2QGUA

Three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
ADAQATVKTAVDDVLATIKGDPDLRGGNLQKVFQLVDQKIVPRADFKRTTQIAMGRFWSQATPEQQQQIQDGFKSLLIRTYAGALANVRNQTVAYKPFRAAADDTDVVVRSTVNNNGEPVALDYRVEKSPNGWKVYDINISGLWLSETYKNQFADVISKRGGVGGLVQFLDERNAQLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the phospholipid-binding protein from Ralstonia solanacearum Q8XV73_RALSQ in complex with a phospholipid at the resolution 1.53 A.
rcsb
source organism Ralstonia solanacearum
molecule tags Structural genomics, unknown function
molecule keywords Probable signal peptide protein
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05494 MlaC MlaC protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A phospholipid-binding protein 2qguA02
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qguA01
3CNMA 3CNXA 3NM2A 5FW5A 3OWYA 2GBWB 4STDA 4CDLA 3EC9A 5IENA 3DXOA 1BUQA 5STDA 3VGNA 3EN1B 1TP6A 3F14A 1NU3A 4HM7B 2HMKB 4L8PA 1JN5B 4ORLA 2HMNB 3FGYA 3OXAA 2YFIB 2F98A 3K0ZA 4J8TA 4MJDA 2IMJA 4N3VA 5AIIA 3VSYA 3WMDA 3KKGA 4FCMA 3RGRA 3DUKA 1QJGA 1SJWA 3F9SA 3K7CA 1OHPA 4OUQA 1W6YA 3OV4A 2XSHB 5IG4A 2XR8B 1OCVA 3MHEA 1W00A 1O7HB 1Q40A 4XBTA 5D83A 3HK4A 3FH1A 1W02A 3D9RA 1GY7A 5KP3A 3F7XA 5CXOA 1GY6A 3FKAA 4HZ9B 5DREA 3S5CA 4XM4A 3SOYA 2F86B 5JPUA 1WQLB 1ZO2A 3NV0A 3CU3A 3LYGA 2Z7AA 1C7HA 3G16A 3HX8A 3BLZA 3E99A 3G8ZA 3MG3A 5CK6A 1OHOA 4HJLB 1CQSA 1GS3A 1HKXA 2BMQB 4RZMA 3DZLA 4WWUC 2PZVA 4WYKA 5IG3A 2QIYA 4IIAA 3MG2A 2XSOB 3M8CA 1O7PB 4LMIA 5KP1A 4J9AA 4WP5A 4Q53A 4K1UA 4PEJA 2BMOB 1NDOB 3F7SA 2BNGA 4OVMA 3G0KA 4HVNA 5EVHA 3SOAA 2OWPA 1UUVB 1VZZA 2YFLB 4LGQA 1O7GB 4HM1B 4X2HA 5AI1A 1EA2A 5G2GA 1TUHA 2STDA 3B8LA 1GYBA 1JKGA 1JB5A 3F40A 5IEPA 5IF6A 3NV0B 5IEOA 1Q40B 5D82A 2B1XB 3ER7A 3EQQB 5DRVA 3UJMA 3SEDA 2QGUA 1DMNA 2RGQA 3IPTA 4XB5A 4R9KA 3DM8A 1OHSA 4X2OA 3CPOA 3GZXB 1ULIB 2R4IA 3EBTA 4I4KA 5AEWB 1ZX2A 3OWSA 3FF2A 2B24B 4XDVA 2GEYA 5CF1A 3ECFA 1O7WB 1AR0A 2CKFB 2UX0A 3JUOA 3NUVA 3STDA 4HM4B 1OUNA 3JUNA 4WYKB 5BVBA 4HM6B 2JQ5A 4L8OA 2HMLB 2XRXB 3GZBA 2CHCA 3KZTA 1UUWB 2HMMB 1STDA 1Z1SA 2A15A 3B4OA 3EBYA 3GWRA 4GB5A 4H3UA 5BXQA 3FZWA 1K41A 3EHCA 5AIGA 2YFJB 4HM3B 1NWWA 3OWUA 3T8UA 6STDA 1OPYA 1Q42A 1IDPA 1W01A 3JUMA 4XBXA 4XDWA 4LEHA 3T8NA 3EJVA 4FCJA 1OF5A 1JKGB 4HM5B 3ROBA 3BB9A 3H3HA 5TGNA 4HM8B 2BMRB 4U13A 5AIHA 3FSDA 4HM0B 2W2CA 3GZYB 2INXA 2RFRA 3JUQA 4R1KA 5CF2A 2K54A 1U5OA 3DMCA 3HZPA 1JB2A 1S5AA 4R9LA 4HM2B 4XBYA 3FF0A 1E3VA 1GY5A 1E3RA 1OH0A 2HMJB 1O7NB 2RCDA 1ASKA 3NBRA 2HMOB 2Z76A 3EX9A 8CHOA 1EG9B 2F99A 3EF8A 3KE7A 3NHXA 3RGAA 5JPPA 3UNLA 1ISKA 3H51A 3MSOA 3B7CA 1QMAA 1DMQA 1ULJB 3F8XA 3GRDA 3KSPA 3JUPA 5HGRA 5AEUB 2GEXA 4KVHA 5IG5A 3Q90A 1JB4A 3A76A 1OGZA 3NXJA 1JN5A 2GXFA 7STDA 3F8HA 1A2KA 3I0YA 1O7MB 1DMMA 3LZAA 4K1VA 5D81A 1OGXA 5CLKA 4HKVB 2Z77A 5IG0A 4HZBB 5KP4A 2GBXB 3FLJA 3EN8A 3OX9A 4L7KA 1OF5B 1E97A 3B4PA 3MG1A 5AIFA 5IERA 3MYTA 3GZRA 2I9WA 3MKIA
chains in the Genus database with same CATH superfamily
3FG4A 4CDLA 1YVBI 3BDDA 3HXLA 3D3LA 2K0MA 1TW3A 4O02B 3HPGA 2MFZA 2ID3A 4KIBA 2VXDA 2IMJA 2M45A 3RGRA 2EFQA 4HF0A 3V4GA 2VOOA 3K7CA 2DPUA 4HYZA 1E3OC 2RN7A 1TQPA 3HTUA 3P9CA 5HODA 4IHYA 1I3IA 1J59A 5EEHA 2VASA 5GP9A 1RGLA 3LNQA 3AHWA 1KONA 1X1AA 5LGUA 3RPQA 1IDZA 1LQ1A 2OAZA 1RKYA 3S5CA 4AD9A 4EJOA 4PFPA 4UV8A 4E6KG 4QTRA 1YNVX 1RR7A 2UXXA 5H6RA 1LVKA 2JRMA 2DQRA 4FMDA 1TT5B 2KRCA 3R4KA 2F2EA 5KVRA 1LQGC 3PYJA 3UR3C 2B0LA 2YX9A 1KWIA 2XSOB 4XQFA 1SC7A 2K7LA 3OOUA 5B1AH 4CXFA 2GOMA 2CUZA 3VYTB 1FUSA 2C4BA 5FKNA 2BHZA 1YITI 4GHOA 4ILFA 1PYVA 1K7AA 1R1UA 1PUFB 2A5YB 1VQ9I 3FXRA 3AG1H 3CMA3 1G4DA 1ETWA 1JKGA 5DS9A 1RN1A 5IF6A 1TZLA 1QHHD 5G1KA 4A69C 5DCFA 5K7FA 4L18B 5DRVA 3LOYA 2IUJA 3TO9A 1FA3A 5HNHA 2O03A 1OHSA 3HRTA 3F72A 4P9FA 3ZN1A 4EC6A 3G6EI 5DV5A 4CZCA 3LOCA 4XDVA 3CME3 4IRHA 1K79A 3DF8A 2ZBKA 1YHQI 4WYKB 2P5LC 5BVBA 4F91B 1IVUA 5JLXA 1BIRA 3HRSA 2HTJA 2FSWA 1TFKA 4X2OA 1R5HA 3BZ6A 5L3BA 1YRNB 1Y0NA 1SIIA 1DVDA 1HA8A 1K41A 1APLC 2K3PA 1ETVA 1D3YA 4NUBA 1Y4KA 1YJN3 3TGNA 1FYMA 2BU4A 2WC2A 4UVCA 1IRZA 2WO0A 1S723 3LSGA 1X1YA 4U13A 1K734 3AL0B 2DDBA 1XD7A 3GX4X 1PP8F 2W2CA 5K5OA 3G713 3OYNA 2RFRA 2EFPA 4BHBA 1XX5A 4ZJZA 1OH0A 3S2WA 3NBRA 3FHZA 2VJ5A 3Q9SA 2KP6A 4ITVA 3KE7A 4EV2A 1IO2A 2N8GA 2JA5J 1GD3A 3GXOA 2FU4A 1V74A 1O3TA 1ZLKA 3ZMTA 2CV1A 1B4AA 3A76A 1SARA 2CFGA 5IT3A 3IL2A 1M1EB 3ELKA 4LG0B 1YVSA 3JRFA 2QVOA 4CYCB 2JQ7A 4WF2A 4JBAA 3SFIA 3LL7A 3MKLA 1W2ZA 2I5UA 2WV0A 5KP4A 3ZR8X 2JVHA 3QODA 2IS4A 4XICA 1HBXG 3A0BC 1JRQA 3G4S3 5IENA 3ZQIA 1VQM3 5STDA 2IEKA 2Q0OA 2K02A 2X48A 3CO7C 2NRAC 4RGRA 2AQFA 3FGYA 3WMDA 3F23A 5F27A 3E6MA 1T0FC 1H9TA 1GOYA 4G8XA 3BJOA 3RNTA 2V6CA 2QA43 2W56B 4XBTA 3DKXA 3FH1A 3UL5A 2XPUA 1LE8A 1KQ9A 4MQVA 3HGYA 1OLTA 3NWSA 2O9LA 3JRAA 1U8CB 4EBGA 2X4HA 4IHSA 3I4PA 1WQLB 1ZO2A 5RNTA 2QQAA 1QVUA 5L3EA 1UAAA 2HI3A 1VI0A 3B73A 4W97A 4IT7A 4KT3B 1FIPA 4HJLB 1PP7U 1HKXA 2A3SA 2IY2A 3BIRA 4WWUC 2CQNA 4BU2A 4J19A 3IWFA 2XKPA 2DFFA 2LVSA 1Y39A 1IV9A 1U8BA 4D5CA 2R0QC 3FISA 2LBFB 4Z6YA 5DM7F 4UHTA 4G6TB 5LHHA 3VB2A 1T08B 4HDVA 2MF7A 2E34A 5IW9A 4CYDA 3OYHA 2Y69H 2VQLA 1I70A 3LSJA 1O7GB 1FOWA 2IA0A 1A6IA 2KISA 2E2JJ 4S04A 3KCHA 4RGXA 2L4VA 4AIHA 4EGZA 4E7IA 3BG3A 2CK3H 3HRMA 3IPTA 3PNYA 4BACA 3NX0A 1ULYA 4XLAA 3H92A 2FUG2 5BQTA 3CPOA 4FMAA 5JR3A 2W48A 4Y4RA 5AEWB 5HDKA 1W7PD 2HPIA 5ILVA 4L9VA 2O5RA 2IVMA 3IWZA 1I1GA 4XRMA 1XGMA 3GEZA 1T3BA 2CKFB 1VNDA 1I3FA 2FNAA 4KMUX 3HOHA 3NUVA 3RPUD 2DO7A 2MABA 3SDBA 3Q0VA 2HMLB 2ZC2A 4M9XA 2XRXB 2PN6A 2A15A 2DCEA 1OCPA 2VPRA 1CYVA 2EZKA 1LQMB 2DT6A 2JWTA 2RNGA 5DDGA 2P05A 4HM3B 4WCGA 1UI7A 2PLYA 2KF6A 4M72A 2HOEA 3CESA 1Q7Y4 2F56A 2DFIA 2IAIA 2CV0A 1BW5A 3FXOA 3DGLA 1OF5A 3EJVA 4L0ZB 2KZGA 4MFEA 4HM5B 2X6XA 2NVQJ 5D4RA 4GO1A 1TTOA 1G8XA 2HNHA 1PYLA 1OR7C 1J09A 2NAZA 1B2MA 2O3FA 4M3DA 4XKVA 2TCTA 1FJLA 1X3ZB 3KEQA 4FX0A 4HPQA 5EZGA 4GYIA 1ASKA 2KDZA 1VQQA 2D5VA 4PZJA 1IYYA 3ZQFA 1SFXA 3GRDA 1FTTA 2EK5A 2O6GE 2F4OB 3BR5A 3PUBA 1U78A 1W5ZA 2NVXJ 2KIUA 1G96A 5D6FA 2H1KA 5EEAA 3HOXJ 3PCRA 4ZM8A 3E0JB 3OX9A 1XDUA 5CVIA 1TQIA 3I54A 3Q0UA 5HLHA 5HS8A 2F4MB 3GZRA 2KKOA 2BBYA 2HQNA 3S3OA 1U5TA 3L0RA 3X2QH 1TQMA 1O7LA 2QYOA 4I0AA 3WGIA 3HG9A 2KCDA 3GZ5A 2JSCA 4XN0A 2XGNA 3F3XA 3FDYA 3ZQHA 2XV4S 5J6XA 3QPHA 4IRGA 4CO8A 1JN5B 2DMQA 1S5LC 2HMNB 1LNWA 3V8JA 3OXAA 3JSPA 3OYFA 2A6TA 1J2BA 2DOFA 2EZIA 1SJWA 1DGRM 1YW8A 1Y0UA 4ESFA 3ZMZA 1X3WB 4LG3A 4CCJA 1MJAA 4HF1A 1KU3A 5CJ9A 4B44A 2MH9A 5KP3A 3K4BA 4JX5A 4XLEA 3F7XA 1VQ73 2CJJA 2DW4A 3SZPA 1OCZH 2R5ZB 4NHFA 3LYGA 2H94A 2OZ6A 4GXOA 3SZGA 1SFUA 2FF4A 1SQWA 1H8AC 1X1BA 3GFMA 4I2OA 1I5ZA 3HZJA 3WTXC 2CUJA 1R00A 1Z0XA 3DZLA 1MJBA 4RA2A 4N6UA 2WAFA 1LKXA 1FMVA 1YW9A 1BNSA 4N0BA 1RKTA 1I0XA 3K4LA 4M9SA 2K9MA 2NVYJ 3SYUA 1AU7A 2PFBA 2DMNA 3EETA 1U3EM 1WMOA 2YFLB 4LGQA 4X2HA 1W5SA 3A4CA 3A01A 4ON0A 3H0DA 2MA3A 4UUVA 2X85A 2P7VB 2CS3A 1NO3A 2IP2A 1ZELA 2Z6BA 3E1SA 1AOYA 4UUTA 1R36A 3HOUJ 1UUGB 3OMYA 2VKHA 4IHVA 1T98A 1EV7A 3CD6I 4A3DJ 2IGKA 3LTBA 2R92J 1K9M4 3TP3A 2PQ8A 2QBYA 4I98B 1AKHB 1O3RA 5DCMA 2GU3A 2RKHA 3CJTB 3H5NA 3ZCOA 1MGWA 1UMQA 1RRLA 2AADA 2HFHA 4EQQA 3CCJI 3LSRA 4A3JJ 1S3JA 2COMA 5EJCA 3OL3A 1BU4A 3GZBA 1UUWB 2FMLA 4Z2YA 3KYDB 3QU3A 2QSHX 2VIXA 3OR1C 2EV5A 1JBSA 2ZNZA 3GTQJ 1MSEC 3ZOBA 3HEFA 4HV6A 1BI2A 5LGTA 2RNJA 3F9KA 1FX7A 5F64A 2NVUB 4A5NA 4BEHA 4AIJA 1GMQA 3S27A 1VQ43 4A93J 5EGOB 2X9DA 3MZYA 3CJRB 4KN4X 3VWBA 4GSPA 4HM0B 4RNTA 4WFOA 1YS7A 5CF2A 9RNTA 2ZXWH 4MNUA 2JMWA 2M87A 1QZZA 8CHOA 4XL9A 2VE8A 3DPUA 3NM7A 1IXSB 1STFI 5JPPA 1VQK3 1N5PA 3GCMA 3F8XA 2VI6A 3CXC2 1FNNA 1FGOA 2LD5A 5HGRA 1YHQ3 2ESHA 3MN2A 2GSPA 4A3FJ 3AAFA 5EF6A 2CWVA 3HRUA 3LFKA 3LQRA 3CMEI 1KD14 4EW5A 4LSOA 3GLLA 3FG1A 3ABTA 1XSXA 4E7KA 2DMPA 3DQVC 3L2RA 3ONQA 4FASD 4L5JA 4BQNA 3OW22 5K5RA 4GRIA 4PDKA 3J80Z 2DK5A 1B72A 2DBBA 3V42A 3WE2A 5DYMA 1DVCA 3C2HA 2MW8A 3NBJA 2ZXJA 3Q0WA 4EEFG 2LTPA 3TDGA 3J7AY 3OWYA 4XSZF 3G73A 1RZ4A 3QYEA 3ZQ7A 2NS7A 4XLHA 5DTDA 3VGNA 2DMUA 2M3AA 2MD5A 3CPW2 3K0ZA 4MJDA 1XN7A 2JA7J 2HWVA 1HLVA 1WSUA 4I99C 5FFXA 4MMXB 2COBA 4LG0A 3Q5FA 4RAYA 1HKSA 1OCVA 4JQFA 3F6OA 3DP7A 2P6TA 3BG5A 2CMPA 2P0WA 4WXHA 5DD8A 3IRQA 3CCLI 2BHYA 5J40A 4HZ9B 3ZG5A 1T56A 1USTA 3WU2C 2OOVA 5HLGA 4AIKA 2Z7AA 3HX8A 4ZYGA 3K4MA 3E99A 3G8ZA 1RN4A 1WI3A 4O8SA 2H0GA 2IS1A 4C30A 3IRRA 4RZMA 3FM5A 2YS9A 3HL2A 1BBYA 4BGDA 2PZVA 3JRDA 3BPVA 2KF5A 1IN8A 3V8KA 5M5YJ 5A0OB 1WRJA 4IRIA 2KJCA 3F7SA 1YFHA 1WVRA 2OQGA 2IJLA 3HOTA 3X3ZA 1Y56A 4D7NA 1B59A 1VZZA 3OWTA 2FOWA 3RQIA 3CCJ3 3L09A 1BRGA 4MMYB 1MZBA 2DOEA 3G71I 2BZTA 2WADA 3E6BA 1G3YA 4J01A 3CCM3 1EJ9A 1YE9A 2FJ1A 1JHFA 2LKXA 4RMNA 1JKRC 2ZNYA 1LEAA 3REOA 1JGGA 1BRJA 1EKEA 2H6CA 4I4KA 1RNBA 1RJOA 2DJIA 1BIAA 1BNEA 3K63A 4XNFA 5A2QZ 3BNCA 1YJWI 1DPUA 1TWGJ 1NB5I 3RIRA 3WTTC 4Y3OA 4BH9A 3WHBA 3CC23 5CVUA 3S93A 3ABLH 3AMOA 3JUNA 4HM6B 4L8OA 3I71A 2E2UA 5HDGA 1E0EA 1XTAA 4PCQA 2HMMB 1Z1SA 1LEBA 3HSFA 1USSA 5BXQA 4DKIA 3EB8A 1RDSA 2E1CA 4DQ2A 4Y17A 2XEPA 3S14J 2PX9A 2OC6A 1W01A 3VSLA 1QVF2 3A5EA 2D1HA 3E6DA 4R1HA 3SLUA 3H9JA 4UUSA 3BG9A 2QEXI 3JRBA 3CCUI 3CMYA 1HW2A 2PEXA 4V2GA 2LOOA 4NREA 1LXEA 5DEQA 1VQ93 4UVAA 4BYYA 1EKMA 2FXAA 1DETA 1JV2B 3H51A 1MW7A 2GBYA 4DNCA 4QPQA 1IG7A 2ML5A 1OR7A 3KSPA 1YI23 1BSDA 3G3ZA 1BA5A 1MDMB 2X1CA 4XLNF 1HKTA 3H9QA 4YRVA 3QRDA 3LZAA 5F1JA 1OYIA 5TISC 1HOMA 4EJVA 3GFIA 4EYCA 1KGSA 3PCSA 1BW6A 2LY9A 1GVDA 4FETA 5E3LA 3OYDA 4EJWA 2BHMA 2XF7A 2PJRA 3MZHA 4PGHA 1QO0D 3LMLA 3A03A 1Z3YA 4KIFA 4C2UA 2IS2A 2CFOA 3TKYA 3MKIA 3BCAA 3TBIA 1WJAA 2OD5A 3OYAA 3S2HJ 5G1LA 1W4MA 1I3AA 1KQ8A 2VBZA 5CKTA 2ELKA 4TX4A 1VQ5I 4A0YA 1N75A 3X3XA 3TP0A 3I64A 2UGIA 1R71A 1ETKA 4GGGA 2X6OA 4Q5SF 1FSEA 2XDVA 3FK6A 3GSPA 3HUGA 2BXZA 2PMUA 3HK4A 2ME0A 3DTEA 3FXLA 4BXXJ 1W02A 3CDIA 3OYIA 4K2EA 4RLQA 4GFBA 1XMXA 4LD5A 4B3AA 3ZPLA 3N9HA 2XFSA 4NQWB 3CLOA 4W1UA 2BMQB 5ICCA 1RTUA 1UCLA 3PFIA 1POGA 3CC43 4IIAA 3VPRA 4XLCA 2VBWA 3R0AA 4Q53A 2BMOB 1XMKA 4PSWA 1I6HJ 4L5EA 2YX7A 1ETOA 2BNGA 2SARA 2NVTJ 4OVMA 3ZMDA 2W9PA 2XVCA 4MGRA 2PI0A 1UUVB 1FGTA 4R4KA 2XAGA 1X1UA 5AI1A 3NARA 4WXDA 1GMRA 3B8LA 4ZC3A 3LT9A 1EQKA 3BTLA 1YYVA 4K90B 3GW2A 1FYSA 4OIQF 4OIOF 1AY7A 2HR3A 1W6GA 4N6NB 2ID6A 1DMNA 2OTJ3 1BOAA 3H3ZA 1G3WA 3C2GA 2L02A 4XB5A 3HI7A 4R9KA 2DYRH 3LFUA 1ULIB 2OJED 2R7QA 1XPXA 2CG1A 5F0CA 3LSKA 1FIAA 2GZWA 3KP6A 3LSHA 3CCVI 1S72I 1CGPA 1MWUA 2HTSA 1VQLI 2KLOA 4BJTA 6PAXA 3AHSA 2A61A 3BNBA 1OUNA 2P6SA 1Q864 2QKLB 2CHCA 1XCBA 1UHMA 5GADJ 4Y7NJ 2Y2ZA 4RB0A 1UFMA 2O9UX 2DLLA 1OPYA 4AKZA 1U9NA 1XGSA 3SJMA 1IDPA 2V79A 1VQL3 3F8MA 4P55A 4FCJA 4CHUA 4IEJA 2VJIA 2R41A 5KHDA 2DMTA 1G3TA 4P9UA 2O7OA 3QQAA 1VQ8I 1B2XA 3WOEB 1P4XA 1XSDA 1MWTA 4PJJA 3DPLC 3DU5A 3KETA 5J47A 3CCSI 3DGYA 1GY5A 3HSEA 3FF0A 5HDNA 1RGKA 3PQJA 5AIQA 4KITB 1CQTA 4MMZB 2IA1A 3C7JA 2EIKH 1F5TA 2CW9A 3NHXA 4LJZF 4G7HF 2P7CB 1NJI4 4LIVA 3FCSB 2K3DA 3ISPA 1FY7A 1Z3XA 4HNTA 3HOVJ 1IRGA 1N25A 1LE8B 4JRFA 4FX4A 1LDJA 1A2KA 2A07F 2R93J 3JSOA 3QPSA 1R4MB 2DTZA 3NQOA 1P2FA 4CGZA 5IG0A 2MLGA 4ZZLA 1YGEA 2GBXB 1NK3P 1GOVA 4BL3A 4EV5A 2QF7A 1DUXC 5M5XJ 4QSHA 1NG7A 3E7LA 3BY6A 2KJBA 4B1RA 2WWYA 3KSED 4DZJA 4DOZA 4ESBA 3DXOA 1M1K4 2HQ5A 1WH7A 1ZRDA 1STZA 3GTLJ 3DH2A 2R7TA 1PFPA 2K4JA 1AQZA 2HVRA 2DA6A 2L9RA 1O3QA 1QJGA 1D1AA 1SVLA 3BC8A 3EUHC 2UZKA 1LJ9A 1BJZA 3RYRA 2R7ZJ 4II3A 2FX0A 4D5FA 3T5XA 1OCCH 1B8IB 2AAEA 1J2XA 1PDNC 3O6BB 4IPAA 2VJJA 1BNFA 4UB8C 3K70D 2Z3YA 4BTXA 1MNEA 2Q07A 3OYLA 1CQSA 1YRNA 1Z67A 2DDAA 1UCIA 2KRTA 5LGNA 1IAWA 4S0HB 4J00A 4CH7A 2CUFA 2DAOA 3LTDA 2PNCA 3ZQLA 1ZR4A 4JP0A 1VQN3 1P9QC 3G0KA 3TEDA 3SOAA 2ZA4A 3HOSA 3SDGA 4L5IA 2R7SA 3BU4A 3I55I 3T0UA 2BE5F 2CW7A 1QAFA 4IL6C 5FGMA 3FKJA 2SBLA 1LOYA 4ETSA 5IEOA 2HXIA 3C18A 5M19A 2B1XB 2IGOA 2BGCA 4I09A 1UCJA 5F0FA 1S6LA 5B66C 3E97A 2GOXB 3S3NA 2LK2A 3I58A 1NTCA 1VQPI 1FGRA 3E5UA 1UCRA 2V26A 5D5XB 1SAUA 3KX2A 3CDHA 5EG0A 2NS8A 1OPCA 1AR0A 3FXJA 5D8KB 2EZHA 2XH9A 2P0MA 1HQCA 3BOQA 3VEPA 4FCZA 2AHQA 2LREA 3K4NA 1VQ6I 2BEOA 3KZTA 2FOKA 2HZTA 5CVJA 1HYFA 4LMYA 1FEXA 2EZLA 3GZNB 3VOEA 2YFJB 1YIJI 2QQ8A 2QZ8A 2V9VA 1PUEE 5FGOA 2G0EA 2M9HA 3KP2A 3GFJA 4L9JA 2F5DA 4CZZA 4ZYDA 4IHWA 2LY1A 5K5QA 3E6CC 1R5ID 1QU3A 1FPQA 2ISZA 5TGNA 4NB5A 4F52A 2K27A 2L1SA 4I76A 1SFEA 3HTSB 3E5XA 3IV5A 3H9GA 1IUFA 3PFYA 3S1NJ 1U5OA 2F5MA 2TDXA 1WI9A 2ZL8A 1AWCA 5AIPA 3L9FA 4YEJA 4BXFA 5FKLA 3U2RA 1R7JA 1WJFA 5IYBJ 3K9MC 1S9HA 3M07A 1QMAA 2MD0A 1MJ9A 2VL8A 4FHTA 5F08A 4DIQA 2BVMA 1UGIA 4KVHA 2P4WA 3IMAB 2FQ4A 3S15J 5J4YA 2CFKA 4L9TA 1VQ53 2GXFA 5C4XJ 2ZFUA 4BL2A 1DQUA 2ME6A 4G6DA 1MBEA 5CLKA 5I97A 1Y1VJ 2QQBA 1Q824 3K5TA 1ORKA 3CUQB 2XGCA 2QKMB 2R7WA 1TT0A 1CF7B 2VKVA 5ERIA 3I4NJ 5LC6A 1E97A 3R61A 3MG1A 2R5YB 3J80K 3AFHA 4IQJA 4NC6A 4CSWA 4CCVA 2P09A 2KT0A 2HKOA 4WWCA 1JKQC 2BIRA 2HOHA 3EN1B 1N8R4 1QBJA 5GPCA 2M7OA 5GTHC 4A6DA 1D5YA 3MQ0A 4BDZA 4J8TA 4N3VA 1X4PA 4YIFA 2CG4A 5LLQA 1ZGJA 1MBGA 2DT5A 4HSRA 4R80A 4AM3A 5LEJA 4LLNA 2XB5A 4MO7A 2JPCA 3MD2A 4KNYA 3JAMK 1YGWA 1HSTA 2ZHXB 5M18A 2FQ3A 1GY6A 5CVRA 3SOYA 2H6BA 1W7PA 2L9SA 3KEOA 2Q8KA 4XR6A 2WB1A 2BYVE 3CU3A 3HOYJ 2ZCWA 1N9JA 3JREA 3KIOA 1IC8A 2KHMA 1XGOA 4HW0A 5DUKA 3SZTA 3PIPF 1X1XA 1KQ0A 3HB9A 5L3DA 5FO5A 1LFUP 3JR9A 3WTSC 1S29A 1N77A 4AYBA 2OZUA 5KP1A 5FROA 4A3GJ 4J9AA 2RDPA 1WZ2A 1SFKA 2KF3A 3QPLA 3WTYC 4BBRJ 3DFGA 1RIOH 1F4KA 3BTIA 2K9LA 1MGRA 4ZDPA 1JNQA 4BJ6C 3G4SI 3GTPJ 1BSAA 1OMIA 2HU9A 1E17A 1Q40B 1Z6TA 3M9AA 5D82A 3B6AA 3VYUB 3CC73 3BZCA 3EUAA 1IXCA 5IT9K 4A5MA 1X3UA 1X1DA 3ZXSA 1RGAA 2E19A 4NHJA 1YIJ3 3K4KA 4PFOA 1ODDA 5JVGF 3CCMI 4ZH4F 2G7UA 1X2NA 1Z05A 2M8GX 1MNMC 4OIPF 3GO5A 2FRHA 2JTVA 1HW5A 4HM4B 3IUOA 1O4XA 1BANA 3B4OA 2HDDA 4P5OA 1ZGAA 2MG4A 3A2KA 4O3MA 3TDZC 2NOJB 1HDDC 3EQLF 3DU6A 1BI3A 2YU3A 1F9NA 3PIOF 3BB9A 1CH0A 2Y31A 4HM8B 1Y1WJ 2IA7A 3FSDA 2EA4A 1TNSA 1IVXA 2MC4A 2K4BA 5EQLA 1REPC 3JCUC 1FBSA 5CPRB 2PJPA 5HOHA 5EZHA 2YR2A 2D2WA 1QALA 2OCTA 5FB2A 1L5GB 4F93B 2FBIA 2L7FP 1XMAA 4IKFA 1OACA 4IQ4A 2BY2A 2GEXA 1YJ9I 1HZ1A 5IG5A 1DYUA 4F55A 1QNTA 3LH4A 2HEOA 3DTIA 2WGQA 2ESNA 1K4SA 4K1VA 2R3SA 2VQGA 4N4OB 3S1MJ 4A3LJ 4HKVB 4ANJA 1P4WA 2QWWA 1OYYA 2L0KA 3FXUA 1SD5A 5ILSA 2BW3B 2DYSH 5DD4A 5GPAA 1RETA 2DI3A 1HXDA 5FFZA 2XGDA 2MGQA 2ZKZA 3TMOA 1FWZA 4JX4A 1RESA 4Y15A 2W7NA 2QENA 3QOPA 4LK0F 3J81K 3A01B 1BL0A 3H5RA 3LMMA 3X3YA 4JK1X 3JRHA 1GMPA 2DT7B 2UV1A 4TV7A 1B2SA 3ASNH 1VQOI 4EXRA 3D0SA 1WH5A 4UV9A 3CC4I 2XR8B 1JE8A 1IJWC 3OYMA 2E60A 1V3FA 4XBFA 4I6ZA 1DGWY 4F7ZA 4ZYAA 2HXOA 5C44J 1HU9A 2KRHA 5AONA 3J81Z 2QBYB 2KIQA 3NV0A 1OFCX 2A05A 2M0CA 2XFTA 1P92A 5J1UA 3SEZA 5JI6A 1WMNA 3FIWA 3PS8A 2LF8A 1X2MA 2JA6J 4D1QA 2O0YA 4KFEA 2LH9A 1ZK8A 2R7UA 4C3HJ 4WYKA 3V8LA 3FMRA 4XK4A 2P0XA 3GMEA 2JSPA 1JUMA 4N9IA 4HVNA 3CQZJ 1ZAOA 1GLNA 1OISA 2HYFA 2L9NA 3PL8A 3KP5A 1AV4A 2OWPA 3HC7A 2Z16A 5IYDJ 3R60A 4BY1J 4M3EA 2G7HA 1W0UA 1GYBA 4KDPA 3HJEA 2XSJC 2FNQA 1S7OA 1W2B2 1ON1A 2GXGA 3P5JA 1NG6A 3MAJA 3ZMSA 4HEA2 1BAOA 2LC2A 2RGQA 4U7BA 5BU4A 8RNTA 5JVTA 1T5YA 1BI0A 3BJ6A 3DEUA 3PUFA 1RI7A 3S3MA 4G1MB 5E3MA 5FLXK 1R1VA 1SFOJ 2AO9A 4K61A 3ULQB 3K4JA 3F22A 1A36A 3BZKA 2OQEA 3D1NI 3I59B 4KUMA 3KEYA 2P38A 1K78A 2DA1A 1AA7A 4M6XA 3CCYA 1AVKA 3Q1CA 4BHCA 3SFZA 3CUOA 1A35A 1N8QA 3RKWA 1NWWA 3HBLA 6STDA 3CCV3 5LC7A 2EQRA 3G6E3 4DBRA 1T2IA 3DY5A 4IHTA 3LT8A 1J75A 4BNCA 3H3HA 1JT6A 3RYPA 1K4TA 5AIHA 5E18F 1C54A 2WV1A 3I9V2 2QQ9A 4V19K 2ZMEB 5D5UB 3HZPA 4XBYA 2VLAA 3IJEB 2F4YA 4H3UA 1WJBA 3M8FA 2RCDA 3U1WA 3E3VA 4XN3A 4XKBA 1BRSA 2R7OA 2LFBA 2RBIA 2VE9A 3WU1B 4FT8A 1B2UA 3I553 4U88A 2KL4A 1MBJA 4I0BA 3KN4A 5J4VA 3JW4A 3CUQC 3WG7H 5EDNA 3AL0C 3I4MJ 2IYJA 3NXJA 4HAAA 3MCZA 5H6QA 1D1CA 2VN2A 2WTEA 3K6GA 3CO6C 1J9IA 1BJAA 2XAQA 3BNDA 2Z99A 1FBQA 3PNTA 2M30A 5CQGA 3HKZN 1Z21A 4B4CA 2DJNA 1JUPA 1SVMA 2M7AA 4LLLA 5L3GA 2Y9ZA 3QK9A 1D6ZA 4A2UA 1FZUA 1UG0A 1JBRA 3L2CA 2BV6A 4GCVA 2GBWB 4E7SA 2CFDA 4F92B 4HG2A 3S8PA 4M74A 4L8PA 2GXBA 2L7KA 5D8LB 4E7ZA 5FKMA 4ENNA 4QWQA 3BTCA 1JJ8C 3FF5A 4NDLA 1QPMA 4QLCU 2WBMA 3U9GA 2R7FA 3SHFA 2W25A 4QIWN 1Z1DA 1W36C 1B27A 1GY7A 1MMSA 1D0ZA 1IF1A 5ELUA 2FEZA 4CCLA 3LTAA 4LITA 2V4JC 1W0TA 4NC8A 4HBLA 3G16A 5LRRA 2ZJQF 1Z9CA 3O8GA 2OV7A 1XSVA 2ZJPF 1OHOA 3T8TA 4KN7X 4S05A 2CQ7A 5BMZA 1EF4A 4V2FA 2P5VA 3VODA 1UJ8A 1VTNC 2FA5A 1UELB 2JZYA 3W6VA 2LDUA 2GIVA 3M8CA 2LSOA 4RLFA 3ZQGA 1FGMA 4XONA 3DGNA 1NDOB 2F5EA 5EVHA 3JTHA 5HVQC 1YTYA 2VB6A 3AG2H 2GQQA 4EJUA 4UUSB 4ZTJA 2Y48A 4AVPA 2B7EA 1ROAA 2EPFA 1TNTA 3BNEA 4U0VA 4BBSJ 3F40A 2E35A 2HQRA 4YFXF 1TFOA 5IEPA 4XSXF 1W5TA 1VZ0A 3I5UA 1B6AA 3ER7A 3PO2J 1BRIA 1I50J 2AXTC 3MKYB 3OSFA 2XAJA 1S7EA 4OMYA 1A2VA 2OBPA 2X1DA 1RKWA 1HKQA 1U9OA 2W24A 1HC8A 1FUTA 2Q2EB 5GAEJ 3ABUA 1DPRA 3PJRA 1GD4A 1T2KA 5E3NA 5A2QK 2BXYA 3BP8A 4Y52J 5GSPA 4ZYEA 2JQ5A 2VT3A 2B63J 4HNVA 1BSEA 1R4YA 4FQGA 5CK6A 4RNYA 2JA8J 1E3HA 4OK0A 2A6EF 5AIGA 1IDYA 1UDII 3VF1A 2XGEA 1D8KA 2AS5F 1R1TA 1Q42A 3URPA 3UKGA 3ZMVA 1T38A 3PSFA 4OAZA 3ROBA 1NNVA 1Z77A 3PXMA 3LA2A 4KJZA 1RGEA 2D1WA 1MBHA 2W85A 1U5TC 4FMCA 4HLXA 2HOSA 2RVCA 4ZDLA 2K3FA 4R1KA 5JBSA 1YS6A 3MWZA 3WGGA 2DFHA 3BROA 1MIJA 2HYJA 2OTJI 2AXLA 5FRMA 2HMOB 2WOFA 2EV6A 4IVNA 1Z7LA 1ZARA 2RAEA 4BTWA 2DFEA 1UZCA 3MSOA 2DA4A 3OYBA 3PZWA 1R4NB 2VXZA 3E5QA 1XDSA 3VDXA 2RNTA 5D6EA 4M3BA 1YO5C 1TWCJ 1JN5A 2M4KA 4I7HA 4XOTA 2QM3A 2CQQA 2HVQA 1LOWA 3CD63 1X1WA 1GDTA 3DGMA 2XAHA 1E2XA 1GUUA 4BXUA 4OWRB 2A69F 2XKOA 2C10A 4BDYA 1U2WA 3CC7I 3VYRB 3JRCA 3FG3A 3MPHA 5IERA 4BTYA 1IV7A 1PVEA 1YIOA 2EIMH 2BVLA 2VBXA 2NNNA 4N6TA 2V1NA 1YOVB 1VQO3 2I10A 3D5LA 4I01A 1NU3A 2EH3A 4U0WA 6GSPA 2Q1ZB 2HS5A 1RN7A 3DBHB 3TW6A 2EB7A 2NOGA 1U8RA 2MC8A 3TL4X 1KQS2 4FCMA 1TRQA 1HSJA 1OCRH 3G1MA 2Z2SB 5BPIA 2J5OA 3KZIC 2XF5A 1J0RA 1FBUA 5CXOA 3FKAA 3MKZA 3QP5A 2XSDC 3ZG0A 3IC7A 1QVG2 4L9NA 1GVJA 1B20A 4LZIA 2PMZA 4M6VA 3O3KA 2Y30A 1SVOA 2CU7A 2NS0A 3SYTA 2HDWA 3T0YA 1IVWA 1F8NA 3FXQA 2K9QA 1OCOH 2CV2A 3C2BA 4LK1F 1N78A 1SMTA 1KC84 1LUJB 1LFBA 2K5CA 1RGCA 5IP6A 3CCRI 3ZRGA 3RZOJ 5CYVA 4DYQA 4LMIA 2E1MC 4F3QA 2KXGA 1Q1HA 2W6JH 2W84A 4KFFA 4BAYA 4ASNA 2PBIA 3MMYB 1VF9A 2RGVA 1AKHA 4N6OB 1D6UA 3BWGA 3H5AA 3PO3J 2V6EA 5LFAA 5HOOA 3UL6A 3WA2X 3J7YJ 3NV0B 1RUNA 2DA5A 3RKYA 2QGUA 2IS6A 1KYWA 2WAQN 3OIPA 3GAXA 2ZSHB 3CDLA 1LPQA 3DPTA 1RCKA 1I27A 2R4IA 2LF7A 4N6V0 4Y13A 4RS8A 1ZX2A 5H20A 1UGHI 1SAXA 1BRNL 3OWSA 2W57A 4JX6A 2CWUA 4FISA 1G6NA 3D5SC 3OYJA 5F0HA 2M4GA 1X19A 1JKPC 2TRTA 3H36A 5E17F 4IHXA 1DE3A 1KU2A 3BR0A 1STDA 2Y75A 2GWRA 1GV2A 3T8UA 2LBFA 1WHUA 1TTYA 2NYXA 4IO9F 1V5FA 4LEHA 4RM3A 2VBYA 1IVVA 1D6YA 2GU1A 3SEQA 1D5VA 1L0OC 3KYLA 1BSCA 2DTRA 2M0MA 2MBFA 1BSBA 2DODA 1F1ZA 1RRJA 1LFPA 3BJAA 3K2ZA 4MIMA 5FD6A 4UY8I 2DA3A 1QGPA 2EBIA 1BNIA 2L7ZA 3I59A 3R0JA 5HS9A 1Z6RA 2HMJB 1O7NB 1MMNA 3CZ6A 1MMDA 2BY3A 3Q9VA 3V92A 3EF8A 3CJNA 1ISKA 3O8HA 5FD5A 3OIOA 2P5KA 4IPBA 4HDUA 1YLFA 5M5WJ 1D0XA 3H35A 1DU0A 2C6YA 4BIRA 4HYEA 2EFNA 2ELHA 1OGZA 4HF2A 2CQXA 2YX4A 1HCRA 2IW5A 1W7PB 2KRFA 3NAUA 1LOVA 4KFDA 4FMBA 1EH7A 2CRGA 3N54B 3ALAA 4XKWA 1NB3I 3G1LA 3K69A 4X1EA 1JHHA 2M2EA 2ZMEA 1ITYA 3ZGKA 5IPAA 2F6CA 1FUWA 4LOCA 5J1YA 1ZTRA 1R6RA 2EJRA 2IGNA 4L0YB 2I9WA 7GSPA 4XM3A 4LLGF 5M1AA 2OPTA 3HIIA 2E36A 1W7CA 2R7RA 1MDMA 4EV0A 3F14A 4HM7B 3LAJA 1U0JA 3K1MA 3ZP5A 1N9EA 2HMKB 2VUMJ 1LNIA 1V57A 1X1PA 2YFIB 5BOXA 5AIIA 1JGSA 1KA8A 4RB2C 3DUKA 4BS9A 5HS7A 4OUQA 1JTYA 1OHPA 4J5GA 4OU0A 2CW8A 2QSFX 3VYSB 3W2VA 2CGPA 1Q40A 3ESWB 1W00A 5D83A 3S29A 1RC9A 3HGGA 3RZDJ 3PNVA 1JUSA 4XM4A 5K7HA 3KFQC 3GBGA 3OS1A 3WR2A 3F21A 2IPQX 3COAC 2STTA 2JUGA 3IHUA 3QPTA 4N4NB 4KICA 2EWNA 5E3OA 3DLAA 3PM1A 2QA4I 2CX1A 3GF2A 4QWTA 3BT9A 3AMOB 5IG3A 2OTL3 2FD5A 1K61A 1IN4A 1BR4A 3SX1A 2F5FA 1RUOA 5L3FA 2KZVA 4MEIA 2M7BA 2LG4A 1DU6A 2V9KA 4C9YA 4PUSA 1LDDA 2L2OA 5CQEA 5IYCJ 4G7OF 4C3IJ 1EA2A 1IN6A 5FRNA 3IAS2 2DOAA 2IXSA 5HNFA 3GTGJ 1WNHA 2FBKA 2O8XA 1BC7C 3LSIA 4BY7J 3EQQB 4LYLB 3ZQQA 2EIJH 3F6VA 1ON2A 3EYYA 4IF4A 1WMPA 3FWEA 3KYCB 4JYKA 1IQYA 1NH3A 2W82A 2PMHA 4PJLA 3TQNA 4RGUA 3U21A 2GM4A 3NBBA 3T1BA 4MFDA 4ZZDA 2B24B 3FK7A 2VJ4A 3DKWA 2CFXA 3ECFA 4KT5C 1K28A 2GXAA 1YX5A 3W2WA 1A2PA 3FHNA 4XMYA 1T2HA 3OV8A 4LIUA 1Y8RB 1D0YA 3BQYA 2E2TA 2L4MA 2YUSA 1B2ZA 5KCMA 2CSOA 1LVAA 1YG2A 4E7JA 4UXNA 3DBRB 1TIJA 3N4MA 1ZG3A 3CCE3 2VONA 4Q4ZF 1JKOC 3WG9A 1Z91A 3HHGA 4GDFA 1VQ83 4XDWA 1OYWA 2V9PA 2QUFA 4LB5A 3BQZA 1T0FA 3GYHX 2E2IJ 2LRDA 4H4KC 4ESJA 1W5CC 6RNTA 3DKYA 2ACJA 1UG2A 1QRYA 4NBQA 1FP1D 1RRHA 1S5AA 4Y33A 1E3VA 1IZ1A 3KPHA 4OIRF 3L2WA 4CJNA 1PY3A 2LNBA 3FX3A 1K83J 4EVIA 3X40A 3WE3A 1TW2A 3IKTA 4PK4A 4WX9A 1DMQA 1ULJB 1ZS7A 2EA2A 4G12A 5AEUB 3HUGB 1DDNA 4A3EJ 3S1RJ 2W4SA 1GT0C 3K1PA 1JB4A 4EM1A 3D5IA 3TOBA 3Q90A 3I53A 4MHGA 4ZYHA 1ZRFA 3PGBA 2X0LA 3L00A 2OCCH 4R79A 1I2GA 3OSGA 4AIDA 4I02A 4KISA 2STWA 3VFZA 4NQWA 4MEXF 2E71A 3SQNA 1LB2A 1W6CA 1IK3A 2K86A 3EPZA 1WGXA 1ZGWA 5L3CA 3AG3H 1EH6A 3AGNA 3KCCA 3CMMA 2Y73A 3EC9A 3RQ4A 1CEWI 3DCFA 4C2MJ 2RSXA 3MVPA 3CF5F 1Y8QB 4NNJA 2F98A 1IRXA 3BR1A 2UXNA 5LEKA 2WAEA 3KKGA 1WKMA 1YW7A 1WTHA 2JT1A 1LOXA 1V5GA 1K8A4 5IG4A 1MMGA 3CP8A 2PG4A 5E8GA 3QYBA 1P6RA 2W0QA 2ECBA 2XF3A 1JXSA 2M34A 1DP3A 4JOMA 3SXYA 4AU7A 3LWFA 1IT8A 1SD6A 1A90A 5ILUA 1I2FA 3V99A 4AWXB 3WTUC 3M1CA 3RKXA 3N05A 1IU7A 5F04A 1BI1A 1YQAA 1VQ4I 1MNDA 1QQIA 4XKCA 3T8RA 3H0GJ 2QIYA 1W36D 1IW7F 1B72B 4ENMA 1V4RA 2VQHA 5D5VB 1T33A 3GVAA 4K1UA 1Z7UA 3K7AJ 1R49A 3JRIA 5E1XA 3S17J 1SD4A 2HKXA 3B02A 2BY1A 1N5HA 1WCMJ 1BC8C 5JPUA 3RPUA 1Q1VA 1KZHA 3FKIJ 2STDA 5B3SH 3NWTA 1JB5A 3ECHA 4FR9A 2JVGA 2VODA 1G2HA 1BGSA 3RKQA 3WA3A 2M5WA 2R7XA 4LB6B 2R5ZA 1TLHB 1P7JA 2CG0A 2CFLA 5IT9Z 5IOYA 4XIDA 3WTWC 1B1BA 2GLOA 3I563 1FC3A 4RAFA 1QZYA 4B09A 2GEYA 1O7WB 2XASA 5HLTA 2BY0A 2JN6A 1RR8C 3O2PE 1YI2I 3IAM2 4AVZA 3HIFA 3D79A 3WHOA 1MSFC 1JZOA 1TWFJ 2ZMEC 3ZQCA 1BNGA 3QAHA 3GWRA 3EBYA 2GIZA 2UWMA 3DLLF 1MWRA 5TRDA 3U1DA 1RPWA 4N9HA 3PQKA 5TGTA 3JUMA 2RQQA 1XC5A 2WA0A 2QEX3 4QPOA 2XPVA 4CYCA 2Y9YA 2BMRB 4C2TA 2LKSA 4WXCA 2IT0A 3GZYB 3V7RA 4R9LA 1JB2A 3BCBA 4RGSA 3DEWA 5F1RA 3M4OJ 4Q47A 2VOPA 1W1WE 2F99A 2OQEC 4AUXA 3NQYA 1I3QJ 5EEGA 1YIT3 3WODF 1Q7HA 3CC2I 2CO5A 2OCEA 1TC3C 1VQNI 5E8IA 4BUPA 4XRSA 3IKVA 1ETYA 2V1DA 1QPIA 1B3SA 3I0YA 4JF8A 2EFWA 2E7WA 1ZG1A 1OGXA 1V54H 2VT2A 4CUGA 2Z77A 4HZBB 1IN5A 3P9KA 4WHAA 4L7KA 3B4PA 4G7ZF 4A3CJ 3KP7A 5J8CA 3MEXA 3CNMA 3BR3A 7RNTA 3OL4A 1GXPA 2P8TA 4STDA 1BUQA 1IXRC 4DYCA 2LY2A 1D8JA 3ZFZA 3BG7A 1TP4A 3H1CA 4HQEA 1NK2P 1R4CA 3SXXA 1H88C 2E7XA 1FZPB 1XS9A 2FGTA 3UNGC 4PGGA 3WTZA 1RSNA 3OV4A 1MNLA 5JHFA 2OF7A 2VKEA 3ERMA 4M9ZA 1XCVA 4KA4A 4R8HA 2F48A 5DM6F 2LLKA 3RDEA 4KMFA 1IN7A 4YELA 4A3BJ 1FTZA 1M904 2VC1A 2BW3A 1GV5A 4BKXA 2LQVA 4HQMA 3N8BA 4P1WA 3M1EA 2M1BA 2XB0X 4RM2A 4D9JA 2G9WA 1SEUA 1ZRCA 1BRKA 2RREA 1JZDA 3CCL3 1ZYRF 4U87A 5HLIA 2XRNA 1C0WA 1I6XA 2ZJ2A 3FXMA 3BTJA 4OMZA 4BE1A 1WJ5A 2LMDA 3ABMH 2K40A 3K9TA 2EFOA 1O7PB 2HVSA 3M7GA 2D1VA 4BQOA 1JT0A 4X0GA 3NRVA 3OOPA 4GYGA 5LBQA 1RGHA 4CICA 1YX3A 2FXTA 1GSPA 3S28A 2H8WA 4A3IJ 1WQ2A 3OS2A 5G2GA 1LVNA 4OAYA 1K6OA 1TUHA 2P81A 4ENKA 2W1OA 1WPKA 4M3GA 4XLFA 1Q9EA 2KMUA 5BNGA 1A31A 3GTMJ 1EEJA 2H0HA 1JBTA 5IP7J 2LKPA 4IZZA 4RAZA 2E1OA 1RLSA 3GZXB 3LSMA 2BOLA 3KP3A 2ML6A 3FF2A 2L4AA 3K0LA 2IRFG 2QSGX 1GOUA 3VSKA 3Q2PA 3SVAA 1OQYA 1KU9A 2QCOA 4XRFA 5JFRA 1WFXA 3C3WA 4BE0A 3GWZA 2IA2A 3KIIA 1YJNI 4B8XA 5FLMJ 1FOXA 4CCNA 2E2VA 3LA7A 1ACIA 4E7LA 2OUMA 2OU2A 5GAHJ 1PUFA 1I39A 2EILH 3CLQA 3OWUA 3KLOA 4X6AJ 3CUQA 1RCLA 3HPHA 1MBFA 4RDUA 4YIIA 1EUIC 3J7Yd 1JKGB 4M73A 5BS6A 4HAMA 4BE2A 1M9GA 4PSXA 1B21A 3GFLA 1V58A 2KDOA 3JUQA 4O5VA 3DMCA 4UNOA 1H9GA 3F8CA 3N97A 3DTKA 3CCEI 2ADUA 1F36A 1I2EA 4A0ZA 2ZDJA 3EX9A 1U5TB 2WY8Q 4DZPA 5JHUA 1FLIA 3OR2C 1EG9B 2HQAA 3UNLA 3NQZA 1VFCA 2XF6A 2M8EA 4EMSA 5LHIA 3J7ZI 2XAFA 3U97A 3OYGA 4DGWB 5FLXZ 5BIRA 3L1PA 3MKWB 1AHDP 2ZXIA 4ZTFA 3TW7A 4GL6A 1O7MB 2PMZN 2CH0A 1HW1A 4WK8F 2Z33A 3QRFF 1VQMI 3HIGA 2WY7Q 4CCOA 3LSTA 3LA3A 3BPXA 1BRHA 3EN8A 1MMAA 4BQAA 1TJDA 4M3FA 2GAUA 5LHGA 5IY5H 1BIBA 2OQRA 3D5RC 1HF0A 3CNXA 5GAGJ 1SPUA 3D4AA 3WHCA 5KAFC 5FW5A 2DA2A 1MH4A 4ORLA 3ASOH 4FCYA 3KLNA 2JK3A 2KIFA 2YPRA 3TO6A 3VSYA 3LXUX 1A5JA 2LYCA 1X4OA 1W6YA 2XSHB 1DP7P 2ZFWA 1O7HB 4AEQA 4BL0B 3IP4B 1BN5A 3RSNA 5DUIA 4DBQA 5K1YA 2IGMA 2X6YA 3S67A 2CW0F 1XG1A 2GA1A 2FE3A 2Z5UA 5C3EJ 1C7HA 1LNHA 1MGTA 4A3MJ 3F0CA 2YSRA 1V5EA 3CJQB 1BR2A 4RNZA 4MTEA 1RNTA 1G02A 2D45A 2OA4A 3BR2A 5J3LA 4BHPA 1UCKA 1RGFA 1CYUA 2Y0SA 5IOZA 1OJLA 2F5CA 1I0VA 3M3YJ 4IOAF 2R7DA 1VQKI 3MZ8A 5KAIC 4D0PA 1JI8A 4MLOA 5BPDA 3HOWJ 4CCMA 2O8KA 3JVCA 3WOFB 3JRGA 3EE1A 5AYSC 2DA7A 2W56A 2V1XA 1JJ22 4A0XA 3K2AA 2ZJRF 5E20A 3GTOJ 4BJ5C 4XRSG 1I1SA 2X6WA 2EINH 2FBHA 4BEHB 3EBTA 3M8EA 2FMYA 4HBRA 5EGOA 5IP9J 3X41A 2XUBA 1BNJA 2QLZA 3FBNB 4D7MA 2F5WA 5CF1A 5E1WA 2UX0A 1QAKA 1BNRA 3CTAA 1ETQA 4E7HA 4OOIA 3W2AA 3OYKA 1J7KA 4GB5A 1BOBA 2UUZA 4MQ9F 1NHAA 3F8NA 1WJDA 5B1BH 2DK8A 3V7CA 2BO9B 3FZWA 2VKDA 3J7AO 2JPBA 2Z1DA 4KFCA 1BR1A 4XLPF 2HYGD 4XBXA 3T8NA 4ZDOA 2LP0A 3I56I 1IQXA 2CH9A 4RBNA 1T95A 3CF2A 1E3PA 2IBDA 3FBIB 2HOTA 1Y6IA 1ZGXA 4DYRA 1FOKA 3WU0A 5LD2C 2INXA 4HX7A 1LDKB 3K70C 2E1MB 4LFUA 3Q3FA 2JJ7A 3DBLB 4HM2B 1GXQA 1H0MA 2KF4A 3CCQ3 1OKRA 4NC7A 2DPDA 1TWHJ 1VQ63 1A04A 1FT9A 1IRFA 3KZZA 3BG6A 3ERED 1FOYA 3GTJJ 3LTCA 3WGHA 5DCMB 2XIGA 3GUDA 1IUYA 2A6HF 1ZQ3P 2KPMA 3TO7A 5J8FA 3S1QJ 3F8HA 4XORA 4U0YA 1VQP3 2O3OA 3FMSA 5E1ZB 2K9SA 2XAUA 2C11A 2A68F 1OF5B 3FZVA 3F8FA 3ML6A 4P96A 5E79C 1VQ7I 3NEUA 4CPKA 2XRLA 3KFWX 3W6JB 3A1YA 1L3LA 2K85A 1TP6A 3FMQA 5C4JJ 4H0EA 1FGQA 2MYSA 3HSRA 2KIMA 4B48A 2NNYA 5KK1A 3P7NA 5TJJA 1IGNA 3AG4H 4HOBA 3F9SA 4HZFA 2XC7A 2ZO4A 4O2HA 2H0IA 3K10A 2V1UA 3ABKH 5ICFA 1TU5A 3A02A 3UB1A 1UHSA 2KFDA 4OINF 3LAPA 2WGOA 3D9RA 2V1LA 1ETXA 1R58A 4CDGA 3HOZJ 2Y0MA 4EATA 2CWTA 1JJ6C 3FXKA 3QP6A 1HDPA 3BLZA 3WTVC 5D4SA 1RMSA 1T39A 1S8NA 3LQQA 2W9QA 1FW7A 4HX8A 2H8RA 5FJ8J 4E70A 3IH4A 3OYCA 4HV5A 1BOXA 3MWMA 3OS0A 4PJMA 1ZREA 2CIUA 1ZLJA 4A3KJ 3V98A 1GHCA 2KAAA 2F4IA 3S16J 1XGNA 3CCQI 2LYXA 3D5GA 2EV0A 5K7ZA 2HGCA 1KYZA 3BR6A 1RHLA 1B9MA 2H09A 1IQ8A 3UJMA 5AYRB 1MD0A 2K9NA 4YIRX 3EDPA 1KU7A 1T8IA 1US1A 3SEDA 3X42A 4C3JJ 1ZHFA 2J5PA 4AKYA 4YFNF 4BQQA 4XOPA 2JDIH 1JTXA 3H3UA 1MKMA 3S2DJ 3I3LA 1PJRA 5B5EC 1LRAA 3ZMUA 3JUOA 3EUKL 3RCOA 3STDA 2CFWA 3S32A 1Q814 3RJPA 1SANA 1D1BA 5M3MJ 2H27A 3HDDA 2L54A 4CA0A 4M6YA 3EHCA 3CCS3 1ZN2A 5JLWA 3ECOA 4LGWA 3WDGB 5D5WB 3HKZA 1MOLA 2DU9A 1ZKGA 4PJNA 2RC4A 4EM2A 1P4AA 2Q2EA 4B3XA 2XROA 2ZXHA 5J1RA 2RQPA 1FP2A 3FM3A 5F6FA 1EH8A 2VQCA 5EG0B 2E5NA 4EGYA 4FTHA 1V55H 1TRPA 5EYRA 1AVLA 1FYLA 3DWLE 2K54A 1A6QA 3TOAA 3KZYA 2E1NA 3RGAA 2KQRA 2L01A 4FE7A 3JAMZ 2CX0A 2HDCA 4A12A 1QHGA 2OOVC 3KE2A 2CQKA 1EA3A 1MWSA 5H2FC 2ZSIB 4KIGA 2CWEA 4N6LA 2E2HJ 1RNLA 4HSTA 3AKZA 3MFKA 3JUPA 5ICEA 2CUEA 4DJAA 1P7IA 1RGGA 5FKOA 3G2BA 3OY9A 2X1EA 3PSIA 2V7FA 3DEEA 4Q48A 3CP2A 5FKKA 2GA2A 3W3CA 1ZR2A 3P9IA 2YU9J 3WODG 2ECCA 3TDUC 1DMMA 3IH3A 4HLYA 3ROUA 4MEYF 3QWLA 1TL8A 2D42A 9ANTA 4AC0A 5AIFA 2ZB9A 2L9VA 2VC0A 3GLXA 3IH2A 4HRIA 1T6SA 2Y0SN 3NM2A 2Y74A 2JA2A 1J5YA 1UB9A 3CMAI 4O6JA 2R4GA 1SD7A 2A5WA 2H1LA 3K1NA 1ZG5A 2IUKA 2UUGC 3L2UA 4RBOA 2MSYA 1QZEA 3Q3SA 2LR8A 4KYWA 1YJ93 2ISYA 3L2QA 1SIHA 1K6YA 4KT6A 2WAQA 1CF7A 3MHEA 1TWAJ 3GZ6A 4EM0B 2R5YA 2WOHA 1G3SA 1I8VA 4ENJA 1SMYF 3RDIA 1F43A 1O7FA 2J8XB 5DREA 2Z9OA 2F86B 4J5KA 3HM5A 2AQEA 4N6MA 1QVTA 4PJ0C 1X58A 4G9YA 5GTIC 1W4NA 2FNPA 3L2VA 3MG3A 1IV8A 2MC3A 1IT7A 2HOAA 2ELJA 1GS3A 1BVIA 5ED4A 3DV8A 5EEOA 1ROVA 1QA6A 4HNUA 1WJEA 3OIQA 4IOCF 3MG2A 2PJRB 3G1OA 4WP5A 3V7SA 4PEJA 1G0TA 1ENHA 2E5ZA 3JTGA 3L7WA 2VPLA 4HOHA 5M3FJ 4U7DA 5LRSA 1FSHA 1R5GA 3BLYA 4IXAA 3ZN0A 4EJTA 4HM1B 1PU4A 3QOEA 1UHWA 2HPMA 2L3DA 3O8YA 4I5QA 1R9TJ 2BT3A 1XB4A 1BUJA 4IX7A 4IJAA 4ABZA 3U1KA 4RAGA 3DM8A 1WJCA 5KNLA 4UB6C 4RB3C 1R22A 2DXIA 4B43A 2MH2A 4KZ1A 5ICGA 2F5VA 4FE4A 1ONVA 3K4CA 2DQLA 3RI4A 5CLSA 1IV6A 1S7AA 2I8DA 3QYFA 3RTRA 5ELJA 1B9NA 3I0TA 3GTKJ 2XGLA 4H61A 2HZDA 2MLKA 4UVBA 1X1CA 3KP4A 2ICWG 4YFKF 1ZH5A 3R6SA 3H3VK 5FLVA 1ERDA 1WWXA 1R23A 3HYIA 4G94A 3DGOA 1MBKA 4HA8A 2DN0A 2RV8A 4II2A 3AGOA 3LSPA 3CCU3 4BU4A 3QU6A 2XGXA 3M8JA 1G59A 4B47A 2OTLI 4CCKA 4M71A 3OYEA 2B9SA 1FYKA 1OCTC 1UW1A 4AYBN 4HX4A 3W6KB 2W00A 3HHHA 1BM9A 1KSIA 3EYIA 3A0HC 4RB1A 4O3VA 1A67A 1UI8A 2W03A 1U6GA 4G6QA 1E3RA 3DXJF 3F8BA 2Z76A 4DW6A 5CVVA 2W04A 4MTDA 1O3SA 2O61A 3B7CA 2X51A 2XHKA 4A6EA 4YG2F 2L5QA 2ETHA 2CC3A 2R7VA 1YJW3 1M1XB 7STDA 2CYYA 2NXNB 1K78B 3EUHA 4E4HA 1TBXA 5D81A 2WB1N 1H89C 3CCR3 3B6CA 4NPBA 1MH3A 1B8IA 2XPWA 2JRTA 3FLJA 1O57A 2L7MP 1FMWA 3MYTA 3C1DA 2JUCA
chains in the Genus database with same CATH topology
3CNMA 3FG4A 2GBWB 4STDA 4CDLA 1YVBI 1BUQA 2CFDA 3D3LA 2K0MA 4L8PA 4O02B 1R4CA 3SXXA 4TX4A 2IMJA 3RGRA 3X3XA 4HYZA 2FGTA 3K7CA 3OV4A 1MNLA 3HK4A 1W02A 1GY7A 3RDEA 1RKYA 5ELUA 3S5CA 1M904 3LTAA 2LQVA 3G16A 3N9HA 3N8BA 2XFSA 3CCL3 1OHOA 4FMDA 2BMQB 3PYJA 3CC43 2YX9A 1KWIA 4IIAA 2XSOB 3M8CA 1O7PB 1FGMA 4Q53A 2BMOB 1NDOB 3DGNA 2BNGA 4OVMA 5EVHA 2FXTA 2W9PA 3S28A 3CMA3 1UUVB 1FGTA 4R4KA 1ROAA 3BNEA 1LVNA 5AI1A 1TUHA 3B8LA 5G2GA 3LT9A 3F40A 1JKGA 1EQKA 5IEPA 5IF6A 1TFOA 4K90B 3ER7A 5DRVA 4N6NB 2OTJ3 1W6GA 3LOYA 1DMNA 2IUJA 1FA3A 4XB5A 1A2VA 3HI7A 4R9KA 1OHSA 3GZXB 1ULIB 4EC6A 2CG1A 2ML6A 4XDVA 3FF2A 3Q2PA 3CME3 3SVAA 1GD4A 3BNBA 1OUNA 3KIIA 4WYKB 5BVBA 2JQ5A 1IVUA 1Q864 1TFKA 2E2VA 2CHCA 4X2OA 5CK6A 1SIIA 4RNYA 4OK0A 1DVDA 1K41A 5AIGA 2O9UX 3VF1A 3OWUA 1OPYA 1Y4KA 4AKZA 1Q42A 1YJN3 1IDPA 1VQL3 4FCJA 3J7Yd 1JKGB 2WO0A 3ROBA 1S723 3PXMA 4U13A 1M9GA 2D1WA 1K734 4FMCA 3G713 2W2CA 2RFRA 3JUQA 4R1KA 3WOEB 5JBSA 3DMCA 3MWZA 3FF0A 1GY5A 1OH0A 3NBRA 4MMZB 2HMOB 2ZDJA 2WOFA 3EX9A 1EG9B 3KE7A 2CW9A 3NHXA 4EV2A 3UNLA 4BTWA 1NJI4 3MSOA 3FCSB 1GD3A 3NQZA 3PZWA 1V74A 3U97A 3A76A 4JRFA 1JN5A 2CFGA 1A2KA 4GL6A 1O7MB 3CD63 3DGMA 1W2ZA 5IG0A 3HIGA 1YGEA 5KP4A 2GBXB 2C10A 3EN8A 4EV5A 3MPHA 3FG3A 5IERA 4BTYA 1IV7A 1JRQA 3G4S3 3CNXA 5IENA 1W2B2 5FW5A 3KSED 4N6TA 1SPUA 3DXOA 1VQM3 1M1K4 5STDA 1VQO3 1NU3A 4ORLA 1PFPA 1RN7A 3FGYA 3WMDA 2MC8A 3VSYA 1KQS2 4FCMA 3LXUX 1QJGA 1W6YA 2XSHB 2QA43 1O7HB 2W56B 4AEQA 4XBTA 3FH1A 3UL5A 1U8CB 5CXOA 3FKAA 3S67A 4EBGA 1WQLB 1ZO2A 1QVG2 4LZIA 1C7HA 1LNHA 1F8NA 4BTXA 1IVWA 4IT7A 4HJLB 2Q07A 1CQSA 1HKXA 4RNZA 4WWUC 1KC84 2KRTA 1IV9A 4LMIA 1CYUA 2KXGA 2W6JH 3LTDA 2PNCA 4KFFA 1VQN3 2MF7A 3G0KA 3SOAA 5IW9A 4N6OB 1D6UA 3T0UA 1O7GB 1QAFA 3JVCA 2SBLA 3WOFB 3EE1A 5AYSC 3NV0B 5IEOA 3UL6A 2W56A 3WA2X 1JJ22 2B1XB 2QGUA 2L4VA 2CK3H 3NX0A 3GAXA 3IPTA 4FMAA 3CPOA 1FGRA 2R4IA 3EBTA 4N6V0 4HBRA 5AEWB 1ZX2A 3X41A 3OWSA 2CWUA 5CF1A 1AR0A 2XH9A 2CKFB 2UX0A 2P0MA 3NUVA 1QAKA 4FCZA 2HMLB 2XRXB 3KZTA 4GB5A 1STDA 2A15A 1CYVA 3FZWA 2BO9B 2P05A 2YFJB 4HM3B 3T8UA 1UI7A 4XBXA 5FGOA 3T8NA 4LEHA 1Q7Y4 1IVVA 1D6YA 3DGLA 3EJVA 1OF5A 2GU1A 1IQXA 4HM5B 2CH9A 5TGNA 4RBNA 2INXA 1U5OA 4HM2B 2HMJB 2ZL8A 1O7NB 1ASKA 3V92A 3EF8A 3CCQ3 1ISKA 3K9MC 1VQ63 1QMAA 3GRDA 4IPBA 4KVHA 3LTCA 3IMAB 1OGZA 2CFKA 1VQ53 2GXFA 3F8HA 4KFDA 4FMBA 3N54B 1W5ZA 5CLKA 5I97A 2O3OA 3ALAA 1VQP3 1NB3I 1G96A 1Q824 3K5TA 3PCRA 4ZM8A 2C11A 5LC6A 3OX9A 1OF5B 1E97A 3MG1A 3GZRA 1FUWA 2I9WA 4CCVA 2P09A 3L0RA 3HIIA 1W7CA 2KCDA 1TP6A 2XGNA 3EN1B 3F14A 1N9EA 2HMKB 1JN5B 1FGQA 2HMNB 2M7OA 4HM7B 3OXAA 2YFIB 4J8TA 4N3VA 5AIIA 1J2BA 3DUKA 1SJWA 3F9SA 4OUQA 1OHPA 4R80A 4O2HA 1W00A 1TU5A 1Q40A 5D83A 3S29A 3UB1A 2WGOA 3D9RA 5KP3A 2V1LA 3F7XA 1VQ73 1GY6A 3SOYA 4XM4A 3KFQC 4NHFA 3CU3A 3LYGA 2CWTA 1N9JA 3BLZA 1SQWA 2W9QA 3DZLA 4QWTA 3AMOB 2OTL3 5IG3A 4N6UA 5KP1A 2CIUA 4J9AA 3SX1A 3V98A 4MEIA 2LYXA 2YFLB 1WMOA 4LGQA 4X2HA 1EA2A 1JNQA 1WNHA 1IQ8A 1NO3A 1Q40B 5D82A 2Z6BA 5AYRB 3EQQB 3UJMA 3CC73 3SEDA 1US1A 3X42A 4AKYA 1WMPA 1IQYA 2JDIH 3LTBA 1K9M4 1YIJ3 3NBBA 2B24B 3ECFA 2GU3A 1K28A 1RRLA 3JUOA 3STDA 4HM4B 2CFWA 2E2TA 1Q814 3GZBA 1UUWB 3B4OA 3EHCA 1TIJA 3CCE3 3CCS3 3WDGB 1MOLA 1VQ83 4XDWA 3BB9A 3S27A 4HM8B 1VQ43 2IA7A 3FSDA 4HM0B 1IVXA 1AVLA 4WFOA 5CF2A 2K54A 1RRHA 1S5AA 5EQLA 1E3VA 3RGAA 8CHOA 1QALA 2OCTA 2OOVC 1STFI 3NM7A 1L5GB 3X40A 5JPPA 1VQK3 1N5PA 3F8XA 1DMQA 1OACA 1ULJB 4N6LA 3CXC2 1FGOA 3JUPA 5HGRA 5AEUB 2GEXA 1YHQ3 5IG5A 1DYUA 2CWVA 3Q90A 3LH4A 1JB4A 2WGQA 1KD14 4LSOA 3WODG 3PGBA 3FG1A 1DMMA 4K1VA 4HKVB 3OW22 1IK3A 1W6CA 2D42A 5AIFA 1DVCA 3NBJA 3TDGA 3NM2A 3OWYA 2Y73A 3EC9A 2Y74A 1CEWI 3VGNA 2RSXA 3CPW2 2F98A 2IUKA 3K0ZA 4MJDA 3X3YA 3KKGA 1WTHA 1LOXA 1YJ93 1K8A4 4EXRA 4MMXB 5IG4A 1SIHA 2XR8B 1OCVA 3MHEA 2WOHA 2W0QA 2XF3A 5DREA 1HU9A 4HZ9B 2OOVA 1IT8A 2F86B 4N6MA 3NV0A 1A90A 2XFTA 2Z7AA 3V99A 1WMNA 1W4NA 3HX8A 3E99A 3G8ZA 3MG3A 1IU7A 3PS8A 4O8SA 1IT7A 5EEOA 1GS3A 4RZMA 4KFEA 1ROVA 2PZVA 4WYKA 2QIYA 3MG2A 5A0OB 4WP5A 4K1UA 2P0XA 4PEJA 3F7SA 4HVNA 3X3ZA 1AV4A 1N5HA 2OWPA 1VZZA 5JPUA 1PU4A 4HM1B 2STDA 3CCJ3 1GYBA 1JB5A 4FR9A 2FNQA 4MMYB 3O8YA 3CCM3 2BT3A 2RGQA 3WA3A 3DM8A 2CG0A 1T5YA 2CFLA 4I4KA 1RJOA 4G1MB 4KZ1A 3K63A 3BNCA 3I563 4K61A 1NB5I 2GEYA 1O7WB 2OQEA 3CC23 3JUNA 2P38A 3AMOA 4HM6B 4L8OA 2E2UA 5ELJA 2XGLA 1AVKA 3Q1CA 4H61A 2HMMB 1Z1SA 3GWRA 3EBYA 5BXQA 3EB8A 1N8QA 1NWWA 2XEPA 6STDA 3CCV3 5LC7A 3G6E3 3DGOA 1W01A 3JUMA 1QVF2 3CCU3 3DY5A 2QEX3 3LT8A 3SLUA 3H3HA 2BMRB 1UW1A 5AIHA 1KSIA 3GZYB 3HZPA 4R9LA 1JB2A 4XBYA 3IJEB 4O3VA 1A67A 1UI8A 2W03A 1E3RA 4H3UA 4NREA 1LXEA 2RCDA 3U1WA 1VQ93 2Z76A 2F99A 3NQYA 2OQEC 2W04A 1EKMA 1JV2B 3H51A 1YIT3 3B7CA 2ML5A 3I553 3KSPA 1YI23 2CC3A 3KN4A 1N8R4 3NXJA 1YJW3 1M1XB 3QRDA 7STDA 4JF8A 3I0YA 3LZAA 5D81A 1OGXA 3BNDA 3CCR3 4EYCA 2Z77A 3PCSA 4HZBB 4WHAA 3FLJA 4L7KA 2BHMA 3B4PA 3QK9A 1D6ZA 3MYTA 3LMLA 3MKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNM A;  3CNX A;  3NM2 A;  5FW5 A;  3OWY A;  2GBW B;  4STD A;  4CDL A;  3EC9 A;  5IEN A;  3DXO A;  1BUQ A;  5STD A;  3VGN A;  3EN1 B;  1TP6 A;  3F14 A;  1NU3 A;  4HM7 B;  2HMK B;  4L8P A;  1JN5 B;  4ORL A;  2HMN B;  3FGY A;  3OXA A;  2YFI B;  2F98 A;  3K0Z A;  4J8T A;  4MJD A;  2IMJ A;  4N3V A;  5AII A;  3VSY A;  3WMD A;  3KKG A;  4FCM A;  3RGR A;  3DUK A;  1QJG A;  1SJW A;  3F9S A;  3K7C A;  1OHP A;  4OUQ A;  1W6Y A;  3OV4 A;  2XSH B;  5IG4 A;  2XR8 B;  1OCV A;  3MHE A;  1W00 A;  1O7H B;  1Q40 A;  4XBT A;  5D83 A;  3HK4 A;  3FH1 A;  1W02 A;  3D9R A;  1GY7 A;  5KP3 A;  3F7X A;  5CXO A;  1GY6 A;  3FKA A;  4HZ9 B;  5DRE A;  3S5C A;  4XM4 A;  3SOY A;  2F86 B;  5JPU A;  1WQL B;  1ZO2 A;  3NV0 A;  3CU3 A;  3LYG A;  2Z7A A;  1C7H A;  3G16 A;  3HX8 A;  3BLZ A;  3E99 A;  3G8Z A;  3MG3 A;  5CK6 A;  1OHO A;  4HJL B;  1CQS A;  1GS3 A;  1HKX A;  2BMQ B;  4RZM A;  3DZL A;  4WWU C;  2PZV A;  4WYK A;  5IG3 A;  2QIY A;  4IIA A;  3MG2 A;  2XSO B;  3M8C A;  1O7P B;  4LMI A;  5KP1 A;  4J9A A;  4WP5 A;  4Q53 A;  4K1U A;  4PEJ A;  2BMO B;  1NDO B;  3F7S A;  2BNG A;  4OVM A;  3G0K A;  4HVN A;  5EVH A;  3SOA A;  2OWP A;  1UUV B;  1VZZ A;  2YFL B;  4LGQ A;  1O7G B;  4HM1 B;  4X2H A;  5AI1 A;  1EA2 A;  5G2G A;  1TUH A;  2STD A;  3B8L A;  1GYB A;  1JKG A;  1JB5 A;  3F40 A;  5IEP A;  5IF6 A;  3NV0 B;  5IEO A;  1Q40 B;  5D82 A;  2B1X B;  3ER7 A;  3EQQ B;  5DRV A;  3UJM A;  3SED A;  2QGU A;  1DMN A;  2RGQ A;  3IPT A;  4XB5 A;  4R9K A;  3DM8 A;  1OHS A;  4X2O A;  3CPO A;  3GZX B;  1ULI B;  2R4I A;  3EBT A;  4I4K A;  5AEW B;  1ZX2 A;  3OWS A;  3FF2 A;  2B24 B;  4XDV A;  2GEY A;  5CF1 A;  3ECF A;  1O7W B;  1AR0 A;  2CKF B;  2UX0 A;  3JUO A;  3NUV A;  3STD A;  4HM4 B;  1OUN A;  3JUN A;  4WYK B;  5BVB A;  4HM6 B;  2JQ5 A;  4L8O A;  2HML B;  2XRX B;  3GZB A;  2CHC A;  3KZT A;  1UUW B;  2HMM B;  1STD A;  1Z1S A;  2A15 A;  3B4O A;  3EBY A;  3GWR A;  4GB5 A;  4H3U A;  5BXQ A;  3FZW A;  1K41 A;  3EHC A;  5AIG A;  2YFJ B;  4HM3 B;  1NWW A;  3OWU A;  3T8U A;  6STD A;  1OPY A;  1Q42 A;  1IDP A;  1W01 A;  3JUM A;  4XBX A;  4XDW A;  4LEH A;  3T8N A;  3EJV A;  4FCJ A;  1OF5 A;  1JKG B;  4HM5 B;  3ROB A;  3BB9 A;  3H3H A;  5TGN A;  4HM8 B;  2BMR B;  4U13 A;  5AIH A;  3FSD A;  4HM0 B;  2W2C A;  3GZY B;  2INX A;  2RFR A;  3JUQ A;  4R1K A;  5CF2 A;  2K54 A;  1U5O A;  3DMC A;  3HZP A;  1JB2 A;  1S5A A;  4R9L A;  4HM2 B;  4XBY A;  3FF0 A;  1E3V A;  1GY5 A;  1E3R A;  1OH0 A;  2HMJ B;  1O7N B;  2RCD A;  1ASK A;  3NBR A;  2HMO B;  2Z76 A;  3EX9 A;  8CHO A;  1EG9 B;  2F99 A;  3EF8 A;  3KE7 A;  3NHX A;  3RGA A;  5JPP A;  3UNL A;  1ISK A;  3H51 A;  3MSO A;  3B7C A;  1QMA A;  1DMQ A;  1ULJ B;  3F8X A;  3GRD A;  3KSP A;  3JUP A;  5HGR A;  5AEU B;  2GEX A;  4KVH A;  5IG5 A;  3Q90 A;  1JB4 A;  3A76 A;  1OGZ A;  3NXJ A;  1JN5 A;  2GXF A;  7STD A;  3F8H A;  1A2K A;  3I0Y A;  1O7M B;  1DMM A;  3LZA A;  4K1V A;  5D81 A;  1OGX A;  5CLK A;  4HKV B;  2Z77 A;  5IG0 A;  4HZB B;  5KP4 A;  2GBX B;  3FLJ A;  3EN8 A;  3OX9 A;  4L7K A;  1OF5 B;  1E97 A;  3B4P A;  3MG1 A;  5AIF A;  5IER A;  3MYT A;  3GZR A;  2I9W A;  3MKI A; 
#chains in the Genus database with same CATH topology
 3FG4 A;  4CDL A;  1YVB I;  3BDD A;  3HXL A;  3D3L A;  2K0M A;  1TW3 A;  4O02 B;  3HPG A;  2MFZ A;  2ID3 A;  4KIB A;  2VXD A;  2IMJ A;  2M45 A;  3RGR A;  2EFQ A;  4HF0 A;  3V4G A;  2VOO A;  3K7C A;  2DPU A;  4HYZ A;  1E3O C;  2RN7 A;  1TQP A;  3HTU A;  3P9C A;  5HOD A;  4IHY A;  1I3I A;  1J59 A;  5EEH A;  2VAS A;  5GP9 A;  1RGL A;  3LNQ A;  3AHW A;  1KON A;  1X1A A;  5LGU A;  3RPQ A;  1IDZ A;  1LQ1 A;  2OAZ A;  1RKY A;  3S5C A;  4AD9 A;  4EJO A;  4PFP A;  4UV8 A;  4E6K G;  4QTR A;  1YNV X;  1RR7 A;  2UXX A;  5H6R A;  1LVK A;  2JRM A;  2DQR A;  4FMD A;  1TT5 B;  2KRC A;  3R4K A;  2F2E A;  5KVR A;  1LQG C;  3PYJ A;  3UR3 C;  2B0L A;  2YX9 A;  1KWI A;  2XSO B;  4XQF A;  1SC7 A;  2K7L A;  3OOU A;  5B1A H;  4CXF A;  2GOM A;  2CUZ A;  3VYT B;  1FUS A;  2C4B A;  5FKN A;  2BHZ A;  1YIT I;  4GHO A;  4ILF A;  1PYV A;  1K7A A;  1R1U A;  1PUF B;  2A5Y B;  1VQ9 I;  3FXR A;  3AG1 H;  3CMA 3;  1G4D A;  1ETW A;  1JKG A;  5DS9 A;  1RN1 A;  5IF6 A;  1TZL A;  1QHH D;  5G1K A;  4A69 C;  5DCF A;  5K7F A;  4L18 B;  5DRV A;  3LOY A;  2IUJ A;  3TO9 A;  1FA3 A;  5HNH A;  2O03 A;  1OHS A;  3HRT A;  3F72 A;  4P9F A;  3ZN1 A;  4EC6 A;  3G6E I;  5DV5 A;  4CZC A;  3LOC A;  4XDV A;  3CME 3;  4IRH A;  1K79 A;  3DF8 A;  2ZBK A;  1YHQ I;  4WYK B;  2P5L C;  5BVB A;  4F91 B;  1IVU A;  5JLX A;  1BIR A;  3HRS A;  2HTJ A;  2FSW A;  1TFK A;  4X2O A;  1R5H A;  3BZ6 A;  5L3B A;  1YRN B;  1Y0N A;  1SII A;  1DVD A;  1HA8 A;  1K41 A;  1APL C;  2K3P A;  1ETV A;  1D3Y A;  4NUB A;  1Y4K A;  1YJN 3;  3TGN A;  1FYM A;  2BU4 A;  2WC2 A;  4UVC A;  1IRZ A;  2WO0 A;  1S72 3;  3LSG A;  1X1Y A;  4U13 A;  1K73 4;  3AL0 B;  2DDB A;  1XD7 A;  3GX4 X;  1PP8 F;  2W2C A;  5K5O A;  3G71 3;  3OYN A;  2RFR A;  2EFP A;  4BHB A;  1XX5 A;  4ZJZ A;  1OH0 A;  3S2W A;  3NBR A;  3FHZ A;  2VJ5 A;  3Q9S A;  2KP6 A;  4ITV A;  3KE7 A;  4EV2 A;  1IO2 A;  2N8G A;  2JA5 J;  1GD3 A;  3GXO A;  2FU4 A;  1V74 A;  1O3T A;  1ZLK A;  3ZMT A;  2CV1 A;  1B4A A;  3A76 A;  1SAR A;  2CFG A;  5IT3 A;  3IL2 A;  1M1E B;  3ELK A;  4LG0 B;  1YVS A;  3JRF A;  2QVO A;  4CYC B;  2JQ7 A;  4WF2 A;  4JBA A;  3SFI A;  3LL7 A;  3MKL A;  1W2Z A;  2I5U A;  2WV0 A;  5KP4 A;  3ZR8 X;  2JVH A;  3QOD A;  2IS4 A;  4XIC A;  1HBX G;  3A0B C;  1JRQ A;  3G4S 3;  5IEN A;  3ZQI A;  1VQM 3;  5STD A;  2IEK A;  2Q0O A;  2K02 A;  2X48 A;  3CO7 C;  2NRA C;  4RGR A;  2AQF A;  3FGY A;  3WMD A;  3F23 A;  5F27 A;  3E6M A;  1T0F C;  1H9T A;  1GOY A;  4G8X A;  3BJO A;  3RNT A;  2V6C A;  2QA4 3;  2W56 B;  4XBT A;  3DKX A;  3FH1 A;  3UL5 A;  2XPU A;  1LE8 A;  1KQ9 A;  4MQV A;  3HGY A;  1OLT A;  3NWS A;  2O9L A;  3JRA A;  1U8C B;  4EBG A;  2X4H A;  4IHS A;  3I4P A;  1WQL B;  1ZO2 A;  5RNT A;  2QQA A;  1QVU A;  5L3E A;  1UAA A;  2HI3 A;  1VI0 A;  3B73 A;  4W97 A;  4IT7 A;  4KT3 B;  1FIP A;  4HJL B;  1PP7 U;  1HKX A;  2A3S A;  2IY2 A;  3BIR A;  4WWU C;  2CQN A;  4BU2 A;  4J19 A;  3IWF A;  2XKP A;  2DFF A;  2LVS A;  1Y39 A;  1IV9 A;  1U8B A;  4D5C A;  2R0Q C;  3FIS A;  2LBF B;  4Z6Y A;  5DM7 F;  4UHT A;  4G6T B;  5LHH A;  3VB2 A;  1T08 B;  4HDV A;  2MF7 A;  2E34 A;  5IW9 A;  4CYD A;  3OYH A;  2Y69 H;  2VQL A;  1I70 A;  3LSJ A;  1O7G B;  1FOW A;  2IA0 A;  1A6I A;  2KIS A;  2E2J J;  4S04 A;  3KCH A;  4RGX A;  2L4V A;  4AIH A;  4EGZ A;  4E7I A;  3BG3 A;  2CK3 H;  3HRM A;  3IPT A;  3PNY A;  4BAC A;  3NX0 A;  1ULY A;  4XLA A;  3H92 A;  2FUG 2;  5BQT A;  3CPO A;  4FMA A;  5JR3 A;  2W48 A;  4Y4R A;  5AEW B;  5HDK A;  1W7P D;  2HPI A;  5ILV A;  4L9V A;  2O5R A;  2IVM A;  3IWZ A;  1I1G A;  4XRM A;  1XGM A;  3GEZ A;  1T3B A;  2CKF B;  1VND A;  1I3F A;  2FNA A;  4KMU X;  3HOH A;  3NUV A;  3RPU D;  2DO7 A;  2MAB A;  3SDB A;  3Q0V A;  2HML B;  2ZC2 A;  4M9X A;  2XRX B;  2PN6 A;  2A15 A;  2DCE A;  1OCP A;  2VPR A;  1CYV A;  2EZK A;  1LQM B;  2DT6 A;  2JWT A;  2RNG A;  5DDG A;  2P05 A;  4HM3 B;  4WCG A;  1UI7 A;  2PLY A;  2KF6 A;  4M72 A;  2HOE A;  3CES A;  1Q7Y 4;  2F56 A;  2DFI A;  2IAI A;  2CV0 A;  1BW5 A;  3FXO A;  3DGL A;  1OF5 A;  3EJV A;  4L0Z B;  2KZG A;  4MFE A;  4HM5 B;  2X6X A;  2NVQ J;  5D4R A;  4GO1 A;  1TTO A;  1G8X A;  2HNH A;  1PYL A;  1OR7 C;  1J09 A;  2NAZ A;  1B2M A;  2O3F A;  4M3D A;  4XKV A;  2TCT A;  1FJL A;  1X3Z B;  3KEQ A;  4FX0 A;  4HPQ A;  5EZG A;  4GYI A;  1ASK A;  2KDZ A;  1VQQ A;  2D5V A;  4PZJ A;  1IYY A;  3ZQF A;  1SFX A;  3GRD A;  1FTT A;  2EK5 A;  2O6G E;  2F4O B;  3BR5 A;  3PUB A;  1U78 A;  1W5Z A;  2NVX J;  2KIU A;  1G96 A;  5D6F A;  2H1K A;  5EEA A;  3HOX J;  3PCR A;  4ZM8 A;  3E0J B;  3OX9 A;  1XDU A;  5CVI A;  1TQI A;  3I54 A;  3Q0U A;  5HLH A;  5HS8 A;  2F4M B;  3GZR A;  2KKO A;  2BBY A;  2HQN A;  3S3O A;  1U5T A;  3L0R A;  3X2Q H;  1TQM A;  1O7L A;  2QYO A;  4I0A A;  3WGI A;  3HG9 A;  2KCD A;  3GZ5 A;  2JSC A;  4XN0 A;  2XGN A;  3F3X A;  3FDY A;  3ZQH A;  2XV4 S;  5J6X A;  3QPH A;  4IRG A;  4CO8 A;  1JN5 B;  2DMQ A;  1S5L C;  2HMN B;  1LNW A;  3V8J A;  3OXA A;  3JSP A;  3OYF A;  2A6T A;  1J2B A;  2DOF A;  2EZI A;  1SJW A;  1DGR M;  1YW8 A;  1Y0U A;  4ESF A;  3ZMZ A;  1X3W B;  4LG3 A;  4CCJ A;  1MJA A;  4HF1 A;  1KU3 A;  5CJ9 A;  4B44 A;  2MH9 A;  5KP3 A;  3K4B A;  4JX5 A;  4XLE A;  3F7X A;  1VQ7 3;  2CJJ A;  2DW4 A;  3SZP A;  1OCZ H;  2R5Z B;  4NHF A;  3LYG A;  2H94 A;  2OZ6 A;  4GXO A;  3SZG A;  1SFU A;  2FF4 A;  1SQW A;  1H8A C;  1X1B A;  3GFM A;  4I2O A;  1I5Z A;  3HZJ A;  3WTX C;  2CUJ A;  1R00 A;  1Z0X A;  3DZL A;  1MJB A;  4RA2 A;  4N6U A;  2WAF A;  1LKX A;  1FMV A;  1YW9 A;  1BNS A;  4N0B A;  1RKT A;  1I0X A;  3K4L A;  4M9S A;  2K9M A;  2NVY J;  3SYU A;  1AU7 A;  2PFB A;  2DMN A;  3EET A;  1U3E M;  1WMO A;  2YFL B;  4LGQ A;  4X2H A;  1W5S A;  3A4C A;  3A01 A;  4ON0 A;  3H0D A;  2MA3 A;  4UUV A;  2X85 A;  2P7V B;  2CS3 A;  1NO3 A;  2IP2 A;  1ZEL A;  2Z6B A;  3E1S A;  1AOY A;  4UUT A;  1R36 A;  3HOU J;  1UUG B;  3OMY A;  2VKH A;  4IHV A;  1T98 A;  1EV7 A;  3CD6 I;  4A3D J;  2IGK A;  3LTB A;  2R92 J;  1K9M 4;  3TP3 A;  2PQ8 A;  2QBY A;  4I98 B;  1AKH B;  1O3R A;  5DCM A;  2GU3 A;  2RKH A;  3CJT B;  3H5N A;  3ZCO A;  1MGW A;  1UMQ A;  1RRL A;  2AAD A;  2HFH A;  4EQQ A;  3CCJ I;  3LSR A;  4A3J J;  1S3J A;  2COM A;  5EJC A;  3OL3 A;  1BU4 A;  3GZB A;  1UUW B;  2FML A;  4Z2Y A;  3KYD B;  3QU3 A;  2QSH X;  2VIX A;  3OR1 C;  2EV5 A;  1JBS A;  2ZNZ A;  3GTQ J;  1MSE C;  3ZOB A;  3HEF A;  4HV6 A;  1BI2 A;  5LGT A;  2RNJ A;  3F9K A;  1FX7 A;  5F64 A;  2NVU B;  4A5N A;  4BEH A;  4AIJ A;  1GMQ A;  3S27 A;  1VQ4 3;  4A93 J;  5EGO B;  2X9D A;  3MZY A;  3CJR B;  4KN4 X;  3VWB A;  4GSP A;  4HM0 B;  4RNT A;  4WFO A;  1YS7 A;  5CF2 A;  9RNT A;  2ZXW H;  4MNU A;  2JMW A;  2M87 A;  1QZZ A;  8CHO A;  4XL9 A;  2VE8 A;  3DPU A;  3NM7 A;  1IXS B;  1STF I;  5JPP A;  1VQK 3;  1N5P A;  3GCM A;  3F8X A;  2VI6 A;  3CXC 2;  1FNN A;  1FGO A;  2LD5 A;  5HGR A;  1YHQ 3;  2ESH A;  3MN2 A;  2GSP A;  4A3F J;  3AAF A;  5EF6 A;  2CWV A;  3HRU A;  3LFK A;  3LQR A;  3CME I;  1KD1 4;  4EW5 A;  4LSO A;  3GLL A;  3FG1 A;  3ABT A;  1XSX A;  4E7K A;  2DMP A;  3DQV C;  3L2R A;  3ONQ A;  4FAS D;  4L5J A;  4BQN A;  3OW2 2;  5K5R A;  4GRI A;  4PDK A;  3J80 Z;  2DK5 A;  1B72 A;  2DBB A;  3V42 A;  3WE2 A;  5DYM A;  1DVC A;  3C2H A;  2MW8 A;  3NBJ A;  2ZXJ A;  3Q0W A;  4EEF G;  2LTP A;  3TDG A;  3J7A Y;  3OWY A;  4XSZ F;  3G73 A;  1RZ4 A;  3QYE A;  3ZQ7 A;  2NS7 A;  4XLH A;  5DTD A;  3VGN A;  2DMU A;  2M3A A;  2MD5 A;  3CPW 2;  3K0Z A;  4MJD A;  1XN7 A;  2JA7 J;  2HWV A;  1HLV A;  1WSU A;  4I99 C;  5FFX A;  4MMX B;  2COB A;  4LG0 A;  3Q5F A;  4RAY A;  1HKS A;  1OCV A;  4JQF A;  3F6O A;  3DP7 A;  2P6T A;  3BG5 A;  2CMP A;  2P0W A;  4WXH A;  5DD8 A;  3IRQ A;  3CCL I;  2BHY A;  5J40 A;  4HZ9 B;  3ZG5 A;  1T56 A;  1UST A;  3WU2 C;  2OOV A;  5HLG A;  4AIK A;  2Z7A A;  3HX8 A;  4ZYG A;  3K4M A;  3E99 A;  3G8Z A;  1RN4 A;  1WI3 A;  4O8S A;  2H0G A;  2IS1 A;  4C30 A;  3IRR A;  4RZM A;  3FM5 A;  2YS9 A;  3HL2 A;  1BBY A;  4BGD A;  2PZV A;  3JRD A;  3BPV A;  2KF5 A;  1IN8 A;  3V8K A;  5M5Y J;  5A0O B;  1WRJ A;  4IRI A;  2KJC A;  3F7S A;  1YFH A;  1WVR A;  2OQG A;  2IJL A;  3HOT A;  3X3Z A;  1Y56 A;  4D7N A;  1B59 A;  1VZZ A;  3OWT A;  2FOW A;  3RQI A;  3CCJ 3;  3L09 A;  1BRG A;  4MMY B;  1MZB A;  2DOE A;  3G71 I;  2BZT A;  2WAD A;  3E6B A;  1G3Y A;  4J01 A;  3CCM 3;  1EJ9 A;  1YE9 A;  2FJ1 A;  1JHF A;  2LKX A;  4RMN A;  1JKR C;  2ZNY A;  1LEA A;  3REO A;  1JGG A;  1BRJ A;  1EKE A;  2H6C A;  4I4K A;  1RNB A;  1RJO A;  2DJI A;  1BIA A;  1BNE A;  3K63 A;  4XNF A;  5A2Q Z;  3BNC A;  1YJW I;  1DPU A;  1TWG J;  1NB5 I;  3RIR A;  3WTT C;  4Y3O A;  4BH9 A;  3WHB A;  3CC2 3;  5CVU A;  3S93 A;  3ABL H;  3AMO A;  3JUN A;  4HM6 B;  4L8O A;  3I71 A;  2E2U A;  5HDG A;  1E0E A;  1XTA A;  4PCQ A;  2HMM B;  1Z1S A;  1LEB A;  3HSF A;  1USS A;  5BXQ A;  4DKI A;  3EB8 A;  1RDS A;  2E1C A;  4DQ2 A;  4Y17 A;  2XEP A;  3S14 J;  2PX9 A;  2OC6 A;  1W01 A;  3VSL A;  1QVF 2;  3A5E A;  2D1H A;  3E6D A;  4R1H A;  3SLU A;  3H9J A;  4UUS A;  3BG9 A;  2QEX I;  3JRB A;  3CCU I;  3CMY A;  1HW2 A;  2PEX A;  4V2G A;  2LOO A;  4NRE A;  1LXE A;  5DEQ A;  1VQ9 3;  4UVA A;  4BYY A;  1EKM A;  2FXA A;  1DET A;  1JV2 B;  3H51 A;  1MW7 A;  2GBY A;  4DNC A;  4QPQ A;  1IG7 A;  2ML5 A;  1OR7 A;  3KSP A;  1YI2 3;  1BSD A;  3G3Z A;  1BA5 A;  1MDM B;  2X1C A;  4XLN F;  1HKT A;  3H9Q A;  4YRV A;  3QRD A;  3LZA A;  5F1J A;  1OYI A;  5TIS C;  1HOM A;  4EJV A;  3GFI A;  4EYC A;  1KGS A;  3PCS A;  1BW6 A;  2LY9 A;  1GVD A;  4FET A;  5E3L A;  3OYD A;  4EJW A;  2BHM A;  2XF7 A;  2PJR A;  3MZH A;  4PGH A;  1QO0 D;  3LML A;  3A03 A;  1Z3Y A;  4KIF A;  4C2U A;  2IS2 A;  2CFO A;  3TKY A;  3MKI A;  3BCA A;  3TBI A;  1WJA A;  2OD5 A;  3OYA A;  3S2H J;  5G1L A;  1W4M A;  1I3A A;  1KQ8 A;  2VBZ A;  5CKT A;  2ELK A;  4TX4 A;  1VQ5 I;  4A0Y A;  1N75 A;  3X3X A;  3TP0 A;  3I64 A;  2UGI A;  1R71 A;  1ETK A;  4GGG A;  2X6O A;  4Q5S F;  1FSE A;  2XDV A;  3FK6 A;  3GSP A;  3HUG A;  2BXZ A;  2PMU A;  3HK4 A;  2ME0 A;  3DTE A;  3FXL A;  4BXX J;  1W02 A;  3CDI A;  3OYI A;  4K2E A;  4RLQ A;  4GFB A;  1XMX A;  4LD5 A;  4B3A A;  3ZPL A;  3N9H A;  2XFS A;  4NQW B;  3CLO A;  4W1U A;  2BMQ B;  5ICC A;  1RTU A;  1UCL A;  3PFI A;  1POG A;  3CC4 3;  4IIA A;  3VPR A;  4XLC A;  2VBW A;  3R0A A;  4Q53 A;  2BMO B;  1XMK A;  4PSW A;  1I6H J;  4L5E A;  2YX7 A;  1ETO A;  2BNG A;  2SAR A;  2NVT J;  4OVM A;  3ZMD A;  2W9P A;  2XVC A;  4MGR A;  2PI0 A;  1UUV B;  1FGT A;  4R4K A;  2XAG A;  1X1U A;  5AI1 A;  3NAR A;  4WXD A;  1GMR A;  3B8L A;  4ZC3 A;  3LT9 A;  1EQK A;  3BTL A;  1YYV A;  4K90 B;  3GW2 A;  1FYS A;  4OIQ F;  4OIO F;  1AY7 A;  2HR3 A;  1W6G A;  4N6N B;  2ID6 A;  1DMN A;  2OTJ 3;  1BOA A;  3H3Z A;  1G3W A;  3C2G A;  2L02 A;  4XB5 A;  3HI7 A;  4R9K A;  2DYR H;  3LFU A;  1ULI B;  2OJE D;  2R7Q A;  1XPX A;  2CG1 A;  5F0C A;  3LSK A;  1FIA A;  2GZW A;  3KP6 A;  3LSH A;  3CCV I;  1S72 I;  1CGP A;  1MWU A;  2HTS A;  1VQL I;  2KLO A;  4BJT A;  6PAX A;  3AHS A;  2A61 A;  3BNB A;  1OUN A;  2P6S A;  1Q86 4;  2QKL B;  2CHC A;  1XCB A;  1UHM A;  5GAD J;  4Y7N J;  2Y2Z A;  4RB0 A;  1UFM A;  2O9U X;  2DLL A;  1OPY A;  4AKZ A;  1U9N A;  1XGS A;  3SJM A;  1IDP A;  2V79 A;  1VQL 3;  3F8M A;  4P55 A;  4FCJ A;  4CHU A;  4IEJ A;  2VJI A;  2R41 A;  5KHD A;  2DMT A;  1G3T A;  4P9U A;  2O7O A;  3QQA A;  1VQ8 I;  1B2X A;  3WOE B;  1P4X A;  1XSD A;  1MWT A;  4PJJ A;  3DPL C;  3DU5 A;  3KET A;  5J47 A;  3CCS I;  3DGY A;  1GY5 A;  3HSE A;  3FF0 A;  5HDN A;  1RGK A;  3PQJ A;  5AIQ A;  4KIT B;  1CQT A;  4MMZ B;  2IA1 A;  3C7J A;  2EIK H;  1F5T A;  2CW9 A;  3NHX A;  4LJZ F;  4G7H F;  2P7C B;  1NJI 4;  4LIV A;  3FCS B;  2K3D A;  3ISP A;  1FY7 A;  1Z3X A;  4HNT A;  3HOV J;  1IRG A;  1N25 A;  1LE8 B;  4JRF A;  4FX4 A;  1LDJ A;  1A2K A;  2A07 F;  2R93 J;  3JSO A;  3QPS A;  1R4M B;  2DTZ A;  3NQO A;  1P2F A;  4CGZ A;  5IG0 A;  2MLG A;  4ZZL A;  1YGE A;  2GBX B;  1NK3 P;  1GOV A;  4BL3 A;  4EV5 A;  2QF7 A;  1DUX C;  5M5X J;  4QSH A;  1NG7 A;  3E7L A;  3BY6 A;  2KJB A;  4B1R A;  2WWY A;  3KSE D;  4DZJ A;  4DOZ A;  4ESB A;  3DXO A;  1M1K 4;  2HQ5 A;  1WH7 A;  1ZRD A;  1STZ A;  3GTL J;  3DH2 A;  2R7T A;  1PFP A;  2K4J A;  1AQZ A;  2HVR A;  2DA6 A;  2L9R A;  1O3Q A;  1QJG A;  1D1A A;  1SVL A;  3BC8 A;  3EUH C;  2UZK A;  1LJ9 A;  1BJZ A;  3RYR A;  2R7Z J;  4II3 A;  2FX0 A;  4D5F A;  3T5X A;  1OCC H;  1B8I B;  2AAE A;  1J2X A;  1PDN C;  3O6B B;  4IPA A;  2VJJ A;  1BNF A;  4UB8 C;  3K70 D;  2Z3Y A;  4BTX A;  1MNE A;  2Q07 A;  3OYL A;  1CQS A;  1YRN A;  1Z67 A;  2DDA A;  1UCI A;  2KRT A;  5LGN A;  1IAW A;  4S0H B;  4J00 A;  4CH7 A;  2CUF A;  2DAO A;  3LTD A;  2PNC A;  3ZQL A;  1ZR4 A;  4JP0 A;  1VQN 3;  1P9Q C;  3G0K A;  3TED A;  3SOA A;  2ZA4 A;  3HOS A;  3SDG A;  4L5I A;  2R7S A;  3BU4 A;  3I55 I;  3T0U A;  2BE5 F;  2CW7 A;  1QAF A;  4IL6 C;  5FGM A;  3FKJ A;  2SBL A;  1LOY A;  4ETS A;  5IEO A;  2HXI A;  3C18 A;  5M19 A;  2B1X B;  2IGO A;  2BGC A;  4I09 A;  1UCJ A;  5F0F A;  1S6L A;  5B66 C;  3E97 A;  2GOX B;  3S3N A;  2LK2 A;  3I58 A;  1NTC A;  1VQP I;  1FGR A;  3E5U A;  1UCR A;  2V26 A;  5D5X B;  1SAU A;  3KX2 A;  3CDH A;  5EG0 A;  2NS8 A;  1OPC A;  1AR0 A;  3FXJ A;  5D8K B;  2EZH A;  2XH9 A;  2P0M A;  1HQC A;  3BOQ A;  3VEP A;  4FCZ A;  2AHQ A;  2LRE A;  3K4N A;  1VQ6 I;  2BEO A;  3KZT A;  2FOK A;  2HZT A;  5CVJ A;  1HYF A;  4LMY A;  1FEX A;  2EZL A;  3GZN B;  3VOE A;  2YFJ B;  1YIJ I;  2QQ8 A;  2QZ8 A;  2V9V A;  1PUE E;  5FGO A;  2G0E A;  2M9H A;  3KP2 A;  3GFJ A;  4L9J A;  2F5D A;  4CZZ A;  4ZYD A;  4IHW A;  2LY1 A;  5K5Q A;  3E6C C;  1R5I D;  1QU3 A;  1FPQ A;  2ISZ A;  5TGN A;  4NB5 A;  4F52 A;  2K27 A;  2L1S A;  4I76 A;  1SFE A;  3HTS B;  3E5X A;  3IV5 A;  3H9G A;  1IUF A;  3PFY A;  3S1N J;  1U5O A;  2F5M A;  2TDX A;  1WI9 A;  2ZL8 A;  1AWC A;  5AIP A;  3L9F A;  4YEJ A;  4BXF A;  5FKL A;  3U2R A;  1R7J A;  1WJF A;  5IYB J;  3K9M C;  1S9H A;  3M07 A;  1QMA A;  2MD0 A;  1MJ9 A;  2VL8 A;  4FHT A;  5F08 A;  4DIQ A;  2BVM A;  1UGI A;  4KVH A;  2P4W A;  3IMA B;  2FQ4 A;  3S15 J;  5J4Y A;  2CFK A;  4L9T A;  1VQ5 3;  2GXF A;  5C4X J;  2ZFU A;  4BL2 A;  1DQU A;  2ME6 A;  4G6D A;  1MBE A;  5CLK A;  5I97 A;  1Y1V J;  2QQB A;  1Q82 4;  3K5T A;  1ORK A;  3CUQ B;  2XGC A;  2QKM B;  2R7W A;  1TT0 A;  1CF7 B;  2VKV A;  5ERI A;  3I4N J;  5LC6 A;  1E97 A;  3R61 A;  3MG1 A;  2R5Y B;  3J80 K;  3AFH A;  4IQJ A;  4NC6 A;  4CSW A;  4CCV A;  2P09 A;  2KT0 A;  2HKO A;  4WWC A;  1JKQ C;  2BIR A;  2HOH A;  3EN1 B;  1N8R 4;  1QBJ A;  5GPC A;  2M7O A;  5GTH C;  4A6D A;  1D5Y A;  3MQ0 A;  4BDZ A;  4J8T A;  4N3V A;  1X4P A;  4YIF A;  2CG4 A;  5LLQ A;  1ZGJ A;  1MBG A;  2DT5 A;  4HSR A;  4R80 A;  4AM3 A;  5LEJ A;  4LLN A;  2XB5 A;  4MO7 A;  2JPC A;  3MD2 A;  4KNY A;  3JAM K;  1YGW A;  1HST A;  2ZHX B;  5M18 A;  2FQ3 A;  1GY6 A;  5CVR A;  3SOY A;  2H6B A;  1W7P A;  2L9S A;  3KEO A;  2Q8K A;  4XR6 A;  2WB1 A;  2BYV E;  3CU3 A;  3HOY J;  2ZCW A;  1N9J A;  3JRE A;  3KIO A;  1IC8 A;  2KHM A;  1XGO A;  4HW0 A;  5DUK A;  3SZT A;  3PIP F;  1X1X A;  1KQ0 A;  3HB9 A;  5L3D A;  5FO5 A;  1LFU P;  3JR9 A;  3WTS C;  1S29 A;  1N77 A;  4AYB A;  2OZU A;  5KP1 A;  5FRO A;  4A3G J;  4J9A A;  2RDP A;  1WZ2 A;  1SFK A;  2KF3 A;  3QPL A;  3WTY C;  4BBR J;  3DFG A;  1RIO H;  1F4K A;  3BTI A;  2K9L A;  1MGR A;  4ZDP A;  1JNQ A;  4BJ6 C;  3G4S I;  3GTP J;  1BSA A;  1OMI A;  2HU9 A;  1E17 A;  1Q40 B;  1Z6T A;  3M9A A;  5D82 A;  3B6A A;  3VYU B;  3CC7 3;  3BZC A;  3EUA A;  1IXC A;  5IT9 K;  4A5M A;  1X3U A;  1X1D A;  3ZXS A;  1RGA A;  2E19 A;  4NHJ A;  1YIJ 3;  3K4K A;  4PFO A;  1ODD A;  5JVG F;  3CCM I;  4ZH4 F;  2G7U A;  1X2N A;  1Z05 A;  2M8G X;  1MNM C;  4OIP F;  3GO5 A;  2FRH A;  2JTV A;  1HW5 A;  4HM4 B;  3IUO A;  1O4X A;  1BAN A;  3B4O A;  2HDD A;  4P5O A;  1ZGA A;  2MG4 A;  3A2K A;  4O3M A;  3TDZ C;  2NOJ B;  1HDD C;  3EQL F;  3DU6 A;  1BI3 A;  2YU3 A;  1F9N A;  3PIO F;  3BB9 A;  1CH0 A;  2Y31 A;  4HM8 B;  1Y1W J;  2IA7 A;  3FSD A;  2EA4 A;  1TNS A;  1IVX A;  2MC4 A;  2K4B A;  5EQL A;  1REP C;  3JCU C;  1FBS A;  5CPR B;  2PJP A;  5HOH A;  5EZH A;  2YR2 A;  2D2W A;  1QAL A;  2OCT A;  5FB2 A;  1L5G B;  4F93 B;  2FBI A;  2L7F P;  1XMA A;  4IKF A;  1OAC A;  4IQ4 A;  2BY2 A;  2GEX A;  1YJ9 I;  1HZ1 A;  5IG5 A;  1DYU A;  4F55 A;  1QNT A;  3LH4 A;  2HEO A;  3DTI A;  2WGQ A;  2ESN A;  1K4S A;  4K1V A;  2R3S A;  2VQG A;  4N4O B;  3S1M J;  4A3L J;  4HKV B;  4ANJ A;  1P4W A;  2QWW A;  1OYY A;  2L0K A;  3FXU A;  1SD5 A;  5ILS A;  2BW3 B;  2DYS H;  5DD4 A;  5GPA A;  1RET A;  2DI3 A;  1HXD A;  5FFZ A;  2XGD A;  2MGQ A;  2ZKZ A;  3TMO A;  1FWZ A;  4JX4 A;  1RES A;  4Y15 A;  2W7N A;  2QEN A;  3QOP A;  4LK0 F;  3J81 K;  3A01 B;  1BL0 A;  3H5R A;  3LMM A;  3X3Y A;  4JK1 X;  3JRH A;  1GMP A;  2DT7 B;  2UV1 A;  4TV7 A;  1B2S A;  3ASN H;  1VQO I;  4EXR A;  3D0S A;  1WH5 A;  4UV9 A;  3CC4 I;  2XR8 B;  1JE8 A;  1IJW C;  3OYM A;  2E60 A;  1V3F A;  4XBF A;  4I6Z A;  1DGW Y;  4F7Z A;  4ZYA A;  2HXO A;  5C44 J;  1HU9 A;  2KRH A;  5AON A;  3J81 Z;  2QBY B;  2KIQ A;  3NV0 A;  1OFC X;  2A05 A;  2M0C A;  2XFT A;  1P92 A;  5J1U A;  3SEZ A;  5JI6 A;  1WMN A;  3FIW A;  3PS8 A;  2LF8 A;  1X2M A;  2JA6 J;  4D1Q A;  2O0Y A;  4KFE A;  2LH9 A;  1ZK8 A;  2R7U A;  4C3H J;  4WYK A;  3V8L A;  3FMR A;  4XK4 A;  2P0X A;  3GME A;  2JSP A;  1JUM A;  4N9I A;  4HVN A;  3CQZ J;  1ZAO A;  1GLN A;  1OIS A;  2HYF A;  2L9N A;  3PL8 A;  3KP5 A;  1AV4 A;  2OWP A;  3HC7 A;  2Z16 A;  5IYD J;  3R60 A;  4BY1 J;  4M3E A;  2G7H A;  1W0U A;  1GYB A;  4KDP A;  3HJE A;  2XSJ C;  2FNQ A;  1S7O A;  1W2B 2;  1ON1 A;  2GXG A;  3P5J A;  1NG6 A;  3MAJ A;  3ZMS A;  4HEA 2;  1BAO A;  2LC2 A;  2RGQ A;  4U7B A;  5BU4 A;  8RNT A;  5JVT A;  1T5Y A;  1BI0 A;  3BJ6 A;  3DEU A;  3PUF A;  1RI7 A;  3S3M A;  4G1M B;  5E3M A;  5FLX K;  1R1V A;  1SFO J;  2AO9 A;  4K61 A;  3ULQ B;  3K4J A;  3F22 A;  1A36 A;  3BZK A;  2OQE A;  3D1N I;  3I59 B;  4KUM A;  3KEY A;  2P38 A;  1K78 A;  2DA1 A;  1AA7 A;  4M6X A;  3CCY A;  1AVK A;  3Q1C A;  4BHC A;  3SFZ A;  3CUO A;  1A35 A;  1N8Q A;  3RKW A;  1NWW A;  3HBL A;  6STD A;  3CCV 3;  5LC7 A;  2EQR A;  3G6E 3;  4DBR A;  1T2I A;  3DY5 A;  4IHT A;  3LT8 A;  1J75 A;  4BNC A;  3H3H A;  1JT6 A;  3RYP A;  1K4T A;  5AIH A;  5E18 F;  1C54 A;  2WV1 A;  3I9V 2;  2QQ9 A;  4V19 K;  2ZME B;  5D5U B;  3HZP A;  4XBY A;  2VLA A;  3IJE B;  2F4Y A;  4H3U A;  1WJB A;  3M8F A;  2RCD A;  3U1W A;  3E3V A;  4XN3 A;  4XKB A;  1BRS A;  2R7O A;  2LFB A;  2RBI A;  2VE9 A;  3WU1 B;  4FT8 A;  1B2U A;  3I55 3;  4U88 A;  2KL4 A;  1MBJ A;  4I0B A;  3KN4 A;  5J4V A;  3JW4 A;  3CUQ C;  3WG7 H;  5EDN A;  3AL0 C;  3I4M J;  2IYJ A;  3NXJ A;  4HAA A;  3MCZ A;  5H6Q A;  1D1C A;  2VN2 A;  2WTE A;  3K6G A;  3CO6 C;  1J9I A;  1BJA A;  2XAQ A;  3BND A;  2Z99 A;  1FBQ A;  3PNT A;  2M30 A;  5CQG A;  3HKZ N;  1Z21 A;  4B4C A;  2DJN A;  1JUP A;  1SVM A;  2M7A A;  4LLL A;  5L3G A;  2Y9Z A;  3QK9 A;  1D6Z A;  4A2U A;  1FZU A;  1UG0 A;  1JBR A;  3L2C A;  2BV6 A;  4GCV A;  2GBW B;  4E7S A;  2CFD A;  4F92 B;  4HG2 A;  3S8P A;  4M74 A;  4L8P A;  2GXB A;  2L7K A;  5D8L B;  4E7Z A;  5FKM A;  4ENN A;  4QWQ A;  3BTC A;  1JJ8 C;  3FF5 A;  4NDL A;  1QPM A;  4QLC U;  2WBM A;  3U9G A;  2R7F A;  3SHF A;  2W25 A;  4QIW N;  1Z1D A;  1W36 C;  1B27 A;  1GY7 A;  1MMS A;  1D0Z A;  1IF1 A;  5ELU A;  2FEZ A;  4CCL A;  3LTA A;  4LIT A;  2V4J C;  1W0T A;  4NC8 A;  4HBL A;  3G16 A;  5LRR A;  2ZJQ F;  1Z9C A;  3O8G A;  2OV7 A;  1XSV A;  2ZJP F;  1OHO A;  3T8T A;  4KN7 X;  4S05 A;  2CQ7 A;  5BMZ A;  1EF4 A;  4V2F A;  2P5V A;  3VOD A;  1UJ8 A;  1VTN C;  2FA5 A;  1UEL B;  2JZY A;  3W6V A;  2LDU A;  2GIV A;  3M8C A;  2LSO A;  4RLF A;  3ZQG A;  1FGM A;  4XON A;  3DGN A;  1NDO B;  2F5E A;  5EVH A;  3JTH A;  5HVQ C;  1YTY A;  2VB6 A;  3AG2 H;  2GQQ A;  4EJU A;  4UUS B;  4ZTJ A;  2Y48 A;  4AVP A;  2B7E A;  1ROA A;  2EPF A;  1TNT A;  3BNE A;  4U0V A;  4BBS J;  3F40 A;  2E35 A;  2HQR A;  4YFX F;  1TFO A;  5IEP A;  4XSX F;  1W5T A;  1VZ0 A;  3I5U A;  1B6A A;  3ER7 A;  3PO2 J;  1BRI A;  1I50 J;  2AXT C;  3MKY B;  3OSF A;  2XAJ A;  1S7E A;  4OMY A;  1A2V A;  2OBP A;  2X1D A;  1RKW A;  1HKQ A;  1U9O A;  2W24 A;  1HC8 A;  1FUT A;  2Q2E B;  5GAE J;  3ABU A;  1DPR A;  3PJR A;  1GD4 A;  1T2K A;  5E3N A;  5A2Q K;  2BXY A;  3BP8 A;  4Y52 J;  5GSP A;  4ZYE A;  2JQ5 A;  2VT3 A;  2B63 J;  4HNV A;  1BSE A;  1R4Y A;  4FQG A;  5CK6 A;  4RNY A;  2JA8 J;  1E3H A;  4OK0 A;  2A6E F;  5AIG A;  1IDY A;  1UDI I;  3VF1 A;  2XGE A;  1D8K A;  2AS5 F;  1R1T A;  1Q42 A;  3URP A;  3UKG A;  3ZMV A;  1T38 A;  3PSF A;  4OAZ A;  3ROB A;  1NNV A;  1Z77 A;  3PXM A;  3LA2 A;  4KJZ A;  1RGE A;  2D1W A;  1MBH A;  2W85 A;  1U5T C;  4FMC A;  4HLX A;  2HOS A;  2RVC A;  4ZDL A;  2K3F A;  4R1K A;  5JBS A;  1YS6 A;  3MWZ A;  3WGG A;  2DFH A;  3BRO A;  1MIJ A;  2HYJ A;  2OTJ I;  2AXL A;  5FRM A;  2HMO B;  2WOF A;  2EV6 A;  4IVN A;  1Z7L A;  1ZAR A;  2RAE A;  4BTW A;  2DFE A;  1UZC A;  3MSO A;  2DA4 A;  3OYB A;  3PZW A;  1R4N B;  2VXZ A;  3E5Q A;  1XDS A;  3VDX A;  2RNT A;  5D6E A;  4M3B A;  1YO5 C;  1TWC J;  1JN5 A;  2M4K A;  4I7H A;  4XOT A;  2QM3 A;  2CQQ A;  2HVQ A;  1LOW A;  3CD6 3;  1X1W A;  1GDT A;  3DGM A;  2XAH A;  1E2X A;  1GUU A;  4BXU A;  4OWR B;  2A69 F;  2XKO A;  2C10 A;  4BDY A;  1U2W A;  3CC7 I;  3VYR B;  3JRC A;  3FG3 A;  3MPH A;  5IER A;  4BTY A;  1IV7 A;  1PVE A;  1YIO A;  2EIM H;  2BVL A;  2VBX A;  2NNN A;  4N6T A;  2V1N A;  1YOV B;  1VQO 3;  2I10 A;  3D5L A;  4I01 A;  1NU3 A;  2EH3 A;  4U0W A;  6GSP A;  2Q1Z B;  2HS5 A;  1RN7 A;  3DBH B;  3TW6 A;  2EB7 A;  2NOG A;  1U8R A;  2MC8 A;  3TL4 X;  1KQS 2;  4FCM A;  1TRQ A;  1HSJ A;  1OCR H;  3G1M A;  2Z2S B;  5BPI A;  2J5O A;  3KZI C;  2XF5 A;  1J0R A;  1FBU A;  5CXO A;  3FKA A;  3MKZ A;  3QP5 A;  2XSD C;  3ZG0 A;  3IC7 A;  1QVG 2;  4L9N A;  1GVJ A;  1B20 A;  4LZI A;  2PMZ A;  4M6V A;  3O3K A;  2Y30 A;  1SVO A;  2CU7 A;  2NS0 A;  3SYT A;  2HDW A;  3T0Y A;  1IVW A;  1F8N A;  3FXQ A;  2K9Q A;  1OCO H;  2CV2 A;  3C2B A;  4LK1 F;  1N78 A;  1SMT A;  1KC8 4;  1LUJ B;  1LFB A;  2K5C A;  1RGC A;  5IP6 A;  3CCR I;  3ZRG A;  3RZO J;  5CYV A;  4DYQ A;  4LMI A;  2E1M C;  4F3Q A;  2KXG A;  1Q1H A;  2W6J H;  2W84 A;  4KFF A;  4BAY A;  4ASN A;  2PBI A;  3MMY B;  1VF9 A;  2RGV A;  1AKH A;  4N6O B;  1D6U A;  3BWG A;  3H5A A;  3PO3 J;  2V6E A;  5LFA A;  5HOO A;  3UL6 A;  3WA2 X;  3J7Y J;  3NV0 B;  1RUN A;  2DA5 A;  3RKY A;  2QGU A;  2IS6 A;  1KYW A;  2WAQ N;  3OIP A;  3GAX A;  2ZSH B;  3CDL A;  1LPQ A;  3DPT A;  1RCK A;  1I27 A;  2R4I A;  2LF7 A;  4N6V 0;  4Y13 A;  4RS8 A;  1ZX2 A;  5H20 A;  1UGH I;  1SAX A;  1BRN L;  3OWS A;  2W57 A;  4JX6 A;  2CWU A;  4FIS A;  1G6N A;  3D5S C;  3OYJ A;  5F0H A;  2M4G A;  1X19 A;  1JKP C;  2TRT A;  3H36 A;  5E17 F;  4IHX A;  1DE3 A;  1KU2 A;  3BR0 A;  1STD A;  2Y75 A;  2GWR A;  1GV2 A;  3T8U A;  2LBF A;  1WHU A;  1TTY A;  2NYX A;  4IO9 F;  1V5F A;  4LEH A;  4RM3 A;  2VBY A;  1IVV A;  1D6Y A;  2GU1 A;  3SEQ A;  1D5V A;  1L0O C;  3KYL A;  1BSC A;  2DTR A;  2M0M A;  2MBF A;  1BSB A;  2DOD A;  1F1Z A;  1RRJ A;  1LFP A;  3BJA A;  3K2Z A;  4MIM A;  5FD6 A;  4UY8 I;  2DA3 A;  1QGP A;  2EBI A;  1BNI A;  2L7Z A;  3I59 A;  3R0J A;  5HS9 A;  1Z6R A;  2HMJ B;  1O7N B;  1MMN A;  3CZ6 A;  1MMD A;  2BY3 A;  3Q9V A;  3V92 A;  3EF8 A;  3CJN A;  1ISK A;  3O8H A;  5FD5 A;  3OIO A;  2P5K A;  4IPB A;  4HDU A;  1YLF A;  5M5W J;  1D0X A;  3H35 A;  1DU0 A;  2C6Y A;  4BIR A;  4HYE A;  2EFN A;  2ELH A;  1OGZ A;  4HF2 A;  2CQX A;  2YX4 A;  1HCR A;  2IW5 A;  1W7P B;  2KRF A;  3NAU A;  1LOV A;  4KFD A;  4FMB A;  1EH7 A;  2CRG A;  3N54 B;  3ALA A;  4XKW A;  1NB3 I;  3G1L A;  3K69 A;  4X1E A;  1JHH A;  2M2E A;  2ZME A;  1ITY A;  3ZGK A;  5IPA A;  2F6C A;  1FUW A;  4LOC A;  5J1Y A;  1ZTR A;  1R6R A;  2EJR A;  2IGN A;  4L0Y B;  2I9W A;  7GSP A;  4XM3 A;  4LLG F;  5M1A A;  2OPT A;  3HII A;  2E36 A;  1W7C A;  2R7R A;  1MDM A;  4EV0 A;  3F14 A;  4HM7 B;  3LAJ A;  1U0J A;  3K1M A;  3ZP5 A;  1N9E A;  2HMK B;  2VUM J;  1LNI A;  1V57 A;  1X1P A;  2YFI B;  5BOX A;  5AII A;  1JGS A;  1KA8 A;  4RB2 C;  3DUK A;  4BS9 A;  5HS7 A;  4OUQ A;  1JTY A;  1OHP A;  4J5G A;  4OU0 A;  2CW8 A;  2QSF X;  3VYS B;  3W2V A;  2CGP A;  1Q40 A;  3ESW B;  1W00 A;  5D83 A;  3S29 A;  1RC9 A;  3HGG A;  3RZD J;  3PNV A;  1JUS A;  4XM4 A;  5K7H A;  3KFQ C;  3GBG A;  3OS1 A;  3WR2 A;  3F21 A;  2IPQ X;  3COA C;  2STT A;  2JUG A;  3IHU A;  3QPT A;  4N4N B;  4KIC A;  2EWN A;  5E3O A;  3DLA A;  3PM1 A;  2QA4 I;  2CX1 A;  3GF2 A;  4QWT A;  3BT9 A;  3AMO B;  5IG3 A;  2OTL 3;  2FD5 A;  1K61 A;  1IN4 A;  1BR4 A;  3SX1 A;  2F5F A;  1RUO A;  5L3F A;  2KZV A;  4MEI A;  2M7B A;  2LG4 A;  1DU6 A;  2V9K A;  4C9Y A;  4PUS A;  1LDD A;  2L2O A;  5CQE A;  5IYC J;  4G7O F;  4C3I J;  1EA2 A;  1IN6 A;  5FRN A;  3IAS 2;  2DOA A;  2IXS A;  5HNF A;  3GTG J;  1WNH A;  2FBK A;  2O8X A;  1BC7 C;  3LSI A;  4BY7 J;  3EQQ B;  4LYL B;  3ZQQ A;  2EIJ H;  3F6V A;  1ON2 A;  3EYY A;  4IF4 A;  1WMP A;  3FWE A;  3KYC B;  4JYK A;  1IQY A;  1NH3 A;  2W82 A;  2PMH A;  4PJL A;  3TQN A;  4RGU A;  3U21 A;  2GM4 A;  3NBB A;  3T1B A;  4MFD A;  4ZZD A;  2B24 B;  3FK7 A;  2VJ4 A;  3DKW A;  2CFX A;  3ECF A;  4KT5 C;  1K28 A;  2GXA A;  1YX5 A;  3W2W A;  1A2P A;  3FHN A;  4XMY A;  1T2H A;  3OV8 A;  4LIU A;  1Y8R B;  1D0Y A;  3BQY A;  2E2T A;  2L4M A;  2YUS A;  1B2Z A;  5KCM A;  2CSO A;  1LVA A;  1YG2 A;  4E7J A;  4UXN A;  3DBR B;  1TIJ A;  3N4M A;  1ZG3 A;  3CCE 3;  2VON A;  4Q4Z F;  1JKO C;  3WG9 A;  1Z91 A;  3HHG A;  4GDF A;  1VQ8 3;  4XDW A;  1OYW A;  2V9P A;  2QUF A;  4LB5 A;  3BQZ A;  1T0F A;  3GYH X;  2E2I J;  2LRD A;  4H4K C;  4ESJ A;  1W5C C;  6RNT A;  3DKY A;  2ACJ A;  1UG2 A;  1QRY A;  4NBQ A;  1FP1 D;  1RRH A;  1S5A A;  4Y33 A;  1E3V A;  1IZ1 A;  3KPH A;  4OIR F;  3L2W A;  4CJN A;  1PY3 A;  2LNB A;  3FX3 A;  1K83 J;  4EVI A;  3X40 A;  3WE3 A;  1TW2 A;  3IKT A;  4PK4 A;  4WX9 A;  1DMQ A;  1ULJ B;  1ZS7 A;  2EA2 A;  4G12 A;  5AEU B;  3HUG B;  1DDN A;  4A3E J;  3S1R J;  2W4S A;  1GT0 C;  3K1P A;  1JB4 A;  4EM1 A;  3D5I A;  3TOB A;  3Q90 A;  3I53 A;  4MHG A;  4ZYH A;  1ZRF A;  3PGB A;  2X0L A;  3L00 A;  2OCC H;  4R79 A;  1I2G A;  3OSG A;  4AID A;  4I02 A;  4KIS A;  2STW A;  3VFZ A;  4NQW A;  4MEX F;  2E71 A;  3SQN A;  1LB2 A;  1W6C A;  1IK3 A;  2K86 A;  3EPZ A;  1WGX A;  1ZGW A;  5L3C A;  3AG3 H;  1EH6 A;  3AGN A;  3KCC A;  3CMM A;  2Y73 A;  3EC9 A;  3RQ4 A;  1CEW I;  3DCF A;  4C2M J;  2RSX A;  3MVP A;  3CF5 F;  1Y8Q B;  4NNJ A;  2F98 A;  1IRX A;  3BR1 A;  2UXN A;  5LEK A;  2WAE A;  3KKG A;  1WKM A;  1YW7 A;  1WTH A;  2JT1 A;  1LOX A;  1V5G A;  1K8A 4;  5IG4 A;  1MMG A;  3CP8 A;  2PG4 A;  5E8G A;  3QYB A;  1P6R A;  2W0Q A;  2ECB A;  2XF3 A;  1JXS A;  2M34 A;  1DP3 A;  4JOM A;  3SXY A;  4AU7 A;  3LWF A;  1IT8 A;  1SD6 A;  1A90 A;  5ILU A;  1I2F A;  3V99 A;  4AWX B;  3WTU C;  3M1C A;  3RKX A;  3N05 A;  1IU7 A;  5F04 A;  1BI1 A;  1YQA A;  1VQ4 I;  1MND A;  1QQI A;  4XKC A;  3T8R A;  3H0G J;  2QIY A;  1W36 D;  1IW7 F;  1B72 B;  4ENM A;  1V4R A;  2VQH A;  5D5V B;  1T33 A;  3GVA A;  4K1U A;  1Z7U A;  3K7A J;  1R49 A;  3JRI A;  5E1X A;  3S17 J;  1SD4 A;  2HKX A;  3B02 A;  2BY1 A;  1N5H A;  1WCM J;  1BC8 C;  5JPU A;  3RPU A;  1Q1V A;  1KZH A;  3FKI J;  2STD A;  5B3S H;  3NWT A;  1JB5 A;  3ECH A;  4FR9 A;  2JVG A;  2VOD A;  1G2H A;  1BGS A;  3RKQ A;  3WA3 A;  2M5W A;  2R7X A;  4LB6 B;  2R5Z A;  1TLH B;  1P7J A;  2CG0 A;  2CFL A;  5IT9 Z;  5IOY A;  4XID A;  3WTW C;  1B1B A;  2GLO A;  3I56 3;  1FC3 A;  4RAF A;  1QZY A;  4B09 A;  2GEY A;  1O7W B;  2XAS A;  5HLT A;  2BY0 A;  2JN6 A;  1RR8 C;  3O2P E;  1YI2 I;  3IAM 2;  4AVZ A;  3HIF A;  3D79 A;  3WHO A;  1MSF C;  1JZO A;  1TWF J;  2ZME C;  3ZQC A;  1BNG A;  3QAH A;  3GWR A;  3EBY A;  2GIZ A;  2UWM A;  3DLL F;  1MWR A;  5TRD A;  3U1D A;  1RPW A;  4N9H A;  3PQK A;  5TGT A;  3JUM A;  2RQQ A;  1XC5 A;  2WA0 A;  2QEX 3;  4QPO A;  2XPV A;  4CYC A;  2Y9Y A;  2BMR B;  4C2T A;  2LKS A;  4WXC A;  2IT0 A;  3GZY B;  3V7R A;  4R9L A;  1JB2 A;  3BCB A;  4RGS A;  3DEW A;  5F1R A;  3M4O J;  4Q47 A;  2VOP A;  1W1W E;  2F99 A;  2OQE C;  4AUX A;  3NQY A;  1I3Q J;  5EEG A;  1YIT 3;  3WOD F;  1Q7H A;  3CC2 I;  2CO5 A;  2OCE A;  1TC3 C;  1VQN I;  5E8I A;  4BUP A;  4XRS A;  3IKV A;  1ETY A;  2V1D A;  1QPI A;  1B3S A;  3I0Y A;  4JF8 A;  2EFW A;  2E7W A;  1ZG1 A;  1OGX A;  1V54 H;  2VT2 A;  4CUG A;  2Z77 A;  4HZB B;  1IN5 A;  3P9K A;  4WHA A;  4L7K A;  3B4P A;  4G7Z F;  4A3C J;  3KP7 A;  5J8C A;  3MEX A;  3CNM A;  3BR3 A;  7RNT A;  3OL4 A;  1GXP A;  2P8T A;  4STD A;  1BUQ A;  1IXR C;  4DYC A;  2LY2 A;  1D8J A;  3ZFZ A;  3BG7 A;  1TP4 A;  3H1C A;  4HQE A;  1NK2 P;  1R4C A;  3SXX A;  1H88 C;  2E7X A;  1FZP B;  1XS9 A;  2FGT A;  3UNG C;  4PGG A;  3WTZ A;  1RSN A;  3OV4 A;  1MNL A;  5JHF A;  2OF7 A;  2VKE A;  3ERM A;  4M9Z A;  1XCV A;  4KA4 A;  4R8H A;  2F48 A;  5DM6 F;  2LLK A;  3RDE A;  4KMF A;  1IN7 A;  4YEL A;  4A3B J;  1FTZ A;  1M90 4;  2VC1 A;  2BW3 A;  1GV5 A;  4BKX A;  2LQV A;  4HQM A;  3N8B A;  4P1W A;  3M1E A;  2M1B A;  2XB0 X;  4RM2 A;  4D9J A;  2G9W A;  1SEU A;  1ZRC A;  1BRK A;  2RRE A;  1JZD A;  3CCL 3;  1ZYR F;  4U87 A;  5HLI A;  2XRN A;  1C0W A;  1I6X A;  2ZJ2 A;  3FXM A;  3BTJ A;  4OMZ A;  4BE1 A;  1WJ5 A;  2LMD A;  3ABM H;  2K40 A;  3K9T A;  2EFO A;  1O7P B;  2HVS A;  3M7G A;  2D1V A;  4BQO A;  1JT0 A;  4X0G A;  3NRV A;  3OOP A;  4GYG A;  5LBQ A;  1RGH A;  4CIC A;  1YX3 A;  2FXT A;  1GSP A;  3S28 A;  2H8W A;  4A3I J;  1WQ2 A;  3OS2 A;  5G2G A;  1LVN A;  4OAY A;  1K6O A;  1TUH A;  2P81 A;  4ENK A;  2W1O A;  1WPK A;  4M3G A;  4XLF A;  1Q9E A;  2KMU A;  5BNG A;  1A31 A;  3GTM J;  1EEJ A;  2H0H A;  1JBT A;  5IP7 J;  2LKP A;  4IZZ A;  4RAZ A;  2E1O A;  1RLS A;  3GZX B;  3LSM A;  2BOL A;  3KP3 A;  2ML6 A;  3FF2 A;  2L4A A;  3K0L A;  2IRF G;  2QSG X;  1GOU A;  3VSK A;  3Q2P A;  3SVA A;  1OQY A;  1KU9 A;  2QCO A;  4XRF A;  5JFR A;  1WFX A;  3C3W A;  4BE0 A;  3GWZ A;  2IA2 A;  3KII A;  1YJN I;  4B8X A;  5FLM J;  1FOX A;  4CCN A;  2E2V A;  3LA7 A;  1ACI A;  4E7L A;  2OUM A;  2OU2 A;  5GAH J;  1PUF A;  1I39 A;  2EIL H;  3CLQ A;  3OWU A;  3KLO A;  4X6A J;  3CUQ A;  1RCL A;  3HPH A;  1MBF A;  4RDU A;  4YII A;  1EUI C;  3J7Y d;  1JKG B;  4M73 A;  5BS6 A;  4HAM A;  4BE2 A;  1M9G A;  4PSX A;  1B21 A;  3GFL A;  1V58 A;  2KDO A;  3JUQ A;  4O5V A;  3DMC A;  4UNO A;  1H9G A;  3F8C A;  3N97 A;  3DTK A;  3CCE I;  2ADU A;  1F36 A;  1I2E A;  4A0Z A;  2ZDJ A;  3EX9 A;  1U5T B;  2WY8 Q;  4DZP A;  5JHU A;  1FLI A;  3OR2 C;  1EG9 B;  2HQA A;  3UNL A;  3NQZ A;  1VFC A;  2XF6 A;  2M8E A;  4EMS A;  5LHI A;  3J7Z I;  2XAF A;  3U97 A;  3OYG A;  4DGW B;  5FLX Z;  5BIR A;  3L1P A;  3MKW B;  1AHD P;  2ZXI A;  4ZTF A;  3TW7 A;  4GL6 A;  1O7M B;  2PMZ N;  2CH0 A;  1HW1 A;  4WK8 F;  2Z33 A;  3QRF F;  1VQM I;  3HIG A;  2WY7 Q;  4CCO A;  3LST A;  3LA3 A;  3BPX A;  1BRH A;  3EN8 A;  1MMA A;  4BQA A;  1TJD A;  4M3F A;  2GAU A;  5LHG A;  5IY5 H;  1BIB A;  2OQR A;  3D5R C;  1HF0 A;  3CNX A;  5GAG J;  1SPU A;  3D4A A;  3WHC A;  5KAF C;  5FW5 A;  2DA2 A;  1MH4 A;  4ORL A;  3ASO H;  4FCY A;  3KLN A;  2JK3 A;  2KIF A;  2YPR A;  3TO6 A;  3VSY A;  3LXU X;  1A5J A;  2LYC A;  1X4O A;  1W6Y A;  2XSH B;  1DP7 P;  2ZFW A;  1O7H B;  4AEQ A;  4BL0 B;  3IP4 B;  1BN5 A;  3RSN A;  5DUI A;  4DBQ A;  5K1Y A;  2IGM A;  2X6Y A;  3S67 A;  2CW0 F;  1XG1 A;  2GA1 A;  2FE3 A;  2Z5U A;  5C3E J;  1C7H A;  1LNH A;  1MGT A;  4A3M J;  3F0C A;  2YSR A;  1V5E A;  3CJQ B;  1BR2 A;  4RNZ A;  4MTE A;  1RNT A;  1G02 A;  2D45 A;  2OA4 A;  3BR2 A;  5J3L A;  4BHP A;  1UCK A;  1RGF A;  1CYU A;  2Y0S A;  5IOZ A;  1OJL A;  2F5C A;  1I0V A;  3M3Y J;  4IOA F;  2R7D A;  1VQK I;  3MZ8 A;  5KAI C;  4D0P A;  1JI8 A;  4MLO A;  5BPD A;  3HOW J;  4CCM A;  2O8K A;  3JVC A;  3WOF B;  3JRG A;  3EE1 A;  5AYS C;  2DA7 A;  2W56 A;  2V1X A;  1JJ2 2;  4A0X A;  3K2A A;  2ZJR F;  5E20 A;  3GTO J;  4BJ5 C;  4XRS G;  1I1S A;  2X6W A;  2EIN H;  2FBH A;  4BEH B;  3EBT A;  3M8E A;  2FMY A;  4HBR A;  5EGO A;  5IP9 J;  3X41 A;  2XUB A;  1BNJ A;  2QLZ A;  3FBN B;  4D7M A;  2F5W A;  5CF1 A;  5E1W A;  2UX0 A;  1QAK A;  1BNR A;  3CTA A;  1ETQ A;  4E7H A;  4OOI A;  3W2A A;  3OYK A;  1J7K A;  4GB5 A;  1BOB A;  2UUZ A;  4MQ9 F;  1NHA A;  3F8N A;  1WJD A;  5B1B H;  2DK8 A;  3V7C A;  2BO9 B;  3FZW A;  2VKD A;  3J7A O;  2JPB A;  2Z1D A;  4KFC A;  1BR1 A;  4XLP F;  2HYG D;  4XBX A;  3T8N A;  4ZDO A;  2LP0 A;  3I56 I;  1IQX A;  2CH9 A;  4RBN A;  1T95 A;  3CF2 A;  1E3P A;  2IBD A;  3FBI B;  2HOT A;  1Y6I A;  1ZGX A;  4DYR A;  1FOK A;  3WU0 A;  5LD2 C;  2INX A;  4HX7 A;  1LDK B;  3K70 C;  2E1M B;  4LFU A;  3Q3F A;  2JJ7 A;  3DBL B;  4HM2 B;  1GXQ A;  1H0M A;  2KF4 A;  3CCQ 3;  1OKR A;  4NC7 A;  2DPD A;  1TWH J;  1VQ6 3;  1A04 A;  1FT9 A;  1IRF A;  3KZZ A;  3BG6 A;  3ERE D;  1FOY A;  3GTJ J;  3LTC A;  3WGH A;  5DCM B;  2XIG A;  3GUD A;  1IUY A;  2A6H F;  1ZQ3 P;  2KPM A;  3TO7 A;  5J8F A;  3S1Q J;  3F8H A;  4XOR A;  4U0Y A;  1VQP 3;  2O3O A;  3FMS A;  5E1Z B;  2K9S A;  2XAU A;  2C11 A;  2A68 F;  1OF5 B;  3FZV A;  3F8F A;  3ML6 A;  4P96 A;  5E79 C;  1VQ7 I;  3NEU A;  4CPK A;  2XRL A;  3KFW X;  3W6J B;  3A1Y A;  1L3L A;  2K85 A;  1TP6 A;  3FMQ A;  5C4J J;  4H0E A;  1FGQ A;  2MYS A;  3HSR A;  2KIM A;  4B48 A;  2NNY A;  5KK1 A;  3P7N A;  5TJJ A;  1IGN A;  3AG4 H;  4HOB A;  3F9S A;  4HZF A;  2XC7 A;  2ZO4 A;  4O2H A;  2H0I A;  3K10 A;  2V1U A;  3ABK H;  5ICF A;  1TU5 A;  3A02 A;  3UB1 A;  1UHS A;  2KFD A;  4OIN F;  3LAP A;  2WGO A;  3D9R A;  2V1L A;  1ETX A;  1R58 A;  4CDG A;  3HOZ J;  2Y0M A;  4EAT A;  2CWT A;  1JJ6 C;  3FXK A;  3QP6 A;  1HDP A;  3BLZ A;  3WTV C;  5D4S A;  1RMS A;  1T39 A;  1S8N A;  3LQQ A;  2W9Q A;  1FW7 A;  4HX8 A;  2H8R A;  5FJ8 J;  4E70 A;  3IH4 A;  3OYC A;  4HV5 A;  1BOX A;  3MWM A;  3OS0 A;  4PJM A;  1ZRE A;  2CIU A;  1ZLJ A;  4A3K J;  3V98 A;  1GHC A;  2KAA A;  2F4I A;  3S16 J;  1XGN A;  3CCQ I;  2LYX A;  3D5G A;  2EV0 A;  5K7Z A;  2HGC A;  1KYZ A;  3BR6 A;  1RHL A;  1B9M A;  2H09 A;  1IQ8 A;  3UJM A;  5AYR B;  1MD0 A;  2K9N A;  4YIR X;  3EDP A;  1KU7 A;  1T8I A;  1US1 A;  3SED A;  3X42 A;  4C3J J;  1ZHF A;  2J5P A;  4AKY A;  4YFN F;  4BQQ A;  4XOP A;  2JDI H;  1JTX A;  3H3U A;  1MKM A;  3S2D J;  3I3L A;  1PJR A;  5B5E C;  1LRA A;  3ZMU A;  3JUO A;  3EUK L;  3RCO A;  3STD A;  2CFW A;  3S32 A;  1Q81 4;  3RJP A;  1SAN A;  1D1B A;  5M3M J;  2H27 A;  3HDD A;  2L54 A;  4CA0 A;  4M6Y A;  3EHC A;  3CCS 3;  1ZN2 A;  5JLW A;  3ECO A;  4LGW A;  3WDG B;  5D5W B;  3HKZ A;  1MOL A;  2DU9 A;  1ZKG A;  4PJN A;  2RC4 A;  4EM2 A;  1P4A A;  2Q2E A;  4B3X A;  2XRO A;  2ZXH A;  5J1R A;  2RQP A;  1FP2 A;  3FM3 A;  5F6F A;  1EH8 A;  2VQC A;  5EG0 B;  2E5N A;  4EGY A;  4FTH A;  1V55 H;  1TRP A;  5EYR A;  1AVL A;  1FYL A;  3DWL E;  2K54 A;  1A6Q A;  3TOA A;  3KZY A;  2E1N A;  3RGA A;  2KQR A;  2L01 A;  4FE7 A;  3JAM Z;  2CX0 A;  2HDC A;  4A12 A;  1QHG A;  2OOV C;  3KE2 A;  2CQK A;  1EA3 A;  1MWS A;  5H2F C;  2ZSI B;  4KIG A;  2CWE A;  4N6L A;  2E2H J;  1RNL A;  4HST A;  3AKZ A;  3MFK A;  3JUP A;  5ICE A;  2CUE A;  4DJA A;  1P7I A;  1RGG A;  5FKO A;  3G2B A;  3OY9 A;  2X1E A;  3PSI A;  2V7F A;  3DEE A;  4Q48 A;  3CP2 A;  5FKK A;  2GA2 A;  3W3C A;  1ZR2 A;  3P9I A;  2YU9 J;  3WOD G;  2ECC A;  3TDU C;  1DMM A;  3IH3 A;  4HLY A;  3ROU A;  4MEY F;  3QWL A;  1TL8 A;  2D42 A;  9ANT A;  4AC0 A;  5AIF A;  2ZB9 A;  2L9V A;  2VC0 A;  3GLX A;  3IH2 A;  4HRI A;  1T6S A;  2Y0S N;  3NM2 A;  2Y74 A;  2JA2 A;  1J5Y A;  1UB9 A;  3CMA I;  4O6J A;  2R4G A;  1SD7 A;  2A5W A;  2H1L A;  3K1N A;  1ZG5 A;  2IUK A;  2UUG C;  3L2U A;  4RBO A;  2MSY A;  1QZE A;  3Q3S A;  2LR8 A;  4KYW A;  1YJ9 3;  2ISY A;  3L2Q A;  1SIH A;  1K6Y A;  4KT6 A;  2WAQ A;  1CF7 A;  3MHE A;  1TWA J;  3GZ6 A;  4EM0 B;  2R5Y A;  2WOH A;  1G3S A;  1I8V A;  4ENJ A;  1SMY F;  3RDI A;  1F43 A;  1O7F A;  2J8X B;  5DRE A;  2Z9O A;  2F86 B;  4J5K A;  3HM5 A;  2AQE A;  4N6M A;  1QVT A;  4PJ0 C;  1X58 A;  4G9Y A;  5GTI C;  1W4N A;  2FNP A;  3L2V A;  3MG3 A;  1IV8 A;  2MC3 A;  1IT7 A;  2HOA A;  2ELJ A;  1GS3 A;  1BVI A;  5ED4 A;  3DV8 A;  5EEO A;  1ROV A;  1QA6 A;  4HNU A;  1WJE A;  3OIQ A;  4IOC F;  3MG2 A;  2PJR B;  3G1O A;  4WP5 A;  3V7S A;  4PEJ A;  1G0T A;  1ENH A;  2E5Z A;  3JTG A;  3L7W A;  2VPL A;  4HOH A;  5M3F J;  4U7D A;  5LRS A;  1FSH A;  1R5G A;  3BLY A;  4IXA A;  3ZN0 A;  4EJT A;  4HM1 B;  1PU4 A;  3QOE A;  1UHW A;  2HPM A;  2L3D A;  3O8Y A;  4I5Q A;  1R9T J;  2BT3 A;  1XB4 A;  1BUJ A;  4IX7 A;  4IJA A;  4ABZ A;  3U1K A;  4RAG A;  3DM8 A;  1WJC A;  5KNL A;  4UB6 C;  4RB3 C;  1R22 A;  2DXI A;  4B43 A;  2MH2 A;  4KZ1 A;  5ICG A;  2F5V A;  4FE4 A;  1ONV A;  3K4C A;  2DQL A;  3RI4 A;  5CLS A;  1IV6 A;  1S7A A;  2I8D A;  3QYF A;  3RTR A;  5ELJ A;  1B9N A;  3I0T A;  3GTK J;  2XGL A;  4H61 A;  2HZD A;  2MLK A;  4UVB A;  1X1C A;  3KP4 A;  2ICW G;  4YFK F;  1ZH5 A;  3R6S A;  3H3V K;  5FLV A;  1ERD A;  1WWX A;  1R23 A;  3HYI A;  4G94 A;  3DGO A;  1MBK A;  4HA8 A;  2DN0 A;  2RV8 A;  4II2 A;  3AGO A;  3LSP A;  3CCU 3;  4BU4 A;  3QU6 A;  2XGX A;  3M8J A;  1G59 A;  4B47 A;  2OTL I;  4CCK A;  4M71 A;  3OYE A;  2B9S A;  1FYK A;  1OCT C;  1UW1 A;  4AYB N;  4HX4 A;  3W6K B;  2W00 A;  3HHH A;  1BM9 A;  1KSI A;  3EYI A;  3A0H C;  4RB1 A;  4O3V A;  1A67 A;  1UI8 A;  2W03 A;  1U6G A;  4G6Q A;  1E3R A;  3DXJ F;  3F8B A;  2Z76 A;  4DW6 A;  5CVV A;  2W04 A;  4MTD A;  1O3S A;  2O61 A;  3B7C A;  2X51 A;  2XHK A;  4A6E A;  4YG2 F;  2L5Q A;  2ETH A;  2CC3 A;  2R7V A;  1YJW 3;  1M1X B;  7STD A;  2CYY A;  2NXN B;  1K78 B;  3EUH A;  4E4H A;  1TBX A;  5D81 A;  2WB1 N;  1H89 C;  3CCR 3;  3B6C A;  4NPB A;  1MH3 A;  1B8I A;  2XPW A;  2JRT A;  3FLJ A;  1O57 A;  2L7M P;  1FMW A;  3MYT A;  3C1D A;  2JUC A; 
#chains in the Genus database with same CATH homology
 3CNM A;  3FG4 A;  2GBW B;  4STD A;  4CDL A;  1YVB I;  1BUQ A;  2CFD A;  3D3L A;  2K0M A;  4L8P A;  4O02 B;  1R4C A;  3SXX A;  4TX4 A;  2IMJ A;  3RGR A;  3X3X A;  4HYZ A;  2FGT A;  3K7C A;  3OV4 A;  1MNL A;  3HK4 A;  1W02 A;  1GY7 A;  3RDE A;  1RKY A;  5ELU A;  3S5C A;  1M90 4;  3LTA A;  2LQV A;  3G16 A;  3N9H A;  3N8B A;  2XFS A;  3CCL 3;  1OHO A;  4FMD A;  2BMQ B;  3PYJ A;  3CC4 3;  2YX9 A;  1KWI A;  4IIA A;  2XSO B;  3M8C A;  1O7P B;  1FGM A;  4Q53 A;  2BMO B;  1NDO B;  3DGN A;  2BNG A;  4OVM A;  5EVH A;  2FXT A;  2W9P A;  3S28 A;  3CMA 3;  1UUV B;  1FGT A;  4R4K A;  1ROA A;  3BNE A;  1LVN A;  5AI1 A;  1TUH A;  3B8L A;  5G2G A;  3LT9 A;  3F40 A;  1JKG A;  1EQK A;  5IEP A;  5IF6 A;  1TFO A;  4K90 B;  3ER7 A;  5DRV A;  4N6N B;  2OTJ 3;  1W6G A;  3LOY A;  1DMN A;  2IUJ A;  1FA3 A;  4XB5 A;  1A2V A;  3HI7 A;  4R9K A;  1OHS A;  3GZX B;  1ULI B;  4EC6 A;  2CG1 A;  2ML6 A;  4XDV A;  3FF2 A;  3Q2P A;  3CME 3;  3SVA A;  1GD4 A;  3BNB A;  1OUN A;  3KII A;  4WYK B;  5BVB A;  2JQ5 A;  1IVU A;  1Q86 4;  1TFK A;  2E2V A;  2CHC A;  4X2O A;  5CK6 A;  1SII A;  4RNY A;  4OK0 A;  1DVD A;  1K41 A;  5AIG A;  2O9U X;  3VF1 A;  3OWU A;  1OPY A;  1Y4K A;  4AKZ A;  1Q42 A;  1YJN 3;  1IDP A;  1VQL 3;  4FCJ A;  3J7Y d;  1JKG B;  2WO0 A;  3ROB A;  1S72 3;  3PXM A;  4U13 A;  1M9G A;  2D1W A;  1K73 4;  4FMC A;  3G71 3;  2W2C A;  2RFR A;  3JUQ A;  4R1K A;  3WOE B;  5JBS A;  3DMC A;  3MWZ A;  3FF0 A;  1GY5 A;  1OH0 A;  3NBR A;  4MMZ B;  2HMO B;  2ZDJ A;  2WOF A;  3EX9 A;  1EG9 B;  3KE7 A;  2CW9 A;  3NHX A;  4EV2 A;  3UNL A;  4BTW A;  1NJI 4;  3MSO A;  3FCS B;  1GD3 A;  3NQZ A;  3PZW A;  1V74 A;  3U97 A;  3A76 A;  4JRF A;  1JN5 A;  2CFG A;  1A2K A;  4GL6 A;  1O7M B;  3CD6 3;  3DGM A;  1W2Z A;  5IG0 A;  3HIG A;  1YGE A;  5KP4 A;  2GBX B;  2C10 A;  3EN8 A;  4EV5 A;  3MPH A;  3FG3 A;  5IER A;  4BTY A;  1IV7 A;  1JRQ A;  3G4S 3;  3CNX A;  5IEN A;  1W2B 2;  5FW5 A;  3KSE D;  4N6T A;  1SPU A;  3DXO A;  1VQM 3;  1M1K 4;  5STD A;  1VQO 3;  1NU3 A;  4ORL A;  1PFP A;  1RN7 A;  3FGY A;  3WMD A;  2MC8 A;  3VSY A;  1KQS 2;  4FCM A;  3LXU X;  1QJG A;  1W6Y A;  2XSH B;  2QA4 3;  1O7H B;  2W56 B;  4AEQ A;  4XBT A;  3FH1 A;  3UL5 A;  1U8C B;  5CXO A;  3FKA A;  3S67 A;  4EBG A;  1WQL B;  1ZO2 A;  1QVG 2;  4LZI A;  1C7H A;  1LNH A;  1F8N A;  4BTX A;  1IVW A;  4IT7 A;  4HJL B;  2Q07 A;  1CQS A;  1HKX A;  4RNZ A;  4WWU C;  1KC8 4;  2KRT A;  1IV9 A;  4LMI A;  1CYU A;  2KXG A;  2W6J H;  3LTD A;  2PNC A;  4KFF A;  1VQN 3;  2MF7 A;  3G0K A;  3SOA A;  5IW9 A;  4N6O B;  1D6U A;  3T0U A;  1O7G B;  1QAF A;  3JVC A;  2SBL A;  3WOF B;  3EE1 A;  5AYS C;  3NV0 B;  5IEO A;  3UL6 A;  2W56 A;  3WA2 X;  1JJ2 2;  2B1X B;  2QGU A;  2L4V A;  2CK3 H;  3NX0 A;  3GAX A;  3IPT A;  4FMA A;  3CPO A;  1FGR A;  2R4I A;  3EBT A;  4N6V 0;  4HBR A;  5AEW B;  1ZX2 A;  3X41 A;  3OWS A;  2CWU A;  5CF1 A;  1AR0 A;  2XH9 A;  2CKF B;  2UX0 A;  2P0M A;  3NUV A;  1QAK A;  4FCZ A;  2HML B;  2XRX B;  3KZT A;  4GB5 A;  1STD A;  2A15 A;  1CYV A;  3FZW A;  2BO9 B;  2P05 A;  2YFJ B;  4HM3 B;  3T8U A;  1UI7 A;  4XBX A;  5FGO A;  3T8N A;  4LEH A;  1Q7Y 4;  1IVV A;  1D6Y A;  3DGL A;  3EJV A;  1OF5 A;  2GU1 A;  1IQX A;  4HM5 B;  2CH9 A;  5TGN A;  4RBN A;  2INX A;  1U5O A;  4HM2 B;  2HMJ B;  2ZL8 A;  1O7N B;  1ASK A;  3V92 A;  3EF8 A;  3CCQ 3;  1ISK A;  3K9M C;  1VQ6 3;  1QMA A;  3GRD A;  4IPB A;  4KVH A;  3LTC A;  3IMA B;  1OGZ A;  2CFK A;  1VQ5 3;  2GXF A;  3F8H A;  4KFD A;  4FMB A;  3N54 B;  1W5Z A;  5CLK A;  5I97 A;  2O3O A;  3ALA A;  1VQP 3;  1NB3 I;  1G96 A;  1Q82 4;  3K5T A;  3PCR A;  4ZM8 A;  2C11 A;  5LC6 A;  3OX9 A;  1OF5 B;  1E97 A;  3MG1 A;  3GZR A;  1FUW A;  2I9W A;  4CCV A;  2P09 A;  3L0R A;  3HII A;  1W7C A;  2KCD A;  1TP6 A;  2XGN A;  3EN1 B;  3F14 A;  1N9E A;  2HMK B;  1JN5 B;  1FGQ A;  2HMN B;  2M7O A;  4HM7 B;  3OXA A;  2YFI B;  4J8T A;  4N3V A;  5AII A;  1J2B A;  3DUK A;  1SJW A;  3F9S A;  4OUQ A;  1OHP A;  4R80 A;  4O2H A;  1W00 A;  1TU5 A;  1Q40 A;  5D83 A;  3S29 A;  3UB1 A;  2WGO A;  3D9R A;  5KP3 A;  2V1L A;  3F7X A;  1VQ7 3;  1GY6 A;  3SOY A;  4XM4 A;  3KFQ C;  4NHF A;  3CU3 A;  3LYG A;  2CWT A;  1N9J A;  3BLZ A;  1SQW A;  2W9Q A;  3DZL A;  4QWT A;  3AMO B;  2OTL 3;  5IG3 A;  4N6U A;  5KP1 A;  2CIU A;  4J9A A;  3SX1 A;  3V98 A;  4MEI A;  2LYX A;  2YFL B;  1WMO A;  4LGQ A;  4X2H A;  1EA2 A;  1JNQ A;  1WNH A;  1IQ8 A;  1NO3 A;  1Q40 B;  5D82 A;  2Z6B A;  5AYR B;  3EQQ B;  3UJM A;  3CC7 3;  3SED A;  1US1 A;  3X42 A;  4AKY A;  1WMP A;  1IQY A;  2JDI H;  3LTB A;  1K9M 4;  1YIJ 3;  3NBB A;  2B24 B;  3ECF A;  2GU3 A;  1K28 A;  1RRL A;  3JUO A;  3STD A;  4HM4 B;  2CFW A;  2E2T A;  1Q81 4;  3GZB A;  1UUW B;  3B4O A;  3EHC A;  1TIJ A;  3CCE 3;  3CCS 3;  3WDG B;  1MOL A;  1VQ8 3;  4XDW A;  3BB9 A;  3S27 A;  4HM8 B;  1VQ4 3;  2IA7 A;  3FSD A;  4HM0 B;  1IVX A;  1AVL A;  4WFO A;  5CF2 A;  2K54 A;  1RRH A;  1S5A A;  5EQL A;  1E3V A;  3RGA A;  8CHO A;  1QAL A;  2OCT A;  2OOV C;  1STF I;  3NM7 A;  1L5G B;  3X40 A;  5JPP A;  1VQK 3;  1N5P A;  3F8X A;  1DMQ A;  1OAC A;  1ULJ B;  4N6L A;  3CXC 2;  1FGO A;  3JUP A;  5HGR A;  5AEU B;  2GEX A;  1YHQ 3;  5IG5 A;  1DYU A;  2CWV A;  3Q90 A;  3LH4 A;  1JB4 A;  2WGQ A;  1KD1 4;  4LSO A;  3WOD G;  3PGB A;  3FG1 A;  1DMM A;  4K1V A;  4HKV B;  3OW2 2;  1IK3 A;  1W6C A;  2D42 A;  5AIF A;  1DVC A;  3NBJ A;  3TDG A;  3NM2 A;  3OWY A;  2Y73 A;  3EC9 A;  2Y74 A;  1CEW I;  3VGN A;  2RSX A;  3CPW 2;  2F98 A;  2IUK A;  3K0Z A;  4MJD A;  3X3Y A;  3KKG A;  1WTH A;  1LOX A;  1YJ9 3;  1K8A 4;  4EXR A;  4MMX B;  5IG4 A;  1SIH A;  2XR8 B;  1OCV A;  3MHE A;  2WOH A;  2W0Q A;  2XF3 A;  5DRE A;  1HU9 A;  4HZ9 B;  2OOV A;  1IT8 A;  2F86 B;  4N6M A;  3NV0 A;  1A90 A;  2XFT A;  2Z7A A;  3V99 A;  1WMN A;  1W4N A;  3HX8 A;  3E99 A;  3G8Z A;  3MG3 A;  1IU7 A;  3PS8 A;  4O8S A;  1IT7 A;  5EEO A;  1GS3 A;  4RZM A;  4KFE A;  1ROV A;  2PZV A;  4WYK A;  2QIY A;  3MG2 A;  5A0O B;  4WP5 A;  4K1U A;  2P0X A;  4PEJ A;  3F7S A;  4HVN A;  3X3Z A;  1AV4 A;  1N5H A;  2OWP A;  1VZZ A;  5JPU A;  1PU4 A;  4HM1 B;  2STD A;  3CCJ 3;  1GYB A;  1JB5 A;  4FR9 A;  2FNQ A;  4MMY B;  3O8Y A;  3CCM 3;  2BT3 A;  2RGQ A;  3WA3 A;  3DM8 A;  2CG0 A;  1T5Y A;  2CFL A;  4I4K A;  1RJO A;  4G1M B;  4KZ1 A;  3K63 A;  3BNC A;  3I56 3;  4K61 A;  1NB5 I;  2GEY A;  1O7W B;  2OQE A;  3CC2 3;  3JUN A;  2P38 A;  3AMO A;  4HM6 B;  4L8O A;  2E2U A;  5ELJ A;  2XGL A;  1AVK A;  3Q1C A;  4H61 A;  2HMM B;  1Z1S A;  3GWR A;  3EBY A;  5BXQ A;  3EB8 A;  1N8Q A;  1NWW A;  2XEP A;  6STD A;  3CCV 3;  5LC7 A;  3G6E 3;  3DGO A;  1W01 A;  3JUM A;  1QVF 2;  3CCU 3;  3DY5 A;  2QEX 3;  3LT8 A;  3SLU A;  3H3H A;  2BMR B;  1UW1 A;  5AIH A;  1KSI A;  3GZY B;  3HZP A;  4R9L A;  1JB2 A;  4XBY A;  3IJE B;  4O3V A;  1A67 A;  1UI8 A;  2W03 A;  1E3R A;  4H3U A;  4NRE A;  1LXE A;  2RCD A;  3U1W A;  1VQ9 3;  2Z76 A;  2F99 A;  3NQY A;  2OQE C;  2W04 A;  1EKM A;  1JV2 B;  3H51 A;  1YIT 3;  3B7C A;  2ML5 A;  3I55 3;  3KSP A;  1YI2 3;  2CC3 A;  3KN4 A;  1N8R 4;  3NXJ A;  1YJW 3;  1M1X B;  3QRD A;  7STD A;  4JF8 A;  3I0Y A;  3LZA A;  5D81 A;  1OGX A;  3BND A;  3CCR 3;  4EYC A;  2Z77 A;  3PCS A;  4HZB B;  4WHA A;  3FLJ A;  4L7K A;  2BHM A;  3B4P A;  3QK9 A;  1D6Z A;  3MYT A;  3LML A;  3MKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...