2QGUA

Three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
ADAQATVKTAVDDVLATIKGDPDLRGGNLQKVFQLVDQKIVPRADFKRTTQIAMGRFWSQATPEQQQQIQDGFKSLLIRTYAGALANVRNQTVAYKPFRAAADDTDVVVRSTVNNNGEPVALDYRVEKSPNGWKVYDINISGLWLSETYKNQFADVISKRGGVGGLVQFLDERNAQLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable signal peptide protein
publication title Three-dimensional structure of the phospholipid-binding protein from Ralstonia solanacearum Q8XV73_RALSQ in complex with a phospholipid at the resolution 1.53 A.
rcsb
source organism Ralstonia solanacearum
molecule tags Structural genomics, unknown function
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05494 MlaC MlaC protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A phospholipid-binding protein 2qguA02
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qguA01
4R9LA 4PEJA 3Q90A 3EN8A 3H3HA 1DMMA 5AI1A 4Q53A 3VSYA 4XM4A 5CXOA 3HX8A 3MG2A 3KE7A 2BMOB 5EVHA 4HM7B 3BLZA 5IEOA 3SOAA 2Z7AA 4LGQA 3F8HA 4I4KA 2Z77A 3MKIA 1JN5B 4HZ9B 1OGXA 2RFRA 1GS3A 3EX9A 1OHPA 1O7PB 1OPYA 1UUVB 1K41A 3A76A 5JPUA 3CU3A 3UJMA 3EN1B 4HM3B 1W6YA 4GB5A 1QMAA 2HMOB 2YFLB 3JUPA 4X2OA 1VZZA 1C7HA 2F99A 3F7SA 5AIHA 3K7CA 4HM5B 5D82A 5IF6A 3SEDA 1ZX2A 1E3VA 4IIAA 5AEWB 2B1XB 3NM2A 3GRDA 5STDA 1O7NB 2XR8B 5TGNA 4FCJA 5IG5A 3CNMA 3VGNA 5D83A 3E99A 3FKAA 4ORLA 2HMJB 1OCVA 3MSOA 1OH0A 4XBTA 3T8UA 7STDA 3D9RA 3MHEA 5BXQA 4WP5A 1STDA 5AIFA 3KKGA 3GZYB 4HM6B 1EG9B 3ROBA 2GEXA 2UX0A 1UUWB 3FF0A 2CKFB 2RCDA 3NV0B 2K54A 1OHOA 3F9SA 1JB2A 5IEPA 3MYTA 5KP3A 5BVBA 3B8LA 3F7XA 5KP1A 2GEYA 1IDPA 3OX9A 3DMCA 3F8XA 3GZBA 2F86B 4K1UA 5IG3A 4XDWA 1JKGB 2YFIB 1E3RA 2IMJA 4RZMA 3LZAA 3B4PA 1QJGA 4K1VA 3OWUA 1NWWA 1BUQA 1ULIB 5IENA 5CLKA 3GZXB 2HMMB 4CDLA 4X2HA 3NV0A 3RGRA 2QIYA 8CHOA 3B4OA 3FF2A 4HKVB 4R9KA 4XBXA 2BMRB 3EHCA 1OF5B 3EJVA 2QGUA 3EF8A 3IPTA 4HM8B 5AIIA 3FZWA 1GY6A 1OHSA 3LYGA 4STDA 1SJWA 3JUMA 1DMQA 1JKGA 1HKXA 2F98A 1U5OA 1JN5A 2BNGA 3OV4A 2Z76A 3MG1A 2GBWB 2GXFA 2YFJB 1OGZA 4U13A 4FCMA 3JUNA 6STDA 3OWSA 1OF5A 5IG4A 3DXOA 5AEUB 4LEHA 3CPOA 3NUVA 4WYKB 3FSDA 4LMIA 2INXA 4XDVA 3HZPA 3H51A 3FH1A 1GYBA 1NDOB 1W01A 4HM2B 1O7WB 4OUQA 4L8PA 4HM1B 3F14A 4XB5A 2JQ5A 1E97A 3B7CA 1WQLB 3GWRA 4J8TA 1Z1SA 4WWUC 3K0ZA 5IG0A 1GY5A 1ISKA 3SOYA 2XSHB 4J9AA 4HZBB 4OVMA 4L7KA 1TP6A 1W02A 3HK4A 3OXAA 3EC9A 2RGQA 4WYKA 2HMLB 2HMKB 3F40A 3S5CA 5G2GA 2XSOB 1Q42A 1S5AA 1W00A 3M8CA 3G8ZA 3KSPA 3OWYA 3RGAA 4L8OA 2HMNB 1O7HB 3G16A 1Q40B 1GY7A 1EA2A 1OUNA 2BMQB 1O7MB 3UNLA 5CF1A 3NBRA 1ASKA 4R1KA 4HVNA 3GZRA 1JB4A 4H3UA 3DUKA 1TUHA 2A15A 1O7GB 4N3VA 2GBXB 3NHXA 2OWPA 4XBYA 3EBYA 3G0KA 4KVHA 3NXJA 5DRVA 3DZLA 2XRXB 4HM4B 3CNXA 2STDA 3I0YA 1NU3A 1Q40A 3ER7A 2W2CA 5D81A 2B24B 1DMNA 1A2KA 5IERA 3EBTA 4HJLB 5DREA 2R4IA 3WMDA 5FW5A 4MJDA 2CHCA 5CK6A 3DM8A 3STDA 3JUOA 5JPPA 2I9WA 3T8NA 3FGYA 1ZO2A 5CF2A 3MG3A 1CQSA 1AR0A 5KP4A 2PZVA 3BB9A 1ULJB 1JB5A 5HGRA 3EQQB 3ECFA 5AIGA 3JUQA 3KZTA 4HM0B 3FLJA
chains in the Genus database with same CATH superfamily
4R9LA 1UCIA 2NNYA 3NEUA 1SC7A 3EN8A 4BHCA 2CU7A 1O7LA 1DMMA 1WI3A 4AC0A 1G02A 3I3LA 4RGRA 7GSPA 1W0TA 2DT5A 1HSTA 1O57A 5IT3A 2ZO4A 3RZDJ 1WJAA 2ZXHA 3E5QA 1R5ID 5FROA 2W7NA 1RR8C 1YGWA 2KIFA 2KDOA 4A0XA 1YIJ3 3HX8A 3MG2A 2DMPA 3F21A 2Z1DA 3S32A 5AYRB 1FOWA 2CGPA 4HM7B 4ESBA 4FE4A 1ACIA 5IEOA 2NS8A 2R7XA 2RKHA 4LGQA 3LL7A 3BZKA 2M4GA 1V5FA 2H6CA 5TJJA 4DIQA 5FO5A 1XG1A 3MKIA 3F6OA 1MDMB 2XSDC 1RGKA 2M3AA 2Q1ZB 1I2EA 3WA3A 5CVJA 5KAIC 1YW7A 3HHGA 1YIT3 1OGXA 2KRTA 1S7AA 3CLOA 3VPRA 1P7JA 1FMWA 3BCAA 1IN8A 1U9NA 4CZCA 4NPBA 2COBA 2L5QA 1W4NA 1CF7A 1YI2I 3V7RA 4CCJA 3CCJI 1BSAA 4W97A 3R0AA 3L09A 4ZM8A 4IQ4A 4OAYA 2OV7A 1IQYA 1QVTA 2PNCA 1CEWI 4EM1A 3EYYA 2F5FA 1I6XA 2FD5A 4MHGA 4RB0A 2TRTA 4HNUA 2EFQA 3K4NA 4IPAA 3FM5A 3K10A 4A12A 1ZTRA 2FBHA 2DMTA 1BRSA 1DVDA 4XR6A 3WHOA 3A76A 5C4JJ 3RKXA 3LXUX 1R58A 1LJ9A 3LTDA 2JZYA 1LDKB 4XKWA 4FISA 3GTPJ 1VQ9I 1FPQA 2NAZA 3N54B 1HXDA 2P7CB 1BNEA 2Y75A 3UJMA 4BE1A 4KFCA 5D6FA 3Q9VA 5M3FJ 3GXOA 1R1VA 3ZMDA 1ZGJA 1W6YA 5ILVA 4LJZF 5FLVA 4BDYA 3I59A 1QMAA 1RUOA 4HNVA 1UGIA 5BOXA 3ALAA 2JK3A 1YJW3 1ONVA 5E3NA 2ZMEA 1U5TA 2E2TA 3A01B 2HMOB 4GHOA 1LVAA 4X2OA 2CMPA 5A2QK 4U7DA 2V9PA 1AQZA 1F8NA 5J1RA 2XB5A 4ETSA 2W4SA 1XGNA 2NVXJ 3P9KA 3F7SA 1T95A 2CG0A 1N8R4 4A69C 5HS7A 2EV5A 2IS6A 3F9KA 5AIPA 3W6VA 5H2FC 3BTJA 2HQAA 2R5YA 4K61A 1R23A 3KETA 4A3DJ 3WTZA 4D5CA 2GZWA 3FF5A 1QPIA 2XPWA 1BSEA 5D82A 1RKYA 3SEDA 1FX7A 3E6BA 3HPGA 4GFBA 3HIGA 4IIAA 3SFZA 3DLLF 2B1XB 1RGCA 4XM3A 2NVUB 5IP6A 3GRDA 2PG4A 1OQYA 4RLFA 8RNTA 2WGQA 1KGSA 1ON1A 2CG4A 2EZIA 2K5CA 3BJAA 5AYSC 1M904 4A3JJ 3K0LA 1T08B 1GOVA 1F9NA 5J40A 1MNDA 3U1KA 2MD0A 1R49A 3OSGA 4C3HJ 1JE8A 2FUG2 3FKAA 4ORLA 4J5KA 5EF6A 3LSHA 1W2B2 2MC3A 1N78A 4H4KC 3MSOA 3TEDA 2VBXA 5BS6A 4RGXA 3T8UA 2OZ6A 7STDA 4EVIA 1UFMA 1HW5A 2W82A 2XROA 3X42A 1FUTA 5CQGA 2KZVA 3IKTA 1US1A 1R4CA 2GSPA 2E7WA 1UHMA 3CMEI 2CX1A 4QIWN 2COMA 2XGXA 5E1XA 1B9NA 2O61A 1M9GA 1SD7A 1KZHA 3TOBA 3KIIA 1BRGA 2H1LA 1FNNA 3L9FA 3PQJA 1ZG5A 2L7ZA 4XRSG 4RAFA 1LFUP 1EG9B 2UX0A 2AQFA 2WV1A 2VT2A 3C2BA 2YX7A 2W03A 2GXAA 4BHBA 1SIIA 3J7Yd 3NV0B 5ELUA 2OTJ3 1L5GB 2K54A 5EQLA 4C3JJ 1TJDA 4B43A 3BLYA 3DPTA 1OISA 3QP6A 5HLIA 1OHOA 2JA2A 5EJCA 5D8LB 1JB2A 4RM2A 4IHSA 4YG2F 3CCSI 1U6GA 3K1PA 2LC2A 1B9MA 2K3PA 1YTYA 2IT0A 5KP1A 1FGRA 3HM5A 4GGGA 1XS9A 1JZDA 2BHZA 2FE3A 5LGUA 4I02A 1IDPA 4I5QA 3K9MC 5B66C 2EILH 2K4BA 1TTOA 3GZBA 4LOCA 2Z9OA 2IAIA 3LSKA 3E5XA 3FK6A 2C10A 4N6MA 2DFHA 1VQM3 2W57A 1OCCH 1BC8C 2OTLI 2G0EA 1STZA 1T98A 2DJIA 3PGBA 4XK4A 4GO1A 3V4GA 2YFIB 1GMQA 1XMKA 4CPKA 1Y6IA 3T5XA 2MSYA 1O7FA 5BNGA 3L1PA 4XLFA 1T5YA 1OFCX 2V1DA 2X51A 3AKZA 4ZDOA 4F91B 1I8VA 2RQQA 1XDUA 4K1VA 2SARA 5E17F 1O3RA 4R4KA 1Z6RA 5FKMA 2E35A 3FWEA 1WWXA 3T8RA 3CCEI 2XF3A 1ULIB 1UELB 1WNHA 4KIGA 3M8JA 3A5EA 3MD2A 3BR2A 2R41A 4LITA 1JBSA 2Y0SA 3CO6C 2A07F 5CLKA 2K02A 1FIPA 2VJ4A 1Y0UA 3JRHA 3OYAA 1Y4KA 1W7PA 3H3UA 3GZXB 4BU4A 3E0JB 3U2RA 4B47A 4KNYA 1MBFA 4IO9F 4HPQA 1EUIC 1BN5A 3FZVA 2FQ4A 1BOBA 1CQTA 2XB0X 3VFZA 2VC0A 3X2QH 1IUYA 4DBQA 2L9SA 5DM7F 3LNQA 1JGGA 2M0MA 4UUSA 4YFKF 4PJMA 2AXTC 2BGCA 3OYDA 2IY2A 3EB8A 3FZWA 2ME6A 4B3XA 1OKRA 2OA4A 3ZQCA 1Z67A 2E60A 2OF7A 2XGEA 1OHSA 3MFKA 4DKIA 3CPW2 5E20A 4PFOA 2CFWA 1NTCA 5CVIA 4P9UA 1AV4A 2DPUA 1DMQA 1IO2A 2M8GX 1JKGA 1MBKA 3W6JB 2F98A 4BBSJ 1RIOH 3QOPA 4XLCA 3CD6I 1UCRA 3KYCB 2YUSA 2DLLA 5BMZA 2VE8A 1KQS2 1RKWA 2ZXIA 4OMZA 3HTUA 3P9CA 4I6ZA 1ZHFA 2Y73A 4E7HA 2IRFG 2HOHA 1I1SA 1H8AC 4U0WA 2ZJ2A 3WODG 1A6QA 2KPMA 2X6WA 4R1HA 1MNMC 1X1CA 1RDSA 3S1QJ 2E2IJ 2BV6A 2IGKA 3B6AA 3KIOA 3VODA 4BJ6C 1RC9A 5J8FA 3DGLA 3GLXA 3DY5A 4EW5A 2BW3B 2OAZA 2M2EA 3ABLH 2AQEA 2YU9J 1OGZA 2X6OA 1JKQC 5M1AA 3DEEA 1IN7A 4HOHA 2CC3A 3JUNA 1WJEA 1NJI4 3ZG0A 3T1BA 4CDGA 2ZFUA 3V42A 1KA8A 2ZXJA 1JJ8C 1T2IA 4XKBA 3IJEB 3NQYA 3OWSA 5KHDA 4KFEA 1D1BA 5IG4A 3AFHA 4BY7J 4G12A 3NWSA 2BBYA 2D2WA 3FXJA 4RB1A 3HEFA 3I71A 2HEOA 4D5FA 4LEHA 4E4HA 1AKHB 1C0WA 3CCRI 2W25A 1O3TA 2DT6A 3NUVA 3G6E3 3BR3A 2K85A 4LG0A 4WYKB 2BYVE 1WMNA 3JRCA 2LKSA 1W5CC 3O8YA 1T33A 2MFZA 3J81K 2H0GA 2BXYA 1RGHA 5G1LA 1ETWA 2EA2A 1XX5A 4QPOA 2E1CA 1NK2P 3V8KA 2JRTA 2NOGA 1D8KA 2AAEA 3FH1A 2F4OB 2XFTA 2KISA 4JX4A 5LHHA 2E7XA 6GSPA 1W01A 5EYRA 4V19K 3ECOA 2RC4A 3HGYA 3C2HA 1T0FC 2W84A 1FYSA 2B0LA 1I1GA 4HM1B 2HKXA 4LK1F 2FA5A 3RYPA 2M7BA 1T56A 1VQ5I 1OCTC 1SIHA 1FIAA 2Y69H 3LQQA 4EV0A 1TWGJ 2HOSA 2RV8A 4C2UA 2LFBA 4HV5A 1EH6A 1MJBA 5EEAA 3WTYC 4GCVA 3OYLA 4G1MB 2L01A 1NB5I 2AHQA 2FNAA 1VNDA 4A3BJ 3CUQA 1V74A 4WXCA 4EJWA 1P9QC 3LSPA 3MPHA 1Z91A 5IG0A 3O8GA 2STWA 4HZBB 1IRGA 3WU0A 2CJJA 2LKPA 2MABA 1P7IA 1QHGA 2JVHA 4L9TA 3WOEB 4EV5A 3LSMA 1YS7A 4RAZA 1TRPA 5F08A 4ZZDA 2RGQA 3SZGA 5J6XA 4ZDPA 2WBMA 4A3MJ 2CW0F 3ESWB 2V26A 2H0IA 4A0YA 2HMKB 2V9KA 4MMXB 2QA43 2DOEA 4LB6B 1USSA 1VQO3 1G59A 3QRDA 2EK5A 1I2GA 5DYMA 4BEHB 2XEPA 1YS6A 4EJOA 2XSOB 1Z7UA 3CCLI 2PJRB 3L7WA 1IXCA 2L7MP 5D8KB 2CYYA 1S5AA 1RGLA 3PM1A 2VKHA 1W00A 3IWZA 3MKZA 4CO8A 3KFWX 1G0TA 3CCVI 3M8CA 1IU7A 2TCTA 2HMNB 3SZPA 1QGPA 1HDDC 4O02B 3FXKA 1AU7A 1WJCA 3GTGJ 2EA4A 5CQEA 1GV5A 3H35A 3JRAA 1B8IB 1FJLA 3S3NA 1BGSA 1IDZA 2F5EA 5DCFA 1BSBA 1IVXA 4N4OB 9RNTA 3CTAA 1EA2A 3SLUA 2X48A 2CX0A 2EFWA 2G9WA 3AMOA 3NQZA 4EEFG 1ETVA 3HJEA 3ABKH 5GPCA 3UNLA 4M3FA 2L1SA 1RETA 3RDEA 3NBRA 3HOHA 3KFQC 1UHWA 4M71A 3PQKA 2P5VA 1IT7A 4LMYA 3BG7A 3JW4A 2H6BA 1HKTA 3KSED 2WB1A 3HSFA 3W2WA 2Q2EA 4XN3A 3GZRA 3HYIA 4HZFA 3OL4A 2V7FA 1EA3A 2KLOA 3RKYA 2AXLA 1K4TA 2M87A 1BIRA 4JBAA 1TWCJ 1V4RA 1WCMJ 3FMSA 3BR0A 1UAAA 1XGSA 1T2HA 4J5GA 4N6UA 4EV2A 2QEX3 3T0UA 4AIJA 1APLC 2KP6A 2QENA 3JRFA 3QPHA 3OYNA 1RNLA 2OQEA 2BY3A 2I5UA 2XF5A 3V8LA 3NRVA 2E2UA 1O7GB 4N3VA 2PN6A 5JI6A 2DTRA 1E3OC 4XBYA 3G0KA 1SFOJ 3DZLA 2DQLA 4AKZA 4F3QA 2EPFA 2BVMA 2JT1A 3ULQB 3GEZA 1BI0A 2Q0OA 2LYCA 4M74A 4WCGA 2XRXB 4FETA 3HOYJ 5HS9A 3N9HA 2V6CA 2LMDA 2JUGA 4EGZA 1Q40A 2P05A 3V92A 2VLAA 2VE9A 4FMBA 4M6VA 3JCUC 4Y7NJ 4KICA 1MSFC 1TFOA 1TFKA 1LXEA 1PY3A 2KXGA 3KYLA 3GO5A 1O3QA 4EM2A 3NBBA 2E36A 4NDLA 3F8CA 5IERA 1I50J 4YRVA 3VDXA 5DREA 1B2MA 1BJAA 2KMUA 2KL4A 1W7PD 3CDLA 3QYFA 1TQMA 2IYJA 3V98A 2MW8A 3WMDA 2QKMB 2PMZN 4HAMA 3DGYA 3HL2A 4HF0A 1Q1HA 4B09A 4DJAA 1FYMA 2R7UA 1BR2A 4L9JA 5J1UA 4MJDA 2CWVA 4MMYB 3GSPA 2CW9A 1IZ1A 2JSPA 1FSEA 3STDA 3JUOA 1S8NA 2DA6A 2VODA 1MNLA 2GAUA 5E1ZB 5JPPA 1W1WE 4CCNA 3DBRB 1XMAA 3MKYB 1MJ9A 5ICFA 2XC7A 5K7HA 1N25A 3JTHA 1Y56A 2CRGA 4ZYAA 3MG3A 1FUWA 3OYKA 3GBGA 4BGDA 1WTHA 5EG0B 2PI0A 3H36A 1AR0A 3CCMI 1T3BA 2ZDJA 1PUFB 2B7EA 4CYDA 2L4MA 3CC4I 3K4BA 4HLXA 1FYLA 3HSRA 2M8EA 4KDPA 2D1VA 4MFEA 1JBTA 3HOUJ 5HGRA 3ECFA 4L0ZB 3ZQGA 2IJLA 4EM0B 5KNLA 5L3DA 4ZYDA 4HM0B 3SDBA 2VL8A 1RI7A 3OL3A 1YVSA 1RUNA 4Y17A 1A2PA 4O8SA 1TZLA 1GMRA 4PEJA 2FU4A 2LQVA 1PU4A 3K1MA 1KQ9A 2XUBA 4UB6C 3E6CC 1DETA 3SFIA 2RNGA 2DA7A 3F8MA 3FISA 3GFLA 1ZKGA 2VXZA 4DYCA 1KONA 2HWVA 3VSYA 1ETQA 4ZC3A 5IOZA 3IC7A 1BNJA 2E1MB 1R1UA 2Y31A 1SFUA 3EUAA 3K63A 2LK2A 5LC7A 3P5JA 2GWRA 2ID3A 4BH9A 2X1EA 3T8TA 2AS5F 1ZREA 5HVQC 1DP7P 3SOAA 2VXDA 3WA2X 1TP4A 2BE5F 3MKLA 1WJDA 3F8HA 1BRNL 4I0BA 4DZPA 3D79A 4BE0A 3PZWA 1DP3A 2F4MB 3FCSB 5EEGA 1WZ2A 3S14J 2PMHA 2HZDA 3TQNA 3GF2A 4GL6A 4OK0A 5IY5H 5CVRA 1I3IA 2GA1A 3O8HA 2UWMA 2ESNA 3BPXA 3W3CA 5J8CA 2OCTA 3SX1A 1LQ1A 4N9IA 1RSNA 3EX9A 4PSWA 2JMWA 3QU6A 4IL6C 5LBQA 1O7PB 2KCDA 1J09A 3B73A 5GTIC 1UUVB 1IV8A 3S29A 2ELJA 4X1EA 3LSGA 3MMYB 3D1NI 2Z2SB 4C9YA 1YITI 1YW8A 5B5EC 1PP8F 2ZMEC 2E1NA 2X0LA 1U5TC 5HDKA 1WMOA 5FLXK 4I99C 1FWZA 2L7KA 5E1WA 2HDWA 1RNTA 1JUPA 1A2VA 3CU3A 1W6CA 2J8XB 1D5YA 3AHWA 2VBZA 3V7SA 1YHQI 2UUZA 1MBEA 1WJBA 2OQRA 3HKZN 2CFXA 4WXDA 2D45A 3TO9A 1LE8B 2VPRA 4IF4A 2ECBA 4XRSA 1HQCA 3JUPA 3DV8A 4N6TA 1E3HA 5E18F 3X40A 3FKIJ 1WSUA 1VZZA 2ZNZA 5LHGA 1MDMA 3B6CA 2M4KA 3HXLA 3ROUA 1I0VA 2F99A 3WGIA 2P0XA 5AIHA 1B6AA 3CXC2 1Z21A 4JQFA 1MSEC 1MW7A 1QHHD 2A68F 2DMNA 4JX5A 4CICA 4HM5B 1FGMA 4WWCA 1YJWI 4XSZF 3S3MA 1KSIA 1KWIA 5IF6A 2IBDA 5F04A 1W36D 3M3YJ 4XN0A 1ZX2A 1N77A 1D1CA 3R60A 1WFXA 3NM2A 4WX9A 4Z2YA 4Q48A 1EKMA 1UHSA 1HOMA 1PYVA 2M1BA 2X4HA 2P4WA 3PNVA 1UDII 2XGNA 2E71A 3G1OA 2O5RA 3IUOA 3MZHA 3FKJA 3UL6A 3DXJF 1YIOA 2B9SA 2R7SA 3E99A 5ELJA 1N8QA 4NC6A 4RMNA 4UNOA 2ZJQF 1YOVB 4P9FA 3LT8A 2Q8KA 3VYRB 2L4AA 4M3DA 2LP0A 1F43A 1X1XA 1LQGC 5E3OA 3D9RA 5BXQA 2CQKA 3DU5A 3KZZA 1U9OA 4B8XA 2OU2A 2WAQN 3WR2A 1YQAA 2BHMA 4PJNA 3MWZA 3QWLA 3V8JA 4MMZB 3S93A 1DUXC 2CFKA 2Y9YA 4IT7A 1BUJA 3OOUA 3HC7A 3LSIA 2KDZA 3MQ0A 3DTEA 2DDAA 1L3LA 1ETOA 3A4CA 3GTOJ 2XFSA 2LH9A 4O5VA 3B8LA 3LFKA 1BM9A 4AYBA 4L0YB 2CS3A 3D0SA 2F5VA 3I54A 5L3FA 1OCZH 1R36A 1VTNC 3BG5A 1TWHJ 2ETHA 4JP0A 2GQQA 4MLOA 3WE2A 4ZH4F 2WA0A 3KEYA 4ON0A 1UUWB 1GV2A 4EGYA 3FF0A 2OJED 4EBGA 1X2NA 1FUSA 1IV7A 5GAGJ 1HZ1A 5K7FA 2YX9A 5E3LA 3K4LA 4XLNF 2JN6A 1OR7A 4M3GA 5FKNA 2X85A 4A3KJ 3REOA 1D6YA 4PCQA 3F9SA 3Q0WA 2MH9A 3HZJA 5IEPA 4OU0A 4U0VA 3MYTA 4N6V0 2AADA 3A03A 5BVBA 1ENHA 5F1JA 1GT0C 2GXGA 4XIDA 2UV1A 3UKGA 1Y39A 3ISPA 1ZK8A 1IGNA 2KHMA 3D5IA 1X58A 1JUSA 3BNCA 4E7IA 2OTJI 1WPKA 3KEQA 1FP2A 5H20A 1HSJA 3KP3A 3SEQA 2HI3A 2DK8A 1VQ4I 3DMCA 4AIKA 5L3BA 5FFZA 1I3AA 2F86B 1PDNC 2A6TA 2C11A 2EFPA 3PIOF 4NB5A 4ZTJA 1SVLA 4LD5A 4PGGA 3ERED 2JJ7A 3KYDB 5IG3A 1LB2A 1BNIA 1D3YA 2XAHA 3BCBA 3SHFA 5ICCA 4R79A 1RJOA 1S6LA 5CJ9A 1E3RA 5JVGF 4E7JA 2DCEA 1BRJA 2V79A 1QJGA 3AGNA 1WGXA 3VYUB 3BG3A 1TBXA 4C3IJ 4DNCA 1NWWA 1BNRA 1MZBA 1A35A 1DGWY 2QSHX 2DOAA 4DW6A 3I4MJ 3GYHX 4IJAA 1VQMI 2PQ8A 3CC73 4LGWA 3H5NA 1IXSB 4GXOA 3V7CA 1LFPA 3SQNA 3QODA 3BQYA 3F8FA 2QM3A 4NREA 3I563 4X2HA 3SYTA 3NV0A 4FASD 2FRHA 4UV9A 3Q3FA 5IYDJ 4BQNA 4KYWA 8CHOA 2DMQA 2HTJA 4DYQA 1NG6A 1R4NB 4ZJZA 1K28A 3B4OA 4HKVB 4XBXA 1MGRA 1VQP3 2MF7A 4MTDA 3EHCA 2RDPA 4EJUA 1T2KA 2ZL8A 3EJVA 3QOEA 4JOMA 1Z1DA 1MGWA 2VJJA 2PEXA 4OWRB 3WGHA 1Q7Y4 3OIPA 4RDUA 1GY6A 3M1EA 1QO0D 2V4JC 3M8FA 5DEQA 1VQ83 3BTCA 1VQ63 2F5CA 1QA6A 3QYEA 4N0BA 1DPRA 2KFDA 1BA5A 1ZS7A 2KF5A 4QSHA 2W0QA 3ZMVA 3AAFA 2LOOA 4M9SA 2M9HA 1FYKA 3JUMA 5EGOB 1BSCA 1IK3A 1D8JA 5F0CA 5LHIA 3WTSC 2HVRA 2HKOA 1IDYA 4OAZA 1OACA 3KN4A 1JN5A 3ASNH 2RSXA 2FX0A 1JV2B 2DA2A 2R7RA 5IT9K 3BU4A 4AEQA 2FBIA 2XAFA 3KP6A 2DN0A 1QBJA 3BZCA 1HKQA 2KZGA 2WY8Q 2XF7A 4N4NB 5GTHC 3AL0C 3A0BC 1A5JA 2LDUA 3H92A 3OS1A 1DYUA 3MG1A 5HNFA 5FGMA 2D5VA 3BR1A 3LA7A 2GM4A 1WH5A 5HS8A 2QSGX 1Z77A 4Y33A 1BR1A 4XNFA 2GXFA 4OMYA 1BL0A 5FFXA 2YFJB 2YPRA 4B48A 4BJTA 4CCOA 3AG4H 2ZCWA 1FGTA 3CJQB 3PIPF 4JK1X 4UHTA 3K70D 3S67A 3L2QA 3F8BA 3J7AY 4AVPA 1X1YA 1XDSA 4G7HF 2CG1A 5DUKA 1WQ2A 4S0HB 1RTUA 3CUOA 3DXOA 3P9IA 5BQTA 2E5ZA 3S17J 2RN7A 4P5OA 1UG0A 1K7AA 3SEZA 1S9HA 4LIVA 1B2ZA 2O3OA 3ZFZA 1D1AA 2A05A 1ORKA 1K78B 3I0TA 5IYBJ 3UL5A 3QK9A 4CYCB 1VZ0A 3G4SI 2DFEA 5HOHA 2EINH 1MWTA 3P7NA 3WG7H 4XDVA 4RLQA 1GDTA 3WODF 4HYEA 3HZPA 3DGOA 1QAKA 1MWUA 2QKLB 4CCMA 6PAXA 4WK8F 2J5PA 3FG1A 4DBRA 1SAXA 5DUIA 3WU1B 3G6EI 2CH0A 1RR7A 4HM2B 4IRHA 5M5WJ 5ILSA 2H8RA 3CUQC 4OUQA 4KT3B 2E2JJ 4NBQA 3L2VA 3HHHA 3PO2J 3I5UA 3TW6A 3K7AJ 5B3SH 4HDUA 1NK3P 1B21A 2OZUA 2XDVA 2JQ5A 2MD5A 3K4MA 2O9UX 2IGOA 3LH4A 3W2VA 1T39A 1E97A 3BNEA 1C54A 2BW3A 2K7LA 1MWRA 5KK1A 3B7CA 4G94A 3GWRA 1BAOA 3OY9A 5M19A 3H3VK 4I7HA 3FMRA 1JJ6C 3BJOA 4UVBA 5FB2A 4X6AJ 5D6EA 4RNZA 5GSPA 1M1K4 4CH7A 1GY5A 4Y15A 2WWYA 2FOKA 3HG9A 4MO7A 2YS9A 3IL2A 3L2RA 3DTKA 2RBIA 2DTZA 1AWCA 2WTEA 1O4XA 3R6SA 1R4YA 1OCRH 1QVG2 2P6SA 2ELHA 3Q9SA 1FOKA 2K9SA 1W36C 1AKHA 1Q9EA 2KAAA 1MBJA 2M30A 3IKVA 3F22A 5E8GA 3DKWA 2QQAA 4CSWA 3V99A 4AKYA 2DMUA 4WYKA 3NX0A 1XC5A 2QF7A 3ZXSA 1W2ZA 3X41A 2IUKA 3RQ4A 2QQ9A 3S1MJ 2LY2A 3NM7A 3F40A 5G2GA 3UNGC 2RQPA 3NBJA 1LRAA 2HDCA 2YSRA 4AIDA 4KA4A 1Q42A 1BIBA 3Q5FA 1V57A 1VQL3 3CCJ3 2OPTA 3H9QA 3BQZA 1KD14 4M72A 3Q0UA 1GD4A 1M1EB 3CF2A 1U8CB 3ZMTA 3RGAA 2LBFA 3FMQA 3QRFF 2VQHA 3HRMA 1Z3XA 5F0FA 3JAMZ 2P0WA 3HKZA 1E3PA 2R7TA 1PYLA 1I0XA 3CMMA 4BDZA 2K3DA 2P8TA 1VQOI 4A2UA 1BR4A 3BPVA 4AU7A 3G1LA 5KVRA 1RCLA 2V1LA 1I2FA 1Z05A 3GTLJ 2K9NA 2MG4A 1OUNA 2BMQB 4UB8C 1W5ZA 3U9GA 1ULYA 4DGWB 1HYFA 1O7MB 4DQ2A 4CZZA 2E2VA 2Y30A 3MZ8A 3DWLE 4HBLA 3X3XA 1YG2A 3FM3A 4NC7A 1V3FA 1K6OA 1ASKA 3HOWJ 4BXUA 3WTVC 2Z5UA 4R1KA 2AO9A 2GOMA 3ABUA 2XGDA 3IP4B 4HA8A 2OQEC 4PGHA 1AA7A 1HU9A 2FNQA 2M45A 1STFI 1IYYA 4HW0A 3WTXC 4XSXF 3OYBA 1HW1A 5FKOA 4JF8A 4HOBA 4L5IA 4HLYA 3F72A 4IEJA 1K4SA 4CCLA 2ZSIB 3J80Z 2H27A 2IS1A 3DUKA 5LGTA 1O3SA 1ZH5A 4RS8A 2DODA 5CLSA 1W5TA 4D7MA 1V5GA 2VT3A 5DRVA 3NXJA 1S5LC 4MQ9F 4BHPA 4AD9A 3PXMA 5ICGA 1RGAA 4G7ZF 4NNJA 4ZYGA 3K4JA 1W0UA 2QEXI 2A61A 1FEXA 3CNXA 2STDA 4HM4B 1B8IA 2JSCA 1U3EM 2IA7A 3IAS2 1B2UA 2V6EA 1BI3A 3K2ZA 5IPAA 2XPUA 2B24B 4E7KA 1GVDA 3VSLA 1JRQA 1NO3A 5CYVA 5DM6F 1ZG1A 4L5EA 3S1NJ 3EBTA 2V9VA 2R4IA 1SPUA 3A1YA 3IRQA 4FMDA 3U97A 4MFDA 1R4MB 1QRYA 4Z6YA 4A3EJ 3H5RA 5FW5A 2CHCA 4E70A 3LSJA 4YFXF 2FF4A 1K6YA 5F64A 4XQFA 1H88C 3EUHA 1BRIA 4ESJA 4IHWA 3FG4A 3ZN0A 3CCUI 1LDDA 2I9WA 4KZ1A 2PMUA 1BANA 1JXSA 2ML5A 5C44J 3N4MA 5CF2A 3OR1C 3EDPA 1RZ4A 1Z6TA 2YU3A 1CQSA 2XHKA 4Y4RA 2VKEA 1R22A 2ZJPF 1OPCA 3H9GA 2IS2A 4ILFA 1B72A 5KP4A 5LRSA 1ZN2A 2L2OA 5FD5A 4AVZA 3GTMJ 2ME0A 2PLYA 3HRUA 5BU4A 5TRDA 3IHUA 1YO5C 2XVCA 1UCJA 1K9M4 1X1PA 1YYVA 3HRTA 1BOAA 2V1UA 3I553 3PUBA 4LLGF 3TW7A 3BIRA 3HGGA 3FLJA 2C4BA 4KIFA 4LSOA 2Z16A 5LGNA 2XIGA 3Q90A 1TNTA 2QWWA 2XF6A 4ABZA 3H3HA 5DTDA 5AI1A 1YX3A 4UUTA 3LT9A 4W1UA 1FC3A 2D42A 4Q53A 2CIUA 1CYUA 1WVRA 2ZA4A 2JA8J 4XM4A 3QU3A 4XLEA 5ERIA 3ZMSA 1BU4A 2O3FA 2OTL3 1MOLA 3TO7A 4UUSB 5A2QZ 3E7LA 4UY8I 1VQK3 1B27A 3S3OA 5FD6A 1VF9A 2WAEA 3HB9A 1LVNA 1L0OC 1ETKA 3SJMA 3K70C 1N9EA 3I9V2 2L3DA 2RNTA 2Z77A 3HUGB 3TKYA 2CV0A 1BW6A 2CV1A 2K9MA 5EG0A 1ZG3A 1HF0A 2XAJA 2JDIH 3UB1A 5JBSA 1PUFA 4PSXA 5DD4A 2STTA 1FP1D 2EWNA 1H9GA 3EYIA 3LTAA 1BRHA 1R7JA 1NH3A 1Q824 4A5MA 1VQNI 5RNTA 3E97A 1DPUA 3M07A 2DYRH 2WOFA 2QQ8A 3ASOH 2JTVA 4IKFA 5ICEA 1GS3A 2BOLA 4HSRA 1OHPA 1MBHA 3GFMA 4U87A 2JUCA 1K41A 3CCQI 4HSTA 1GUUA 1JKPC 4Y13A 3A02A 3DLAA 2CW8A 3C2GA 1JT0A 1G3YA 2E19A 1HLVA 3CP2A 2K4JA 2F5MA 1U8BA 2H0HA 1RNBA 3CESA 2JWTA 1K61A 4L9NA 1LOWA 2QSFX 4IRIA 1ZGXA 3EN1B 2FEZA 1Y0NA 4M6YA 4DZJA 2W1OA 5E3MA 3K4KA 4D0PA 1IVUA 2K9LA 3R0JA 1JI8A 2F5WA 4DYRA 2XRNA 3S8PA 1B1BA 4GRIA 4YIIA 5L3GA 3JR9A 5AIQA 3J7YJ 3R61A 1Y1WJ 4G9YA 1C7HA 2M7AA 4RB2C 1ODDA 2VPLA 2A69F 2VQGA 3IH2A 4IXAA 2VQLA 5LLQA 4O6JA 4N6LA 1LFBA 1XD7A 3TDZC 3CJNA 4YFNF 3F23A 5G1KA 4J19A 3FBIB 1LNIA 1Q864 1E3VA 3BJ6A 3KE2A 2MBFA 4IHVA 1SANA 4WHAA 5STDA 4WF2A 1HKSA 3RJPA 3ZCOA 1XPXA 1LNWA 3G73A 1M1XB 1O7NB 1IN6A 2OOVA 2KQRA 4EATA 3VF1A 3AHSA 4I98B 5TGNA 1S3JA 2OCCH 1ZYRF 2CQXA 1TW3A 1ETXA 3LOYA 3S16J 3ML6A 4BTXA 3CNMA 1YX5A 2DA4A 3H1CA 4KN4X 3IV5A 2Y9ZA 4RBNA 3DU6A 5D83A 3VGNA 3N05A 1AVKA 5GPAA 2WY7Q 2GBYA 2HR3A 2R3SA 1I39A 2ECCA 2HMJB 5C3EJ 2R7VA 4I01A 1EV7A 4ZZLA 4OIPF 1QVF2 1OH0A 4O2HA 4CJNA 2E1OA 4XBTA 4RAYA 1RGEA 2EFNA 3KX2A 3MHEA 2DW4A 1K734 2IGMA 3HIIA 3OSFA 1LE8A 1PUEE 1A6IA 5B1BH 1STDA 3PFYA 2DDBA 3U1DA 4L18B 1DU6A 3KKGA 1X1AA 3JTGA 2EV0A 4XORA 3KEOA 1PFPA 2VB6A 4CGZA 2XGCA 4YELA 1OR7C 5E79C 1T8IA 5HLGA 3E1SA 1SVOA 4AWXB 3ROBA 4C2TA 4MNUA 3S15J 1UW1A 2XAUA 4ENJA 3OIQA 3NAUA 3FXOA 5JHUA 2RCDA 9ANTA 5EEOA 2CFOA 1HW2A 1UMQA 1MH3A 2KIQA 1YRNA 4QPQA 2PX9A 1P6RA 2KKOA 5EDNA 3S2HJ 3LOCA 1RRJA 1JBRA 1GOYA 1U2WA 1YJ93 3MWMA 3EETA 3FIWA 3CMA3 2ML6A 3U1WA 5KP3A 2ACJA 2VKDA 2V1XA 3LMLA 3TL4X 2JA5J 3K69A 1JHFA 1SEUA 2F4IA 3CMYA 3F8XA 1TTYA 2VN2A 4NQWB 1B59A 2Y2ZA 3KPHA 5B1AH 2X1CA 4FMAA 3SDGA 3CCL3 4XKCA 5IP7J 5KAFC 1GVJA 3DEWA 3GZ5A 3L00A 4TV7A 1YIJI 1IF1A 2M7OA 4C2MJ 1FA3A 4HX7A 2CFLA 2VBWA 2EJRA 2IMJA 3N97A 1W4MA 3LZAA 3CF5F 2KIMA 3CC23 2NVQJ 3ZP5A 1KYWA 2K86A 3OWUA 2P38A 3ONQA 2F2EA 1BUQA 3FX3A 1Z3YA 5IENA 3LTCA 3DBLB 3MEXA 2HDDA 2EH3A 4IHXA 4Q4ZF 2HMMB 2CO5A 2DA1A 4CDLA 2SBLA 3RGRA 2OQGA 2UUGC 1LNHA 4ENNA 1S7EA 1EKEA 3OYCA 2QQBA 3KLNA 2I8DA 2BIRA 4R9KA 5DS9A 2BMRB 1XCVA 2IW5A 1OF5B 2GA2A 2L7FP 2XKPA 3LFUA 1RGGA 1ZAOA 4KMUX 1TU5A 1MBGA 3J81Z 2Z99A 1YJN3 1LOYA 3I56I 3F3XA 2BHYA 3LYGA 3CO7C 4STDA 2IA1A 1CH0A 5DCMB 4EMSA 3FXMA 5HDGA 1HKXA 2IP2A 1A04A 1XSVA 4NUBA 4BACA 4TX4A 3ABMH 3COAC 3H9JA 1LEBA 1OYIA 3AG1H 5FRNA 4QLCU 1B2SA 4XLHA 1IAWA 1Y1VJ 1RN4A 1KU7A 3JRGA 1I3QJ 2Z6BA 2WAFA 2Y0SN 1VQ8I 1KYZA 2M5WA 1UCKA 3OMYA 4XMYA 5GAEJ 3RDIA 2Z76A 6RNTA 1FW7A 2ICWG 2LRDA 4F92B 1ROAA 2A3SA 2ADUA 5EZHA 4RNTA 2A6EF 3ZGKA 2E34A 2GBWB 1J0RA 3IH3A 2DYSH 3GWZA 5D4SA 1HC8A 4FCZA 1T6SA 1V55H 2R7DA 4M3EA 1E17A 1EF4A 1N5PA 4R8HA 1N9JA 1Q7HA 3RNTA 2EZHA 3FHZA 1FT9A 3QPLA 3OS2A 4Q5SF 4U13A 4XOPA 1RESA 3WHCA 4O3MA 3M7GA 4FCMA 3OW22 6STDA 2R5ZB 1KC84 4XL9A 4BTYA 5IP9J 3LAPA 3PSIA 4ZDLA 4A3FJ 5FKKA 1UZCA 3DKYA 4LG3A 2L54A 3MN2A 2NRAC 1YVBI 3BDDA 3MCZA 3H0GJ 4RGSA 4IOCF 4XKVA 1AOYA 4PDKA 4J00A 1LDJA 4BQOA 1DGRM 1U5OA 4KFFA 5I97A 3VWBA 2VIXA 1V54H 2O8KA 3A01A 1I6HJ 3FSDA 4OOIA 2CUFA 4QTRA 5EGOA 1RKTA 4PJLA 1P2FA 4LMIA 3CCM3 1UGHI 2VONA 4A5NA 1JT6A 5TISC 4Q47A 5H6RA 3S2DJ 2EZKA 3S1RJ 1GYBA 1MKMA 4LLNA 2KJBA 1IJWC 2QCOA 1SVMA 1S723 3K9TA 1WJ5A 1YNVX 3LQRA 2DFIA 2OCEA 3TGNA 5K1YA 1O7WB 4I76A 3FG3A 2GU1A 1GLNA 4IZZA 1DU0A 1FLIA 3F14A 1U78A 1J2XA 2JA6J 4G8XA 3D5RC 4RA2A 2NS0A 4ZYHA 3KP4A 3BTLA 2CW7A 4HG2A 3HOSA 4CUGA 1I5ZA 1IW7F 3ZG5A 5DV5A 2MH2A 2UXXA 2W24A 1Z1SA 4WWUC 2MLGA 4Y3OA 3WTTC 1TQIA 1VQ73 5CVUA 2DOFA 5LRRA 1IXRC 1JUMA 2QUFA 4CA0A 2KRCA 4YEJA 3K0ZA 1ISKA 4J9AA 2JVGA 2LR8A 2PFBA 2K3FA 1X2MA 3MAJA 5J3LA 4OVMA 1PJRA 3OR2C 4AIHA 2QBYB 4XICA 1TP6A 1W02A 2BT3A 3HK4A 5H6QA 2B63J 4ITVA 4BE2A 3I53A 3OXAA 2DJNA 3BR5A 1OJLA 3RSNA 1K78A 1QZYA 4E6KG 2HMLB 4CYCA 1ZGAA 1RPWA 2JPCA 4U7BA 2RNJA 2Y0MA 2CSOA 5LEJA 3GUDA 3S5CA 2R7ZJ 7RNTA 4HAAA 5HODA 3TP0A 1S29A 1ROVA 3MKWB 3TP3A 4YIFA 3G8ZA 1N5HA 3PJRA 1BNGA 1D0YA 1JZOA 2XRLA 1BI1A 4FT8A 2HQRA 1O7HB 3G16A 4G6TB 3DGNA 1XN7A 2P5KA 1G3WA 2IA0A 4B1RA 2ZFWA 3OOPA 3QPTA 1TT0A 2O8XA 2DAOA 3KP2A 4BL2A 4B44A 3DH2A 3G1MA 1VQLI 2QYOA 1RGFA 2W56B 4HQMA 1NNVA 4BBRJ 3T0YA 4ESFA 1TT5B 5HLHA 1DE3A 5CF1A 1EH7A 4F55A 1P4XA 1R00A 1SMTA 3Q0VA 1YHQ3 3VOEA 2JRMA 4XRMA 2Y48A 1QZZA 2LY1A 1LOXA 1BJZA 3HBLA 2GU3A 3F0CA 2LYXA 2XAGA 1UI7A 3ABTA 3OYHA 4KFDA 2PBIA 2VC1A 1JB4A 3KLOA 1WKMA 4KJZA 3W6KB 1B4AA 3ZMZA 1WH7A 3KCCA 3TMOA 1IRXA 2L4VA 2PMZA 3GCMA 2CWTA 3MZYA 2W9PA 1FSHA 2W04A 1LPQA 4BAYA 1TUHA 2A15A 3KP7A 4M6XA 4MEXF 2VUMJ 3RPUA 1XCBA 4QWQA 1B2XA 2GBXB 1BSDA 3NHXA 3C18A 1SFEA 2BY0A 1G8XA 2BY1A 2QZ8A 2VKVA 2OWPA 2YX4A 1QZEA 4LB5A 4K90B 3RIRA 2LNBA 2DPDA 2KF3A 2ZKZA 5K5QA 4HQEA 1GOUA 2CFDA 4N9HA 2VASA 3MVPA 3B02A 3K2AA 3I0YA 3BC8A 3G713 5IYCJ 3ER7A 2ZJRF 2W2CA 3PCRA 5D81A 1ZLJA 3RKWA 5BPIA 3WGGA 4XOTA 4N6OB 1NG7A 1X4OA 3EUHC 4HX4A 5M5YJ 1A2KA 3ZQ7A 1GHCA 2WB1N 1DMNA 2XGLA 1WMPA 3QYBA 3FXLA 2DA3A 2CQQA 4HJLB 4LIUA 5ED4A 2EZLA 1ZR2A 1GSPA 1TC3C 2WOHA 3N8BA 1OYWA 3S27A 2YR2A 2I10A 2VOPA 2RREA 2N8GA 2R7QA 5CK6A 3JSPA 1MJAA 4R80A 3BP8A 1X3ZB 3EQLF 2DA5A 4XBFA 4D1QA 2CWEA 2G7UA 2LREA 3H5AA 3BT9A 5BIRA 3FK7A 3AG2H 2R7FA 1T38A 4JX6A 4V2FA 1MIJA 2D1HA 4MEIA 3OIOA 1ZO2A 2H09A 5TGTA 4A3IJ 1SAUA 4ANJA 4BXXJ 2V1NA 2VBYA 2HPMA 3CP8A 2XPVA 1DQUA 1XMXA 3A2KA 3WU2C 4D7NA 3K6GA 1YFHA 2R7OA 4KISA 3BB9A 2E2HJ 1H0MA 3NWTA 1OYYA 1ULJB 1JB5A 2X1DA 3RQIA 1CF7B 3RYRA 2LD5A 4GYGA 1UI8A 4XLPF 1ITYA 1JTYA 3JUQA 1XTAA 3DBHB 2HTSA 4CHUA 3HPHA 5FLXZ 3FHNA 1FGQA 5HNHA 2IVMA 1J59A 1FY7A 1QPMA 1TL8A 2EB7A 2LG4A 3PCSA 3LAJA 1VQ43 5L3EA 4X0GA 2BO9B 1MMNA 2DO7A 4BS9A 3M4OJ 4B3AA 2A6HF 4D9JA 2P5LC 1SD5A 3C3WA 3DPLC 3I55I 4HRIA 2CFGA 4XRFA 2O6GE 3LTBA 5CXOA 3ZPLA 1H9TA 2RAEA 3LMMA 4BU2A 3ERMA 4HF1A 2BMOB 3KE7A 4LK0F 1D6ZA 4PJ0C 3I59B 3GTKJ 1J7KA 5EVHA 1S7OA 1VFCA 3URPA 3BLZA 2ZMEB 2Z7AA 1U5TB 2R7WA 3BR6A 3D5SC 2JPBA 4II2A 3OYMA 2BVLA 2BZTA 1YI23 1MGTA 1VQQA 1JJ22 4I4KA 3CZ6A 2K40A 4M73A 4PFPA 1SQWA 4ZYEA 2LTPA 4A6DA 1IVWA 2CUEA 4G7OF 3ZQLA 3PNTA 2O9LA 3HOVJ 2P6TA 2QA4I 4OIQF 1JN5B 2RGVA 4HZ9B 4ENKA 2OC6A 1VQKI 2HXOA 2NYXA 3GW2A 3J7AO 1BOXA 1I3FA 2R5YB 1RHLA 3SYUA 2RFRA 2F5DA 1SFXA 4CCVA 2CH9A 5IOYA 4RNYA 1EEJA 3KP5A 4U88A 2HS5A 1HA8A 1QNTA 1ZARA 2NS7A 3FDYA 1MH4A 4HV6A 1VQ93 5GP9A 2R93J 3OS0A 2ZBKA 3DKXA 2HVSA 5D4RA 2HOEA 1IT8A 3VYTB 3UR3C 2E1MC 1Z7LA 1YE9A 1BVIA 1OPYA 4DOZA 2J5OA 1ZELA 3L2CA 4BTWA 3I4NJ 1DVCA 2X6YA 4A3CJ 2VQCA 3LSTA 1MNEA 4LLLA 1IUFA 5JPUA 2DK5A 2HYGD 3WHBA 5HDNA 1RLSA 4EYCA 1XSXA 1W7CA 4HM3B 1W6GA 3WTWC 4EXRA 2W6JH 4GB5A 3E6DA 4V2GA 2RVCA 2VJIA 4BEHA 2XKOA 4QWTA 4PK4A 2PJRA 2M0CA 5K5OA 2FXTA 2YFLB 3GTJJ 3K4CA 2MLKA 3VEPA 1TLHB 3OYEA 3KZIC 2HFHA 3HUGA 2HQ5A 3FBNB 1USTA 4PJJA 5JHFA 1K8A4 2MC8A 1X1UA 1FMVA 1TW2A 5LC6A 1XB4A 3O3KA 4GSPA 3HRSA 3J7ZI 4MGRA 2WAQA 2KRFA 1IN5A 5CPRB 2OOVC 3K7CA 4NHFA 4P1WA 1KQ0A 1ETYA 2A5WA 3G3ZA 1G2HA 3CJTB 3E3VA 5M3MJ 1BBYA 3KZYA 3FXUA 1JKRC 4A6EA 2XASA 1Z9CA 3G2BA 4XONA 5C4XJ 5J1YA 2IEKA 3E5UA 4UVCA 3TDGA 5AEWB 3FXQA 1H89C 2HGCA 1F1ZA 2HYJA 1FTTA 3SZTA 2XR8B 1JHHA 3ZQIA 4EC6A 4MIMA 2FSWA 3F6VA 1I27A 1RMSA 3BZ6A 3EPZA 1J9IA 4FCJA 2CQNA 5CKTA 3Q1CA 2KT0A 5IG5A 4IOAF 2DBBA 2BY2A 3I64A 3G4S3 3RI4A 3CME3 1YLFA 5K5RA 1X19A 2GOXB 4OINF 3PS8A 1FBUA 1MMDA 1Z0XA 3RCOA 2NVTJ 1OCVA 3JRIA 5EEHA 2HQNA 2QVOA 2FGTA 1TNSA 2P81A 4NHJA 4HEA2 4HNTA 2F56A 2CV2A 2IA2A 1ZRDA 1SFKA 1WHUA 2W85A 2IGNA 2VJ5A 4KUMA 4UXNA 1UUGB 4WP5A 2FJ1A 3D4AA 2L02A 5K7ZA 5AIFA 1U0JA 1P4AA 4II3A 3GZYB 1B20A 5AONA 2ISYA 1QAFA 4BJ5C 4O3VA 1MMGA 2HPIA 4HM6B 4GYIA 3CCS3 3BNDA 3JVCA 2GEXA 4C30A 4UV8A 3OYFA 3DEUA 3BNBA 1W7PB 2CKFB 1ZRCA 1BRKA 4Y52J 4JRFA 3RPUD 2LBFB 1HDPA 3GVAA 2HVQA 2LLKA 4M9ZA 5D5WB 1ZGWA 2D1WA 3KCHA 2H8WA 1IC8A 2XAQA 5JFRA 4I2OA 5HLTA 3M8EA 3BROA 3HSEA 1LKXA 4IHYA 2L9NA 1IV6A 5JLWA 4A3LJ 1QVUA 1G96A 2WV0A 3LA2A 2EQRA 1PP7U 3F7XA 4FTHA 5FRMA 2GEYA 2GIZA 4BQQA 4BYYA 1IRZA 2ISZA 4K1UA 4LYLB 4IX7A 1XSDA 3L0RA 5LFAA 3I58A 4A3GJ 2P0MA 3CCE3 1Y8QB 5IT9Z 3DPUA 2LVSA 3E6MA 1IQXA 1JKGB 1XGMA 4UVAA 3TBIA 1YJ9I 4XDWA 4YIRX 3OYIA 3CMAI 3DFGA 2GLOA 1A67A 1LOVA 3RZOJ 4AYBN 3JRDA 4HBRA 1IV9A 1RCKA 3O6BB 2ID6A 2MYSA 4RZMA 1D0ZA 3B4PA 5A0OB 4P55A 2OBPA 1P92A 1QU3A 1UB9A 1BW5A 2CK3H 1D6UA 3ZQQA 3CQZJ 4U0YA 5JLXA 1G6NA 2HOAA 3OV8A 3BY6A 4RGUA 1GXPA 1SMYF 3DCFA 2FBKA 1SD4A 2NXNB 2O7OA 3ELKA 4FHTA 4IRGA 1HBXG 2QIYA 1RRHA 4KT6A 3AL0B 3BTIA 3OYGA 3CC2I 3FF2A 4E7SA 4FR9A 1E0EA 3TO6A 1G3SA 2X6XA 3DQVC 4S04A 2QLZA 2DFFA 1ON2A 3DF8A 4H61A 2QGUA 4IVNA 3EF8A 2DXIA 3ZMUA 3IPTA 3SXXA 4HM8B 5FJ8J 2IPQX 1UCLA 5AIIA 2K27A 3CD63 2R92J 2GIVA 4MEYF 2HYFA 2ELKA 3NARA 4OIRF 3BWGA 5LEKA 3ECHA 4BXFA 3ZRGA 4ENMA 2FXAA 1IG7A 1MWSA 3WDGB 1IVVA 3PYJA 1X4PA 4LG0B 4NQWA 4MTEA 4M9XA 3TOAA 5HOOA 1SJWA 1XGOA 1FZUA 1R5HA 4RAGA 3VSKA 2MA3A 2DT7B 2XV4S 3PO3J 1KQ8A 1R9TJ 2P7VB 1IRFA 2OD5A 4WXHA 3GAXA 3Q3SA 4CXFA 3L2WA 3M1CA 1FOYA 3BOQA 1YJNI 3IRRA 2BNGA 2CUZA 5FGOA 4IPBA 2JQ7A 1LQMB 3OV4A 1FBSA 2IUJA 1F4KA 3H0DA 4BNCA 3HOZJ 2G7HA 5FKLA 3CDHA 3GX4X 1EH8A 4AUXA 1B72B 2UGIA 1UJ8A 3DTIA 3WE3A 5DDGA 1MD0A 3JSOA 4I09A 2L9RA 3PNYA 3CCR3 3IH4A 3R4KA 3HOTA 1ERDA 4KIBA 3IMAB 4FMCA 4HX8A 1WRJA 3CUQB 3WOFB 2FMYA 4MQVA 4FX4A 3VB2A 3CCYA 4L9VA 1IN4A 4AM3A 1YGEA 1OF5A 3EE1A 1CGPA 3K5TA 1JGSA 5F1RA 2A5YB 2ZHXB 3QAHA 2H94A 2GXBA 2FMLA 3SVAA 2K9QA 5DD8A 5AEUB 3GFJA 3ZR8X 2W00A 5KCMA 3CCU3 4IQJA 2ZNYA 2L0KA 3BG9A 2OUMA 3CPOA 1TRQA 1Q1VA 4GDFA 1AY7A 5DCMA 4NC8A 4JYKA 3OWTA 5LD2C 3D5GA 1VQ53 2HNHA 2KIUA 1FZPB 2INXA 1DDNA 4E7ZA 5D5XB 2Z33A 1NHAA 2PJPA 2WO0A 3H51A 1TWAJ 1JKOC 1REPC 1Y8RB 3PUFA 5IW9A 1BNFA 1NDOB 1IQ8A 2KF6A 4P96A 1I70A 2BXZA 4KMFA 4L8PA 3AG3H 4BY1J 1ZQ3P 4XB5A 2X9DA 1GXQA 1N75A 4LZIA 1YW9A 3LSRA 5JR3A 2CQ7A 3NQOA 2F6CA 2Q07A 3H3ZA 4EJTA 2O03A 1WQLB 1AHDP 1ZLKA 2CWUA 3RPQA 4J8TA 3AMOB 1FTZA 2FOWA 1S72I 4HYZA 2EBIA 1T0FA 2EIJH 4M3BA 2R5ZA 3CJRB 2EFOA 2DU9A 4BUPA 4RB3C 4K2EA 2FNPA 2CUJA 2LY9A 2XSHB 1P4WA 3SOYA 1KU3A 4ZTFA 3VYSB 4L7KA 1OCPA 1MMSA 5M5XJ 3PFIA 2F4YA 2O0YA 3BG6A 2Q2EB 1JTXA 4RM3A 4CCKA 3GFIA 2EIMH 4N6NB 1Q814 1A36A 3EC9A 2LSOA 3JREA 1X3WB 2ESHA 2KF4A 4E7LA 1X3UA 3QPSA 3DGMA 3CCV3 4HF2A 1VQ7I 3HTSB 1F36A 3S2WA 1SARA 1R71A 3D3LA 4G6DA 3O2PE 4KN7X 1F5TA 2KRHA 4J01A 4A93J 5GAHJ 3GZ6A 1PVEA 5J4YA 3TDUC 1VQN3 2W9QA 1UG2A 1ZR4A 1ZRFA 1G4DA 3KSPA 3OWYA 4L8OA 1R5GA 3QQAA 4WFOA 1D0XA 5F6FA 5D5UB 2ZSHB 4BIRA 3GTQJ 1X1WA 3CCQ3 1Q40B 3K1NA 2LF7A 1LUJB 1D5VA 1GY7A 1VI0A 3LA3A 4S05A 5D5VB 1X1BA 3A0HC 5J47A 3CC7I 2Y74A 3ZOBA 4HDVA 5JVTA 1WI9A 4BL3A 3WG9A 4RBOA 1GD3A 3HOXJ 1OLTA 2F48A 1LEAA 2XSJC 3WTUC 3X3YA 3ZQFA 2EIKH 2NNNA 1VQPI 3JRBA 1G3TA 2QBYA 2VOOA 1J2BA 4HVNA 3PSFA 1K79A 2H1KA 2EV6A 3C1DA 1QALA 1R1TA 3D5LA 3ZN1A 2HOTA 3LWFA 2L9VA 4XLAA 4A0ZA 2LF8A 5CVVA 1B3SA 2WC2A 2UZKA 3S28A 1TIJA 2MC4A 3IWFA 1R6RA 1AVLA 1FGOA 1VQ6I 4H3UA 4I0AA 4FQGA 2NVYJ 4BL0B 2UXNA 2WGOA 2BEOA 1X1DA 5ILUA 5FLMJ 1OMIA 5F0HA 1BIAA 4LFUA 5GADJ 3X3ZA 4F52A 5EZGA 1WJFA 3RTRA 3QP5A 4PZJA 3SXYA 1J75A 3DP7A 4OIOF 2BU4A 3EBYA 4KVHA 3EUKL 3OX9A 4L5JA 1V58A 1QQIA 1RRLA 3C7JA 2C6YA 4B4CA 5L3CA 2HXIA 3CLQA 1POGA 1BNSA 1BI2A 3IAM2 3L2UA 3W2AA 3PL8A 1NU3A 3GLLA 3U21A 1KU9A 1EQKA 1A31A 2P09A 4KITB 2KJCA 2E5NA 2DI3A 2NOJB 3JAMK 2ZC2A 2W56A 1YRNB 1CYVA 2Z3YA 2K0MA 2R0QC 1HCRA 1SD6A 4PUSA 3F8NA 1K83J 2ZB9A 1E2XA 3M9AA 2W48A 2HU9A 3CDIA 1RN1A 3HI7A 3G71I 5F27A 1EJ9A 1OCOH 1TWFJ 2TDXA 3GMEA 4ASNA 3FXRA 1LVKA 4EQQA 4FCYA 4UUVA 3DM8A 2LKXA 4BKXA 3CC43 3GZNB 2JA7J 1J5YA 2IXSA 4G6QA 1RN7A 5E8IA 4F7ZA 5J4VA 3FGYA 4KT5C 2R4GA 3T8NA 1NB3I 1W5SA 4EJVA 1BC7C 3RKQA 2ZXWH 2MGQA 3AGOA 2FQ3A 3J80K 1U8RA 4IHTA 3I4PA 2PZVA 1TQPA 2VI6A 4F93B 1FOXA 4FX0A 2DQRA 3OYJA 2M34A 4BQAA 2HZTA 3ZQHA 3EQQB 3HIFA 3HDDA 2XH9A 5AIGA 1KU2A 1MMAA 5M18A 3Q2PA 3KZTA 2WADA 4FE7A 1V5EA 1GMPA 1A90A 4H0EA 2IS4A 5BPDA 1JNQA 1FBQA
chains in the Genus database with same CATH topology
1FGQA 4R9LA 4PEJA 4O8SA 1PU4A 3Q90A 2LQVA 3EN8A 3H3HA 1VQ43 3PCSA 1DMMA 5AI1A 2BO9B 3LT9A 2D42A 4Q53A 2CIUA 1CYUA 3VSYA 3LTBA 2CFGA 4XM4A 2OTL3 5CXOA 1YIJ3 3HX8A 3MG2A 1MOLA 3KE7A 2BMOB 3K63A 1D6ZA 5EVHA 5AYRB 5LC7A 1VQK3 4HM7B 1LVNA 3BLZA 5IEOA 2Z7AA 3SOAA 4LGQA 3WA2X 1N9EA 1YI23 3F8HA 1JJ22 4I4KA 2Z77A 3MKIA 3PZWA 1SQWA 1IVWA 3FCSB 3WA3A 1JN5B 4HZ9B 1YIT3 2JDIH 3UB1A 5JBSA 1OGXA 2KRTA 4GL6A 2RFRA 3LTAA 4OK0A 4CCVA 2CH9A 4RNYA 1Q824 1W4NA 2WOFA 2OCTA 3SX1A 1VQ93 1GS3A 3EX9A 4ZM8A 1IQYA 1OHPA 2KCDA 2PNCA 1O7PB 1IT8A 1CEWI 1OPYA 1UUVB 1K41A 3S29A 4BTWA 1DVCA 1WMOA 1DVDA 3A76A 3LXUX 3LTDA 5JPUA 3N54B 1A2VA 3CU3A 1W6CA 4EYCA 3UJMA 3EN1B 1W7CA 4HM3B 1W6GA 1W6YA 2W6JH 4EXRA 4GB5A 1QMAA 3ALAA 1YJW3 1IVUA 2E2TA 4QWTA 2HMOB 2FXTA 2YFLB 4N6TA 3JUPA 4X2OA 3X40A 1F8NA 1K8A4 1VZZA 2MC8A 5LC6A 1C7HA 2F99A 2P0XA 3F7SA 5AIHA 2CG0A 3CXC2 1N8R4 3K7CA 2OOVC 4NHFA 4N6LA 4K61A 4HM5B 1FGMA 1RKYA 1KSIA 1KWIA 5D82A 5IF6A 3SEDA 1Q864 1ZX2A 1E3VA 3HIGA 4IIAA 3TDGA 2B1XB 5AEWB 4WHAA 3NM2A 3GRDA 5STDA 1EKMA 1M1XB 1O7NB 2XGNA 2XR8B 2WGQA 2OOVA 3VF1A 4EC6A 5TGNA 4FCJA 1M904 5AYSC 3LOYA 3Q1CA 3UL6A 4BTXA 5IG5A 3CNMA 4RBNA 3VGNA 3E99A 5D83A 3G4S3 1AVKA 3FKAA 1N8QA 5ELJA 3CME3 4ORLA 2HMJB 3PS8A 1W2B2 1OCVA 3LT8A 1QVF2 3MSOA 1OH0A 2FGTA 4O2HA 4XBTA 3T8UA 7STDA 3D9RA 3MHEA 5BXQA 1K734 3X42A 4WP5A 3HIIA 2BHMA 1US1A 3MWZA 1R4CA 1STDA 2CFKA 4MMZB 5AIFA 4IT7A 3KKGA 3GZYB 1QAFA 1M9GA 1PFPA 4O3VA 3KIIA 2XFSA 4HM6B 3CCS3 3BNDA 1EG9B 3JVCA 3ROBA 2GEXA 2UX0A 1UW1A 1UUWB 3FF0A 3BNBA 2W03A 2CKFB 4EBGA 1SIIA 3J7Yd 2RCDA 3NV0B 4JRFA 5ELUA 2K54A 5EQLA 5EEOA 1IV7A 1L5GB 2OTJ3 2D1WA 2YX9A 1OHOA 1D6YA 3F9SA 1JB2A 1YJ93 3CMA3 5IEPA 2ML6A 1G96A 3MYTA 4N6V0 3U1WA 5KP3A 5BVBA 3B8LA 3F7XA 5KP1A 1FGRA 2GEYA 3BNCA 1IDPA 3OX9A 3K9MC 3DMCA 3F8XA 3GZBA 2F86B 4K1UA 3CCE3 2C11A 3L0RA 4FMAA 2C10A 2P0MA 5IG3A 3CCL3 4XDWA 1IQXA 1JKGB 4N6MA 1VQM3 3PGBA 1A67A 2M7OA 2YFIB 1RJOA 4HBRA 1IV9A 2CFLA 1FA3A 1E3RA 2IMJA 4RZMA 1T5YA 3LZAA 3B4PA 1QJGA 5A0OB 3CC23 4K1VA 3OWUA 1NWWA 2P38A 2XF3A 2CK3H 4R4KA 1BUQA 1D6UA 1ULIB 5IENA 1WNHA 3LTCA 3CC73 5CLKA 3GZXB 1Y4KA 2HMMB 4CDLA 2SBLA 4NREA 3I563 4X2HA 3NV0A 3RGRA 2QIYA 1RRHA 1LNHA 8CHOA 3B4OA 1K28A 3FF2A 4FR9A 4HKVB 4R9KA 4XBXA 2BMRB 1VQP3 2MF7A 3EHCA 4H61A 1OF5B 2ZL8A 3EJVA 2QGUA 3EF8A 3IPTA 3SXXA 1TU5A 1Q7Y4 4HM8B 3CD63 5AIIA 3FZWA 3EB8A 1GY6A 1YJN3 1VQ83 3LMLA 1VQ63 1OHSA 3CPW2 3WDGB 1IVVA 3LYGA 3PYJA 4STDA 2W0QA 1SJWA 2CFWA 3JUMA 1AV4A 1DMQA 1JKGA 1HKXA 1IK3A 4TX4A 3GAXA 2F98A 1U5OA 1OACA 3KN4A 1JN5A 2RSXA 2Z6BA 1KQS2 2BNGA 5FGOA 4IPBA 1JV2B 4AEQA 3OV4A 2Z76A 2IUJA 2Y73A 3WODG 1DYUA 1ROAA 3MG1A 2GBWB 4FCZA 1N5PA 3DGLA 1N9JA 3DY5A 2GXFA 2YFJB 1OGZA 3CCR3 4U13A 4FMCA 3IMAB 1FGTA 2CC3A 4FCMA 3JUNA 3OW22 6STDA 3WOFB 1NJI4 1KC84 4BTYA 3S67A 3NQYA 1YGEA 3OWSA 3EE1A 1OF5A 3IJEB 4KFEA 5IG4A 2CG1A 3DXOA 1YVBI 3SVAA 5AEUB 4LEHA 3CCU3 3CPOA 5I97A 3NUVA 4KFFA 2O3OA 3G6E3 4WYKB 1WMNA 3FSDA 3O8YA 3UL5A 3QK9A 4LMIA 3CCM3 1VQ53 2INXA 4XDVA 3HZPA 3H51A 2WO0A 3DGOA 1QAKA 2XFTA 3FH1A 1GYBA 3FG1A 5IW9A 1S723 1NDOB 1W01A 1IQ8A 4HM2B 1O7WB 4OUQA 4L8PA 3FG3A 2GU1A 4HM1B 3F14A 4XB5A 3X3XA 2O9UX 1SIHA 2JQ5A 3LH4A 4LZIA 1E97A 3BNEA 2Q07A 3B7CA 1WQLB 2CWUA 3GWRA 4J8TA 3AMOB 4G1MB 1Z1SA 4WWUC 1NB5I 4HYZA 1VQ73 1V74A 4RNZA 3MPHA 3K0ZA 1M1K4 5IG0A 1GY5A 1ISKA 2XSHB 4J9AA 3SOYA 4HZBB 4OVMA 4L7KA 1TP6A 1W02A 2BT3A 3HK4A 1QVG2 3WOEB 4N6NB 4EV5A 1Q814 3OXAA 3EC9A 3V99A 2RGQA 3DGMA 4AKYA 4WYKA 3CCV3 3NX0A 2HMLB 2HMKB 1W2ZA 4MMXB 3D3LA 3X41A 2QA43 2IUKA 1VQO3 3QRDA 3NM7A 3F40A 3S5CA 2XEPA 5G2GA 2XSOB 3NBJA 1VQN3 1Q42A 2W9QA 1S5AA 1VQL3 3CCJ3 1ROVA 1KD14 1W00A 1GD4A 3G8ZA 1N5HA 3KSPA 1U8CB 3M8CA 1IU7A 3OWYA 4L8OA 2HMNB 4O02B 3RGAA 4WFOA 1O7HB 3G16A 3CCQ3 3DGNA 1IVXA 1Q40B 1GY7A 2V1LA 1EA2A 3SLUA 1OUNA 2Y74A 2BMQB 3AMOA 1W5ZA 1O7MB 2W56B 3NQZA 2E2VA 3UNLA 5CF1A 1GD3A 3RDEA 3NBRA 1YHQ3 1ASKA 3KFQC 4R1KA 1IT7A 3X3YA 1LOXA 1J2BA 3KSED 2OQEC 4HVNA 1HU9A 1QALA 2FNQA 2GU3A 2LYXA 1STFI 1UI7A 3GZRA 4KFDA 1JB4A 4JF8A 3K5TA 3S28A 1TIJA 2L4VA 4EV2A 4N6UA 2CWTA 1AVLA 1FGOA 2W9PA 4H3UA 2QEX3 3DUKA 3T0UA 2W04A 1TUHA 2A15A 2WGOA 2OQEA 2E2UA 1O7GB 4N3VA 3X3ZA 2GBXB 3NHXA 2OWPA 4XBYA 3EBYA 3G0KA 4KVHA 3NXJA 5DRVA 3DZLA 4K90B 3PXMA 4AKZA 1RRLA 2XRXB 2CFDA 4HM4B 3CNXA 2STDA 3I0YA 3N9HA 3G713 3V92A 2IA7A 1NU3A 1Q40A 2P05A 2W2CA 3ER7A 3PCRA 4FMBA 5D81A 1TFOA 2B24B 1EQKA 2P09A 1TFKA 2KXGA 1LXEA 4N6OB 1NO3A 1JRQA 2XGLA 1DMNA 1A2KA 2W56A 1CYVA 3NBBA 1WMPA 5IERA 2K0MA 3EBTA 4HJLB 5DREA 2R4IA 1SPUA 2WOHA 4FMDA 3U97A 3N8BA 3S27A 3V98A 3WMDA 3HI7A 5FW5A 4MJDA 4MMYB 2CWVA 2CHCA 5CK6A 2CW9A 4R80A 3DM8A 3STDA 3JUOA 1MNLA 3CC43 3FG4A 5JPPA 2I9WA 4KZ1A 2ML5A 1RN7A 3T8NA 3FGYA 4MEIA 1ZO2A 5CF2A 3MG3A 1FUWA 1CQSA 1NB3I 1WTHA 1AR0A 2ZDJA 5KP4A 2PZVA 3BB9A 1ULJB 1JB5A 1K9M4 5HGRA 3EQQB 3ECFA 2XH9A 3I553 5AIGA 1UI8A 3JUQA 3Q2PA 3KZTA 4HM0B 1A90A 3FLJA 4LSOA 1JNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9L A;  4PEJ A;  3Q90 A;  3EN8 A;  3H3H A;  1DMM A;  5AI1 A;  4Q53 A;  3VSY A;  4XM4 A;  5CXO A;  3HX8 A;  3MG2 A;  3KE7 A;  2BMO B;  5EVH A;  4HM7 B;  3BLZ A;  5IEO A;  3SOA A;  2Z7A A;  4LGQ A;  3F8H A;  4I4K A;  2Z77 A;  3MKI A;  1JN5 B;  4HZ9 B;  1OGX A;  2RFR A;  1GS3 A;  3EX9 A;  1OHP A;  1O7P B;  1OPY A;  1UUV B;  1K41 A;  3A76 A;  5JPU A;  3CU3 A;  3UJM A;  3EN1 B;  4HM3 B;  1W6Y A;  4GB5 A;  1QMA A;  2HMO B;  2YFL B;  3JUP A;  4X2O A;  1VZZ A;  1C7H A;  2F99 A;  3F7S A;  5AIH A;  3K7C A;  4HM5 B;  5D82 A;  5IF6 A;  3SED A;  1ZX2 A;  1E3V A;  4IIA A;  5AEW B;  2B1X B;  3NM2 A;  3GRD A;  5STD A;  1O7N B;  2XR8 B;  5TGN A;  4FCJ A;  5IG5 A;  3CNM A;  3VGN A;  5D83 A;  3E99 A;  3FKA A;  4ORL A;  2HMJ B;  1OCV A;  3MSO A;  1OH0 A;  4XBT A;  3T8U A;  7STD A;  3D9R A;  3MHE A;  5BXQ A;  4WP5 A;  1STD A;  5AIF A;  3KKG A;  3GZY B;  4HM6 B;  1EG9 B;  3ROB A;  2GEX A;  2UX0 A;  1UUW B;  3FF0 A;  2CKF B;  2RCD A;  3NV0 B;  2K54 A;  1OHO A;  3F9S A;  1JB2 A;  5IEP A;  3MYT A;  5KP3 A;  5BVB A;  3B8L A;  3F7X A;  5KP1 A;  2GEY A;  1IDP A;  3OX9 A;  3DMC A;  3F8X A;  3GZB A;  2F86 B;  4K1U A;  5IG3 A;  4XDW A;  1JKG B;  2YFI B;  1E3R A;  2IMJ A;  4RZM A;  3LZA A;  3B4P A;  1QJG A;  4K1V A;  3OWU A;  1NWW A;  1BUQ A;  1ULI B;  5IEN A;  5CLK A;  3GZX B;  2HMM B;  4CDL A;  4X2H A;  3NV0 A;  3RGR A;  2QIY A;  8CHO A;  3B4O A;  3FF2 A;  4HKV B;  4R9K A;  4XBX A;  2BMR B;  3EHC A;  1OF5 B;  3EJV A;  2QGU A;  3EF8 A;  3IPT A;  4HM8 B;  5AII A;  3FZW A;  1GY6 A;  1OHS A;  3LYG A;  4STD A;  1SJW A;  3JUM A;  1DMQ A;  1JKG A;  1HKX A;  2F98 A;  1U5O A;  1JN5 A;  2BNG A;  3OV4 A;  2Z76 A;  3MG1 A;  2GBW B;  2GXF A;  2YFJ B;  1OGZ A;  4U13 A;  4FCM A;  3JUN A;  6STD A;  3OWS A;  1OF5 A;  5IG4 A;  3DXO A;  5AEU B;  4LEH A;  3CPO A;  3NUV A;  4WYK B;  3FSD A;  4LMI A;  2INX A;  4XDV A;  3HZP A;  3H51 A;  3FH1 A;  1GYB A;  1NDO B;  1W01 A;  4HM2 B;  1O7W B;  4OUQ A;  4L8P A;  4HM1 B;  3F14 A;  4XB5 A;  2JQ5 A;  1E97 A;  3B7C A;  1WQL B;  3GWR A;  4J8T A;  1Z1S A;  4WWU C;  3K0Z A;  5IG0 A;  1GY5 A;  1ISK A;  3SOY A;  2XSH B;  4J9A A;  4HZB B;  4OVM A;  4L7K A;  1TP6 A;  1W02 A;  3HK4 A;  3OXA A;  3EC9 A;  2RGQ A;  4WYK A;  2HML B;  2HMK B;  3F40 A;  3S5C A;  5G2G A;  2XSO B;  1Q42 A;  1S5A A;  1W00 A;  3M8C A;  3G8Z A;  3KSP A;  3OWY A;  3RGA A;  4L8O A;  2HMN B;  1O7H B;  3G16 A;  1Q40 B;  1GY7 A;  1EA2 A;  1OUN A;  2BMQ B;  1O7M B;  3UNL A;  5CF1 A;  3NBR A;  1ASK A;  4R1K A;  4HVN A;  3GZR A;  1JB4 A;  4H3U A;  3DUK A;  1TUH A;  2A15 A;  1O7G B;  4N3V A;  2GBX B;  3NHX A;  2OWP A;  4XBY A;  3EBY A;  3G0K A;  4KVH A;  3NXJ A;  5DRV A;  3DZL A;  2XRX B;  4HM4 B;  3CNX A;  2STD A;  3I0Y A;  1NU3 A;  1Q40 A;  3ER7 A;  2W2C A;  5D81 A;  2B24 B;  1DMN A;  1A2K A;  5IER A;  3EBT A;  4HJL B;  5DRE A;  2R4I A;  3WMD A;  5FW5 A;  4MJD A;  2CHC A;  5CK6 A;  3DM8 A;  3STD A;  3JUO A;  5JPP A;  2I9W A;  3T8N A;  3FGY A;  1ZO2 A;  5CF2 A;  3MG3 A;  1CQS A;  1AR0 A;  5KP4 A;  2PZV A;  3BB9 A;  1ULJ B;  1JB5 A;  5HGR A;  3EQQ B;  3ECF A;  5AIG A;  3JUQ A;  3KZT A;  4HM0 B;  3FLJ A; 
#chains in the Genus database with same CATH topology
 4R9L A;  1UCI A;  2NNY A;  3NEU A;  1SC7 A;  3EN8 A;  4BHC A;  2CU7 A;  1O7L A;  1DMM A;  1WI3 A;  4AC0 A;  1G02 A;  3I3L A;  4RGR A;  7GSP A;  1W0T A;  2DT5 A;  1HST A;  1O57 A;  5IT3 A;  2ZO4 A;  3RZD J;  1WJA A;  2ZXH A;  3E5Q A;  1R5I D;  5FRO A;  2W7N A;  1RR8 C;  1YGW A;  2KIF A;  2KDO A;  4A0X A;  1YIJ 3;  3HX8 A;  3MG2 A;  2DMP A;  3F21 A;  2Z1D A;  3S32 A;  5AYR B;  1FOW A;  2CGP A;  4HM7 B;  4ESB A;  4FE4 A;  1ACI A;  5IEO A;  2NS8 A;  2R7X A;  2RKH A;  4LGQ A;  3LL7 A;  3BZK A;  2M4G A;  1V5F A;  2H6C A;  5TJJ A;  4DIQ A;  5FO5 A;  1XG1 A;  3MKI A;  3F6O A;  1MDM B;  2XSD C;  1RGK A;  2M3A A;  2Q1Z B;  1I2E A;  3WA3 A;  5CVJ A;  5KAI C;  1YW7 A;  3HHG A;  1YIT 3;  1OGX A;  2KRT A;  1S7A A;  3CLO A;  3VPR A;  1P7J A;  1FMW A;  3BCA A;  1IN8 A;  1U9N A;  4CZC A;  4NPB A;  2COB A;  2L5Q A;  1W4N A;  1CF7 A;  1YI2 I;  3V7R A;  4CCJ A;  3CCJ I;  1BSA A;  4W97 A;  3R0A A;  3L09 A;  4ZM8 A;  4IQ4 A;  4OAY A;  2OV7 A;  1IQY A;  1QVT A;  2PNC A;  1CEW I;  4EM1 A;  3EYY A;  2F5F A;  1I6X A;  2FD5 A;  4MHG A;  4RB0 A;  2TRT A;  4HNU A;  2EFQ A;  3K4N A;  4IPA A;  3FM5 A;  3K10 A;  4A12 A;  1ZTR A;  2FBH A;  2DMT A;  1BRS A;  1DVD A;  4XR6 A;  3WHO A;  3A76 A;  5C4J J;  3RKX A;  3LXU X;  1R58 A;  1LJ9 A;  3LTD A;  2JZY A;  1LDK B;  4XKW A;  4FIS A;  3GTP J;  1VQ9 I;  1FPQ A;  2NAZ A;  3N54 B;  1HXD A;  2P7C B;  1BNE A;  2Y75 A;  3UJM A;  4BE1 A;  4KFC A;  5D6F A;  3Q9V A;  5M3F J;  3GXO A;  1R1V A;  3ZMD A;  1ZGJ A;  1W6Y A;  5ILV A;  4LJZ F;  5FLV A;  4BDY A;  3I59 A;  1QMA A;  1RUO A;  4HNV A;  1UGI A;  5BOX A;  3ALA A;  2JK3 A;  1YJW 3;  1ONV A;  5E3N A;  2ZME A;  1U5T A;  2E2T A;  3A01 B;  2HMO B;  4GHO A;  1LVA A;  4X2O A;  2CMP A;  5A2Q K;  4U7D A;  2V9P A;  1AQZ A;  1F8N A;  5J1R A;  2XB5 A;  4ETS A;  2W4S A;  1XGN A;  2NVX J;  3P9K A;  3F7S A;  1T95 A;  2CG0 A;  1N8R 4;  4A69 C;  5HS7 A;  2EV5 A;  2IS6 A;  3F9K A;  5AIP A;  3W6V A;  5H2F C;  3BTJ A;  2HQA A;  2R5Y A;  4K61 A;  1R23 A;  3KET A;  4A3D J;  3WTZ A;  4D5C A;  2GZW A;  3FF5 A;  1QPI A;  2XPW A;  1BSE A;  5D82 A;  1RKY A;  3SED A;  1FX7 A;  3E6B A;  3HPG A;  4GFB A;  3HIG A;  4IIA A;  3SFZ A;  3DLL F;  2B1X B;  1RGC A;  4XM3 A;  2NVU B;  5IP6 A;  3GRD A;  2PG4 A;  1OQY A;  4RLF A;  8RNT A;  2WGQ A;  1KGS A;  1ON1 A;  2CG4 A;  2EZI A;  2K5C A;  3BJA A;  5AYS C;  1M90 4;  4A3J J;  3K0L A;  1T08 B;  1GOV A;  1F9N A;  5J40 A;  1MND A;  3U1K A;  2MD0 A;  1R49 A;  3OSG A;  4C3H J;  1JE8 A;  2FUG 2;  3FKA A;  4ORL A;  4J5K A;  5EF6 A;  3LSH A;  1W2B 2;  2MC3 A;  1N78 A;  4H4K C;  3MSO A;  3TED A;  2VBX A;  5BS6 A;  4RGX A;  3T8U A;  2OZ6 A;  7STD A;  4EVI A;  1UFM A;  1HW5 A;  2W82 A;  2XRO A;  3X42 A;  1FUT A;  5CQG A;  2KZV A;  3IKT A;  1US1 A;  1R4C A;  2GSP A;  2E7W A;  1UHM A;  3CME I;  2CX1 A;  4QIW N;  2COM A;  2XGX A;  5E1X A;  1B9N A;  2O61 A;  1M9G A;  1SD7 A;  1KZH A;  3TOB A;  3KII A;  1BRG A;  2H1L A;  1FNN A;  3L9F A;  3PQJ A;  1ZG5 A;  2L7Z A;  4XRS G;  4RAF A;  1LFU P;  1EG9 B;  2UX0 A;  2AQF A;  2WV1 A;  2VT2 A;  3C2B A;  2YX7 A;  2W03 A;  2GXA A;  4BHB A;  1SII A;  3J7Y d;  3NV0 B;  5ELU A;  2OTJ 3;  1L5G B;  2K54 A;  5EQL A;  4C3J J;  1TJD A;  4B43 A;  3BLY A;  3DPT A;  1OIS A;  3QP6 A;  5HLI A;  1OHO A;  2JA2 A;  5EJC A;  5D8L B;  1JB2 A;  4RM2 A;  4IHS A;  4YG2 F;  3CCS I;  1U6G A;  3K1P A;  2LC2 A;  1B9M A;  2K3P A;  1YTY A;  2IT0 A;  5KP1 A;  1FGR A;  3HM5 A;  4GGG A;  1XS9 A;  1JZD A;  2BHZ A;  2FE3 A;  5LGU A;  4I02 A;  1IDP A;  4I5Q A;  3K9M C;  5B66 C;  2EIL H;  2K4B A;  1TTO A;  3GZB A;  4LOC A;  2Z9O A;  2IAI A;  3LSK A;  3E5X A;  3FK6 A;  2C10 A;  4N6M A;  2DFH A;  1VQM 3;  2W57 A;  1OCC H;  1BC8 C;  2OTL I;  2G0E A;  1STZ A;  1T98 A;  2DJI A;  3PGB A;  4XK4 A;  4GO1 A;  3V4G A;  2YFI B;  1GMQ A;  1XMK A;  4CPK A;  1Y6I A;  3T5X A;  2MSY A;  1O7F A;  5BNG A;  3L1P A;  4XLF A;  1T5Y A;  1OFC X;  2V1D A;  2X51 A;  3AKZ A;  4ZDO A;  4F91 B;  1I8V A;  2RQQ A;  1XDU A;  4K1V A;  2SAR A;  5E17 F;  1O3R A;  4R4K A;  1Z6R A;  5FKM A;  2E35 A;  3FWE A;  1WWX A;  3T8R A;  3CCE I;  2XF3 A;  1ULI B;  1UEL B;  1WNH A;  4KIG A;  3M8J A;  3A5E A;  3MD2 A;  3BR2 A;  2R41 A;  4LIT A;  1JBS A;  2Y0S A;  3CO6 C;  2A07 F;  5CLK A;  2K02 A;  1FIP A;  2VJ4 A;  1Y0U A;  3JRH A;  3OYA A;  1Y4K A;  1W7P A;  3H3U A;  3GZX B;  4BU4 A;  3E0J B;  3U2R A;  4B47 A;  4KNY A;  1MBF A;  4IO9 F;  4HPQ A;  1EUI C;  1BN5 A;  3FZV A;  2FQ4 A;  1BOB A;  1CQT A;  2XB0 X;  3VFZ A;  2VC0 A;  3X2Q H;  1IUY A;  4DBQ A;  2L9S A;  5DM7 F;  3LNQ A;  1JGG A;  2M0M A;  4UUS A;  4YFK F;  4PJM A;  2AXT C;  2BGC A;  3OYD A;  2IY2 A;  3EB8 A;  3FZW A;  2ME6 A;  4B3X A;  1OKR A;  2OA4 A;  3ZQC A;  1Z67 A;  2E60 A;  2OF7 A;  2XGE A;  1OHS A;  3MFK A;  4DKI A;  3CPW 2;  5E20 A;  4PFO A;  2CFW A;  1NTC A;  5CVI A;  4P9U A;  1AV4 A;  2DPU A;  1DMQ A;  1IO2 A;  2M8G X;  1JKG A;  1MBK A;  3W6J B;  2F98 A;  4BBS J;  1RIO H;  3QOP A;  4XLC A;  3CD6 I;  1UCR A;  3KYC B;  2YUS A;  2DLL A;  5BMZ A;  2VE8 A;  1KQS 2;  1RKW A;  2ZXI A;  4OMZ A;  3HTU A;  3P9C A;  4I6Z A;  1ZHF A;  2Y73 A;  4E7H A;  2IRF G;  2HOH A;  1I1S A;  1H8A C;  4U0W A;  2ZJ2 A;  3WOD G;  1A6Q A;  2KPM A;  2X6W A;  4R1H A;  1MNM C;  1X1C A;  1RDS A;  3S1Q J;  2E2I J;  2BV6 A;  2IGK A;  3B6A A;  3KIO A;  3VOD A;  4BJ6 C;  1RC9 A;  5J8F A;  3DGL A;  3GLX A;  3DY5 A;  4EW5 A;  2BW3 B;  2OAZ A;  2M2E A;  3ABL H;  2AQE A;  2YU9 J;  1OGZ A;  2X6O A;  1JKQ C;  5M1A A;  3DEE A;  1IN7 A;  4HOH A;  2CC3 A;  3JUN A;  1WJE A;  1NJI 4;  3ZG0 A;  3T1B A;  4CDG A;  2ZFU A;  3V42 A;  1KA8 A;  2ZXJ A;  1JJ8 C;  1T2I A;  4XKB A;  3IJE B;  3NQY A;  3OWS A;  5KHD A;  4KFE A;  1D1B A;  5IG4 A;  3AFH A;  4BY7 J;  4G12 A;  3NWS A;  2BBY A;  2D2W A;  3FXJ A;  4RB1 A;  3HEF A;  3I71 A;  2HEO A;  4D5F A;  4LEH A;  4E4H A;  1AKH B;  1C0W A;  3CCR I;  2W25 A;  1O3T A;  2DT6 A;  3NUV A;  3G6E 3;  3BR3 A;  2K85 A;  4LG0 A;  4WYK B;  2BYV E;  1WMN A;  3JRC A;  2LKS A;  1W5C C;  3O8Y A;  1T33 A;  2MFZ A;  3J81 K;  2H0G A;  2BXY A;  1RGH A;  5G1L A;  1ETW A;  2EA2 A;  1XX5 A;  4QPO A;  2E1C A;  1NK2 P;  3V8K A;  2JRT A;  2NOG A;  1D8K A;  2AAE A;  3FH1 A;  2F4O B;  2XFT A;  2KIS A;  4JX4 A;  5LHH A;  2E7X A;  6GSP A;  1W01 A;  5EYR A;  4V19 K;  3ECO A;  2RC4 A;  3HGY A;  3C2H A;  1T0F C;  2W84 A;  1FYS A;  2B0L A;  1I1G A;  4HM1 B;  2HKX A;  4LK1 F;  2FA5 A;  3RYP A;  2M7B A;  1T56 A;  1VQ5 I;  1OCT C;  1SIH A;  1FIA A;  2Y69 H;  3LQQ A;  4EV0 A;  1TWG J;  2HOS A;  2RV8 A;  4C2U A;  2LFB A;  4HV5 A;  1EH6 A;  1MJB A;  5EEA A;  3WTY C;  4GCV A;  3OYL A;  4G1M B;  2L01 A;  1NB5 I;  2AHQ A;  2FNA A;  1VND A;  4A3B J;  3CUQ A;  1V74 A;  4WXC A;  4EJW A;  1P9Q C;  3LSP A;  3MPH A;  1Z91 A;  5IG0 A;  3O8G A;  2STW A;  4HZB B;  1IRG A;  3WU0 A;  2CJJ A;  2LKP A;  2MAB A;  1P7I A;  1QHG A;  2JVH A;  4L9T A;  3WOE B;  4EV5 A;  3LSM A;  1YS7 A;  4RAZ A;  1TRP A;  5F08 A;  4ZZD A;  2RGQ A;  3SZG A;  5J6X A;  4ZDP A;  2WBM A;  4A3M J;  2CW0 F;  3ESW B;  2V26 A;  2H0I A;  4A0Y A;  2HMK B;  2V9K A;  4MMX B;  2QA4 3;  2DOE A;  4LB6 B;  1USS A;  1VQO 3;  1G59 A;  3QRD A;  2EK5 A;  1I2G A;  5DYM A;  4BEH B;  2XEP A;  1YS6 A;  4EJO A;  2XSO B;  1Z7U A;  3CCL I;  2PJR B;  3L7W A;  1IXC A;  2L7M P;  5D8K B;  2CYY A;  1S5A A;  1RGL A;  3PM1 A;  2VKH A;  1W00 A;  3IWZ A;  3MKZ A;  4CO8 A;  3KFW X;  1G0T A;  3CCV I;  3M8C A;  1IU7 A;  2TCT A;  2HMN B;  3SZP A;  1QGP A;  1HDD C;  4O02 B;  3FXK A;  1AU7 A;  1WJC A;  3GTG J;  2EA4 A;  5CQE A;  1GV5 A;  3H35 A;  3JRA A;  1B8I B;  1FJL A;  3S3N A;  1BGS A;  1IDZ A;  2F5E A;  5DCF A;  1BSB A;  1IVX A;  4N4O B;  9RNT A;  3CTA A;  1EA2 A;  3SLU A;  2X48 A;  2CX0 A;  2EFW A;  2G9W A;  3AMO A;  3NQZ A;  4EEF G;  1ETV A;  3HJE A;  3ABK H;  5GPC A;  3UNL A;  4M3F A;  2L1S A;  1RET A;  3RDE A;  3NBR A;  3HOH A;  3KFQ C;  1UHW A;  4M71 A;  3PQK A;  2P5V A;  1IT7 A;  4LMY A;  3BG7 A;  3JW4 A;  2H6B A;  1HKT A;  3KSE D;  2WB1 A;  3HSF A;  3W2W A;  2Q2E A;  4XN3 A;  3GZR A;  3HYI A;  4HZF A;  3OL4 A;  2V7F A;  1EA3 A;  2KLO A;  3RKY A;  2AXL A;  1K4T A;  2M87 A;  1BIR A;  4JBA A;  1TWC J;  1V4R A;  1WCM J;  3FMS A;  3BR0 A;  1UAA A;  1XGS A;  1T2H A;  4J5G A;  4N6U A;  4EV2 A;  2QEX 3;  3T0U A;  4AIJ A;  1APL C;  2KP6 A;  2QEN A;  3JRF A;  3QPH A;  3OYN A;  1RNL A;  2OQE A;  2BY3 A;  2I5U A;  2XF5 A;  3V8L A;  3NRV A;  2E2U A;  1O7G B;  4N3V A;  2PN6 A;  5JI6 A;  2DTR A;  1E3O C;  4XBY A;  3G0K A;  1SFO J;  3DZL A;  2DQL A;  4AKZ A;  4F3Q A;  2EPF A;  2BVM A;  2JT1 A;  3ULQ B;  3GEZ A;  1BI0 A;  2Q0O A;  2LYC A;  4M74 A;  4WCG A;  2XRX B;  4FET A;  3HOY J;  5HS9 A;  3N9H A;  2V6C A;  2LMD A;  2JUG A;  4EGZ A;  1Q40 A;  2P05 A;  3V92 A;  2VLA A;  2VE9 A;  4FMB A;  4M6V A;  3JCU C;  4Y7N J;  4KIC A;  1MSF C;  1TFO A;  1TFK A;  1LXE A;  1PY3 A;  2KXG A;  3KYL A;  3GO5 A;  1O3Q A;  4EM2 A;  3NBB A;  2E36 A;  4NDL A;  3F8C A;  5IER A;  1I50 J;  4YRV A;  3VDX A;  5DRE A;  1B2M A;  1BJA A;  2KMU A;  2KL4 A;  1W7P D;  3CDL A;  3QYF A;  1TQM A;  2IYJ A;  3V98 A;  2MW8 A;  3WMD A;  2QKM B;  2PMZ N;  4HAM A;  3DGY A;  3HL2 A;  4HF0 A;  1Q1H A;  4B09 A;  4DJA A;  1FYM A;  2R7U A;  1BR2 A;  4L9J A;  5J1U A;  4MJD A;  2CWV A;  4MMY B;  3GSP A;  2CW9 A;  1IZ1 A;  2JSP A;  1FSE A;  3STD A;  3JUO A;  1S8N A;  2DA6 A;  2VOD A;  1MNL A;  2GAU A;  5E1Z B;  5JPP A;  1W1W E;  4CCN A;  3DBR B;  1XMA A;  3MKY B;  1MJ9 A;  5ICF A;  2XC7 A;  5K7H A;  1N25 A;  3JTH A;  1Y56 A;  2CRG A;  4ZYA A;  3MG3 A;  1FUW A;  3OYK A;  3GBG A;  4BGD A;  1WTH A;  5EG0 B;  2PI0 A;  3H36 A;  1AR0 A;  3CCM I;  1T3B A;  2ZDJ A;  1PUF B;  2B7E A;  4CYD A;  2L4M A;  3CC4 I;  3K4B A;  4HLX A;  1FYL A;  3HSR A;  2M8E A;  4KDP A;  2D1V A;  4MFE A;  1JBT A;  3HOU J;  5HGR A;  3ECF A;  4L0Z B;  3ZQG A;  2IJL A;  4EM0 B;  5KNL A;  5L3D A;  4ZYD A;  4HM0 B;  3SDB A;  2VL8 A;  1RI7 A;  3OL3 A;  1YVS A;  1RUN A;  4Y17 A;  1A2P A;  4O8S A;  1TZL A;  1GMR A;  4PEJ A;  2FU4 A;  2LQV A;  1PU4 A;  3K1M A;  1KQ9 A;  2XUB A;  4UB6 C;  3E6C C;  1DET A;  3SFI A;  2RNG A;  2DA7 A;  3F8M A;  3FIS A;  3GFL A;  1ZKG A;  2VXZ A;  4DYC A;  1KON A;  2HWV A;  3VSY A;  1ETQ A;  4ZC3 A;  5IOZ A;  3IC7 A;  1BNJ A;  2E1M B;  1R1U A;  2Y31 A;  1SFU A;  3EUA A;  3K63 A;  2LK2 A;  5LC7 A;  3P5J A;  2GWR A;  2ID3 A;  4BH9 A;  2X1E A;  3T8T A;  2AS5 F;  1ZRE A;  5HVQ C;  1DP7 P;  3SOA A;  2VXD A;  3WA2 X;  1TP4 A;  2BE5 F;  3MKL A;  1WJD A;  3F8H A;  1BRN L;  4I0B A;  4DZP A;  3D79 A;  4BE0 A;  3PZW A;  1DP3 A;  2F4M B;  3FCS B;  5EEG A;  1WZ2 A;  3S14 J;  2PMH A;  2HZD A;  3TQN A;  3GF2 A;  4GL6 A;  4OK0 A;  5IY5 H;  5CVR A;  1I3I A;  2GA1 A;  3O8H A;  2UWM A;  2ESN A;  3BPX A;  3W3C A;  5J8C A;  2OCT A;  3SX1 A;  1LQ1 A;  4N9I A;  1RSN A;  3EX9 A;  4PSW A;  2JMW A;  3QU6 A;  4IL6 C;  5LBQ A;  1O7P B;  2KCD A;  1J09 A;  3B73 A;  5GTI C;  1UUV B;  1IV8 A;  3S29 A;  2ELJ A;  4X1E A;  3LSG A;  3MMY B;  3D1N I;  2Z2S B;  4C9Y A;  1YIT I;  1YW8 A;  5B5E C;  1PP8 F;  2ZME C;  2E1N A;  2X0L A;  1U5T C;  5HDK A;  1WMO A;  5FLX K;  4I99 C;  1FWZ A;  2L7K A;  5E1W A;  2HDW A;  1RNT A;  1JUP A;  1A2V A;  3CU3 A;  1W6C A;  2J8X B;  1D5Y A;  3AHW A;  2VBZ A;  3V7S A;  1YHQ I;  2UUZ A;  1MBE A;  1WJB A;  2OQR A;  3HKZ N;  2CFX A;  4WXD A;  2D45 A;  3TO9 A;  1LE8 B;  2VPR A;  4IF4 A;  2ECB A;  4XRS A;  1HQC A;  3JUP A;  3DV8 A;  4N6T A;  1E3H A;  5E18 F;  3X40 A;  3FKI J;  1WSU A;  1VZZ A;  2ZNZ A;  5LHG A;  1MDM A;  3B6C A;  2M4K A;  3HXL A;  3ROU A;  1I0V A;  2F99 A;  3WGI A;  2P0X A;  5AIH A;  1B6A A;  3CXC 2;  1Z21 A;  4JQF A;  1MSE C;  1MW7 A;  1QHH D;  2A68 F;  2DMN A;  4JX5 A;  4CIC A;  4HM5 B;  1FGM A;  4WWC A;  1YJW I;  4XSZ F;  3S3M A;  1KSI A;  1KWI A;  5IF6 A;  2IBD A;  5F04 A;  1W36 D;  3M3Y J;  4XN0 A;  1ZX2 A;  1N77 A;  1D1C A;  3R60 A;  1WFX A;  3NM2 A;  4WX9 A;  4Z2Y A;  4Q48 A;  1EKM A;  1UHS A;  1HOM A;  1PYV A;  2M1B A;  2X4H A;  2P4W A;  3PNV A;  1UDI I;  2XGN A;  2E71 A;  3G1O A;  2O5R A;  3IUO A;  3MZH A;  3FKJ A;  3UL6 A;  3DXJ F;  1YIO A;  2B9S A;  2R7S A;  3E99 A;  5ELJ A;  1N8Q A;  4NC6 A;  4RMN A;  4UNO A;  2ZJQ F;  1YOV B;  4P9F A;  3LT8 A;  2Q8K A;  3VYR B;  2L4A A;  4M3D A;  2LP0 A;  1F43 A;  1X1X A;  1LQG C;  5E3O A;  3D9R A;  5BXQ A;  2CQK A;  3DU5 A;  3KZZ A;  1U9O A;  4B8X A;  2OU2 A;  2WAQ N;  3WR2 A;  1YQA A;  2BHM A;  4PJN A;  3MWZ A;  3QWL A;  3V8J A;  4MMZ B;  3S93 A;  1DUX C;  2CFK A;  2Y9Y A;  4IT7 A;  1BUJ A;  3OOU A;  3HC7 A;  3LSI A;  2KDZ A;  3MQ0 A;  3DTE A;  2DDA A;  1L3L A;  1ETO A;  3A4C A;  3GTO J;  2XFS A;  2LH9 A;  4O5V A;  3B8L A;  3LFK A;  1BM9 A;  4AYB A;  4L0Y B;  2CS3 A;  3D0S A;  2F5V A;  3I54 A;  5L3F A;  1OCZ H;  1R36 A;  1VTN C;  3BG5 A;  1TWH J;  2ETH A;  4JP0 A;  2GQQ A;  4MLO A;  3WE2 A;  4ZH4 F;  2WA0 A;  3KEY A;  4ON0 A;  1UUW B;  1GV2 A;  4EGY A;  3FF0 A;  2OJE D;  4EBG A;  1X2N A;  1FUS A;  1IV7 A;  5GAG J;  1HZ1 A;  5K7F A;  2YX9 A;  5E3L A;  3K4L A;  4XLN F;  2JN6 A;  1OR7 A;  4M3G A;  5FKN A;  2X85 A;  4A3K J;  3REO A;  1D6Y A;  4PCQ A;  3F9S A;  3Q0W A;  2MH9 A;  3HZJ A;  5IEP A;  4OU0 A;  4U0V A;  3MYT A;  4N6V 0;  2AAD A;  3A03 A;  5BVB A;  1ENH A;  5F1J A;  1GT0 C;  2GXG A;  4XID A;  2UV1 A;  3UKG A;  1Y39 A;  3ISP A;  1ZK8 A;  1IGN A;  2KHM A;  3D5I A;  1X58 A;  1JUS A;  3BNC A;  4E7I A;  2OTJ I;  1WPK A;  3KEQ A;  1FP2 A;  5H20 A;  1HSJ A;  3KP3 A;  3SEQ A;  2HI3 A;  2DK8 A;  1VQ4 I;  3DMC A;  4AIK A;  5L3B A;  5FFZ A;  1I3A A;  2F86 B;  1PDN C;  2A6T A;  2C11 A;  2EFP A;  3PIO F;  4NB5 A;  4ZTJ A;  1SVL A;  4LD5 A;  4PGG A;  3ERE D;  2JJ7 A;  3KYD B;  5IG3 A;  1LB2 A;  1BNI A;  1D3Y A;  2XAH A;  3BCB A;  3SHF A;  5ICC A;  4R79 A;  1RJO A;  1S6L A;  5CJ9 A;  1E3R A;  5JVG F;  4E7J A;  2DCE A;  1BRJ A;  2V79 A;  1QJG A;  3AGN A;  1WGX A;  3VYU B;  3BG3 A;  1TBX A;  4C3I J;  4DNC A;  1NWW A;  1BNR A;  1MZB A;  1A35 A;  1DGW Y;  2QSH X;  2DOA A;  4DW6 A;  3I4M J;  3GYH X;  4IJA A;  1VQM I;  2PQ8 A;  3CC7 3;  4LGW A;  3H5N A;  1IXS B;  4GXO A;  3V7C A;  1LFP A;  3SQN A;  3QOD A;  3BQY A;  3F8F A;  2QM3 A;  4NRE A;  3I56 3;  4X2H A;  3SYT A;  3NV0 A;  4FAS D;  2FRH A;  4UV9 A;  3Q3F A;  5IYD J;  4BQN A;  4KYW A;  8CHO A;  2DMQ A;  2HTJ A;  4DYQ A;  1NG6 A;  1R4N B;  4ZJZ A;  1K28 A;  3B4O A;  4HKV B;  4XBX A;  1MGR A;  1VQP 3;  2MF7 A;  4MTD A;  3EHC A;  2RDP A;  4EJU A;  1T2K A;  2ZL8 A;  3EJV A;  3QOE A;  4JOM A;  1Z1D A;  1MGW A;  2VJJ A;  2PEX A;  4OWR B;  3WGH A;  1Q7Y 4;  3OIP A;  4RDU A;  1GY6 A;  3M1E A;  1QO0 D;  2V4J C;  3M8F A;  5DEQ A;  1VQ8 3;  3BTC A;  1VQ6 3;  2F5C A;  1QA6 A;  3QYE A;  4N0B A;  1DPR A;  2KFD A;  1BA5 A;  1ZS7 A;  2KF5 A;  4QSH A;  2W0Q A;  3ZMV A;  3AAF A;  2LOO A;  4M9S A;  2M9H A;  1FYK A;  3JUM A;  5EGO B;  1BSC A;  1IK3 A;  1D8J A;  5F0C A;  5LHI A;  3WTS C;  2HVR A;  2HKO A;  1IDY A;  4OAZ A;  1OAC A;  3KN4 A;  1JN5 A;  3ASN H;  2RSX A;  2FX0 A;  1JV2 B;  2DA2 A;  2R7R A;  5IT9 K;  3BU4 A;  4AEQ A;  2FBI A;  2XAF A;  3KP6 A;  2DN0 A;  1QBJ A;  3BZC A;  1HKQ A;  2KZG A;  2WY8 Q;  2XF7 A;  4N4N B;  5GTH C;  3AL0 C;  3A0B C;  1A5J A;  2LDU A;  3H92 A;  3OS1 A;  1DYU A;  3MG1 A;  5HNF A;  5FGM A;  2D5V A;  3BR1 A;  3LA7 A;  2GM4 A;  1WH5 A;  5HS8 A;  2QSG X;  1Z77 A;  4Y33 A;  1BR1 A;  4XNF A;  2GXF A;  4OMY A;  1BL0 A;  5FFX A;  2YFJ B;  2YPR A;  4B48 A;  4BJT A;  4CCO A;  3AG4 H;  2ZCW A;  1FGT A;  3CJQ B;  3PIP F;  4JK1 X;  4UHT A;  3K70 D;  3S67 A;  3L2Q A;  3F8B A;  3J7A Y;  4AVP A;  1X1Y A;  1XDS A;  4G7H F;  2CG1 A;  5DUK A;  1WQ2 A;  4S0H B;  1RTU A;  3CUO A;  3DXO A;  3P9I A;  5BQT A;  2E5Z A;  3S17 J;  2RN7 A;  4P5O A;  1UG0 A;  1K7A A;  3SEZ A;  1S9H A;  4LIV A;  1B2Z A;  2O3O A;  3ZFZ A;  1D1A A;  2A05 A;  1ORK A;  1K78 B;  3I0T A;  5IYB J;  3UL5 A;  3QK9 A;  4CYC B;  1VZ0 A;  3G4S I;  2DFE A;  5HOH A;  2EIN H;  1MWT A;  3P7N A;  3WG7 H;  4XDV A;  4RLQ A;  1GDT A;  3WOD F;  4HYE A;  3HZP A;  3DGO A;  1QAK A;  1MWU A;  2QKL B;  4CCM A;  6PAX A;  4WK8 F;  2J5P A;  3FG1 A;  4DBR A;  1SAX A;  5DUI A;  3WU1 B;  3G6E I;  2CH0 A;  1RR7 A;  4HM2 B;  4IRH A;  5M5W J;  5ILS A;  2H8R A;  3CUQ C;  4OUQ A;  4KT3 B;  2E2J J;  4NBQ A;  3L2V A;  3HHH A;  3PO2 J;  3I5U A;  3TW6 A;  3K7A J;  5B3S H;  4HDU A;  1NK3 P;  1B21 A;  2OZU A;  2XDV A;  2JQ5 A;  2MD5 A;  3K4M A;  2O9U X;  2IGO A;  3LH4 A;  3W2V A;  1T39 A;  1E97 A;  3BNE A;  1C54 A;  2BW3 A;  2K7L A;  1MWR A;  5KK1 A;  3B7C A;  4G94 A;  3GWR A;  1BAO A;  3OY9 A;  5M19 A;  3H3V K;  4I7H A;  3FMR A;  1JJ6 C;  3BJO A;  4UVB A;  5FB2 A;  4X6A J;  5D6E A;  4RNZ A;  5GSP A;  1M1K 4;  4CH7 A;  1GY5 A;  4Y15 A;  2WWY A;  2FOK A;  3HG9 A;  4MO7 A;  2YS9 A;  3IL2 A;  3L2R A;  3DTK A;  2RBI A;  2DTZ A;  1AWC A;  2WTE A;  1O4X A;  3R6S A;  1R4Y A;  1OCR H;  1QVG 2;  2P6S A;  2ELH A;  3Q9S A;  1FOK A;  2K9S A;  1W36 C;  1AKH A;  1Q9E A;  2KAA A;  1MBJ A;  2M30 A;  3IKV A;  3F22 A;  5E8G A;  3DKW A;  2QQA A;  4CSW A;  3V99 A;  4AKY A;  2DMU A;  4WYK A;  3NX0 A;  1XC5 A;  2QF7 A;  3ZXS A;  1W2Z A;  3X41 A;  2IUK A;  3RQ4 A;  2QQ9 A;  3S1M J;  2LY2 A;  3NM7 A;  3F40 A;  5G2G A;  3UNG C;  2RQP A;  3NBJ A;  1LRA A;  2HDC A;  2YSR A;  4AID A;  4KA4 A;  1Q42 A;  1BIB A;  3Q5F A;  1V57 A;  1VQL 3;  3CCJ 3;  2OPT A;  3H9Q A;  3BQZ A;  1KD1 4;  4M72 A;  3Q0U A;  1GD4 A;  1M1E B;  3CF2 A;  1U8C B;  3ZMT A;  3RGA A;  2LBF A;  3FMQ A;  3QRF F;  2VQH A;  3HRM A;  1Z3X A;  5F0F A;  3JAM Z;  2P0W A;  3HKZ A;  1E3P A;  2R7T A;  1PYL A;  1I0X A;  3CMM A;  4BDZ A;  2K3D A;  2P8T A;  1VQO I;  4A2U A;  1BR4 A;  3BPV A;  4AU7 A;  3G1L A;  5KVR A;  1RCL A;  2V1L A;  1I2F A;  1Z05 A;  3GTL J;  2K9N A;  2MG4 A;  1OUN A;  2BMQ B;  4UB8 C;  1W5Z A;  3U9G A;  1ULY A;  4DGW B;  1HYF A;  1O7M B;  4DQ2 A;  4CZZ A;  2E2V A;  2Y30 A;  3MZ8 A;  3DWL E;  4HBL A;  3X3X A;  1YG2 A;  3FM3 A;  4NC7 A;  1V3F A;  1K6O A;  1ASK A;  3HOW J;  4BXU A;  3WTV C;  2Z5U A;  4R1K A;  2AO9 A;  2GOM A;  3ABU A;  2XGD A;  3IP4 B;  4HA8 A;  2OQE C;  4PGH A;  1AA7 A;  1HU9 A;  2FNQ A;  2M45 A;  1STF I;  1IYY A;  4HW0 A;  3WTX C;  4XSX F;  3OYB A;  1HW1 A;  5FKO A;  4JF8 A;  4HOB A;  4L5I A;  4HLY A;  3F72 A;  4IEJ A;  1K4S A;  4CCL A;  2ZSI B;  3J80 Z;  2H27 A;  2IS1 A;  3DUK A;  5LGT A;  1O3S A;  1ZH5 A;  4RS8 A;  2DOD A;  5CLS A;  1W5T A;  4D7M A;  1V5G A;  2VT3 A;  5DRV A;  3NXJ A;  1S5L C;  4MQ9 F;  4BHP A;  4AD9 A;  3PXM A;  5ICG A;  1RGA A;  4G7Z F;  4NNJ A;  4ZYG A;  3K4J A;  1W0U A;  2QEX I;  2A61 A;  1FEX A;  3CNX A;  2STD A;  4HM4 B;  1B8I A;  2JSC A;  1U3E M;  2IA7 A;  3IAS 2;  1B2U A;  2V6E A;  1BI3 A;  3K2Z A;  5IPA A;  2XPU A;  2B24 B;  4E7K A;  1GVD A;  3VSL A;  1JRQ A;  1NO3 A;  5CYV A;  5DM6 F;  1ZG1 A;  4L5E A;  3S1N J;  3EBT A;  2V9V A;  2R4I A;  1SPU A;  3A1Y A;  3IRQ A;  4FMD A;  3U97 A;  4MFD A;  1R4M B;  1QRY A;  4Z6Y A;  4A3E J;  3H5R A;  5FW5 A;  2CHC A;  4E70 A;  3LSJ A;  4YFX F;  2FF4 A;  1K6Y A;  5F64 A;  4XQF A;  1H88 C;  3EUH A;  1BRI A;  4ESJ A;  4IHW A;  3FG4 A;  3ZN0 A;  3CCU I;  1LDD A;  2I9W A;  4KZ1 A;  2PMU A;  1BAN A;  1JXS A;  2ML5 A;  5C44 J;  3N4M A;  5CF2 A;  3OR1 C;  3EDP A;  1RZ4 A;  1Z6T A;  2YU3 A;  1CQS A;  2XHK A;  4Y4R A;  2VKE A;  1R22 A;  2ZJP F;  1OPC A;  3H9G A;  2IS2 A;  4ILF A;  1B72 A;  5KP4 A;  5LRS A;  1ZN2 A;  2L2O A;  5FD5 A;  4AVZ A;  3GTM J;  2ME0 A;  2PLY A;  3HRU A;  5BU4 A;  5TRD A;  3IHU A;  1YO5 C;  2XVC A;  1UCJ A;  1K9M 4;  1X1P A;  1YYV A;  3HRT A;  1BOA A;  2V1U A;  3I55 3;  3PUB A;  4LLG F;  3TW7 A;  3BIR A;  3HGG A;  3FLJ A;  2C4B A;  4KIF A;  4LSO A;  2Z16 A;  5LGN A;  2XIG A;  3Q90 A;  1TNT A;  2QWW A;  2XF6 A;  4ABZ A;  3H3H A;  5DTD A;  5AI1 A;  1YX3 A;  4UUT A;  3LT9 A;  4W1U A;  1FC3 A;  2D42 A;  4Q53 A;  2CIU A;  1CYU A;  1WVR A;  2ZA4 A;  2JA8 J;  4XM4 A;  3QU3 A;  4XLE A;  5ERI A;  3ZMS A;  1BU4 A;  2O3F A;  2OTL 3;  1MOL A;  3TO7 A;  4UUS B;  5A2Q Z;  3E7L A;  4UY8 I;  1VQK 3;  1B27 A;  3S3O A;  5FD6 A;  1VF9 A;  2WAE A;  3HB9 A;  1LVN A;  1L0O C;  1ETK A;  3SJM A;  3K70 C;  1N9E A;  3I9V 2;  2L3D A;  2RNT A;  2Z77 A;  3HUG B;  3TKY A;  2CV0 A;  1BW6 A;  2CV1 A;  2K9M A;  5EG0 A;  1ZG3 A;  1HF0 A;  2XAJ A;  2JDI H;  3UB1 A;  5JBS A;  1PUF A;  4PSX A;  5DD4 A;  2STT A;  1FP1 D;  2EWN A;  1H9G A;  3EYI A;  3LTA A;  1BRH A;  1R7J A;  1NH3 A;  1Q82 4;  4A5M A;  1VQN I;  5RNT A;  3E97 A;  1DPU A;  3M07 A;  2DYR H;  2WOF A;  2QQ8 A;  3ASO H;  2JTV A;  4IKF A;  5ICE A;  1GS3 A;  2BOL A;  4HSR A;  1OHP A;  1MBH A;  3GFM A;  4U87 A;  2JUC A;  1K41 A;  3CCQ I;  4HST A;  1GUU A;  1JKP C;  4Y13 A;  3A02 A;  3DLA A;  2CW8 A;  3C2G A;  1JT0 A;  1G3Y A;  2E19 A;  1HLV A;  3CP2 A;  2K4J A;  2F5M A;  1U8B A;  2H0H A;  1RNB A;  3CES A;  2JWT A;  1K61 A;  4L9N A;  1LOW A;  2QSF X;  4IRI A;  1ZGX A;  3EN1 B;  2FEZ A;  1Y0N A;  4M6Y A;  4DZJ A;  2W1O A;  5E3M A;  3K4K A;  4D0P A;  1IVU A;  2K9L A;  3R0J A;  1JI8 A;  2F5W A;  4DYR A;  2XRN A;  3S8P A;  1B1B A;  4GRI A;  4YII A;  5L3G A;  3JR9 A;  5AIQ A;  3J7Y J;  3R61 A;  1Y1W J;  4G9Y A;  1C7H A;  2M7A A;  4RB2 C;  1ODD A;  2VPL A;  2A69 F;  2VQG A;  3IH2 A;  4IXA A;  2VQL A;  5LLQ A;  4O6J A;  4N6L A;  1LFB A;  1XD7 A;  3TDZ C;  3CJN A;  4YFN F;  3F23 A;  5G1K A;  4J19 A;  3FBI B;  1LNI A;  1Q86 4;  1E3V A;  3BJ6 A;  3KE2 A;  2MBF A;  4IHV A;  1SAN A;  4WHA A;  5STD A;  4WF2 A;  1HKS A;  3RJP A;  3ZCO A;  1XPX A;  1LNW A;  3G73 A;  1M1X B;  1O7N B;  1IN6 A;  2OOV A;  2KQR A;  4EAT A;  3VF1 A;  3AHS A;  4I98 B;  5TGN A;  1S3J A;  2OCC H;  1ZYR F;  2CQX A;  1TW3 A;  1ETX A;  3LOY A;  3S16 J;  3ML6 A;  4BTX A;  3CNM A;  1YX5 A;  2DA4 A;  3H1C A;  4KN4 X;  3IV5 A;  2Y9Z A;  4RBN A;  3DU6 A;  5D83 A;  3VGN A;  3N05 A;  1AVK A;  5GPA A;  2WY7 Q;  2GBY A;  2HR3 A;  2R3S A;  1I39 A;  2ECC A;  2HMJ B;  5C3E J;  2R7V A;  4I01 A;  1EV7 A;  4ZZL A;  4OIP F;  1QVF 2;  1OH0 A;  4O2H A;  4CJN A;  2E1O A;  4XBT A;  4RAY A;  1RGE A;  2EFN A;  3KX2 A;  3MHE A;  2DW4 A;  1K73 4;  2IGM A;  3HII A;  3OSF A;  1LE8 A;  1PUE E;  1A6I A;  5B1B H;  1STD A;  3PFY A;  2DDB A;  3U1D A;  4L18 B;  1DU6 A;  3KKG A;  1X1A A;  3JTG A;  2EV0 A;  4XOR A;  3KEO A;  1PFP A;  2VB6 A;  4CGZ A;  2XGC A;  4YEL A;  1OR7 C;  5E79 C;  1T8I A;  5HLG A;  3E1S A;  1SVO A;  4AWX B;  3ROB A;  4C2T A;  4MNU A;  3S15 J;  1UW1 A;  2XAU A;  4ENJ A;  3OIQ A;  3NAU A;  3FXO A;  5JHU A;  2RCD A;  9ANT A;  5EEO A;  2CFO A;  1HW2 A;  1UMQ A;  1MH3 A;  2KIQ A;  1YRN A;  4QPQ A;  2PX9 A;  1P6R A;  2KKO A;  5EDN A;  3S2H J;  3LOC A;  1RRJ A;  1JBR A;  1GOY A;  1U2W A;  1YJ9 3;  3MWM A;  3EET A;  3FIW A;  3CMA 3;  2ML6 A;  3U1W A;  5KP3 A;  2ACJ A;  2VKD A;  2V1X A;  3LML A;  3TL4 X;  2JA5 J;  3K69 A;  1JHF A;  1SEU A;  2F4I A;  3CMY A;  3F8X A;  1TTY A;  2VN2 A;  4NQW B;  1B59 A;  2Y2Z A;  3KPH A;  5B1A H;  2X1C A;  4FMA A;  3SDG A;  3CCL 3;  4XKC A;  5IP7 J;  5KAF C;  1GVJ A;  3DEW A;  3GZ5 A;  3L00 A;  4TV7 A;  1YIJ I;  1IF1 A;  2M7O A;  4C2M J;  1FA3 A;  4HX7 A;  2CFL A;  2VBW A;  2EJR A;  2IMJ A;  3N97 A;  1W4M A;  3LZA A;  3CF5 F;  2KIM A;  3CC2 3;  2NVQ J;  3ZP5 A;  1KYW A;  2K86 A;  3OWU A;  2P38 A;  3ONQ A;  2F2E A;  1BUQ A;  3FX3 A;  1Z3Y A;  5IEN A;  3LTC A;  3DBL B;  3MEX A;  2HDD A;  2EH3 A;  4IHX A;  4Q4Z F;  2HMM B;  2CO5 A;  2DA1 A;  4CDL A;  2SBL A;  3RGR A;  2OQG A;  2UUG C;  1LNH A;  4ENN A;  1S7E A;  1EKE A;  3OYC A;  2QQB A;  3KLN A;  2I8D A;  2BIR A;  4R9K A;  5DS9 A;  2BMR B;  1XCV A;  2IW5 A;  1OF5 B;  2GA2 A;  2L7F P;  2XKP A;  3LFU A;  1RGG A;  1ZAO A;  4KMU X;  1TU5 A;  1MBG A;  3J81 Z;  2Z99 A;  1YJN 3;  1LOY A;  3I56 I;  3F3X A;  2BHY A;  3LYG A;  3CO7 C;  4STD A;  2IA1 A;  1CH0 A;  5DCM B;  4EMS A;  3FXM A;  5HDG A;  1HKX A;  2IP2 A;  1A04 A;  1XSV A;  4NUB A;  4BAC A;  4TX4 A;  3ABM H;  3COA C;  3H9J A;  1LEB A;  1OYI A;  3AG1 H;  5FRN A;  4QLC U;  1B2S A;  4XLH A;  1IAW A;  1Y1V J;  1RN4 A;  1KU7 A;  3JRG A;  1I3Q J;  2Z6B A;  2WAF A;  2Y0S N;  1VQ8 I;  1KYZ A;  2M5W A;  1UCK A;  3OMY A;  4XMY A;  5GAE J;  3RDI A;  2Z76 A;  6RNT A;  1FW7 A;  2ICW G;  2LRD A;  4F92 B;  1ROA A;  2A3S A;  2ADU A;  5EZH A;  4RNT A;  2A6E F;  3ZGK A;  2E34 A;  2GBW B;  1J0R A;  3IH3 A;  2DYS H;  3GWZ A;  5D4S A;  1HC8 A;  4FCZ A;  1T6S A;  1V55 H;  2R7D A;  4M3E A;  1E17 A;  1EF4 A;  1N5P A;  4R8H A;  1N9J A;  1Q7H A;  3RNT A;  2EZH A;  3FHZ A;  1FT9 A;  3QPL A;  3OS2 A;  4Q5S F;  4U13 A;  4XOP A;  1RES A;  3WHC A;  4O3M A;  3M7G A;  4FCM A;  3OW2 2;  6STD A;  2R5Z B;  1KC8 4;  4XL9 A;  4BTY A;  5IP9 J;  3LAP A;  3PSI A;  4ZDL A;  4A3F J;  5FKK A;  1UZC A;  3DKY A;  4LG3 A;  2L54 A;  3MN2 A;  2NRA C;  1YVB I;  3BDD A;  3MCZ A;  3H0G J;  4RGS A;  4IOC F;  4XKV A;  1AOY A;  4PDK A;  4J00 A;  1LDJ A;  4BQO A;  1DGR M;  1U5O A;  4KFF A;  5I97 A;  3VWB A;  2VIX A;  1V54 H;  2O8K A;  3A01 A;  1I6H J;  3FSD A;  4OOI A;  2CUF A;  4QTR A;  5EGO A;  1RKT A;  4PJL A;  1P2F A;  4LMI A;  3CCM 3;  1UGH I;  2VON A;  4A5N A;  1JT6 A;  5TIS C;  4Q47 A;  5H6R A;  3S2D J;  2EZK A;  3S1R J;  1GYB A;  1MKM A;  4LLN A;  2KJB A;  1IJW C;  2QCO A;  1SVM A;  1S72 3;  3K9T A;  1WJ5 A;  1YNV X;  3LQR A;  2DFI A;  2OCE A;  3TGN A;  5K1Y A;  1O7W B;  4I76 A;  3FG3 A;  2GU1 A;  1GLN A;  4IZZ A;  1DU0 A;  1FLI A;  3F14 A;  1U78 A;  1J2X A;  2JA6 J;  4G8X A;  3D5R C;  4RA2 A;  2NS0 A;  4ZYH A;  3KP4 A;  3BTL A;  2CW7 A;  4HG2 A;  3HOS A;  4CUG A;  1I5Z A;  1IW7 F;  3ZG5 A;  5DV5 A;  2MH2 A;  2UXX A;  2W24 A;  1Z1S A;  4WWU C;  2MLG A;  4Y3O A;  3WTT C;  1TQI A;  1VQ7 3;  5CVU A;  2DOF A;  5LRR A;  1IXR C;  1JUM A;  2QUF A;  4CA0 A;  2KRC A;  4YEJ A;  3K0Z A;  1ISK A;  4J9A A;  2JVG A;  2LR8 A;  2PFB A;  2K3F A;  1X2M A;  3MAJ A;  5J3L A;  4OVM A;  1PJR A;  3OR2 C;  4AIH A;  2QBY B;  4XIC A;  1TP6 A;  1W02 A;  2BT3 A;  3HK4 A;  5H6Q A;  2B63 J;  4ITV A;  4BE2 A;  3I53 A;  3OXA A;  2DJN A;  3BR5 A;  1OJL A;  3RSN A;  1K78 A;  1QZY A;  4E6K G;  2HML B;  4CYC A;  1ZGA A;  1RPW A;  2JPC A;  4U7B A;  2RNJ A;  2Y0M A;  2CSO A;  5LEJ A;  3GUD A;  3S5C A;  2R7Z J;  7RNT A;  4HAA A;  5HOD A;  3TP0 A;  1S29 A;  1ROV A;  3MKW B;  3TP3 A;  4YIF A;  3G8Z A;  1N5H A;  3PJR A;  1BNG A;  1D0Y A;  1JZO A;  2XRL A;  1BI1 A;  4FT8 A;  2HQR A;  1O7H B;  3G16 A;  4G6T B;  3DGN A;  1XN7 A;  2P5K A;  1G3W A;  2IA0 A;  4B1R A;  2ZFW A;  3OOP A;  3QPT A;  1TT0 A;  2O8X A;  2DAO A;  3KP2 A;  4BL2 A;  4B44 A;  3DH2 A;  3G1M A;  1VQL I;  2QYO A;  1RGF A;  2W56 B;  4HQM A;  1NNV A;  4BBR J;  3T0Y A;  4ESF A;  1TT5 B;  5HLH A;  1DE3 A;  5CF1 A;  1EH7 A;  4F55 A;  1P4X A;  1R00 A;  1SMT A;  3Q0V A;  1YHQ 3;  3VOE A;  2JRM A;  4XRM A;  2Y48 A;  1QZZ A;  2LY1 A;  1LOX A;  1BJZ A;  3HBL A;  2GU3 A;  3F0C A;  2LYX A;  2XAG A;  1UI7 A;  3ABT A;  3OYH A;  4KFD A;  2PBI A;  2VC1 A;  1JB4 A;  3KLO A;  1WKM A;  4KJZ A;  3W6K B;  1B4A A;  3ZMZ A;  1WH7 A;  3KCC A;  3TMO A;  1IRX A;  2L4V A;  2PMZ A;  3GCM A;  2CWT A;  3MZY A;  2W9P A;  1FSH A;  2W04 A;  1LPQ A;  4BAY A;  1TUH A;  2A15 A;  3KP7 A;  4M6X A;  4MEX F;  2VUM J;  3RPU A;  1XCB A;  4QWQ A;  1B2X A;  2GBX B;  1BSD A;  3NHX A;  3C18 A;  1SFE A;  2BY0 A;  1G8X A;  2BY1 A;  2QZ8 A;  2VKV A;  2OWP A;  2YX4 A;  1QZE A;  4LB5 A;  4K90 B;  3RIR A;  2LNB A;  2DPD A;  2KF3 A;  2ZKZ A;  5K5Q A;  4HQE A;  1GOU A;  2CFD A;  4N9H A;  2VAS A;  3MVP A;  3B02 A;  3K2A A;  3I0Y A;  3BC8 A;  3G71 3;  5IYC J;  3ER7 A;  2ZJR F;  2W2C A;  3PCR A;  5D81 A;  1ZLJ A;  3RKW A;  5BPI A;  3WGG A;  4XOT A;  4N6O B;  1NG7 A;  1X4O A;  3EUH C;  4HX4 A;  5M5Y J;  1A2K A;  3ZQ7 A;  1GHC A;  2WB1 N;  1DMN A;  2XGL A;  1WMP A;  3QYB A;  3FXL A;  2DA3 A;  2CQQ A;  4HJL B;  4LIU A;  5ED4 A;  2EZL A;  1ZR2 A;  1GSP A;  1TC3 C;  2WOH A;  3N8B A;  1OYW A;  3S27 A;  2YR2 A;  2I10 A;  2VOP A;  2RRE A;  2N8G A;  2R7Q A;  5CK6 A;  3JSP A;  1MJA A;  4R80 A;  3BP8 A;  1X3Z B;  3EQL F;  2DA5 A;  4XBF A;  4D1Q A;  2CWE A;  2G7U A;  2LRE A;  3H5A A;  3BT9 A;  5BIR A;  3FK7 A;  3AG2 H;  2R7F A;  1T38 A;  4JX6 A;  4V2F A;  1MIJ A;  2D1H A;  4MEI A;  3OIO A;  1ZO2 A;  2H09 A;  5TGT A;  4A3I J;  1SAU A;  4ANJ A;  4BXX J;  2V1N A;  2VBY A;  2HPM A;  3CP8 A;  2XPV A;  1DQU A;  1XMX A;  3A2K A;  3WU2 C;  4D7N A;  3K6G A;  1YFH A;  2R7O A;  4KIS A;  3BB9 A;  2E2H J;  1H0M A;  3NWT A;  1OYY A;  1ULJ B;  1JB5 A;  2X1D A;  3RQI A;  1CF7 B;  3RYR A;  2LD5 A;  4GYG A;  1UI8 A;  4XLP F;  1ITY A;  1JTY A;  3JUQ A;  1XTA A;  3DBH B;  2HTS A;  4CHU A;  3HPH A;  5FLX Z;  3FHN A;  1FGQ A;  5HNH A;  2IVM A;  1J59 A;  1FY7 A;  1QPM A;  1TL8 A;  2EB7 A;  2LG4 A;  3PCS A;  3LAJ A;  1VQ4 3;  5L3E A;  4X0G A;  2BO9 B;  1MMN A;  2DO7 A;  4BS9 A;  3M4O J;  4B3A A;  2A6H F;  4D9J A;  2P5L C;  1SD5 A;  3C3W A;  3DPL C;  3I55 I;  4HRI A;  2CFG A;  4XRF A;  2O6G E;  3LTB A;  5CXO A;  3ZPL A;  1H9T A;  2RAE A;  3LMM A;  4BU2 A;  3ERM A;  4HF1 A;  2BMO B;  3KE7 A;  4LK0 F;  1D6Z A;  4PJ0 C;  3I59 B;  3GTK J;  1J7K A;  5EVH A;  1S7O A;  1VFC A;  3URP A;  3BLZ A;  2ZME B;  2Z7A A;  1U5T B;  2R7W A;  3BR6 A;  3D5S C;  2JPB A;  4II2 A;  3OYM A;  2BVL A;  2BZT A;  1YI2 3;  1MGT A;  1VQQ A;  1JJ2 2;  4I4K A;  3CZ6 A;  2K40 A;  4M73 A;  4PFP A;  1SQW A;  4ZYE A;  2LTP A;  4A6D A;  1IVW A;  2CUE A;  4G7O F;  3ZQL A;  3PNT A;  2O9L A;  3HOV J;  2P6T A;  2QA4 I;  4OIQ F;  1JN5 B;  2RGV A;  4HZ9 B;  4ENK A;  2OC6 A;  1VQK I;  2HXO A;  2NYX A;  3GW2 A;  3J7A O;  1BOX A;  1I3F A;  2R5Y B;  1RHL A;  3SYU A;  2RFR A;  2F5D A;  1SFX A;  4CCV A;  2CH9 A;  5IOY A;  4RNY A;  1EEJ A;  3KP5 A;  4U88 A;  2HS5 A;  1HA8 A;  1QNT A;  1ZAR A;  2NS7 A;  3FDY A;  1MH4 A;  4HV6 A;  1VQ9 3;  5GP9 A;  2R93 J;  3OS0 A;  2ZBK A;  3DKX A;  2HVS A;  5D4R A;  2HOE A;  1IT8 A;  3VYT B;  3UR3 C;  2E1M C;  1Z7L A;  1YE9 A;  1BVI A;  1OPY A;  4DOZ A;  2J5O A;  1ZEL A;  3L2C A;  4BTW A;  3I4N J;  1DVC A;  2X6Y A;  4A3C J;  2VQC A;  3LST A;  1MNE A;  4LLL A;  1IUF A;  5JPU A;  2DK5 A;  2HYG D;  3WHB A;  5HDN A;  1RLS A;  4EYC A;  1XSX A;  1W7C A;  4HM3 B;  1W6G A;  3WTW C;  4EXR A;  2W6J H;  4GB5 A;  3E6D A;  4V2G A;  2RVC A;  2VJI A;  4BEH A;  2XKO A;  4QWT A;  4PK4 A;  2PJR A;  2M0C A;  5K5O A;  2FXT A;  2YFL B;  3GTJ J;  3K4C A;  2MLK A;  3VEP A;  1TLH B;  3OYE A;  3KZI C;  2HFH A;  3HUG A;  2HQ5 A;  3FBN B;  1UST A;  4PJJ A;  5JHF A;  1K8A 4;  2MC8 A;  1X1U A;  1FMV A;  1TW2 A;  5LC6 A;  1XB4 A;  3O3K A;  4GSP A;  3HRS A;  3J7Z I;  4MGR A;  2WAQ A;  2KRF A;  1IN5 A;  5CPR B;  2OOV C;  3K7C A;  4NHF A;  4P1W A;  1KQ0 A;  1ETY A;  2A5W A;  3G3Z A;  1G2H A;  3CJT B;  3E3V A;  5M3M J;  1BBY A;  3KZY A;  3FXU A;  1JKR C;  4A6E A;  2XAS A;  1Z9C A;  3G2B A;  4XON A;  5C4X J;  5J1Y A;  2IEK A;  3E5U A;  4UVC A;  3TDG A;  5AEW B;  3FXQ A;  1H89 C;  2HGC A;  1F1Z A;  2HYJ A;  1FTT A;  3SZT A;  2XR8 B;  1JHH A;  3ZQI A;  4EC6 A;  4MIM A;  2FSW A;  3F6V A;  1I27 A;  1RMS A;  3BZ6 A;  3EPZ A;  1J9I A;  4FCJ A;  2CQN A;  5CKT A;  3Q1C A;  2KT0 A;  5IG5 A;  4IOA F;  2DBB A;  2BY2 A;  3I64 A;  3G4S 3;  3RI4 A;  3CME 3;  1YLF A;  5K5R A;  1X19 A;  2GOX B;  4OIN F;  3PS8 A;  1FBU A;  1MMD A;  1Z0X A;  3RCO A;  2NVT J;  1OCV A;  3JRI A;  5EEH A;  2HQN A;  2QVO A;  2FGT A;  1TNS A;  2P81 A;  4NHJ A;  4HEA 2;  4HNT A;  2F56 A;  2CV2 A;  2IA2 A;  1ZRD A;  1SFK A;  1WHU A;  2W85 A;  2IGN A;  2VJ5 A;  4KUM A;  4UXN A;  1UUG B;  4WP5 A;  2FJ1 A;  3D4A A;  2L02 A;  5K7Z A;  5AIF A;  1U0J A;  1P4A A;  4II3 A;  3GZY B;  1B20 A;  5AON A;  2ISY A;  1QAF A;  4BJ5 C;  4O3V A;  1MMG A;  2HPI A;  4HM6 B;  4GYI A;  3CCS 3;  3BND A;  3JVC A;  2GEX A;  4C30 A;  4UV8 A;  3OYF A;  3DEU A;  3BNB A;  1W7P B;  2CKF B;  1ZRC A;  1BRK A;  4Y52 J;  4JRF A;  3RPU D;  2LBF B;  1HDP A;  3GVA A;  2HVQ A;  2LLK A;  4M9Z A;  5D5W B;  1ZGW A;  2D1W A;  3KCH A;  2H8W A;  1IC8 A;  2XAQ A;  5JFR A;  4I2O A;  5HLT A;  3M8E A;  3BRO A;  3HSE A;  1LKX A;  4IHY A;  2L9N A;  1IV6 A;  5JLW A;  4A3L J;  1QVU A;  1G96 A;  2WV0 A;  3LA2 A;  2EQR A;  1PP7 U;  3F7X A;  4FTH A;  5FRM A;  2GEY A;  2GIZ A;  4BQQ A;  4BYY A;  1IRZ A;  2ISZ A;  4K1U A;  4LYL B;  4IX7 A;  1XSD A;  3L0R A;  5LFA A;  3I58 A;  4A3G J;  2P0M A;  3CCE 3;  1Y8Q B;  5IT9 Z;  3DPU A;  2LVS A;  3E6M A;  1IQX A;  1JKG B;  1XGM A;  4UVA A;  3TBI A;  1YJ9 I;  4XDW A;  4YIR X;  3OYI A;  3CMA I;  3DFG A;  2GLO A;  1A67 A;  1LOV A;  3RZO J;  4AYB N;  3JRD A;  4HBR A;  1IV9 A;  1RCK A;  3O6B B;  2ID6 A;  2MYS A;  4RZM A;  1D0Z A;  3B4P A;  5A0O B;  4P55 A;  2OBP A;  1P92 A;  1QU3 A;  1UB9 A;  1BW5 A;  2CK3 H;  1D6U A;  3ZQQ A;  3CQZ J;  4U0Y A;  5JLX A;  1G6N A;  2HOA A;  3OV8 A;  3BY6 A;  4RGU A;  1GXP A;  1SMY F;  3DCF A;  2FBK A;  1SD4 A;  2NXN B;  2O7O A;  3ELK A;  4FHT A;  4IRG A;  1HBX G;  2QIY A;  1RRH A;  4KT6 A;  3AL0 B;  3BTI A;  3OYG A;  3CC2 I;  3FF2 A;  4E7S A;  4FR9 A;  1E0E A;  3TO6 A;  1G3S A;  2X6X A;  3DQV C;  4S04 A;  2QLZ A;  2DFF A;  1ON2 A;  3DF8 A;  4H61 A;  2QGU A;  4IVN A;  3EF8 A;  2DXI A;  3ZMU A;  3IPT A;  3SXX A;  4HM8 B;  5FJ8 J;  2IPQ X;  1UCL A;  5AII A;  2K27 A;  3CD6 3;  2R92 J;  2GIV A;  4MEY F;  2HYF A;  2ELK A;  3NAR A;  4OIR F;  3BWG A;  5LEK A;  3ECH A;  4BXF A;  3ZRG A;  4ENM A;  2FXA A;  1IG7 A;  1MWS A;  3WDG B;  1IVV A;  3PYJ A;  1X4P A;  4LG0 B;  4NQW A;  4MTE A;  4M9X A;  3TOA A;  5HOO A;  1SJW A;  1XGO A;  1FZU A;  1R5H A;  4RAG A;  3VSK A;  2MA3 A;  2DT7 B;  2XV4 S;  3PO3 J;  1KQ8 A;  1R9T J;  2P7V B;  1IRF A;  2OD5 A;  4WXH A;  3GAX A;  3Q3S A;  4CXF A;  3L2W A;  3M1C A;  1FOY A;  3BOQ A;  1YJN I;  3IRR A;  2BNG A;  2CUZ A;  5FGO A;  4IPB A;  2JQ7 A;  1LQM B;  3OV4 A;  1FBS A;  2IUJ A;  1F4K A;  3H0D A;  4BNC A;  3HOZ J;  2G7H A;  5FKL A;  3CDH A;  3GX4 X;  1EH8 A;  4AUX A;  1B72 B;  2UGI A;  1UJ8 A;  3DTI A;  3WE3 A;  5DDG A;  1MD0 A;  3JSO A;  4I09 A;  2L9R A;  3PNY A;  3CCR 3;  3IH4 A;  3R4K A;  3HOT A;  1ERD A;  4KIB A;  3IMA B;  4FMC A;  4HX8 A;  1WRJ A;  3CUQ B;  3WOF B;  2FMY A;  4MQV A;  4FX4 A;  3VB2 A;  3CCY A;  4L9V A;  1IN4 A;  4AM3 A;  1YGE A;  1OF5 A;  3EE1 A;  1CGP A;  3K5T A;  1JGS A;  5F1R A;  2A5Y B;  2ZHX B;  3QAH A;  2H94 A;  2GXB A;  2FML A;  3SVA A;  2K9Q A;  5DD8 A;  5AEU B;  3GFJ A;  3ZR8 X;  2W00 A;  5KCM A;  3CCU 3;  4IQJ A;  2ZNY A;  2L0K A;  3BG9 A;  2OUM A;  3CPO A;  1TRQ A;  1Q1V A;  4GDF A;  1AY7 A;  5DCM A;  4NC8 A;  4JYK A;  3OWT A;  5LD2 C;  3D5G A;  1VQ5 3;  2HNH A;  2KIU A;  1FZP B;  2INX A;  1DDN A;  4E7Z A;  5D5X B;  2Z33 A;  1NHA A;  2PJP A;  2WO0 A;  3H51 A;  1TWA J;  1JKO C;  1REP C;  1Y8R B;  3PUF A;  5IW9 A;  1BNF A;  1NDO B;  1IQ8 A;  2KF6 A;  4P96 A;  1I70 A;  2BXZ A;  4KMF A;  4L8P A;  3AG3 H;  4BY1 J;  1ZQ3 P;  4XB5 A;  2X9D A;  1GXQ A;  1N75 A;  4LZI A;  1YW9 A;  3LSR A;  5JR3 A;  2CQ7 A;  3NQO A;  2F6C A;  2Q07 A;  3H3Z A;  4EJT A;  2O03 A;  1WQL B;  1AHD P;  1ZLK A;  2CWU A;  3RPQ A;  4J8T A;  3AMO B;  1FTZ A;  2FOW A;  1S72 I;  4HYZ A;  2EBI A;  1T0F A;  2EIJ H;  4M3B A;  2R5Z A;  3CJR B;  2EFO A;  2DU9 A;  4BUP A;  4RB3 C;  4K2E A;  2FNP A;  2CUJ A;  2LY9 A;  2XSH B;  1P4W A;  3SOY A;  1KU3 A;  4ZTF A;  3VYS B;  4L7K A;  1OCP A;  1MMS A;  5M5X J;  3PFI A;  2F4Y A;  2O0Y A;  3BG6 A;  2Q2E B;  1JTX A;  4RM3 A;  4CCK A;  3GFI A;  2EIM H;  4N6N B;  1Q81 4;  1A36 A;  3EC9 A;  2LSO A;  3JRE A;  1X3W B;  2ESH A;  2KF4 A;  4E7L A;  1X3U A;  3QPS A;  3DGM A;  3CCV 3;  4HF2 A;  1VQ7 I;  3HTS B;  1F36 A;  3S2W A;  1SAR A;  1R71 A;  3D3L A;  4G6D A;  3O2P E;  4KN7 X;  1F5T A;  2KRH A;  4J01 A;  4A93 J;  5GAH J;  3GZ6 A;  1PVE A;  5J4Y A;  3TDU C;  1VQN 3;  2W9Q A;  1UG2 A;  1ZR4 A;  1ZRF A;  1G4D A;  3KSP A;  3OWY A;  4L8O A;  1R5G A;  3QQA A;  4WFO A;  1D0X A;  5F6F A;  5D5U B;  2ZSH B;  4BIR A;  3GTQ J;  1X1W A;  3CCQ 3;  1Q40 B;  3K1N A;  2LF7 A;  1LUJ B;  1D5V A;  1GY7 A;  1VI0 A;  3LA3 A;  4S05 A;  5D5V B;  1X1B A;  3A0H C;  5J47 A;  3CC7 I;  2Y74 A;  3ZOB A;  4HDV A;  5JVT A;  1WI9 A;  4BL3 A;  3WG9 A;  4RBO A;  1GD3 A;  3HOX J;  1OLT A;  2F48 A;  1LEA A;  2XSJ C;  3WTU C;  3X3Y A;  3ZQF A;  2EIK H;  2NNN A;  1VQP I;  3JRB A;  1G3T A;  2QBY A;  2VOO A;  1J2B A;  4HVN A;  3PSF A;  1K79 A;  2H1K A;  2EV6 A;  3C1D A;  1QAL A;  1R1T A;  3D5L A;  3ZN1 A;  2HOT A;  3LWF A;  2L9V A;  4XLA A;  4A0Z A;  2LF8 A;  5CVV A;  1B3S A;  2WC2 A;  2UZK A;  3S28 A;  1TIJ A;  2MC4 A;  3IWF A;  1R6R A;  1AVL A;  1FGO A;  1VQ6 I;  4H3U A;  4I0A A;  4FQG A;  2NVY J;  4BL0 B;  2UXN A;  2WGO A;  2BEO A;  1X1D A;  5ILU A;  5FLM J;  1OMI A;  5F0H A;  1BIA A;  4LFU A;  5GAD J;  3X3Z A;  4F52 A;  5EZG A;  1WJF A;  3RTR A;  3QP5 A;  4PZJ A;  3SXY A;  1J75 A;  3DP7 A;  4OIO F;  2BU4 A;  3EBY A;  4KVH A;  3EUK L;  3OX9 A;  4L5J A;  1V58 A;  1QQI A;  1RRL A;  3C7J A;  2C6Y A;  4B4C A;  5L3C A;  2HXI A;  3CLQ A;  1POG A;  1BNS A;  1BI2 A;  3IAM 2;  3L2U A;  3W2A A;  3PL8 A;  1NU3 A;  3GLL A;  3U21 A;  1KU9 A;  1EQK A;  1A31 A;  2P09 A;  4KIT B;  2KJC A;  2E5N A;  2DI3 A;  2NOJ B;  3JAM K;  2ZC2 A;  2W56 A;  1YRN B;  1CYV A;  2Z3Y A;  2K0M A;  2R0Q C;  1HCR A;  1SD6 A;  4PUS A;  3F8N A;  1K83 J;  2ZB9 A;  1E2X A;  3M9A A;  2W48 A;  2HU9 A;  3CDI A;  1RN1 A;  3HI7 A;  3G71 I;  5F27 A;  1EJ9 A;  1OCO H;  1TWF J;  2TDX A;  3GME A;  4ASN A;  3FXR A;  1LVK A;  4EQQ A;  4FCY A;  4UUV A;  3DM8 A;  2LKX A;  4BKX A;  3CC4 3;  3GZN B;  2JA7 J;  1J5Y A;  2IXS A;  4G6Q A;  1RN7 A;  5E8I A;  4F7Z A;  5J4V A;  3FGY A;  4KT5 C;  2R4G A;  3T8N A;  1NB3 I;  1W5S A;  4EJV A;  1BC7 C;  3RKQ A;  2ZXW H;  2MGQ A;  3AGO A;  2FQ3 A;  3J80 K;  1U8R A;  4IHT A;  3I4P A;  2PZV A;  1TQP A;  2VI6 A;  4F93 B;  1FOX A;  4FX0 A;  2DQR A;  3OYJ A;  2M34 A;  4BQA A;  2HZT A;  3ZQH A;  3EQQ B;  3HIF A;  3HDD A;  2XH9 A;  5AIG A;  1KU2 A;  1MMA A;  5M18 A;  3Q2P A;  3KZT A;  2WAD A;  4FE7 A;  1V5E A;  1GMP A;  1A90 A;  4H0E A;  2IS4 A;  5BPD A;  1JNQ A;  1FBQ A; 
#chains in the Genus database with same CATH homology
 1FGQ A;  4R9L A;  4PEJ A;  4O8S A;  1PU4 A;  3Q90 A;  2LQV A;  3EN8 A;  3H3H A;  1VQ4 3;  3PCS A;  1DMM A;  5AI1 A;  2BO9 B;  3LT9 A;  2D42 A;  4Q53 A;  2CIU A;  1CYU A;  3VSY A;  3LTB A;  2CFG A;  4XM4 A;  2OTL 3;  5CXO A;  1YIJ 3;  3HX8 A;  3MG2 A;  1MOL A;  3KE7 A;  2BMO B;  3K63 A;  1D6Z A;  5EVH A;  5AYR B;  5LC7 A;  1VQK 3;  4HM7 B;  1LVN A;  3BLZ A;  5IEO A;  2Z7A A;  3SOA A;  4LGQ A;  3WA2 X;  1N9E A;  1YI2 3;  3F8H A;  1JJ2 2;  4I4K A;  2Z77 A;  3MKI A;  3PZW A;  1SQW A;  1IVW A;  3FCS B;  3WA3 A;  1JN5 B;  4HZ9 B;  1YIT 3;  2JDI H;  3UB1 A;  5JBS A;  1OGX A;  2KRT A;  4GL6 A;  2RFR A;  3LTA A;  4OK0 A;  4CCV A;  2CH9 A;  4RNY A;  1Q82 4;  1W4N A;  2WOF A;  2OCT A;  3SX1 A;  1VQ9 3;  1GS3 A;  3EX9 A;  4ZM8 A;  1IQY A;  1OHP A;  2KCD A;  2PNC A;  1O7P B;  1IT8 A;  1CEW I;  1OPY A;  1UUV B;  1K41 A;  3S29 A;  4BTW A;  1DVC A;  1WMO A;  1DVD A;  3A76 A;  3LXU X;  3LTD A;  5JPU A;  3N54 B;  1A2V A;  3CU3 A;  1W6C A;  4EYC A;  3UJM A;  3EN1 B;  1W7C A;  4HM3 B;  1W6G A;  1W6Y A;  2W6J H;  4EXR A;  4GB5 A;  1QMA A;  3ALA A;  1YJW 3;  1IVU A;  2E2T A;  4QWT A;  2HMO B;  2FXT A;  2YFL B;  4N6T A;  3JUP A;  4X2O A;  3X40 A;  1F8N A;  1K8A 4;  1VZZ A;  2MC8 A;  5LC6 A;  1C7H A;  2F99 A;  2P0X A;  3F7S A;  5AIH A;  2CG0 A;  3CXC 2;  1N8R 4;  3K7C A;  2OOV C;  4NHF A;  4N6L A;  4K61 A;  4HM5 B;  1FGM A;  1RKY A;  1KSI A;  1KWI A;  5D82 A;  5IF6 A;  3SED A;  1Q86 4;  1ZX2 A;  1E3V A;  3HIG A;  4IIA A;  3TDG A;  2B1X B;  5AEW B;  4WHA A;  3NM2 A;  3GRD A;  5STD A;  1EKM A;  1M1X B;  1O7N B;  2XGN A;  2XR8 B;  2WGQ A;  2OOV A;  3VF1 A;  4EC6 A;  5TGN A;  4FCJ A;  1M90 4;  5AYS C;  3LOY A;  3Q1C A;  3UL6 A;  4BTX A;  5IG5 A;  3CNM A;  4RBN A;  3VGN A;  3E99 A;  5D83 A;  3G4S 3;  1AVK A;  3FKA A;  1N8Q A;  5ELJ A;  3CME 3;  4ORL A;  2HMJ B;  3PS8 A;  1W2B 2;  1OCV A;  3LT8 A;  1QVF 2;  3MSO A;  1OH0 A;  2FGT A;  4O2H A;  4XBT A;  3T8U A;  7STD A;  3D9R A;  3MHE A;  5BXQ A;  1K73 4;  3X42 A;  4WP5 A;  3HII A;  2BHM A;  1US1 A;  3MWZ A;  1R4C A;  1STD A;  2CFK A;  4MMZ B;  5AIF A;  4IT7 A;  3KKG A;  3GZY B;  1QAF A;  1M9G A;  1PFP A;  4O3V A;  3KII A;  2XFS A;  4HM6 B;  3CCS 3;  3BND A;  1EG9 B;  3JVC A;  3ROB A;  2GEX A;  2UX0 A;  1UW1 A;  1UUW B;  3FF0 A;  3BNB A;  2W03 A;  2CKF B;  4EBG A;  1SII A;  3J7Y d;  2RCD A;  3NV0 B;  4JRF A;  5ELU A;  2K54 A;  5EQL A;  5EEO A;  1IV7 A;  1L5G B;  2OTJ 3;  2D1W A;  2YX9 A;  1OHO A;  1D6Y A;  3F9S A;  1JB2 A;  1YJ9 3;  3CMA 3;  5IEP A;  2ML6 A;  1G96 A;  3MYT A;  4N6V 0;  3U1W A;  5KP3 A;  5BVB A;  3B8L A;  3F7X A;  5KP1 A;  1FGR A;  2GEY A;  3BNC A;  1IDP A;  3OX9 A;  3K9M C;  3DMC A;  3F8X A;  3GZB A;  2F86 B;  4K1U A;  3CCE 3;  2C11 A;  3L0R A;  4FMA A;  2C10 A;  2P0M A;  5IG3 A;  3CCL 3;  4XDW A;  1IQX A;  1JKG B;  4N6M A;  1VQM 3;  3PGB A;  1A67 A;  2M7O A;  2YFI B;  1RJO A;  4HBR A;  1IV9 A;  2CFL A;  1FA3 A;  1E3R A;  2IMJ A;  4RZM A;  1T5Y A;  3LZA A;  3B4P A;  1QJG A;  5A0O B;  3CC2 3;  4K1V A;  3OWU A;  1NWW A;  2P38 A;  2XF3 A;  2CK3 H;  4R4K A;  1BUQ A;  1D6U A;  1ULI B;  5IEN A;  1WNH A;  3LTC A;  3CC7 3;  5CLK A;  3GZX B;  1Y4K A;  2HMM B;  4CDL A;  2SBL A;  4NRE A;  3I56 3;  4X2H A;  3NV0 A;  3RGR A;  2QIY A;  1RRH A;  1LNH A;  8CHO A;  3B4O A;  1K28 A;  3FF2 A;  4FR9 A;  4HKV B;  4R9K A;  4XBX A;  2BMR B;  1VQP 3;  2MF7 A;  3EHC A;  4H61 A;  1OF5 B;  2ZL8 A;  3EJV A;  2QGU A;  3EF8 A;  3IPT A;  3SXX A;  1TU5 A;  1Q7Y 4;  4HM8 B;  3CD6 3;  5AII A;  3FZW A;  3EB8 A;  1GY6 A;  1YJN 3;  1VQ8 3;  3LML A;  1VQ6 3;  1OHS A;  3CPW 2;  3WDG B;  1IVV A;  3LYG A;  3PYJ A;  4STD A;  2W0Q A;  1SJW A;  2CFW A;  3JUM A;  1AV4 A;  1DMQ A;  1JKG A;  1HKX A;  1IK3 A;  4TX4 A;  3GAX A;  2F98 A;  1U5O A;  1OAC A;  3KN4 A;  1JN5 A;  2RSX A;  2Z6B A;  1KQS 2;  2BNG A;  5FGO A;  4IPB A;  1JV2 B;  4AEQ A;  3OV4 A;  2Z76 A;  2IUJ A;  2Y73 A;  3WOD G;  1DYU A;  1ROA A;  3MG1 A;  2GBW B;  4FCZ A;  1N5P A;  3DGL A;  1N9J A;  3DY5 A;  2GXF A;  2YFJ B;  1OGZ A;  3CCR 3;  4U13 A;  4FMC A;  3IMA B;  1FGT A;  2CC3 A;  4FCM A;  3JUN A;  3OW2 2;  6STD A;  3WOF B;  1NJI 4;  1KC8 4;  4BTY A;  3S67 A;  3NQY A;  1YGE A;  3OWS A;  3EE1 A;  1OF5 A;  3IJE B;  4KFE A;  5IG4 A;  2CG1 A;  3DXO A;  1YVB I;  3SVA A;  5AEU B;  4LEH A;  3CCU 3;  3CPO A;  5I97 A;  3NUV A;  4KFF A;  2O3O A;  3G6E 3;  4WYK B;  1WMN A;  3FSD A;  3O8Y A;  3UL5 A;  3QK9 A;  4LMI A;  3CCM 3;  1VQ5 3;  2INX A;  4XDV A;  3HZP A;  3H51 A;  2WO0 A;  3DGO A;  1QAK A;  2XFT A;  3FH1 A;  1GYB A;  3FG1 A;  5IW9 A;  1S72 3;  1NDO B;  1W01 A;  1IQ8 A;  4HM2 B;  1O7W B;  4OUQ A;  4L8P A;  3FG3 A;  2GU1 A;  4HM1 B;  3F14 A;  4XB5 A;  3X3X A;  2O9U X;  1SIH A;  2JQ5 A;  3LH4 A;  4LZI A;  1E97 A;  3BNE A;  2Q07 A;  3B7C A;  1WQL B;  2CWU A;  3GWR A;  4J8T A;  3AMO B;  4G1M B;  1Z1S A;  4WWU C;  1NB5 I;  4HYZ A;  1VQ7 3;  1V74 A;  4RNZ A;  3MPH A;  3K0Z A;  1M1K 4;  5IG0 A;  1GY5 A;  1ISK A;  2XSH B;  4J9A A;  3SOY A;  4HZB B;  4OVM A;  4L7K A;  1TP6 A;  1W02 A;  2BT3 A;  3HK4 A;  1QVG 2;  3WOE B;  4N6N B;  4EV5 A;  1Q81 4;  3OXA A;  3EC9 A;  3V99 A;  2RGQ A;  3DGM A;  4AKY A;  4WYK A;  3CCV 3;  3NX0 A;  2HML B;  2HMK B;  1W2Z A;  4MMX B;  3D3L A;  3X41 A;  2QA4 3;  2IUK A;  1VQO 3;  3QRD A;  3NM7 A;  3F40 A;  3S5C A;  2XEP A;  5G2G A;  2XSO B;  3NBJ A;  1VQN 3;  1Q42 A;  2W9Q A;  1S5A A;  1VQL 3;  3CCJ 3;  1ROV A;  1KD1 4;  1W00 A;  1GD4 A;  3G8Z A;  1N5H A;  3KSP A;  1U8C B;  3M8C A;  1IU7 A;  3OWY A;  4L8O A;  2HMN B;  4O02 B;  3RGA A;  4WFO A;  1O7H B;  3G16 A;  3CCQ 3;  3DGN A;  1IVX A;  1Q40 B;  1GY7 A;  2V1L A;  1EA2 A;  3SLU A;  1OUN A;  2Y74 A;  2BMQ B;  3AMO A;  1W5Z A;  1O7M B;  2W56 B;  3NQZ A;  2E2V A;  3UNL A;  5CF1 A;  1GD3 A;  3RDE A;  3NBR A;  1YHQ 3;  1ASK A;  3KFQ C;  4R1K A;  1IT7 A;  3X3Y A;  1LOX A;  1J2B A;  3KSE D;  2OQE C;  4HVN A;  1HU9 A;  1QAL A;  2FNQ A;  2GU3 A;  2LYX A;  1STF I;  1UI7 A;  3GZR A;  4KFD A;  1JB4 A;  4JF8 A;  3K5T A;  3S28 A;  1TIJ A;  2L4V A;  4EV2 A;  4N6U A;  2CWT A;  1AVL A;  1FGO A;  2W9P A;  4H3U A;  2QEX 3;  3DUK A;  3T0U A;  2W04 A;  1TUH A;  2A15 A;  2WGO A;  2OQE A;  2E2U A;  1O7G B;  4N3V A;  3X3Z A;  2GBX B;  3NHX A;  2OWP A;  4XBY A;  3EBY A;  3G0K A;  4KVH A;  3NXJ A;  5DRV A;  3DZL A;  4K90 B;  3PXM A;  4AKZ A;  1RRL A;  2XRX B;  2CFD A;  4HM4 B;  3CNX A;  2STD A;  3I0Y A;  3N9H A;  3G71 3;  3V92 A;  2IA7 A;  1NU3 A;  1Q40 A;  2P05 A;  2W2C A;  3ER7 A;  3PCR A;  4FMB A;  5D81 A;  1TFO A;  2B24 B;  1EQK A;  2P09 A;  1TFK A;  2KXG A;  1LXE A;  4N6O B;  1NO3 A;  1JRQ A;  2XGL A;  1DMN A;  1A2K A;  2W56 A;  1CYV A;  3NBB A;  1WMP A;  5IER A;  2K0M A;  3EBT A;  4HJL B;  5DRE A;  2R4I A;  1SPU A;  2WOH A;  4FMD A;  3U97 A;  3N8B A;  3S27 A;  3V98 A;  3WMD A;  3HI7 A;  5FW5 A;  4MJD A;  4MMY B;  2CWV A;  2CHC A;  5CK6 A;  2CW9 A;  4R80 A;  3DM8 A;  3STD A;  3JUO A;  1MNL A;  3CC4 3;  3FG4 A;  5JPP A;  2I9W A;  4KZ1 A;  2ML5 A;  1RN7 A;  3T8N A;  3FGY A;  4MEI A;  1ZO2 A;  5CF2 A;  3MG3 A;  1FUW A;  1CQS A;  1NB3 I;  1WTH A;  1AR0 A;  2ZDJ A;  5KP4 A;  2PZV A;  3BB9 A;  1ULJ B;  1JB5 A;  1K9M 4;  5HGR A;  3EQQ B;  3ECF A;  2XH9 A;  3I55 3;  5AIG A;  1UI8 A;  3JUQ A;  3Q2P A;  3KZT A;  4HM0 B;  1A90 A;  3FLJ A;  4LSO A;  1JNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...