M A;  5AI1 A;  3EYY A;  1IXR C;  2DOD A;  2W6J H;  1ON2 A;  3OXA A;  3HZP A;  4LK1 F;  5IG4 A;  1B20 A;  1E0E A;  1R4N B;  1CGP A;  4JF8 A;  1XN7 A;  2WTE A;  3ZN1 A;  3OS2 A;  1IN7 A;  1YE9 A;  3AL0 B;  2R5Y A;  3LA3 A;  2EFW A;  3H1C A;  3LFU A;  2HR3 A;  3RQI A;  5IW9 A;  1EH6 A;  3LSP A;  1R36 A;  4ZH4 F;  4HQE A;  2DU9 A;  2YX4 A;  3HTS B;  1N78 A;  3V99 A;  3R0A A;  5CKT A;  5J1R A;  1BRH A;  3RKX A;  1VQP 3;  3J7Z I;  2B24 B;  3OYK A;  1IVV A;  3V8J A;  4FE7 A;  3K2Z A;  1QA6 A;  1ETQ A;  4RGU A;  2V6E A;  3X3Z A;  4G1M B;  2FOK A;  2XIG A;  5KHD A;  2LSO A;  3B6A A;  4D7M A;  3JRD A;  2R92 J;  2BY2 A;  2KFD A;  1LNW A;  4LIU A;  4LK0 F;  4DBR A;  1IAW A;  4MEX F;  3W2A A;  2L7Z A;  3C18 A;  2HVR A;  1DVD A;  3K6G A;  4ZTJ A;  2MC8 A;  1R4C A;  9RNT A;  2JT1 A;  5L3G A;  5C3E J;  3ECF A;  3HDD A;  4J5K A;  4L7K A;  1NB3 I;  2OAZ A;  3HRS A;  3ZG0 A;  1WWX A;  2VQL A;  1TT5 B;  1I39 A;  3NRV A;  1FWZ A;  3FMS A;  4FQG A;  1HA8 A;  2SAR A;  2O61 A;  3M9A A;  1PUE E;  2XDV A;  8CHO A;  1HLV A;  2AHQ A;  2XGN A;  3F6O A;  2RQP A;  3WTY C;  3ESW B;  1USS A;  1IGN A;  2W85 A;  1LVA A;  3UJM A;  1ROV A;  1BNF A;  1GY5 A;  3BY6 A;  3F6V A;  5HS8 A;  3RDI A;  1RIO H;  2DMU A;  1OCP A;  2KP6 A;  4MEY F;  1UDI I;  3PZW A;  2IUJ A;  3RPQ A;  2HQA A;  2Z2S B;  3CCJ I;  5FJ8 J;  2PLY A;  3AHW A;  3KCC A;  3SFZ A;  3BIR A;  4K1U A;  3GZN B;  1O3S A;  1SD7 A;  2OUM A;  2BHZ A;  4E70 A;  3JRG A;  3CCV I;  1O3T A;  1TC3 C;  2DXI A;  5HGR A;  2L9N A;  4I7H A;  2XFT A;  1ODD A;  1WMO A;  2ETH A;  3E5X A;  4XKB A;  4LEH A;  4HZB B;  2XAS A;  5HS9 A;  4LLN A;  1NNV A;  2ADU A;  2H09 A;  4L9V A;  1FUT A;  4RLQ A;  4PK4 A;  4LG0 B;  2KF5 A;  4D1Q A;  3OV4 A;  5DM7 F;  3DLA A;  4I98 B;  3HL2 A;  1E3H A;  5C4X J;  2BZT A;  1SQW A;  1POG A;  4L5I A;  1RNT A;  3WMD A;  2MA3 A;  2BBY A;  2FEZ A;  4RBO A;  3AGO A;  2EBI A;  2QQB A;  1MGT A;  4XKV A;  1NK3 P;  4RM3 A;  3QPS A;  2VPR A;  1KA8 A;  4RB3 C;  2VQC A;  5IYC J;  4MMY B;  2ML6 A;  1X1C A;  1OF5 A;  4KIT B;  1WJ5 A;  1K6O A;  1FBQ A;  2PG4 A;  2FNA A;  2GOX B;  1YQA A;  1J7K A;  2Q0O A;  1BR1 A;  2ZME A;  1Q7H A;  1FP1 D;  1Z0X A;  2CFG A;  2INX A;  5M19 A;  2EK5 A;  1I0X A;  1OMI A;  3ZQQ A;  2IVM A;  2VL8 A;  5GPA A;  4ZJZ A;  1BC7 C;  1LNH A;  5LLQ A;  5A2Q K;  5DUK A;  2HGC A;  4XLA A;  4PFO A;  4M3G A;  2W7N A;  1WZ2 A;  1IDP A;  3LZA A;  3C7J A;  3LTA A;  2R7V A;  1RKY A;  3DF8 A;  1VQ5 I;  4BXX J;  3K0L A;  4N9H A;  3OYD A;  1MGR A;  1H8A C;  2ZC2 A;  5EEA A;  1XGO A;  2CSO A;  4Q5S F;  2ZDJ A;  2L4M A;  3QOD A;  2TDX A;  4FMC A;  3AMO B;  7RNT A;  3HHG A;  4DW6 A;  5FKN A;  2CUJ A;  1TWF J;  3EYI A;  3F72 A;  2DK8 A;  1IDY A;  1E3V A;  1T2H A;  4RAF A;  4DYR A;  2QKM B;  1W7C A;  2STD A;  2HOH A;  5EYR A;  2RBI A;  4MQ9 F;  4MFD A;  4ENK A;  5FGM A;  5HNH A;  2X0L A;  1LFP A;  1S8N A;  4P9F A;  4FX0 A;  1FGO A;  2E60 A;  2ELK A;  2IS1 A;  5IPA A;  2VBW A;  1LPQ A;  2EIM H;  4B43 A;  1OQY A;  1QNT A;  3JRH A;  4J9A A;  2WAF A;  1OCT C;  5D5U B;  3JSO A;  1W0T A;  3CCL I;  4EM1 A;  2CFX A;  1RGF A;  3EC9 A;  3LAP A;  1STZ A;  3PSF A;  1J75 A;  4HDU A;  3BWG A;  5KNL A;  1RI7 A;  3HRT A;  2L9R A;  1QJG A;  3AGN A;  1FGT A;  3GF2 A;  4KT6 A;  3VDX A;  5HDG A;  1TUH A;  3R6S A;  1HDP A;  4N3V A;  3K4N A;  1SFE A;  1C0W A;  2WAD A;  3RQ4 A;  2DK5 A;  4KVH A;  3G71 3;  1I27 A;  2E34 A;  1O7M B;  2R7U A;  4HM1 B;  2FQ3 A;  3GTK J;  1TNS A;  1ZYR F;  4AD9 A;  1VTN C;  2H27 A;  2BVM A;  1AKH A;  2GXG A;  4HYE A;  4JYK A;  5C44 J;  3LOC A;  1GS3 A;  3TDG A;  1N8Q A;  4XLF A;  4NQW B;  4CUG A;  2ZO4 A;  2ZNZ A;  1XGS A;  2Y2Z A;  4RB0 A;  3SYT A;  4Q4Z F;  1V57 A;  2HQ5 A;  1QZE A;  2H8W A;  4FET A;  4R9K A;  1OCZ H;  3KYC B;  2C11 A;  3H3Z A;  2HOA A;  1RCL A;  2NAZ A;  3CLQ A;  5F6F A;  4LG0 A;  2DYR H;  1MIJ A;  1FNN A;  3FIW A;  3A76 A;  1V5F A;  3IWF A;  2CYY A;  2EB7 A;  3HTU A;  3JR9 A;  2CWT A;  4BIR A;  4HDV A;  3SXX A;  2GXB A;  2HI3 A;  1WI3 A;  4FCY A;  2IUK A;  5J3L A;  4KA4 A;  4OVM A;  2OCT A;  2YFJ B;  2QWW A;  3TDZ C;  1YG2 A;  2Y0M A;  2O5R A;  1GY7 A;  3FXU A;  1SVM A;  4HOH A;  1DGR M;  2BV6 A;  3VGN A;  4IVN A;  2MW8 A;  1EA3 A;  1P4A A;  4PJM A;  1TRP A;  2F56 A;  2NVY J;  3UNG C;  4RA2 A;  1N5P A;  2BEO A;  4ESB A;  3AG3 H;  4C2U A;  1P4W A;  4HX4 A;  2NRA C;  3FZV A;  2I9W A;  3N4M A;  2VB6 A;  4XRS A;  2F5C A;  4ZDL A;  4CIC A;  4DZP A;  3CF5 F;  2LKS A;  3QAH A;  4HX8 A;  2X9D A;  4F55 A;  5DS9 A;  1AA7 A;  4AC0 A;  1ZKG A;  2VLA A;  2ZL8 A;  2LOO A;  1JE8 A;  5EJC A;  2D42 A;  1JHH A;  3GTO J;  3KFQ C;  3QRD A;  4BTY A;  2OTJ 3;  1U3E M;  4GXO A;  4MTE A;  3CCM 3;  3H5R A;  3NHX A;  4F52 A;  1A2V A;  4LGQ A;  2QBY B;  5EF6 A;  4PZJ A;  2CH9 A;  2KDO A;  4OWR B;  3AMO A;  2OPT A;  5E1Z B;  1ZLK A;  1I2E A;  4K61 A;  2VI6 A;  4A3J J;  3JCU C;  1YIJ I;  4YFN F;  2W56 B;  4HLY A;  2XSH B;  2HXI A;  2K27 A;  3M1C A;  1Z1S A;  4UVB A;  1S5L C;  1ETO A;  2DMQ A;  2JQ7 A;  4UVC A;  5E3M A;  3WTS C;  5HOH A;  2QVO A;  3STD A;  3CMY A;  4UNO A;  3OYB A;  1D5V A;  1MDM B;  3B02 A;  1FMV A;  3M07 A;  2GBY A;  3D5S C;  3HBL A;  1P6R A;  5F1R A;  3S14 J;  1XGN A;  5ICE A;  3WU1 B;  2CHC A;  3OWU A;  4DYQ A;  4EJT A;  3ZPL A;  5CVV A;  1LB2 A;  3WU2 C;  1B2X A;  2A61 A;  3GME A;  2E1N A;  3OY9 A;  2HMJ B;  4CH7 A;  1F43 A;  2KIQ A;  3DTE A;  3CCU 3;  1HKQ A;  4A3G J;  2V4J C;  4M72 A;  2VJI A;  2Y75 A;  1KWI A;  1UCI A;  4DQ2 A;  1A5J A;  3VSK A;  3S2W A;  2XR8 B;  2QUF A;  1LOW A;  3DTI A;  4CSW A;  3PIO F;  1WPK A;  1A2K A;  3E6B A;  1GYB A;  1Y56 A;  3D4A A;  3LSM A;  3Q3S A;  2GU1 A;  2HMN B;  3CU3 A;  5M5X J;  3H35 A;  1RGK A;  1O4X A;  4DBQ A;  1ZQ3 P;  2FRH A;  4A12 A;  1BNS A;  1PFP A;  2IGO A;  3F14 A;  3CC4 3;  1U6G A;  2HTS A;  3CCQ I;  2CFD A;  5FLX Z;  4YIR X;  1F8N A;  1STF I;  1EUI C;  1SFO J;  4G94 A;  3J7A O;  1DP3 A;  2W24 A;  1CF7 B;  1A04 A;  5D4S A;  4QWT A;  1LUJ B;  5IF6 A;  1GLN A;  2EV5 A;  3RKW A;  4TX4 A;  2BW3 B;  3F3X A;  2LD5 A;  1YIT 3;  2MD0 A;  2ID3 A;  3ZN0 A;  4HM7 B;  5DUI A;  3BRO A;  1EQK A;  3HZJ A;  2WA0 A;  4P55 A;  1ZS7 A;  2LY2 A;  2QQ9 A;  4YIF A;  3AAF A;  1SD6 A;  3DXO A;  3VFZ A;  2ESH A;  4B48 A;  1D1A A;  2HZD A;  1ZGJ A;  1I0V A;  1BRJ A;  2VT3 A;  3RNT A;  3KYL A;  2JA8 J;  3OIP A;  1Y0U A;  1RR7 A;  4HKV B;  3ZQH A;  5G1K A;  2Y69 H;  3F8X A;  2F4Y A;  2LC2 A;  1PYV A;  4BDY A;  3FGY A;  1FZP B;  4FCZ A;  4L5J A;  4CO8 A;  2R7X A;  3MFK A;  3DFG A;  1SAR A;  5AIQ A;  2YFL B;  1MGW A;  2DPD A;  5IYB J;  2FGT A;  1JUM A;  3G1M A;  2P7V B;  4OIR F;  1IRG A;  3W6V A;  2LYC A;  2IAI A;  1FUW A;  2ZXI A;  1WGX A;  3JW4 A;  1AQZ A;  1LEA A;  2R41 A;  1YJW 3;  2DTR A;  2K40 A;  1IT8 A;  2VBX A;  2DJI A;  1RGC A;  3OX9 A;  1JBR A;  2DT5 A;  3PL8 A;  1YHQ I;  2EZH A;  5LHI A;  3SZT A;  1ULJ B;  4DKI A;  2Z1D A;  2P0W A;  4U7D A;  1DYU A;  1IYY A;  2UX0 A;  3X42 A;  4G7H F;  2QBY A;  3HSE A;  5FKO A;  1BJA A;  1B9N A;  5F64 A;  3L9F A;  2IBD A;  3K4C A;  3OYL A;  1ON1 A;  5GP9 A;  3CUQ C;  3RZO J;  3K4B A;  3EQQ B;  1N25 A;  1UG0 A;  2W56 A;  5H20 A;  3V7R A;  5D4R A;  3KEQ A;  1REP C;  2XGC A;  3U97 A;  4CYD A;  2FXA A;  1FGM A;  2DT7 B;  3DLL F;  3K70 C;  4II2 A;  5LBQ A;  4ZYG A;  2DQL A;  5AON A;  2W00 A;  2W03 A;  2CS3 A;  2XAF A;  4O02 B;  5GTI C;  5EQL A;  4L9J A;  1RES A;  3ZMT A;  1FYS A;  4RM2 A;  3P5J A;  2OD5 A;  3JRF A;  1IXC A;  5ICG A;  3RTR A;  2DOF A;  3JUM A;  2OTL I;  4XBX A;  2KF6 A;  1BIB A;  4XDW A;  1IN6 A;  2KKO A;  3L2U A;  1HCR A;  3JSP A;  2KF4 A;  1SMT A;  1S7E A;  4O3V A;  4EVI A;  1IJW C;  1ISK A;  4BHC A;  4RNY A;  2A3S A;  4NDL A;  3SEZ A;  1VQL I;  1LDD A;  3DU5 A;  2M8G X;  2XAG A;  3B4O A;  1BI3 A;  3PUB A;  3P9C A;  3BNC A;  4RGS A;  3LML A;  3CCE I;  2E1C A;  3EHC A;  1X1X A;  1ZG1 A;  3ELK A;  2DMT A;  1W5T A;  4XOT A;  3TL4 X;  2B63 J;  3I4M J;  4XLH A;  1QMA A;  3CMA 3;  2MLG A;  4A3I J;  3BTC A;  3CJT B;  4QPQ A;  4BXU A;  2LF7 A;  3I53 A;  1M1E B;  5E1W A;  5JVG F;  3S3N A;  3PGB A;  1M1K 4;  4D9J A;  1CF7 A;  4OMZ A;  1HKT A;  1Q9E A;  3JVC A;  1D1B A;  1Z1D A;  1ZR4 A;  1JTX A;  1MMG A;  2PQ8 A;  2X4H A;  3PJR A;  2C10 A;  4IHV A;  1K4S A;  3BDD A;  2PJP A;  5IYD J;  3SOA A;  4IRH A;  2H1L A;  4FT8 A;  2RRE A;  2XPW A;  4U0Y A;  1K4T A;  4CJN A;  4S0H B;  5C4J J;  3A0H C;  3C2G A;  1X1W A;  4WX9 A;  3ISP A;  3G4S 3;  2DA7 A;  3RKY A;  2LK2 A;  3E1S A;  3U1D A;  1OKR A;  1LRA A;  4LB6 B;  1K7A A;  2NXN B;  2R7T A;  1HSJ A;  4V19 K;  2CG0 A;  2RC4 A;  1FP2 A;  1B8I B;  1VQ8 3;  3BZ6 A;  3OL3 A;  2F4I A;  4UXN A;  2QM3 A;  3JUP A;  4BQQ A;  3DBR B;  1TW3 A;  2ZJQ F;  2CV1 A;  3OL4 A;  2CQK A;  4XMY A;  3NWS A;  1OCC H;  1JKG B;  1O7P B;  3HOH A;  5BOX A;  3ER7 A;  3Q90 A;  1HBX G;  4KFF A;  4BTW A;  3HHH A;  1D3Y A;  4BJ6 C;  2JA5 J;  2W2C A;  5K7Z A;  2ZA4 A;  1FYM A;  2IW5 A;  5IEP A;  1G0T A;  1YJ9 3;  2JTV A;  1N9E A;  4N6M A;  2EH3 A;  3WE3 A;  4Y3O A;  2P5K A;  2GBW B;  5G2G A;  3ZCO A;  3GBG A;  1W36 D;  1YI2 3;  3S2D J;  4M6Y A;  5KAI C;  3EJV A;  3L0R A;  2CQN A;  4XNF A;  1Y0N A;  1ZG5 A;  2DPU A;  2R7S A;  4M71 A;  4PFP A;  3B7C A;  3D9R A;  3FXO A;  4A0Z A;  4N6T A;  1N77 A;  4NC8 A;  1BA5 A;  2NNN A;  1YX5 A;  1DE3 A;  1K78 B;  3HRM A;  3KP7 A;  5IP9 J;  1UHM A;  1B21 A;  2MSY A;  1LE8 B;  4BL2 A;  4ZYA A;  4XRM A;  1UJ8 A;  1WJA A;  1ZAR A;  3OR1 C;  4U88 A;  5H2F C;  1T3B A;  1X1U A;  4IPB A;  2O3F A;  1WNH A;  4BTX A;  1BAO A;  4N4O B;  2A07 F;  3AHS A;  1B6A A;  1J2B A;  3OIQ A;  1RKT A;  3NQZ A;  1BI2 A;  4OU0 A;  4PGH A;  4HM0 B;  5CK6 A;  3BU4 A;  3LST A;  2COM A;  2F5E A;  4HPQ A;  1XSX A;  2QEX 3;  5KVR A;  3KYD B;  3LT8 A;  3T5X A;  2YSR A;  1UAA A;  3E6D A;  1I6H J;  4BEH A;  2STW A;  1KON A;  1MMS A;  3X3X A;  3BTI A;  4XN3 A;  2W84 A;  4BQA A;  1EEJ A;  3FG4 A;  3ROB A;  1CYU A;  3PXM A;  1UHS A;  1U5T B;  3F8H A;  4FAS D;  3DPL C;  1VND A;  4RLF A;  2W82 A;  3CME 3;  1W5C C;  4Q47 A;  3OIO A;  4M3D A;  4JK1 X;  1BIA A;  4Z2Y A;  2YFI B;  3CUQ B;  1IW7 F;  3HB9 A;  2R0Q C;  1RGE A;  2XC7 A;  2BXY A;  3F21 A;  5D83 A;  2CFL A;  3EF8 A;  2LVS A;  3OYG A;  3RDE A;  4AYB N;  1VQK 3;  1WVR A;  4HZ9 B;  2R5Z A;  1MBK A;  3EB8 A;  3WA2 X;  2E1O A;  1OJL A;  1R1U A;  3MQ0 A;  1TJD A;  2QGU A;  2HFH A;  5AYR B;  3S5C A;  2PMZ A;  1PUF B;  3X2Q H;  1D8K A;  2CV0 A;  2WOF A;  1MNE A;  4ABZ A;  2GA1 A;  4A0X A;  1SVL A;  2VXZ A;  3Q9V A;  2CFW A;  1TWC J;  1UZC A;  5D6F A;  1JI8 A;  1SD4 A;  2XRO A;  1AVL A;  4KIS A;  4M73 A;  3RPU D;  1YOV B;  2KCD A;  2UXX A;  2IGM A;  3CP8 A;  3HEF A;  3D5L A;  5HDN A;  4A3M J;  1DUX C;  5M3F J;  2D5V A;  5CF1 A;  1QU3 A;  2W1O A;  2VKD A;  3E3V A;  4BNC A;  1NB5 I;  1FOK A;  2MBF A;  2MGQ A;  4KDP A;  2DYS H;  1IC8 A;  5ELU A;  4FTH A;  1STD A;  1ZAO A;  4LJZ F;  1XMA A;  5CQE A;  5J47 A;  4U0V A;  1VQO I;  2RGV A;  3PFY A;  2N8G A;  3BQZ A;  2L5Q A;  3GLL A;  4BYY A;  2CX1 A;  2OV7 A;  4R1H A;  2KZV A;  3LNQ A;  3RPU A;  5J8C A;  1JKG A;  3MZY A;  3TOB A;  4EM2 A;  4M74 A;  4P1W A;  4DGW B;  3QK9 A;  1K8A 4;  3S93 A;  3CO7 C;  3PNY A;  3REO A;  2IA1 A;  3GZ5 A;  1LFB A;  4HG2 A;  5TJJ A;  4AIH A;  1NU3 A;  1XTA A;  2L9S A;  4QSH A;  5D5W B;  3IV5 A;  3IH2 A;  1RR8 C;  1W02 A;  1LJ9 A;  5FO5 A;  1VQ7 I;  2XRX B;  5JR3 A;  1P7J A;  3D5G A;  4G6D A;  3GTM J;  1IZ1 A;  1YGE A;  2HMK B;  5B66 C;  2A5W A;  1OHS A;  2E5N A;  2IGK A;  1H89 C;  4IRG A;  2DFF A;  5LGU A;  1N5H A;  3H3U A;  3LT9 A;  4U87 A;  4ORL A;  1K78 A;  2LQV A;  3BNE A;  3HJE A;  3GO5 A;  1YRN B;  3GZR A;  3FXR A;  1NDO B;  1X1D A;  3CCS I;  2AQF A;  1LE8 A;  1GD3 A;  2E2V A;  5CXO A;  1YW7 A;  4ZDP A;  2H0G A;  3LQR A;  3QPL A;  2JA6 J;  5J4Y A;  2JWT A;  5F0C A;  3WHO A;  4CCV A;  3K4L A;  3FKI J;  2EIL H;  1Y39 A;  1F9N A;  4JP0 A;  3SDG A;  1WJD A;  3EQL F;  1FLI A;  3JRA A;  5JVT A;  2GIZ A;  3IH4 A;  5BXQ A;  1V4R A;  4BY1 J;  4IL6 C;  2K9L A;  2K3D A;  5IG0 A;  1XCB A;  2Z7A A;  4XDV A;  1QAL A;  3V42 A;  2E2J J;  3M4O J;  4IZZ A;  1MSE C;  1A36 A;  3G6E I;  1DP7 P;  5LD2 C;  3OYM A;  1RC9 A;  3HOV J;  3M1E A;  3MZ8 A;  4PJL A;  2XVC A;  4HA8 A;  4B3X A;  2PJR B;  2VAS A;  3EPZ A;  4A3L J;  3J7Y J;  1U5T A;  2FUG 2;  5FD6 A;  3MKL A;  3FG1 A;  4IOC F;  1FBU A;  2M34 A;  3K0Z A;  5LEJ A;  4XLP F;  1N75 A;  1OLT A;  1QZZ A;  3LTB A;  4OIP F;  4IHT A;  3CO6 C;  4FMD A;  5AEW B;  3BG7 A;  3CUQ A;  3S1R J;  1DMM A;  2RFR A;  1IDZ A;  3TGN A;  1BR2 A;  2V26 A;  1FA3 A;  1ZHF A;  1C54 A;  3KCH A;  2EIK H;  2FX0 A;  3F8N A;  1ZN2 A;  2F5F A;  7GSP A;  3TO9 A;  4I01 A;  2KHM A;  4HX7 A;  3LA7 A;  2KXG A;  1CEW I;  1IRF A;  3MYT A;  3CZ6 A;  5FW5 A;  2LY1 A;  5ERI A;  2HVS A;  4WFO A;  5RNT A;  3HX8 A;  5F1J A;  5D82 A;  4CYC A;  3L2C A;  4S04 A;  1PUF A;  4FE4 A;  2IS2 A;  2F5D A;  1T2I A;  3GVA A;  3NM2 A;  1GY6 A;  3GRD A;  4BJT A;  2B0L A;  3OS0 A;  3W6J B;  3S3M A;  2M7B A;  3FXK A;  1FGQ A;  4XKC A;  2DMN A;  3E6M A;  1M9G A;  4MHG A;  2GBX B;  3C2B A;  2K9M A;  2ZJ2 A;  4G8X A;  4XRF A;  2F98 A;  3F40 A;  1VQ9 3;  2JA2 A;  3PNT A;  1ULI B;  4XK4 A;  2BVL A;  5AEU B;  3KSP A;  1RHL A;  2VKV A;  4NC6 A;  1VQN 3;  3AG2 H;  3B73 A;  4PCQ A;  3BZK A;  2V1L A;  1LVK A;  3DGY A;  2BXZ A;  2VC1 A;  3QWL A;  3CDH A;  1BUQ A;  4EW5 A;  2M3A A;  3F9K A;  1JBS A;  1QO0 D;  2Q2E B;  2EFN A;  1PP7 U;  5GPC A;  4Y13 A;  2XB5 A;  4V2F A;  1VQM I;  5HNF A;  2ZSI B;  3VSL A;  2GM4 A;  2WAQ A;  2RAE A;  2Z99 A;  3I5U A;  3RSN A;  1FY7 A;  3DGN A;  3QPH A;  1YO5 C;  2HNH A;  1FZU A;  3E0J B;  3WGI A;  3ABU A;  1KQ9 A;  2EZK A;  1ZGA A;  1U8B A;  3R61 A;  3SDB A;  3OV8 A;  1HQC A;  4GRI A;  4HRI A;  2GOM A;  4L18 B;  1RTU A;  2Z76 A;  3CC7 3;  2K4J A;  4I0A A;  2AAE A;  1W7P B;  3IC7 A;  1Q86 4;  3FWE A;  2XHK A;  1G8X A;  1G59 A;  4KIG A;  5LFA A;  1WH5 A;  1IUF A;  2XV4 S;  2ZXJ A;  3OSG A;  2VON A;  4X6A J;  2LNB A;  1ZGX A;  3BR2 A;  1HW2 A;  2WOH A;  4II3 A;  4BUP A;  3O8Y A;  2FA5 A;  2R7Q A;  3K7A J;  4E7L A;  1RN1 A;  1KD1 4;  3PM1 A;  2EV0 A;  3J81 Z;  4WHA A;  5CVU A;  1YRN A;  3GEZ A;  3PO2 J;  2BNG A;  2F5M A;  4LD5 A;  6RNT A;  1YTY A;  9ANT A;  3ABK H;  1W6C A;  3DKY A;  3JRI A;  3BTL A;  5EVH A;  3CCY A;  1L5G B;  3WOD G;  3GUD A;  2FU4 A;  1OPY A;  4BY7 J;  3BG5 A;  4OAZ A;  3O2P E;  3M8J A;  3GTP J;  5LC6 A;  2ISY A;  1I3A A;  1DQU A;  1I50 J;  3OYN A;  1OGX A;  2KRH A;  1JUS A;  2A5Y B;  1JJ6 C;  1T0F A;  2DFH A;  3BJ6 A;  1AR0 A;  2G7U A;  1IUY A;  4ITV A;  2E2U A;  1LOV A;  4GFB A;  2W25 A;  1GUU A;  1TFK A;  4RNT A;  2ELJ A;  2PMU A;  3BR6 A;  4OMY A;  1NHA A;  1QQI A;  1FMW A;  3SZG A;  4U7B A;  4RDU A;  2P5L C;  4CHU A;  4O6J A;  1IVU A;  1HU9 A;  1UB9 A;  4NC7 A;  2BIR A;  4XQF A;  1MNM C;  3BPV A;  2PJR A;  3TBI A;  4GCV A;  3WTW C;  1T2K A;  3HXL A;  1RNL A;  5IEO A;  1X1P A;  4N0B A;  2BT3 A;  2QA4 I;  4XKW A;  3CPO A;  3DWL E;  2VKE A;  1HZ1 A;  2B1X B;  1YFH A;  3KX2 A;  2CW0 F;  5EEO A;  1RUO A;  4FIS A;  4N4N B;  3B6C A;  2IGN A;  3CJR B;  1MWS A;  4N6O B;  2P81 A;  3BNB A;  2VE8 A;  2H0H A;  1LXE A;  2CUF A;  1FPQ A;  3NM7 A;  3GTQ J;  5E8G A;  2CGP A;  2P7C B;  2RGQ A;  3QP5 A;  4Q48 A;  3PQK A;  3ZQ7 A;  2BY3 A;  5FRO A;  1BSB A;  1Z3Y A;  2WBM A;  4J5G A;  1LDK B;  4XOP A;  1YW9 A;  3ZMU A;  3QQA A;  3RIR A;  4M9X A;  1BI1 A;  2P0M A;  5K5Q A;  1GXP A;  1R1V A;  3EDP A;  1W0U A;  2Y74 A;  4XON A;  1HW5 A;  3H5N A;  3L00 A;  4KN7 X;  3O8G A;  1NO3 A;  1K73 4;  5E1X A;  3I55 3;  2JPC A;  1JT6 A;  1MBF A;  5CVR A;  1B72 B;  2K9N A;  2XKP A;  5FLX K;  3PCS A;  4IHW A;  4I4K A;  4JX4 A;  4CA0 A;  3OYJ A;  5J4V A;  1LEB A;  1JRQ A;  2AAD A;  3FXJ A;  2WWY A;  1BVI A;  4N6N B;  2QSF X;  3T8U A;  4FX4 A;  1X58 A;  1EH7 A;  1PY3 A;  3WOE B;  4IEJ A;  4XBT A;  5STD A;  2ID6 A;  2W57 A;  1WTH A;  3CNM A;  2DA4 A;  3COA C;  4NUB A;  1S72 3;  3T8T A;  1H9G A;  1Z67 A;  2CQX A;  2Q2E A;  3LQQ A;  4EV2 A;  1FOW A;  2OOV A;  2MH2 A;  3DMC A;  1O57 A;  3SFI A;  3V7S A;  3GZY B;  2SBL A;  2Z33 A;  2JQ5 A;  4BL0 B;  3R0J A;  3ZMV A;  2H94 A;  5EEH A;  5DEQ A;  1T95 A;  5M1A A;  2CUZ A;  2V1U A;  4NNJ A;  3I56 3;  1Q7Y 4;  3DCF A;  4IPA A;  2DQR A;  3J80 Z;  1Q1V A;  4LZI A;  1VQP I;  1NG7 A;  1W7P A;  2E5Z A;  3W2V A;  2XB0 X;  2HQR A;  4BAC A;  1MNL A;  3UNL A;  5G1L A;  1RCK A;  5BS6 A;  3HM5 A;  5DCF A;  4R8H A;  5IOY A;  1JB2 A;  2Q07 A;  5DRE A;  2IXS A;  2EFP A;  1WSU A;  3M8C A;  1O7G B;  2OQE C;  2O8X A;  2KRF A;  5IT3 A;  3SXY A;  3NX0 A;  4WP5 A;  1OIS A;  3I0T A;  4MO7 A;  3QP6 A;  1XPX A;  3HKZ A;  1O7N B;  4HBL A;  3HSR A;  2NS8 A;  3N05 A;  2E1M C;  5LRS A;  2NS0 A;  5J40 A;  1KQ0 A;  4OUQ A;  5GAE J;  3LWF A;  1JTY A;  4PGG A;  2V79 A;  1DGW Y;  3EUA A;  3HPH A;  1VQ6 3;  1XDU A;  3BJA A;  1TL8 A;  2XFS A;  3IMA B;  3CCR 3;  3MCZ A;  4E4H A;  4CZC A;  2EIJ H;  4F7Z A;  1V5E A;  4R9L A;  3WGG A;  1HW1 A;  1T33 A;  3DU6 A;  2Y0S A;  1T56 A;  3W6K B;  2YU3 A;  3JRE A;  3CDI A;  3VWB A;  5ILU A;  1EKM A;  5CLK A;  3HUG B;  1WJF A;  2VJ4 A;  3TOA A;  5D5V B;  3MG1 A;  4G9Y A;  3O3K A;  4EGY A;  1JGS A;  3I4P A;  4M3E A;  1OUN A;  1RN4 A;  3GTL J;  5D81 A;  3QOP A;  1JKO C;  1PDN C;  2JDI H;  3LMM A;  2QSH X;  2JSP A;  5B5E C;  2E35 A;  3GZX B;  3J7Y d;  2E36 A;  1S29 A;  3IP4 B;  4I6Z A;  1JXS A;  4EJU A;  1UCJ A;  1NTC A;  3L09 A;  3HII A;  4L8P A;  1ZX2 A;  1WJC A;  4PDK A;  3KEO A;  1B3S A;  4X1E A;  4C3I J;  3QU3 A;  1G3Y A;  4BE2 A;  3GSP A;  3K4M A;  1VF9 A;  3MPH A;  3S1N J;  2BY0 A;  1SFX A;  2DDB A;  2L9V A;  2XH9 A;  1BRI A;  4LSO A;  3EUH C;  4EMS A;  4HJL B;  1IK3 A;  1RGH A;  4JX6 A;  4BL3 A;  3DEE A;  5J1U A;  3A4C A;  3DZL A;  3ZGK A;  3W2W A;  3K1N A;  3H9Q A;  1QRY A;  4Y52 J;  1R71 A;  1YX3 A;  2GA2 A;  2IEK A;  1PVE A;  3TP3 A;  2P0X A;  5FRN A;  2OF7 A;  2K4B A;  2XGE A;  3VYU B;  2B7E A;  5ILV A;  4AKY A;  1U2W A;  1VFC A;  2KT0 A;  1RRJ A;  2EPF A;  2VT2 A;  5F0F A;  4RBN A;  4WCG A;  2CW8 A;  3LSR A;  1CQT A;  2A6H F;  3TW7 A;  4ENM A;  2VOP A;  4GL6 A;  1BRG A;  4L9N A;  5GAG J;  5FD5 A;  3H0D A;  1AWC A;  3CC2 3;  3MVP A;  2X6X A;  2XPU A;  5D8K B;  1QPI A;  3QYE A;  3RI4 A;  2KJC A;  2D1V A;  5M18 A;  1RNB A;  4ILF A;  3IL2 A;  3ZMD A;  2LH9 A;  4NQW A;  2ECC A;  4UUT A;  2YU9 J;  5E8I A;  4P9U A;  2ISZ A;  2UV1 A;  3JAM K;  1A2P A;  4BAY A;  2O0Y A;  5H6Q A;  2LG4 A;  4EBG A;  4H0E A;  1BBY A;  3IUO A;  3HYI A;  4EEF G;  4IRI A;  2KPM A;  4F92 B;  5JFR A;  5AIP A;  1VQ4 3;  3ASN H;  2HOS A;  1IRZ A;  4HM6 B;  3FHN A;  2RNG A;  2WO0 A;  5BMZ A;  2M9H A;  1R4Y A;  4UVA A;  1UEL B;  1Z9C A;  2G7H A;  2Z5U A;  2XKO A;  4LG3 A;  5IT9 Z;  2F5W A;  4HYZ A;  4CDG A;  3ZP5 A;  4KFE A;  2H8R A;  3F7X A;  1ZG3 A;  2KRT A;  3BCB A;  3VPR A;  4RNZ A;  1RGG A;  1IN5 A;  1S5A A;  2PN6 A;  2QIY A;  3MKZ A;  1HKS A;  1SFK A;  3AKZ A;  4Y15 A;  4XN0 A;  4QLC U;  1R49 A;  1I6X A;  2CFO A;  5E20 A;  5F04 A;  3DEW A;  1SAU A;  3G71 I;  2CWU A;  4N6V 0;  4HST A;  1I1S A;  4K2E A;  1ETK A;  1KYZ A;  2XRN A;  1RSN A;  1MMD A;  1QBJ A;  3KFW X;  4KIC A;  3K4J A;  3DY5 A;  1FIA A;  1MZB A;  5LGN A;  1SPU A;  2YS9 A;  1XMK A;  2R4G A;  1V3F A;  4EXR A;  5BU4 A;  3KEY A;  4XOR A;  4STD A;  4ZZD A;  1FOX A;  1SD5 A;  4UUS B;  2JJ7 A;  3KKG A;  1RUN A;  1OR7 C;  4A0Y A;  2LTP A;  1JV2 B;  5ED4 A;  2Z6B A;  2BGC A;  5EZG A;  3HGG A;  3OW2 2;  3U1W A;  2E1M B;  2W04 A;  1V54 H;  2FE3 A;  4ON0 A;  3BOQ A;  4N9I A;  2JRT A;  3H3V K;  4A6E A;  3R4K A;  2ME6 A;  5ELJ A;  2DDA A;  2VQH A;  1B2S A;  2FXT A;  3M7G A;  5KAF C;  1ETW A;  1HST A;  2J5O A;  2JVH A;  1V58 A;  2HYJ A;  2ZFW A;  1YJN 3;  2Y31 A;  4UV9 A;  2BMR B;  1MDM A;  4XM3 A;  3U1K A;  4H61 A;  4YII A;  1O7W B;  1KU3 A;  3KZY A;  2V9P A;  4EGZ A;  1P92 A;  2WY7 Q;  3Q5F A;  1UCR A;  1MWT A;  1X19 A;  4X0G A;  3H3H A;  2IJL A;  1MBE A;  5DD4 A;  3RZD J;  2F99 A;  3OYH A;  3KE2 A;  4D5C A;  2R7W A;  4U13 A;  4XM4 A;  4B8X A;  2Z9O A;  1I2G A;  3L2Q A;  1S7A A;  1D6U A;  3MN2 A;  4IO9 F;  3GFL A;  1B4A A;  1P2F A;  3CD6 3;  4DZJ A;  1WQ2 A;  1WRJ A;  5FLV A;  1BSA A;  1YYV A;  1DVC A;  3GTJ J;  3DM8 A;  2OCE A;  1FGR A;  2F86 B;  3G0K A;  3HOY J;  3LFK A;  3X41 A;  1W4M A;  4IQJ A;  2A69 F;  2M0C A;  1D0X A;  4I02 A;  2JMW A;  5E3O A;  2Z3Y A;  3T8R A;  1K28 A;  3K63 A;  1T98 A;  4OOI A;  2L7K A;  4I76 A;  1G96 A;  4AUX A;  1BOA A;  4MGR A;  3NEU A;  3K69 A;  2OTJ I;  2L1S A;  1WMN A;  4ZM8 A;  4EV0 A;  1R1T A;  2EA2 A;  3ERE D;  2IPQ X;  3CCM I;  3D5I A;  3DEU A;  4D5F A;  3JUN A;  1MBH A;  1QVG 2;  2DFE A;  3GFJ A;  4GO1 A;  2ZB9 A;  1S9H A;  2RVC A;  3WOD F;  3GFI A;  3QYF A;  3ABT A;  4NBQ A;  2M4K A;  1D5Y A;  2QQ8 A;  1GV5 A;  2FBI A;  3SZP A;  4A69 C;  5K7F A;  2P4W A;  2IMJ A;  3E97 A;  1R22 A;  3H9G A;  4RGR A;  1O7F A;  2F2E A;  1ASK A;  1AV4 A;  2BW3 A;  2XGX A;  4AIJ A;  3P9K A;  2K0M A;  1R5H A;  2OQG A;  1FSE A;  3FX3 A;  3TDU C;  1L3L A;  1BGS A;  3S1Q J;  1X1A A;  1BNE A;  4GHO A;  3QU6 A;  1KYW A;  4KT3 B;  2DOE A;  1EF4 A;  5L3C A;  4XSZ F;  1JUP A;  2YPR A;  5BPD A;  1LQ1 A;  1DMQ A;  2HML B;  1OYW A;  2W0Q A;  1TWA J;  3FF2 A;  4J19 A;  1T6S A;  3OOP A;  3DP7 A;  4KMF A;  1YGW A;  3HOU J;  2YX9 A;  1P7I A;  3O8H A;  3RYR A;  3I64 A;  4GB5 A;  1R00 A;  1W6G A;  1WQL B;  3IHU A;  4KN4 X;  4ANJ A;  3JAM Z;  3CCU I;  3V8K A;  1IF1 A;  2DLL A;  3FIS A;  4WK8 F;  3RCO A;  1H88 C;  1Q42 A;  4M6X A;  2QZ8 A;  1SIH A;  4ENN A;  2L3D A;  1W5Z A;  1LFU P;  3DGL A;  5IEN A;  2VC0 A;  1FYK A;  2HYG D;  5CLS A;  1X3Z B;  2JN6 A;  4YRV A;  3SJM A;  4E7I A;  2CIU A;  2OQR A;  3WTT C;  4LFU A;  5AIF A;  4IQ4 A;  1JGG A;  2O9L A;  2JSC A;  1IV9 A;  4ZYD A;  3DTK A;  2K3F A;  4MTD A;  2L7M P;  3DQV C;  2BMQ B;  1KQ8 A;  3M8F A;  3OWS A;  3SLU A;  3CC4 I;  2CX0 A;  4BHB A;  1JJ8 C;  1K83 J;  1T5Y A;  1X4O A;  1BRN L;  2DA2 A;  5CYV A;  1J2X A;  1FBS A;  2DO7 A;  2P5V A;  4A5M A;  4AIK A;  3Q2P A;  2ZME C;  3FSD A;  1TQI A;  1RDS A;  1DMN A;  4I0B A;  3LXU X;  2QF7 A;  3MKW B;  3LL7 A;  2GIV A;  3FMQ A;  1SJW A;  1QVF 2;  1P4X A;  2UUZ A;  1YIT I;  2RV8 A;  5CPR B;  4CZZ A;  4BBS J;  2Y9Y A;  1VQQ A;  1E3R A;  2PFB A;  1ZO2 A;  4FMA A;  3GWZ A;  2WAQ N;  3MD2 A;  6STD A;  1L0O C;  2M5W A;  4MNU A;  2QQA A;  2V7F A;  1OPC A;  2IA0 A;  3K1M A;  4IJA A;  3D1N I;  2HDW A;  2HVQ A;  4OIQ F;  1GMP A;  4R4K A;  1FT9 A;  1MKM A;  3A5E A;  1B1B A;  4CCL A;  2DOA A;  1E17 A;  4EAT A;  1ULY A;  3NBB A;  4HV6 A;  3ZQI A;  1A67 A;  3ABM H;  5HLI A;  1F1Z A;  1IQ8 A;  1BSC A;  3T0U A;  3I0Y A;  3GZ6 A;  1UMQ A;  3TO7 A;  4XLC A;  3ML6 A;  2LKX A;  4BQO A;  2DA1 A;  5FLM J;  5DD8 A;  4AKZ A;  3VEP A;  1RZ4 A;  5EG0 B;  4K1V A;  3K7C A;  3WTV C;  1YS7 A;  2R4I A;  3WDG B;  3F8M A;  4EV5 A;  2DA6 A;  2XAJ A;  4ASN A;  3LYG A;  3D3L A;  3PIP F;  3TED A;  3SED A;  2VPL A;  2OBP A;  1TTO A;  4HM4 B;  4W1U A;  3U2R A;  4TV7 A;  2A6T A;  4WWC A;  3LTC A;  1YJW I;  4HV5 A;  1ENH A;  1B2U A;  5K5R A;  1SC7 A;  2CK3 H;  3E5Q A;  4KIF A;  4EM0 B;  1UGI A;  3MHE A;  2VOO A;  3QYB A;  5HLT A;  2FD5 A;  3I58 A;  1VZZ A;  3HOS A;  5DV5 A;  1JZD A;  1GT0 C;  1NG6 A;  3WG9 A;  4PUS A;  4EJO A;  5FRM A;  3CCJ 3;  2LLK A;  3D5R C;  1MJB A;  5LHG A;  4H4K C;  1JB5 A;  1G02 A;  3X40 A;  3WHC A;  3HOT A;  4WXC A;  3CCV 3;  3WHB A;  1E3P A;  2HYF A;  4YEJ A;  1OHP A;  3VSY A;  1FW7 A;  3DKW A;  5CF2 A;  1BOB A;  2EZI A;  5IER A;  3URP A;  4ZZL A;  2XPV A;  2VKH A;  2HDD A;  2CW9 A;  1OCV A;  1KU2 A;  1ZRF A;  2L01 A;  1Q82 4;  3LTD A;  4A3K J;  3TP0 A;  1T8I A;  3CQZ J;  2XSD C;  2LFB A;  3F9S A;  1CQS A;  1Q1H A;  4MFE A;  1ROA A;  4I09 A;  2ZXW H;  1Z91 A;  2ECB A;  4IKF A;  2GU3 A;  2M8E A;  1IQX A;  1KZH A;  1JB4 A;  4KJZ A;  4XLN F;  3GYH X;  4HM2 B;  1MBG A;  1B8I A;  5B1A H;  1ZRC A;  3I3L A;  2MF7 A;  3MG2 A;  3IAM 2;  4HM8 B;  2WY8 Q;  1N8R 4;  5KP1 A;  4HEA 2;  3DXJ F;  1UUW B;  1APL C;  3G2B A;  3J7A Y;  3PUF A;  1HC8 A;  5GAD J;  1R5G A;  1TT0 A;  3BR1 A;  3C3W A;  3AG4 H;  4L5E A;  5H6R A;  5TGT A;  5HOD A;  3J81 K;  1KQS 2;  3A02 A;  3LH4 A;  1WCM J;  2R93 J;  1TZL A;  2RKH A;  5GSP A;  4HSR A;  1BRK A;  1GD4 A;  1UST A;  4MJD A;  1RET A;  1Q81 4;  5IOZ A;  2K85 A;  3EUK L;  3OMY A;  4EJW A;  3BLZ A;  4ENJ A;  1VQ5 3;  2QCO A;  4C9Y A;  3WTU C;  3VOE A;  3CMA I;  4AVP A;  3F23 A;  1X3W B;  2GEY A;  4RB2 C;  5B1B H;  2DAO A;  5HS7 A;  2CMP A;  2L2O A;  1MND A;  4DIQ A;  1I70 A;  3RGR A;  3S29 A;  4RS8 A;  3TW6 A;  3IKT A;  4BDZ A;  4BE1 A;  1FSH A;  2FBH A;  4MLO A;  3M3Y J;  1LNI A;  5BIR A;  1I3Q J;  2HQN A;  3K4K A;  1R58 A;  2OU2 A;  5GAH J;  1XSD A;  3IPT A;  1YLF A;  2Q1Z B;  4B47 A;  2GXA A;  4JRF A;  1U8R A;  3FH1 A;  1O7L A;  4BH9 A;  1MWU A;  3FBI B;  3N8B A;  4WWU C;  1JBT A;  1A31 A;  1BNJ A;  3KP5 A;  3LSJ A;  4KNY A;  3PSI A;  5M3M J;  2ZBK A;  3L7W A;  3Q0V A;  2FF4 A;  2DCE A;  4P96 A;  3VYT B;  3G4S I;  3I4N J;  1BIR A;  4IIA A;  4X2H A;  2QSG X;  3CDL A;  3FXM A;  2MH9 A;  2HU9 A;  2AS5 F;  1VQ8 I;  4RB1 A;  3H5A A;  4LLL A;  3K70 D;  1MSF C;  5TIS C;  2E7X A;  2V9K A;  2E2T A;  1EG9 B;  2IT0 A;  1IU7 A;  4GYI A;  1EKE A;  1R4M B;  5KCM A;  3T0Y A;  1QGP A;  1QHH D;  1EH8 A;  2LF8 A;  4E7Z A;  5EG0 A;  3CCL 3;  4HAA A;  5HOO A;  2UUG C;  4IXA A;  2ZHX B;  1D1C A;  1GV2 A;  4PJJ A;  3JRB A;  1YJ9 I;  3KP2 A;  1TRQ A;  2D2W A;  1YI2 I;  2WAE A;  2E71 A;  4EQQ A;  4MMX B;  3HKZ N;  5K1Y A;  1FEX A;  4HM3 B;  2BE5 F;  2DT6 A;  3LSH A;  2QLZ A;  5IP6 A;  2JVG A;  2IYJ A;  4AVZ A;  5J6X A;  1HKX A;  5EEG A;  3GWR A;  1UI7 A;  4FR9 A;  3RGA A;  1WJE A;  2RNJ A;  2MC4 A;  4FCJ A;  5DDG A;  1J09 A;  5ICF A;  2UXN A;  2HMO B;  7STD A;  3FMR A;  1DPR A;  5DTD A;  3K9M C;  3LAJ A;  1IT7 A;  2DJN A;  2RCD A;  2Y0S N;  5E79 C;  2ACJ A;  2R3S A;  4HLX A;  5DCM B;  4CGZ A;  1X4P A;  4WXD A;  1FX7 A;  1IN8 A;  1BR4 A;  3I71 A;  2LBF B;  1J5Y A;  8RNT A;  4NB5 A;  3SEQ A;  4QPO A;  1Y1W J;  1SAN A;  3DH2 A;  3PYJ A;  3CLO A;  2QEX I;  2V1D A;  1V5G A;  2OC6 A;  1UUG B;  4M9S A;  2O7O A;  4MIM A;  1J59 A;  4IX7 A;  1TTY A;  3O6B B;  1G2H A;  2DI3 A;  4RGX A;  1ZH5 A;  3J80 K;  1EV7 A;  2KLO A;  3T8N A;  2R7Z J;  1BUJ A;  2BHM A;  1BSE A;  4YFK F;  1FJL A;  2XAQ A;  1Z3X A;  1X3U A;  4W97 A;  4BBR J;  1W2Z A;  4PSX A;  2HOE A;  2XGD A;  2OCC H;  3JTH A;  4CXF A;  4DNC A;  2Y48 A;  2HOT A;  3BG6 A;  3IRQ A;  3CME I;  2D45 A;  1U8C B;  3KN4 A;  3FLJ A;  1XD7 A;  2CU7 A;  2CWE A;  2HTJ A;  3F22 A;  2ESN A;  4XIC A;  1MH4 A;  2F4O B;  4MQV A;  1OAC A;  3D79 A;  3S8P A;  3HPG A;  2XF6 A;  2CV2 A;  1VQK I;  1GOU A;  2KL4 A;  2VJJ A;  2I8D A;  1P9Q C;  4IHY A;  2VJ5 A;  4OK0 A;  2XEP A;  4NPB A;  2NVQ J;  4XBF A;  2ZSH B;  2WV0 A;  2GZW A;  1S3J A;  4A6D A;  1A6I A;  1G4D A;  1Z6T A;  1AKH B;  1DU6 A;  3G16 A;  4Y7N J;  4CCN A;  2ZXH A;  1W5S A;  2FMY A;  4BGD A;  3LSG A;  2P05 A;  1B59 A;  2DW4 A;  4G7O F;  3SHF A;  2WB1 A;  5LHH A;  1Y4K A;  5CQG A;  1A35 A;  5D6E A;  1MBJ A;  2HMM B;  2L7F P;  3BCA A;  1YVB I;  3ZMS A;  3H0G J;  5AIG A;  1YIJ 3;  2HPI A;  2DFI A;  2M2E A;  1PP8 F;  2KDZ A;  2BMO B;  4MMZ B;  5KK1 A;  1IV6 A;  2RNT A;  3SYU A;  1AY7 A;  1NH3 A;  2M7A A;  2X1D A;  4WXH A;  1R9T J;  2ICW G;  1HYF A;  3EN8 A;  4CDL A;  1AU7 A;  5FKK A;  4BU2 A;  3KLO A;  1XX5 A;  4G6Q A;  3G3Z A;  4F91 B;  3CJQ B;  3DKX A;  3KP4 A;  1KU9 A;  3DV8 A;  1ERD A;  2EIN H;  2XAU A;  4JX5 A;  3GX4 X;  4AYB A;  1SFU A;  4IT7 A;  1ORK A;  5EZH A;  1QPM A;  4G6T B;  2GLO A;  2I5U A;  1RMS A;  2FML A;  2K5C A;  1XGM A;  5ICC A;  2CC3 A;  1LOY A;  4I2O A;  1D6Y A;  1W2B 2;  1V74 A;  1W01 A;  3FBN B;  1LKX A;  3GZB A;  4OAY A;  4P5O A;  2G0E A;  2AO9 A;  5F0H A;  3EE1 A;  2X6W A;  2P09 A;  3BG3 A;  3FK6 A;  3BP8 A;  3LSK A;  5HLH A;  2NS7 A;  1H9T A;  2F5V A;  1BI0 A;  4JQF A;  2EA4 A;  1D6Z A;  2AQE A;  1CYV A;  5IG5 A;  3S17 J;  2KIF A;  2HWV A;  3ERM A;  5K5O A;  2WV1 A;  3WA3 A;  2YX7 A;  4KUM A;  3CCQ 3;  4LGW A;  3RYP A;  1TBX A;  4BKX A;  2P6S A;  3RKQ A;  2NNY A;  1MH3 A;  3K9T A;  3P9I A;  1F4K A;  1EJ9 A;  2L0K A;  1MMA A;  3KET A;  2L4A A;  1JHF A;  1RJO A;  5DYM A;  5D8L B;  2OJE D;  3K1P A;  4D0P A;  1T38 A;  2JUG A;  1IG7 A;  2VBY A;  2LY9 A;  2L54 A;  5FFZ A;  2H1K A;  4A2U A;  5DCM A;  1E2X A;  2KIU A;  5JHU A;  2NOG A;  2O6G E;  3GTG J;  2Q8K A;  1MW7 A;  4Y4R A;  2LBF A;  1UCL A;  3NV0 B;  5JBS A;  3VYS B;  2LR8 A;  4Y17 A;  1ZEL A;  4BXF A;  4XID A;  1K61 A;  4N6U A;  2H6C A;  1UHW A;  1XDS A;  4FMB A;  2RSX A;  2V1X A;  1W7P D;  2M7O A;  3JRC A;  1XCV A;  1U78 A;  1UCK A;  3OS1 A;  1PU4 A;  4HAM A;  3MWM A;  1GDT A;  3BLY A;  3DBH B;  2EFO A;  3MKI A;  3V98 A;  2EJR A;  2VXD A;  1RKW A;  4UUV A;  4RAY A;  2GQQ A;  1IRX A;  4ESJ A;  2NVU B;  2HDC A;  4E6K G;  1RGL A;  4X2O A;  3VB2 A;  2J5P A;  2YUS A;  3L2R A;  5IT9 K;  3LOY A;  1T08 B;  2QKL B;  1GOV A;  2HKO A;  4O3M A;  1I8V A;  3E6C C;  4IHX A;  1OYY A;  1X1Y A;  2M1B A;  4GYG A;  1Z05 A;  3V8L A;  2UZK A;  2F48 A;  2VN2 A;  3NAR A;  2WGO A;  3S67 A;  2PEX A;  3H9J A;  3IAS 2;  1QVU A;  3D0S A;  5DRV A;  4F3Q A;  3GLX A;  2X1E A;  2OZU A;  3HSF A;  2VUM J;  3BB9 A;  2IY2 A;  1GHC A;  3E5U A;  2R7R A;  5A0O B;  1YHQ 3;  2BYV E;  3C2H A;  3Q3F A;  1IQY A;  4PJ0 C;  3NWT A;  4CCK A;  3C1D A;  3S28 A;  2FSW A;  3PQJ A;  4ZTF A;  3R60 A;  1DU0 A;  1IO2 A;  1MMN A;  4JOM A;  3ONQ A;  3U9G A;  2ZCW A;  3WG7 H;  3BG9 A;  2F6C A;  2AXL A;  4BJ5 C;  1TFO A;  3ABL H;  1VQ9 I;  1BM9 A;  4XBY A;  2VOD A;  4CCM A;  1ZGW A;  3ZFZ A;  2CO5 A;  3IKV A;  3MWZ A;  4HNV A;  2O03 A;  1UFM A;  5CVI A;  2EWN A;  4C3H J;  3SQN A;  1H0M A;  2PBI A;  3CF2 A;  2STT A;  2DMP A;  4L9T A;  1VQN I;  2EZL A;  3CNX A;  3MG3 A;  4XLE A;  2CH0 A;  1I3I A;  3S16 J;  4XSX F;  2RDP A;  2IA7 A;  1TU5 A;  4KFC A;  3NBR A;  2NVT J;  5HLG A;  4WYK B;  3HIG A;  5J1Y A;  2CKF B;  1GVJ A;  1NJI 4;  5IP7 J;  4A3B J;  3S27 A;  3F0C A;  1IXS B;  1ZK8 A;  5E17 F;  3B4P A;  3OR2 C;  3DPU A;  2OTL 3;  3KIO A;  1G3S A;  2JA7 J;  4LLG F;  3UKG A;  1W36 C;  1BNR A;  1VZ0 A;  3OYI A;  4O8S A;  3CC7 I;  3NBJ A;  2W9P A;  2KQR A;  1KC8 4;  3HK4 A;  1WKM A;  3FHZ A;  1YW8 A;  3A2K A;  1VQL 3;  4ZYE A;  2ELH A;  4XL9 A;  4DYC A;  2VE9 A;  2GXF A;  4H3U A;  3S1M J;  5E3L A;  4C30 A;  3V4G A;  3CCE 3;  4YFX F;  4HW0 A;  1SII A;  2W9Q A;  1QVT A;  2K9Q A;  2E19 A;  4ZYH A;  5BQT A;  2PZV A;  2MD5 A;  3L2V A;  1GXQ A;  3VOD A;  4ZDO A;  1KU7 A;  1YVS A;  4C2M J;  5JLW A;  1ZRD A;  3GCM A;  3CJN A;  5A2Q Z;  1JN5 B;  3NQY A;  2K02 A;  1Y6I A;  3F7S A;  2Y73 A;  1TQP A;  1XC5 A;  2DTZ A;  3KZI C;  2M4G A;  3ECO A;  4Y33 A;  2BO9 B;  3MSO A;  2A68 F;  3KE7 A;  1PJR A;  3ZG5 A;  1B72 A;  4UV8 A;  2IRF G;  1BC8 C;  4HNT A;  2C6Y A;  3EBY A;  3NV0 A;  1QHG A;  2BY1 A;  2FBK A;  4M3B A;  3OWY A;  1W4N A;  1K41 A;  1IN4 A;  1UI8 A;  1BNI A;  3A01 B;  2CG1 A;  2WGQ A;  2YR2 A;  1Y8Q B;  5M5W J;  1DET A;  1LQG C;  2IS4 A;  3H51 A;  6GSP A;  5BVB A;  3MKY B;  1KSI A;  3EN1 B;  5AIH A;  1IVW A;  1XB4 A;  1MJA A;  4F93 B;  2KRC A;  1FUS A;  4CCJ A;  4ZC3 A;  2EQR A;  4A3C J;  2Z77 A;  1SVO A;  3HOW J;  4LIV A;  2CW7 A;  5JLX A;  1SAX A;  4M3F A;  4B3A A;  4NHJ A;  3KZZ A;  3BZC A;  5LRR A;  2I10 A;  1JT0 A;  5M5Y J;  1PYL A;  2KZG A;  2GWR A;  1JKQ C;  1MJ9 A;  1X1B A;  5D5X B;  3HOZ J;  3WOF B;  3K2A A;  3FM3 A;  4PSW A;  2CQQ A;  4QWQ A;  4RMN A;  1IVX A;  2RN7 A;  4ETS A;  3TMO A;  3PCR A;  1I2F A;  1IV7 A;  1FOY A;  3HI7 A;  4A3E J;  2COB A;  3WE2 A;  2NVX J;  6PAX A;  1W6Y A;  1XSV A;  4E7K A;  4EJV A;  1U0J A;  2TRT A;  3F8F A;  3I55 I;  1BW6 A;  1K9M 4;  3N9H A;  1X2M A;  2R7F A;  1I3F A;  4LMY A;  2PMZ N;  2HZT A;  2HEO A;  3FDY A;  2KJB A;  3QPT A;  5FB2 A;  4OIN F;  1BU4 A;  3E99 A;  4HBR A;  4XRS G;  2A6E F;  5J8F A;  4BE0 A;  4EYC A;  3FKJ A;  3FXL A;  3L1P A;  3NAU A;  2VQG A;  1U5O A;  1O3Q A;  2KAA A;  1F36 A;  2CRG A;  4HF1 A;  3H36 A;  2TCT A;  3BR3 A;  3DGM A;  1S72 I;  4LIT A;  2FNQ A;  1JJ2 2;  2UGI A;  4M9Z A;  1E97 A;  4DOZ A;  2BHY A;  1ACI A;  1D8J A;  5HVQ C;  2MC3 A;  1JKR C;  4WYK A;  4I5Q A;  3HUG A;  2ZKZ A;  4B4C A;  4R80 A;  2G9W A;  4L8O A;  3W3C A;  2ZNY A;  3ZR8 X;  3VYR B;  4GGG A;  2UWM A;  3ZQL A;  4HQM A;  1J9I A;  3FKA A;  4HNU A;  2HPM A;  1TP4 A;  3I56 I;  4AM3 A;  3DPT A;  5EGO B;  5AYS C;  1XMX A;  4RZM A;  1K79 A;  1HF0 A;  3NUV A;  4J01 A;  2ZFU A;  2XGL A;  2JZY A;  3T1B A;  5F27 A;  4LMI A;  1FTT A;  3CMM A;  2MAB A;  1OGZ A;  2KIS A;  1Y1V J;  2FOW A;  2X48 A;  2FNP A;  2CUE A;  5BNG A;  3F8C A;  1YIO A;  3UR3 C;  3ZOB A;  4AWX B;  1U5T C;  4L0Y B;  3K5T A;  4N6L A;  1U9O A;  5KP3 A;  1B2Z A;  1JN5 A;  4A93 J;  4DJA A;  3DUK A;  4K90 B;  1ONV A;  2Y30 A;  3CUO A;  3OYE A;  1V55 H;  2K86 A;  1LVN A;  3QOE A;  3OSF A;  1VQ6 I;  1WJB A;  2JPB A;  2FQ4 A;  2BOL A;  3I59 B;  2XRL A;  3CCR I;  1RN7 A;  4J00 A;  4LB5 A;  2IA2 A;  1Q40 B;  3ZXS A;  2CQ7 A;  1XS9 A;  4C3J J;  1US1 A;  4BQN A;  4B1R A;  5JI6 A;  2A05 A;  2K7L A;  3A01 A;  4E7S A;  5CJ9 A;  1D0Y A;  1FIP A;  1HXD A;  3ZMZ A;  2GEX A;  4BEH B;  2W4S A;  1LQM B;  2HKX A;  2BU4 A;  1VQO 3;  1OCO H;  2D1H A;  3CPW 2;  3HIF A;  5CVJ A;  4O5V A;  3ZQF A;  1RPW A;  5FFX A;  4HF2 A;  3N97 A;  3H92 A;  3RJP A;  3ECH A;  2ML5 A;  4KT5 C;  2A15 A;  1B9M A;  4FHT A;  1WFX A;  1F5T A;  3BC8 A;  3Q0U A;  1R23 A;  1VQ7 3;  2M30 A;  3IJE B;  2X1C A;  1G3W A;  2R5Z B;  2IS6 A;  4J8T A;  1N9J A;  1IV8 A;  4D7N A;  3FG3 A;  1YS6 A;  2EV6 A;  3U21 A;  1AOY A;  5L3D A;  5LEK A;  4HOB A;  2XF3 A;  5AII A;  2JRM A;  3FXQ A;  4Z6Y A;  2X51 A;  3I9V 2;  5L3F A;  1S7O A;  1RGA A;  4WF2 A;  4KZ1 A;  1BRS A;  3HGY A;  1ZR2 A;  2DA3 A;  3MEX A;  1JNQ A;  3CCS 3;  1WH7 A;  3GW2 A;  3KPH A;  2R7O A;  3G73 A;  4BHP A;  3MZH A;  4KYW A;  4GSP A;  1TWG J;  5BPI A;  1E3O C;  1QAF A;  1Z6R A;  3EET A;  2X6Y A;  3NXJ A;  4UB8 C;  2ME0 A;  4G12 A;  3ULQ B;  2Z16 A;  5DM6 F;  3S15 J;  3TO6 A;  1MD0 A;  1BOX A;  3GAX A;  1BJZ A;  1UGH I;  1ZRE A;  3SX1 A;  3PNV A;  4KIB A;  4UB6 C;  4CPK A;  1WMP A;  2P8T A;  3CTA A;  3Q9S A;  4AU7 A;  1Z7U A;  3P7N A;  1TQM A;  4A3F J;  3CC2 I;  2PMH A;  3BR5 A;  3KP3 A;  4C2T A;  1M1X B;  1BL0 A;  1OHO A;  3G6E 3;  4AEQ A;  2LRE A;  1U9N A;  4Q53 A;  3SVA A;  4CCO A;  5IY5 H;  1ETV A;  2OQE A;  4YG2 F;  1K6Y A;  2X6O A;  5IG3 A;  4UUS A;  1ETX A;  4S05 A;  3NQO A;  1FTZ A;  2X85 A;  2R7D A;  2V9V A;  5EGO A;  1BAN A;  1AHD P;  1AVK A;  1YNV X;  3A03 A;  1T0F C;  3M8E A;  3OWT A;  4M6V A;  3ROU A;  1VQ4 I;  5E18 F;  3IH3 A;  1Y8R B;  1CH0 A;  3Q0W A;  3VF1 A;  3BT9 A;  4G7Z F;  4E7H A;  2DN0 A;  5GTH C;  1C7H A;  4UY8 I;  3QRF F;  2LRD A;  1Z7L A;  3KII A;  4BU4 A;  2D1W A;  3HG9 A;  1MOL A;  3IWZ A;  3LSI A;  3EBT A;  5L3B A;  1UG2 A;  1TWH J;  2IP2 A;  4A5N A;  4HVN A;  1O7H B;  2VBZ A;  5FKL A;  5B3S H;  2O8K A;  1GVD A;  1D0Z A;  3G1O A;  1JKP C;  3AL0 C;  1TP6 A;  1UUV B;  2HS5 A;  2LDU A;  3KLN A;  3IRR A;  1GOY A;  3L2W A;  4HM5 B;  2HXO A;  3PFI A;  3BJO A;  3I59 A;  1JZO A;  4KMU X;  5HDK A;  3S2H J;  2M87 A;  3FM5 A;  1Q40 A;  3K10 A;  2E7W A;  1RRH A;  2MFZ A;  2KMU A;  4B09 A;  3FZW A;  2WB1 N;  1X2N A;  3B8L A;  3ZQG A;  4PJN A;  1GMQ A;  1A90 A;  1TW2 A;  4IF4 A;  1G6N A;  2K9S A;  2B9S A;  4R1K A;  1OFC X;  2JUC A;  3WR2 A;  2V6C A;  3ASO H;  5JHF A;  2LMD A;  4I99 C;  4QIW N;  1DPU A;  3ALA A;  1OCR H;  1ZTR A;  2XAH A;  4XB5 A;  3X3Y A;  3EUH A;  1RRL A;  1VQM 3;  2PI0 A;  3BPX A;  3HOX J;  3PO3 J;  2OWP A;  3PS8 A;  5F08 A;  1RLS A;  2E2H J;  2EFQ A;  2H6B A;  3OYC A;  4GDF A;  3JUO A;  4EC6 A;  3WU0 A;  4NHF A;  3HRU A;  2R5Y B;  3BND A;  2CFK A;  4LYL B;  3UL6 A;  1WI9 A;  5LC7 A;  2CG4 A;  3CP2 A;  1R5I D;  4LOC A;  4IOA F;  1UW1 A;  1W00 A;  4OIO F;  2Y9Z A;  1YJN I;  1HDD C;  2XSJ C;  2ZJR F;  1NK2 P;  1NWW A;  4KFD A;  2OOV C;  2JK3 A;  2QEN A;  3JUQ A;  3WGH A;  1OH0 A;  4CYC B;  1BN5 A;  2VIX A;  2AXT C;  2KF3 A;  5EDN A;  2O9U X;  3TQN A;  3BQY A;  3WTX C;  3CD6 I;  3DGO A;  1ZLJ A;  3Q1C A;  3MMY B;  1KGS A;  1BW5 A;  4PEJ A;  2DA5 A;  2CJJ A;  3SOY A;  2L4V A;  5FGO A;  1Z21 A;  1B27 A;  1VI0 A;  1LDJ A;  5L3E A;  4HF0 A;  2J8X B;  2W48 A;  4O2H A;  1I5Z A;  2LP0 A;  2NOJ B;  2V1N A;  4B44 A;  2P38 A;  3BTJ A;  2PX9 A;  2CWV A;  4L0Z B;  2KIM A;  4BS9 A;  1W1W E;  3AFH A;  1GMR A;  1ETY A;  3I54 A;  2M45 A;  3FCS B;  3MAJ A;  5TGN A;  1J0R A;  2PNC A;  1BNG A;  2P6T A;  5JPU A;  1WHU A;  4A3D J;  2LKP A;  2OA4 A;  1A6Q A;  2MLK A;  5LGT A;  4QTR A;  2E2I J;  4JBA A;  2L02 A;  2MG4 A;  1HOM A;  2FJ1 A;  4YEL A;  1R7J A;  3A1Y A;  3TKY A;  4MEI A;  3WTZ A;  4RAG A;  4FCM A;  3FF0 A;  3G8Z A;  3UL5 A;  3FK7 A;  2QA4 3;  4UHT A;  1I1G A;  5FKM A;  3OYF A;  4IHS A;  1Z77 A;  1B2M A;  5I97 A;  3S3O A;  3AG1 H;  4ESF A;  3KP6 A;  1T39 A;  1FYL A;  1QAK A;  2RQQ A;  1LOX A;  1FC3 A;  2XF7 A;  3F8B A;  2ZJP F;  2H0I A;  2K54 A;  1G3T A;  3ZQC A;  3KSE D;  3UB1 A;  4V2G A;  1SMY F;  2XUB A;  3S32 A;  1EA2 A;  2GSP A;  3V7C A;  4U0W A;  5K7H A;  1R6R A;  4R79 A;  3KZT A;  1BSD A;  1O3R A;  1OF5 B;  3LA2 A;  3E7L A;  2WC2 A;  3HC7 A;  3JTG A;  5JPP A;  4NRE A;  2F4M B;  2ZME B;  1S6L A;  2XF5 A;  3OOU A;  3G1L A;  2LYX A;  5KP4 A;  3BR0 A;  3DBL B;  1DDN A;  1MWR A;  2DBB A;  1OR7 A;  4AID A;  4HZF A;  1TNT A;  1XG1 A;  3OYA A;  2MYS A;  1ITY A;  2XSO B;  1TLH B;  5TRD A;  3CXC 2; 
#chains in the Genus database with same CATH homology
 5G2G A;  1YI2 3;  1VQ4 3;  3EJV A;  3L0R A;  1TIJ A;  4HM6 B;  4N6U A;  4FMB A;  2RSX A;  2WO0 A;  3B7C A;  3D9R A;  4N6T A;  2M7O A;  1M90 4;  3N54 B;  1PU4 A;  3V92 A;  4HYZ A;  3EX9 A;  2O3O A;  3MKI A;  3F7X A;  4KFE A;  3V98 A;  2KRT A;  5AI1 A;  4RNZ A;  2W6J H;  3OXA A;  3HZP A;  4IPB A;  4X2O A;  5IG4 A;  1S5A A;  1WNH A;  4BTX A;  3LOY A;  4JF8 A;  2QIY A;  5IW9 A;  1J2B A;  3V99 A;  3NQZ A;  2CWU A;  4N6V 0;  4HM0 B;  5CK6 A;  2WGO A;  3S67 A;  2B24 B;  1VQP 3;  1IVV A;  5DRV A;  3X3Z A;  3BB9 A;  2QEX 3;  4G1M B;  3DY5 A;  3LT8 A;  1SPU A;  1YHQ 3;  5A0O B;  1IQY A;  3S28 A;  3X3X A;  4EXR A;  4STD A;  1DVD A;  1CYU A;  3FG4 A;  3ROB A;  2MC8 A;  1R4C A;  3KKG A;  3PXM A;  3ECF A;  3F8H A;  1TFO A;  2Z6B A;  1JV2 B;  1NB3 I;  4L7K A;  4XBY A;  3CME 3;  3OW2 2;  3U1W A;  2W04 A;  3MWZ A;  8CHO A;  2YFI B;  2XGL A;  2XGN A;  3MG3 A;  5ELJ A;  3CNX A;  3UJM A;  1ROV A;  2CFL A;  2FXT A;  3EF8 A;  5D83 A;  1GY5 A;  3RDE A;  1VQK 3;  4HZ9 B;  2IUJ A;  2IA7 A;  3PZW A;  1TU5 A;  3EB8 A;  1YJN 3;  2BMR B;  3NBR A;  3WA2 X;  4H61 A;  1O7W B;  4WYK B;  2QGU A;  3HIG A;  4K1U A;  5AYR B;  3S5C A;  3H3H A;  2CKF B;  2WOF A;  1NJI 4;  2F99 A;  4U13 A;  3S27 A;  4XM4 A;  3B4P A;  5HGR A;  2OTL 3;  1D6U A;  2CFW A;  3CD6 3;  1AVL A;  2XFT A;  1WMO A;  4LEH A;  4O8S A;  4HZB B;  3NBJ A;  1DVC A;  3DM8 A;  3X41 A;  1FGR A;  2F86 B;  2KCD A;  2W9P A;  3G0K A;  1KC8 4;  3HK4 A;  5CF1 A;  1VQL 3;  3OV4 A;  1K28 A;  2GXF A;  4H3U A;  3K63 A;  1NB5 I;  1SQW A;  1G96 A;  3CCE 3;  3WMD A;  1SII A;  1WMN A;  1STD A;  2W9Q A;  5ELU A;  4ZM8 A;  2PZV A;  3JUN A;  1QVG 2;  4MMY B;  2ML6 A;  1OF5 A;  1JN5 B;  3NQY A;  1JKG A;  2CFG A;  2INX A;  3F7S A;  3QK9 A;  2Y73 A;  1K8A 4;  2BO9 B;  2IMJ A;  3MSO A;  3KE7 A;  1ASK A;  1NU3 A;  1AV4 A;  3CXC 2;  1LNH A;  1W02 A;  2K0M A;  3EBY A;  2XRX B;  3NV0 A;  3OWY A;  1IDP A;  3LZA A;  1YGE A;  2HMK B;  3LTA A;  1W4N A;  1OHS A;  1K41 A;  1RKY A;  1UI8 A;  2CG1 A;  2WGQ A;  1N5H A;  2HML B;  2W0Q A;  1DMQ A;  3FF2 A;  3H51 A;  3LT9 A;  5BVB A;  1KSI A;  4ORL A;  3EN1 B;  2LQV A;  5AIH A;  1IVW A;  3BNE A;  2YX9 A;  4GB5 A;  2ZDJ A;  3GZR A;  1W6G A;  1NDO B;  1WQL B;  1GD3 A;  2E2V A;  4FMC A;  3AMO B;  5CXO A;  2Z77 A;  1Q42 A;  1SIH A;  1W5Z A;  4CCV A;  1E3V A;  1W7C A;  2STD A;  3DGL A;  5IEN A;  2CIU A;  5AIF A;  3WOF B;  1IV9 A;  2BMQ B;  5BXQ A;  5IG0 A;  2Z7A A;  4XDV A;  1QAL A;  3OWS A;  3SLU A;  1IVX A;  1FGO A;  1T5Y A;  3PCR A;  1IV7 A;  3Q2P A;  3HI7 A;  4J9A A;  3FSD A;  1DMN A;  1W6Y A;  3LXU X;  1SJW A;  3EC9 A;  1QVF 2;  3FG1 A;  1K9M 4;  3N9H A;  3K0Z A;  1E3R A;  1QJG A;  3LTB A;  4FMD A;  5AEW B;  1ZO2 A;  4FMA A;  1FGT A;  3E99 A;  1TUH A;  1DMM A;  2RFR A;  4HBR A;  6STD A;  4OK0 A;  4EYC A;  4N3V A;  1FA3 A;  4R4K A;  1U5O A;  4KVH A;  3G71 3;  4WP5 A;  3DGM A;  1O7M B;  3MYT A;  2KXG A;  1CEW I;  3NBB A;  2FNQ A;  1JJ2 2;  1A67 A;  4HM1 B;  1E97 A;  5FW5 A;  4WFO A;  4WYK A;  3HX8 A;  1IQ8 A;  5D82 A;  3T0U A;  4R80 A;  3I0Y A;  3NM2 A;  4L8O A;  1GY6 A;  3GRD A;  4AKZ A;  1GS3 A;  3TDG A;  1FGQ A;  1M9G A;  1N8Q A;  4K1V A;  2GBX B;  2R4I A;  3FKA A;  3K7C A;  3WDG B;  4EV5 A;  2F98 A;  3F40 A;  3LYG A;  1VQ9 3;  3D3L A;  4R9K A;  5AYS C;  3SED A;  1ULI B;  4RZM A;  2C11 A;  4HM4 B;  5AEU B;  3NUV A;  3KSP A;  3LTC A;  2CK3 H;  1VQN 3;  4LMI A;  2V1L A;  3A76 A;  1OGZ A;  3MHE A;  2CWT A;  1BUQ A;  1VZZ A;  3SXX A;  3CCJ 3;  2IUK A;  4OVM A;  2OCT A;  2YFJ B;  3K5T A;  4N6L A;  5KP3 A;  1GY7 A;  1JN5 A;  1JB5 A;  3DGN A;  3X40 A;  3DUK A;  3VGN A;  4K90 B;  1OHP A;  3CCV 3;  3VSY A;  5CF2 A;  1LVN A;  5IER A;  1N5P A;  2CW9 A;  1OCV A;  1RN7 A;  2Z76 A;  3CC7 3;  1Q82 4;  3LTD A;  1Q40 B;  2I9W A;  1Q86 4;  1US1 A;  3F9S A;  1CQS A;  2ZL8 A;  1ROA A;  2D42 A;  3KFQ C;  3QRD A;  2WOH A;  2GEX A;  2GU3 A;  3O8Y A;  4BTY A;  2OTJ 3;  1IQX A;  3CCM 3;  1KD1 4;  1JB4 A;  3NHX A;  1A2V A;  1VQO 3;  4HM2 B;  4LGQ A;  4WHA A;  3CPW 2;  2BNG A;  2MF7 A;  3MG2 A;  4HM8 B;  2CH9 A;  1W6C A;  1N8R 4;  3AMO A;  5KP1 A;  4K61 A;  1UUW B;  5EVH A;  1L5G B;  3WOD G;  2ML5 A;  2A15 A;  1OPY A;  5LC6 A;  2W56 B;  1KQS 2;  2XSH B;  3LH4 A;  1Z1S A;  1OGX A;  1GD4 A;  4MJD A;  1VQ7 3;  3IJE B;  3STD A;  1Q81 4;  4J8T A;  1N9J A;  3FG3 A;  1AR0 A;  3BLZ A;  2E2U A;  2XF3 A;  1VQ5 3;  5AII A;  1TFK A;  3OWU A;  2CHC A;  2GEY A;  1HU9 A;  1IVU A;  3RGR A;  4KZ1 A;  3S29 A;  2HMJ B;  1JNQ A;  3CCS 3;  3CCU 3;  5IEO A;  2BT3 A;  3IPT A;  1KWI A;  1QAF A;  3CPO A;  3NXJ A;  2B1X B;  4JRF A;  3FH1 A;  5EEO A;  4WWU C;  3N8B A;  2XR8 B;  4N6O B;  1A2K A;  3GAX A;  1GYB A;  3BNB A;  1LXE A;  3SX1 A;  3NM7 A;  2GU1 A;  2HMN B;  4IIA A;  3CU3 A;  1WMP A;  2RGQ A;  4X2H A;  1PFP A;  3F14 A;  3CC4 3;  1OHO A;  1M1X B;  2CFD A;  1F8N A;  2E2T A;  3G6E 3;  4AEQ A;  1EG9 B;  1STF I;  4Q53 A;  3SVA A;  2P0M A;  1IU7 A;  2OQE A;  2Y74 A;  3CCL 3;  5IG3 A;  4QWT A;  5IF6 A;  1NO3 A;  1K73 4;  3I55 3;  1YIT 3;  4TX4 A;  3PCS A;  4I4K A;  1AVK A;  4HM7 B;  1EQK A;  1JRQ A;  4MMX B;  4N6N B;  4HM3 B;  3T8U A;  3VF1 A;  3DXO A;  3WOE B;  4XBT A;  5STD A;  1WTH A;  3CNM A;  1C7H A;  3GWR A;  1HKX A;  4FR9 A;  3RGA A;  1UI7 A;  1S72 3;  4EV2 A;  3KII A;  2OOV A;  4FCJ A;  2D1W A;  3DMC A;  4HKV B;  1MOL A;  3F8X A;  3GZY B;  2SBL A;  2HMO B;  7STD A;  3EBT A;  2JQ5 A;  3K9M C;  3FGY A;  4HVN A;  1IT7 A;  1O7H B;  4FCZ A;  2RCD A;  1TP6 A;  1UUV B;  2YFL B;  4HM5 B;  3I56 3;  2FGT A;  1Q7Y 4;  4LZI A;  1Q40 A;  1RRH A;  3UNL A;  1MNL A;  1FUW A;  3FZW A;  3PYJ A;  1YJW 3;  3B8L A;  2Q07 A;  1IT8 A;  1JB2 A;  3OX9 A;  5DRE A;  1A90 A;  1ULJ B;  3T8N A;  3M8C A;  4R1K A;  2BHM A;  1DYU A;  1O7G B;  2OQE C;  2UX0 A;  3NX0 A;  3ALA A;  3X42 A;  4XB5 A;  1VQM 3;  3X3Y A;  1RRL A;  1W2Z A;  2OWP A;  1O7N B;  3PS8 A;  4EC6 A;  3JUO A;  1U8C B;  3KN4 A;  4OUQ A;  4NHF A;  3EQQ B;  3FLJ A;  3BND A;  2W56 A;  3U97 A;  2CFK A;  3UL6 A;  1VQ6 3;  1FGM A;  2XFS A;  3IMA B;  5LC7 A;  1OAC A;  3CCR 3;  1UW1 A;  1W00 A;  1NWW A;  2W03 A;  4R9L A;  2XEP A;  4KFD A;  2OOV C;  4O02 B;  5EQL A;  3JUQ A;  1EKM A;  1OH0 A;  5CLK A;  3MG1 A;  3JUM A;  3G16 A;  2O9U X;  3DGO A;  1OUN A;  4XBX A;  3Q1C A;  4PEJ A;  4XDW A;  5D81 A;  2P05 A;  2JDI H;  3SOY A;  4O3V A;  1ISK A;  1Y4K A;  2L4V A;  5FGO A;  4RNY A;  2HMM B;  4O2H A;  3J7Y d;  3GZX B;  1YVB I;  2P38 A;  5AIG A;  1YIJ 3;  4L8P A;  3HII A;  3B4O A;  2CWV A;  2BMO B;  1ZX2 A;  4MMZ B;  3BNC A;  3MPH A;  3LML A;  3EHC A;  2XH9 A;  3FCS B;  4LSO A;  5TGN A;  3EN8 A;  2PNC A;  4HJL B;  4CDL A;  5JPU A;  1IK3 A;  1QMA A;  3CMA 3;  3DZL A;  3PGB A;  4IT7 A;  1M1K 4;  3JVC A;  4MEI A;  2P0X A;  4FCM A;  3FF0 A;  3G8Z A;  3UL5 A;  2QA4 3;  2CC3 A;  2C10 A;  1D6Y A;  1W2B 2;  1V74 A;  4AKY A;  1W01 A;  3SOA A;  3GZB A;  5I97 A;  3EE1 A;  2P09 A;  4RBN A;  1QAK A;  1LOX A;  2K54 A;  1D6Z A;  3G4S 3;  3KSE D;  3UB1 A;  1EA2 A;  4GL6 A;  1CYV A;  5IG5 A;  2CG0 A;  3KZT A;  1VQ8 3;  3WA3 A;  3CC2 3;  1OF5 B;  3CCQ 3;  3JUP A;  5JPP A;  1JKG B;  4NRE A;  1O7P B;  2LYX A;  3ER7 A;  3Q90 A;  4KFF A;  4BTW A;  1RJO A;  5KP4 A;  2W2C A;  2XSO B;  5IEP A;  1YJ9 3;  4EBG A;  1N9E A;  4N6M A;  3NV0 B;  5JBS A;  2GBW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...