2QGUA

Three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
ADAQATVKTAVDDVLATIKGDPDLRGGNLQKVFQLVDQKIVPRADFKRTTQIAMGRFWSQATPEQQQQIQDGFKSLLIRTYAGALANVRNQTVAYKPFRAAADDTDVVVRSTVNNNGEPVALDYRVEKSPNGWKVYDINISGLWLSETYKNQFADVISKRGGVGGLVQFLDERNAQLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Probable signal peptide protein
publication title Three-dimensional structure of the phospholipid-binding protein from Ralstonia solanacearum Q8XV73_RALSQ in complex with a phospholipid at the resolution 1.53 A.
rcsb
source organism Ralstonia solanacearum
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05494 MlaC MlaC protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A phospholipid-binding protein 2qguA02
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2qguA01
1ISKA 2I9WA 1E3RA 5AIHA 1QJGA 1OF5A 3OWYA 1BUQA 1O7GB 3F7SA 2F99A 1C7HA 1JB5A 2UX0A 4MJDA 2GBXB 5IENA 1SJWA 4STDA 5CF2A 2Z77A 5BVBA 2K54A 5IEOA 4WYKA 5AIFA 2YFJB 3MG2A 3DUKA 3I0YA 6STDA 3RGAA 4RZMA 2BMRB 3KE7A 1JN5A 1NDOB 1O7HB 1OUNA 2BMOB 3MG3A 5IEPA 4K1UA 1OF5B 3FLJA 2GBWB 3NXJA 4X2OA 3SOAA 1OPYA 4HZ9B 3VSYA 1GS3A 1DMQA 5JPUA 1AR0A 3DXOA 5IERA 3K0ZA 4WYKB 1Z1SA 3JUOA 3T8NA 3WMDA 5CF1A 1GY5A 1GY6A 4R9LA 1JN5B 4XM4A 1WQLB 3EN8A 4FCJA 5D82A 3B4OA 5TGNA 1W6YA 5IG5A 3JUMA 3NV0B 3MSOA 3RGRA 1HKXA 4LMIA 5AIIA 4HM1B 2PZVA 5IG3A 3JUPA 1UUVB 1EG9B 3KZTA 3HX8A 4L7KA 2HMNB 3FSDA 3OXAA 3T8UA 3SEDA 2STDA 3FZWA 1O7WB 3NHXA 1Q42A 3NBRA 3EC9A 3B4PA 5AEWB 1W01A 4HM6B 3G8ZA 4H3UA 2Z76A 1E3VA 3EJVA 5AIGA 5JPPA 3EQQB 3LZAA 3F8XA 5D81A 3HZPA 5KP3A 3H3HA 4XDVA 2OWPA 5IG0A 1UUWB 3S5CA 2HMOB 4GB5A 3Q90A 2W2CA 4HM7B 5AEUB 3DMCA 3SOYA 5CXOA 2F98A 3GRDA 3UJMA 3OWSA 3GZYB 1STDA 1OCVA 1TP6A 3EBYA 3NV0A 1ZO2A 1TUHA 3B8LA 3KKGA 5G2GA 4IIAA 2XSOB 3F14A 2HMJB 4K1VA 3ER7A 1OH0A 1OGZA 3FF0A 1GY7A 4LGQA 3OWUA 2QGUA 1JKGB 3E99A 3EX9A 2QIYA 2YFIB 4OVMA 4L8PA 4LEHA 3GZXB 1E97A 4XB5A 2RFRA 5DREA 4HJLB 3CNXA 4CDLA 1NWWA 2A15A 2BNGA 4R9KA 4XBTA 4HM5B 3DM8A 3F40A 3G0KA 3G16A 1A2KA 3DZLA 4L8OA 2RCDA 3B7CA 2F86B 7STDA 3H51A 1ASKA 4HM3B 5KP1A 3ECFA 4X2HA 5IF6A 3ROBA 2Z7AA 3KSPA 5KP4A 3EHCA 3CNMA 1QMAA 4N3VA 3VGNA 4WP5A 3BB9A 1VZZA 3F9SA 3EBTA 2YFLB 4XBXA 3F7XA 5DRVA 1W00A 2GEXA 2HMMB 1JB2A 1ZX2A 2R4IA 2XR8B 1ULIB 1U5OA 3GZRA 4HKVB 5HGRA 3GZBA 5IG4A 1IDPA 1JKGA 2INXA 3JUQA 3UNLA 5AI1A 3MKIA 1O7NB 3F8HA 4HZBB 4HM8B 3CU3A 5STDA 4XBYA 4FCMA 3EF8A 5BXQA 4HM4B 2BMQB 3M8CA 3JUNA 4PEJA 2JQ5A 4WWUC 1DMNA 1O7MB 4I4KA 4U13A 1NU3A 3OV4A 2RGQA 1DMMA 3OX9A 4J9AA 3STDA 1Q40A 1K41A 1EA2A 2CHCA 3HK4A 5D83A 8CHOA 3FGYA 1ULJB 3IPTA 3MYTA 5FW5A 3FF2A 4J8TA 4XDWA 5CLKA 2GEYA 4HVNA 5EVHA 4KVHA 5CK6A 4ORLA 4HM2B 1OHSA 1JB4A 3LYGA 1O7PB 2B1XB 2HMLB 1CQSA 4Q53A 1GYBA 3FH1A 1OHOA 4HM0B 1OHPA 2HMKB 2XRXB 3GWRA 1Q40B 3NM2A 2CKFB 3FKAA 3K7CA 2IMJA 2B24B 1W02A 3D9RA 4R1KA 3NUVA 3MG1A 1S5AA 4OUQA 3A76A 3MHEA 2XSHB 3EN1B 1OGXA 3BLZA 2GXFA 3CPOA
chains in the Genus database with same CATH superfamily
3TO9A 1KQS2 1ISKA 4GDFA 3S1QJ 1DPUA 2MSYA 4OAYA 2KQRA 1XSVA 3OSFA 2V79A 1JXSA 3LSTA 2CWTA 2RQPA 2ZL8A 1FWZA 2CFLA 1X58A 1I39A 2DOEA 1D6ZA 1FGQA 1XMAA 1S7AA 1QVF2 4M74A 5C3EJ 1JRQA 1O7GB 2WB1A 3F7SA 2LYCA 4WCGA 5D5VB 3UR3C 5ERIA 1RKTA 2KZVA 2GBXB 1MWRA 3CD63 5LGNA 5IENA 4IRIA 1SJWA 4STDA 1CEWI 5CF2A 3BWGA 4A3EJ 2Z77A 5EGOB 3GXOA 4Y7NJ 2FX0A 2K3PA 2CUJA 2H6BA 2DA2A 2L7KA 3NAUA 4XL9A 1FOKA 4NBQA 4LG3A 2N8GA 3LTAA 1BI3A 1VQ6I 4HSRA 4KMFA 3D5RC 1T0FA 5F6FA 2KL4A 3CESA 1Z7UA 3FK6A 3FMRA 5HDNA 3IV5A 2PQ8A 2HU9A 2R5YA 4RB1A 1KWIA 2ZSHB 3S16J 1JJ8C 2W00A 1FSHA 1O7HB 3CDIA 1ORKA 5EDNA 3HG9A 1D0YA 1ETOA 2O0YA 3OYGA 1NK3P 1CYVA 1OUNA 4ZM8A 1D5VA 1BJAA 4BY7J 1P4WA 2W25A 5IEPA 2QA43 5DYMA 4G1MB 2VJ5A 4YFKF 4ZDOA 1WPKA 4XBFA 1OQYA 3BTLA 4GXOA 1OF5B 2KJBA 3BG5A 1MBHA 3FBIB 3ZXSA 3NXJA 3SOAA 4HX7A 1I3IA 1H9GA 4HPQA 1DP7P 1ULYA 4YELA 4EVIA 1M1K4 1AQZA 4FCZA 1DGWY 1MJ9A 2WGQA 3DGYA 1T95A 2Z9OA 2M0CA 3ESWB 1U8RA 2A07F 2QF7A 3BNBA 2BW3B 3GBGA 2OUMA 4RMNA 3CC7I 5IPAA 5G1LA 5GPCA 3GTJJ 4WYKB 1JZDA 1VTNC 2PI0A 6GSPA 2EFWA 1W1WE 3LSGA 3P7NA 3WMDA 5ELJA 2ESNA 4BKXA 4WXHA 2L5QA 3FG3A 1ZG5A 2BY3A 4AKYA 3OYIA 1MJAA 3UL5A 1J5YA 2VJJA 4JX5A 3LT8A 1JN5B 3MFKA 1RGHA 4XM4A 4EMSA 1JNQA 1UCIA 1TNSA 3MKZA 4JP0A 2G7HA 2BVMA 3EN8A 3NARA 4BL0B 1G4DA 1HOMA 1LDKB 2OCTA 4A69C 3SDGA 2JWTA 3NV0B 2JA6J 5RNTA 2HDCA 2XAUA 1BAOA 2IA7A 1X3UA 2DTZA 2LH9A 4U87A 1W5CC 2GBYA 3I59B 1HKXA 1IRZA 2MD5A 1IDYA 3HC7A 3O3KA 1TTOA 3BC8A 1D3YA 5AIIA 5TJJA 4LFUA 5EGOA 2JDIH 4RB3C 4R8HA 5HLHA 1T3BA 2X6XA 1G3TA 2CH0A 3KZIC 1XGNA 1IQXA 4ON0A 3JUPA 4B1RA 1UUVB 3CCQI 1BW5A 2E2IJ 4IHXA 3MD2A 1LEAA 3ZG5A 1TW3A 3VYSB 4C2MJ 3OYHA 3KZTA 1MBJA 2DMQA 5HOOA 3WR2A 2JT1A 3PNTA 3W2WA 4BQNA 5M5XJ 3ZQLA 3HRSA 1IAWA 4B43A 4WXCA 3CCUI 1YGWA 2QVOA 2DT7B 1N5PA 1X1YA 3FSDA 4D9JA 1TFKA 1W7PB 1XDSA 1UI7A 3PUFA 2NOGA 3KPHA 3HGGA 4ZTJA 5EG0A 1T8IA 3FM5A 3HPGA 3ZMZA 3J80Z 1RMSA 1X3ZB 2GOXB 3Q0WA 3QPSA 4I0AA 3ZOBA 5DEQA 2Z33A 4G6TB 3EC9A 2BHMA 2Y9YA 3GFMA 1T6SA 1ZG3A 2EV6A 3TKYA 1I2FA 4I99C 3LTCA 1W01A 3G8ZA 1KC84 2XGCA 2LFBA 2K3FA 1WJ5A 3WA2X 1XDUA 4M3BA 2QLZA 1RKYA 3CCSI 2FF4A 2M87A 2MYSA 1PUEE 2BY1A 2MFZA 2L4VA 2EH3A 3K1MA 3KEOA 3ZQHA 1IC8A 3CCR3 2K4BA 1R5HA 4MQVA 2B9SA 3JRGA 3EQQB 5GTHC 2CUZA 3TP0A 4G7ZF 1IF1A 1MBFA 5D81A 5IT3A 3HZPA 5KP3A 4XDVA 2KAAA 4AVZA 3NBBA 1BR2A 1BR1A 4B4CA 1NK2P 3TW6A 2DA4A 5TISC 4RM3A 4MIMA 3MN2A 3ZQCA 1UUWB 1B27A 1QQIA 4XQFA 3IH2A 2NOJB 2M7OA 3X42A 1L5GB 3BG9A 1EH7A 2HZTA 4ZDPA 2FNPA 2EZHA 3CCYA 4HYZA 5CXOA 1VQ8I 1V55H 3BPXA 3RQIA 3DBHB 2F98A 2EIJH 4NHFA 1FTTA 1D1BA 1F8NA 4KT6A 1O3TA 3OWSA 3SEDA 4AEQA 4U0YA 3GTQJ 4B09A 2LKPA 3GFIA 2X6WA 3DEWA 3HJEA 1QU3A 2E7XA 3WTSC 2MG4A 3S15J 4OIQF 4O3MA 3NV0A 1VQ4I 3KLNA 5FJ8J 1SFUA 4F55A 1TUHA 3HOXJ 4Q48A 1I0XA 4IRHA 3PQKA 1X4OA 2XSOB 5ILVA 2DPDA 1Q7HA 4CXFA 5F1JA 1FBQA 2IAIA 3RDIA 1MBGA 3WOFB 3TDGA 2CW0F 1JJ22 2CG4A 4E7HA 3X3XA 3BR6A 1FMVA 1YS6A 1I6HJ 4F7ZA 2XUBA 1K6OA 1T0FC 2DLLA 1BGSA 1OGZA 2Y9ZA 3F3XA 1GY7A 1TW2A 1YJW3 2HYFA 3A01A 2W7NA 1XSDA 1BSAA 1RGAA 2ZXJA 2HQ5A 2FJ1A 3LA7A 4XONA 1BBYA 2IJLA 2JA2A 3QP6A 1ONVA 4RAZA 1USSA 3A2KA 4OIRF 3EYYA 1OCZH 3E3VA 3E6DA 3W2AA 1C54A 4OVMA 1YLFA 4L8PA 5H6RA 2XH9A 1NH3A 4LB5A 4FT8A 3IP4B 1DE3A 3ZCOA 2OTLI 3JTHA 3KIIA 3GW2A 1OISA 4WK8F 1IRGA 3S32A 1FUWA 2DA1A 1A5JA 2A15A 1O7FA 3V99A 3DPTA 1UFMA 2L9VA 5LGTA 2GM4A 2CS3A 5E1XA 4R79A 4A3GJ 1JT0A 3VPRA 2CFGA 1VQKI 1D6UA 3D0SA 4UVCA 1B9NA 5DCMA 4ENKA 4GYIA 1FTZA 4X0GA 1FSEA 1DP3A 5FD5A 3N54B 2XASA 3K4JA 2K02A 2RCDA 4L18B 2ID3A 3MWMA 7STDA 2C10A 2W56B 2M8EA 1ZRDA 5E17F 3H51A 2GIZA 1IN4A 5IF6A 3O8HA 1O7LA 1BIAA 4OOIA 4KICA 3KSPA 4LB6B 3CJQB 5KP4A 1JHFA 3EHCA 1BN5A 2VUMJ 1BC7C 4M73A 4OMZA 1MGTA 4BE0A 1RR8C 2KRTA 3QK9A 2IA2A 5AIPA 3E7LA 1JJ6C 3VFZA 3BB9A 3KYCB 1U78A 1P2FA 4HBRA 3X40A 1YIT3 2ME0A 4BL3A 2VE8A 4C3JJ 1TIJA 2FNAA 2GAUA 2JA8J 3KP4A 2DQRA 3D5GA 2IS1A 4O3VA 1YW7A 1IZ1A 3RDEA 2M8GX 3HZJA 4M6VA 4EJWA 2O7OA 3K10A 2E1MB 2OA4A 3FIWA 5J4VA 5C4JJ 3GSPA 2EZLA 4HX8A 2OZUA 2QEXI 2FOWA 1GMPA 1YHQI 1FYMA 4EYCA 2PJRA 3QPHA 3HRTA 3HTSB 2XEPA 3CMA3 2D1VA 4RM2A 1BRHA 4GL6A 3D1NI 3V4GA 2KMUA 1NHAA 1ZX2A 4KFFA 2PMZN 4BJTA 1E3PA 2ZKZA 1OYIA 2FQ3A 1SMYF 3CUOA 3WTTC 2ZXIA 1U2WA 3PJRA 2R93J 2EA2A 4P96A 2UUZA 4BDZA 1DQUA 3PL8A 4LITA 1QBJA 2MBFA 3BNDA 2M0MA 3K4BA 1R9TJ 2H8RA 4XICA 2RVCA 5M5WJ 5HGRA 1HF0A 3MZ8A 5FRNA 3K0LA 1V58A 2W82A 4A3IJ 2M7BA 3D5SC 3JW4A 3RSNA 4RNZA 2CUFA 2CYYA 2VQHA 4XLFA 4M3FA 1P7JA 1LNHA 3K4KA 2ACJA 1B21A 2L01A 3SZTA 1H0MA 1DUXC 3LT9A 4NQWB 3MKIA 1YOVB 3G4S3 1O7NB 1T38A 4KYWA 4X6AJ 3NEUA 4M9SA 1YI23 2R7TA 1F9NA 3JVCA 2CQQA 4BQAA 2Y31A 1JTXA 1UJ8A 3M4OJ 2H09A 2JSPA 4FCMA 4FMDA 5IYDJ 2QYOA 3OL4A 1YRNA 2XAFA 3T0UA 1HW5A 2K86A 4CUGA 1AKHA 4I98B 4HM4B 4FASD 4RB2C 4UUSA 2KCDA 3VSLA 2BV6A 2XSDC 1U6GA 3LFUA 3JUNA 4BXFA 1FT9A 3HXLA 2I10A 1X1BA 4BAYA 5JLWA 2KF4A 4WWUC 3W6JB 3SVAA 4I4KA 2W56A 3PNVA 2O3OA 1NU3A 3LSIA 1GV5A 2RGQA 1DMMA 1JBTA 2FU4A 4HEA2 2A5WA 1K41A 2YUSA 4MEYF 1IV8A 1RIOH 2EILH 1EA2A 2EFNA 3TEDA 2CHCA 1ON1A 4HQMA 4E6KG 1FX7A 5E1WA 1JE8A 4ZYAA 3ZN0A 4AUXA 4CCMA 3TP3A 1I5ZA 1VQPI 4XN0A 3IWZA 2HQRA 2PN6A 1UMQA 4NNJA 4B3AA 4OMYA 3FGYA 2XAQA 4NREA 2YR2A 4Y52J 1BI2A 4MNUA 2H0HA 2R5ZB 1IW7F 1S29A 2HKXA 3RPUA 4AWXB 4J8TA 4YIIA 2COBA 2FQ4A 2IS2A 2K4JA 1GLNA 2QQAA 1R22A 1A04A 3ALAA 2AQFA 2R4GA 3RPUD 1N77A 4XDWA 4HVNA 5CLKA 1BIBA 2QQBA 3RKYA 1YW8A 2M30A 2AO9A 4C3IJ 1DGRM 3QRDA 3WTYC 1BOBA 4LZIA 1GD3A 3FF5A 2B1XB 2R7DA 2HS5A 4JK1X 4XMYA 2KPMA 3P9KA 5E20A 2J8XB 2FXAA 1UCLA 2QBYA 2W4SA 2DODA 1LJ9A 4CGZA 1VFCA 2CW8A 4LLLA 1XTAA 2QQ9A 2CQXA 2DFIA 3Q0VA 1UB9A 4U88A 1AHDP 1OCTC 1T2IA 2JTVA 1P92A 2AHQA 3QYEA 2GOMA 2XGDA 4HA8A 3WU1B 2HMKB 2P05A 3DV8A 1UELB 2XPWA 3C2HA 3FM3A 3I71A 3H92A 5HLTA 2K85A 4IO9F 2E2JJ 2XROA 1I1SA 2XRXB 2Y73A 2RC4A 3DGOA 4HOBA 3DKXA 3BOQA 3LA3A 5EQLA 3NM2A 2VKHA 4NQWA 4HBLA 1YTYA 3LQRA 2CKFB 5LD2C 3CLQA 3BQZA 1QALA 3EUKL 2P5KA 3VF1A 2Z16A 2XVCA 3VWBA 4GRIA 5LRSA 4BEHB 2CV1A 2HDDA 1A90A 1KYZA 4HW0A 4ANJA 3LOYA 4HNUA 3PO2J 3WTVC 3NUVA 2VBXA 2NAZA 2HNHA 2XRNA 4IQ4A 3KE2A 1V4RA 3K70D 4GO1A 3WGHA 1S5AA 1FGRA 4O5VA 3DTEA 4CCOA 3D5IA 5C44J 2KFDA 3CCRI 4EBGA 1ZGAA 1M9GA 3LMMA 5ICEA 2W6JH 3I64A 3KSED 3EDPA 2W0QA 4QWTA 3QU3A 2X0LA 2HYJA 3U2RA 3FXRA 4ENNA 2DW4A 2HOEA 5IYBJ 1JZOA 1WMPA 2BU4A 1TWGJ 3CPOA 1GOUA 5LC6A 4BBRJ 2TRTA 2GLOA 1J2BA 2DJNA 1LE8A 1DU6A 1QJGA 1J75A 3D79A 4RAFA 4O8SA 4CCLA 4QTRA 1UG2A 2BIRA 5LEJA 4E7IA 1G3WA 5LEKA 3BZKA 3EUAA 3W6VA 3CJNA 2O9LA 2MLGA 2VI6A 2K9SA 3DU6A 4MQ9F 5ICGA 1C7HA 2O03A 1MGRA 3FK7A 2P4WA 5CLSA 1JB5A 2KF3A 2UUGC 2FNQA 2UX0A 1LFPA 2WAEA 2V1UA 4G6QA 1KA8A 4C9YA 3G73A 2R41A 3S29A 4XRSG 2MF7A 4ITVA 4JOMA 4OIPF 3OS0A 2K0MA 2L9RA 4IPAA 2PFBA 4MEXF 3TOAA 3F8FA 3U97A 2K7LA 1EH6A 2X48A 2F5EA 4L0YB 1RCKA 1WJBA 2DAOA 3SFIA 4RNYA 5AIFA 2KIMA 3JTGA 1NO3A 2L02A 3OIOA 1VQ9I 1VQLI 1TBXA 3I0YA 1WKMA 2HOSA 1L3LA 3HOZJ 1KQ0A 4IOAF 3KIOA 4E7SA 2V1XA 3PUBA 4KT5C 4OU0A 4PGHA 5FD6A 2CK3H 2PNCA 3RGAA 5LBQA 2P5VA 2ZC2A 3GCMA 4ENMA 5KK1A 2XDVA 2DA6A 2CW7A 3LTDA 1DVCA 3H9GA 3HKZA 5GAEJ 1FPQA 2RGVA 4HQEA 5K5RA 1R4NB 2QUFA 1BUJA 3MG3A 3TL4X 1MJBA 4D7MA 2K27A 4E4HA 2J5PA 3ZQ7A 2V4JC 1E3HA 2XAHA 2HZDA 4BQQA 3DQVC 3BCAA 4DGWB 2XKPA 1UCKA 2WGOA 3S1NJ 4HZ9B 1OPCA 1GS3A 2F5DA 1DMQA 1Y56A 2CQ7A 2Z3YA 4BTYA 3ZN1A 4DYRA 5D4RA 5ICFA 2W84A 1BRIA 1G6NA 1Z05A 1PVEA 3HBLA 3K2ZA 3ZQIA 3VODA 5ELUA 5FROA 2B7EA 2PLYA 5IERA 3GAXA 1BRSA 1MH4A 3CC2I 1NG6A 2V6CA 1N8QA 4LIUA 1JGSA 3ASOH 7GSPA 3TMOA 4YG2F 3QAHA 3F6VA 2HXIA 3A03A 3W2VA 3T8NA 5GTIC 4N4OB 3EB8A 3ZPLA 3S14J 1GY5A 3R60A 1GY6A 1MBKA 3OMYA 3WG7H 1YIJI 1UHSA 2R5YB 1QPIA 4R9LA 3VDXA 1FIAA 2G7UA 1LEBA 3QWLA 2FA5A 1IO2A 2XF5A 1HC8A 2Y0SA 5L3CA 2AADA 1BA5A 3IH3A 2FOKA 3B4OA 5F1RA 4QSHA 3WODG 1MGWA 1ODDA 2OCCH 1W6YA 5TGNA 2UZKA 3PZWA 1OLTA 3JRDA 2DK8A 1W2B2 3RGRA 3KYDB 4AYBN 2DTRA 3BJAA 1HZ1A 2BBYA 2ELKA 2ECBA 1APLC 3F8NA 3J7AY 3I553 2CWVA 3GMEA 4PFPA 5IP6A 2E1MC 1GMQA 1FUTA 2DOAA 1Q824 2OTJ3 2F5VA 4E7LA 1ZYRF 2KLOA 2A61A 4P9FA 4RAYA 3AG3H 1EG9B 4Y4RA 1ETKA 3Q3SA 4UV8A 1SIIA 3D4AA 5FLVA 3HI7A 3WDGB 5HS9A 1MWTA 3KP2A 1BJZA 3OOUA 4BUPA 2RNTA 3HX8A 3BLYA 3UNGC 5J4YA 4OIOF 2CIUA 4A3BJ 1EF4A 4HNTA 4EATA 9ANTA 5ILUA 2P7VB 3HOHA 3ABUA 3OXAA 4LSOA 3FCSB 1YQAA 2A69F 4XOTA 2M2EA 4JYKA 3NX0A 5B5EC 1FGTA 5DCFA 2VC0A 3S27A 1YI2I 1U9NA 5EZGA 2DYSH 1O7WB 3WU2C 1SEUA 1G3YA 1OYYA 4HV6A 1WJDA 1SAXA 5J3LA 3MKYB 2NYXA 3GO5A 2AXTC 3HL2A 5HVQC 5AEWB 1QO0D 5HNHA 2VBZA 2EFOA 2OQRA 5E18F 3JAMK 3GTMJ 5EJCA 2OPTA 5JFRA 1I3QJ 3K70C 1FLIA 3NRVA 2WAFA 4UY8I 2MLKA 1RN4A 3BQYA 2GXAA 3ASNH 1EH8A 3L1PA 1PFPA 2C11A 5CVJA 4KISA 5H2FC 1H88C 1E3VA 3U1WA 1JI8A 1KQ9A 3ISPA 3O6BB 3HOSA 2W03A 3SZPA 5IT9K 2H0GA 1LFUP 5EEAA 3CCL3 2QZ8A 4NUBA 4KIBA 3RYRA 4DBRA 3KZZA 2VJIA 3SOYA 1QZZA 1SC7A 1IXSB 4AD9A 5TGTA 2KT0A 1X1UA 4PUSA 3OYLA 5BU4A 3CP2A 3VB2A 1S72I 2EA4A 4FTHA 4LK0F 1IYYA 2RAEA 1W5ZA 2EV0A 4HM7B 5AEUB 3B6AA 2GU3A 3V7SA 3OS1A 1IN8A 3H3VK 5EG0B 3GRDA 4XM3A 3J81K 1RGCA 3GZYB 2CFWA 3A1YA 3C1DA 3ELKA 3F9KA 1STDA 1UAAA 2JZYA 1OCVA 1TP6A 4FMCA 4EC6A 4CCVA 4DZPA 1EEJA 3SYUA 3KKGA 1HQCA 3PSFA 4V2FA 1MIJA 3TDZC 5HODA 3OYMA 2KRHA 1FC3A 3OYKA 3I56I 4MO7A 2CWEA 1YX3A 1GV2A 3EUHA 2HMJB 1RETA 1Q814 5BPDA 2DFHA 2LY1A 1ZGXA 2XGLA 1ZHFA 2GIVA 4IHYA 5E3OA 3JSOA 4K1VA 3LQQA 3L2RA 3KFQC 5FLXK 5HDKA 2L4AA 4A93J 1OH0A 3HUGB 1MSEC 1Z0XA 5B1AH 1X1CA 2LF7A 4A2UA 3OW22 5IY5H 3O8GA 1WZ2A 2WTEA 2DMTA 4LGQA 2VIXA 3OWUA 1RRLA 2F56A 3ZMVA 2DQLA 1OCRH 3WE2A 5J1RA 1MWUA 3D3LA 2YFIB 1JUSA 2W48A 3S2WA 5DDGA 2O6GE 3MVPA 4PGGA 1SFEA 2R7UA 3FG1A 3FHZA 5D8KB 5BQTA 4EGYA 1OR7A 2VPLA 3RNTA 1EQKA 4XB5A 4RGSA 1WWXA 3WTXC 1RGLA 5DREA 3M3YJ 4HJLB 1I27A 3T1BA 1USTA 1OCPA 3K69A 2XIGA 5FLMJ 3CNXA 3NQYA 2VPRA 1I50J 4YRVA 2VB6A 1VQOI 1Y0NA 1QHGA 2CQKA 2A6HF 1TWFJ 1X1XA 3N97A 2IXSA 1UW1A 1FOYA 1PP7U 1RNBA 4YIRX 1BC8C 2ETHA 2WWYA 2FXTA 2XF3A 1WI3A 3AG1H 2BVLA 2FBKA 3H1CA 3MKLA 2X6YA 1E2XA 4WXDA 3KP5A 3CQZJ 1MNMC 4CHUA 1BNRA 1PJRA 2ZA4A 1JT6A 2P8TA 3M8FA 3GYHX 2LKXA 2K40A 4HRIA 3B7CA 3LH4A 2IA0A 1V54H 2A6EF 3TDUC 1ZREA 2QKMB 1FGMA 4UV9A 1BANA 2WB1N 1ASKA 4HM3B 4MMZB 5IOZA 1W4NA 2M7AA 1LFBA 3IAM2 4IVNA 5D5WB 3HOUJ 4BY1J 3ROBA 1DETA 3A01B 3H5NA 5DD4A 3CO6C 1H8AC 1K78B 2KDOA 2K9MA 3I53A 3CNMA 2OJED 3LOCA 3HOWJ 3UB1A 4N3VA 4Q4ZF 4CSWA 2BOLA 3TGNA 1V57A 2HXOA 3EE1A 4IPBA 4EV2A 2VKEA 2VN2A 1O3RA 1F4KA 3SYTA 1KU3A 1VNDA 4UVBA 1IQ8A 2LG4A 2ZJPF 2NVYJ 1X1AA 2BHZA 3F9SA 4J19A 2WAQA 2F6CA 2YFLB 2VOOA 3BDDA 3ROUA 1A35A 3D5LA 2BXYA 2Z6BA 4Y3OA 3H5AA 3F7XA 5DRVA 1H9TA 1WI9A 2HQAA 2YU3A 2YX7A 1X4PA 2L7MP 2ZBKA 3KLOA 4K2EA 4KA4A 1Q1HA 2PEXA 3CMEI 4JF8A 2HKOA 4ZJZA 3FMSA 2L1SA 1RI7A 3MMYB 2DPUA 4IRGA 3RYPA 2FSWA 1JB2A 5K5QA 5FO5A 3F8MA 2VLAA 3QQAA 2O5RA 3DEEA 5DCMB 2QSGX 1K8A4 5EEHA 4A5MA 4A3MJ 2XR8B 3SXXA 1O4XA 3HUGA 3CCV3 2R0QC 3KZYA 5B1BH 1U5OA 3PXMA 4I09A 3GZRA 4HKVB 3HTUA 3I9V2 4HOHA 1MNEA 3GZBA 2MH9A 2QQ8A 1VQM3 3Q0UA 3S67A 2E34A 5K7ZA 1RJOA 2INXA 4A6EA 1VQNI 5K5OA 3AMOA 2EINH 4NC6A 2DXIA 5AI1A 2XF6A 1ZH5A 3A0HC 5DS9A 2H1LA 1QRYA 3CCEI 1J9IA 3F8HA 1FA3A 3GUDA 3HOYJ 1Y1WJ 1NB5I 1D1CA 4D5FA 4CYDA 2EFPA 1T5YA 4BJ6C 5JI6A 1I2GA 4XBYA 5BXQA 1PU4A 4NHJA 2CG1A 1BNGA 4JRFA 5HDGA 2ELJA 3BNCA 3OIPA 1BNFA 2YPRA 2KDZA 2MC8A 3AGNA 1RRHA 2BMQB 1YG2A 3OS2A 1R5GA 1RR7A 2JN6A 4HDUA 3IH4A 1CF7A 2WY7Q 4V2GA 2FEZA 2O3FA 3N05A 3H5RA 2D45A 2HTSA 2PJRB 3HPHA 1FYKA 3R4KA 1IU7A 1T08B 2P81A 1K4TA 2HVSA 2WBMA 2XFTA 1R1TA 3X3ZA 4PZJA 4BH9A 4XIDA 1FJLA 1OACA 3OR2C 3S3OA 2H0IA 4U13A 1WMNA 3EPZA 4W97A 1IV6A 2XAGA 3RJPA 1AY7A 1Z6RA 1YJ9I 1BSDA 1BRNL 3PCSA 2ZNYA 4ESJA 2CFXA 4ASNA 1Q40A 2BYVE 1VQ5I 2RSXA 2CSOA 5E8GA 3DLAA 5KAFC 1K78A 2PBIA 4CZZA 3ZMUA 4HLXA 1G02A 8CHOA 4XRSA 2EPFA 1GXQA 3LAJA 2ZMEA 3X41A 4KNYA 2LVSA 2VONA 2R7SA 1J59A 1JUMA 5LLQA 1ITYA 3IPTA 4XORA 4BU4A 1O3SA 1O3QA 1UHMA 3B02A 1LOVA 1MZBA 3G1OA 3CC43 3JREA 3OYJA 4FISA 4E70A 1S9HA 3AFHA 2O8XA 4XRFA 1M1EB 1B8IA 5BOXA 3H36A 2GEYA 3FXKA 1YRNB 1IVXA 3E6CC 1NG7A 2HEOA 2OTJI 2SBLA 3GTGJ 4PK4A 1AKHB 5H20A 3EUHC 5JHUA 3OYCA 4UUSB 1XPXA 2CW9A 2CWUA 1B9MA 3CO7C 1OHSA 1JB4A 1VQ7I 1SVOA 1R58A 2BXZA 3PFIA 3CXC2 3H3UA 2V26A 2HOAA 4N9HA 1LDJA 5F04A 3T8RA 3MZHA 2F4IA 4Q53A 3F22A 1H89C 4M6YA 1IV7A 2YSRA 3ZGKA 1KU9A 1RNTA 1FIPA 2WOHA 1IVUA 2CUEA 3AAFA 1OHOA 2CX1A 4HM0B 1T56A 2HDWA 1Y39A 3K2AA 2MD0A 1TLHB 2XGEA 1W0UA 1O57A 4RDUA 4LG0A 3QODA 5M3FJ 5A2QK 1IUYA 2BEOA 3RKQA 2A3SA 2F48A 1OR7C 3Q9VA 5H6QA 1Y0UA 5IYCJ 1X1WA 5DUKA 4FQGA 2XGNA 3FKAA 4I7HA 3KETA 1TP4A 2BE5F 2PJPA 2ZO4A 3GTOJ 1I0VA 4N6V0 1W02A 4Z6YA 4CH7A 3H0GJ 5JVGF 4PFOA 1ERDA 4R1KA 2CFOA 3CD6I 3CDLA 1FBSA 2E1OA 2OV7A 3CJTB 2ZFUA 3ZG0A 3A5EA 2GU1A 3VSKA 4J5KA 1ETQA 1ROVA 3L09A 4C3HJ 3FXLA 3OYBA 4IHVA 3BT9A 3FXMA 2HI3A 1WVRA 3GZ5A 3MHEA 4LMYA 2XB0X 2LP0A 1GVJA 2XSHB 4PJ0C 3EN1B 1IDZA 1BOXA 3CCJ3 1TQMA 2IP2A 9RNTA 2XFSA 4OWRB 3BTCA 1XGMA 1IVVA 2V1NA 2JUGA 5KVRA 1RCLA 3G6E3 4JQFA 1WJEA 3V7CA 2QBYB 2ZXWH 3E1SA 5GAHJ 2I9WA 1V5GA 2MH2A 5FGMA 4G94A 4ESBA 3L2QA 4IHTA 3V42A 1UCRA 2XKOA 1BU4A 3F8BA 1BUQA 2E7WA 1ZELA 3HSRA 3MWZA 3QOPA 4XSXF 2QA4I 4WFOA 3GTPJ 3K7AJ 4PJNA 1MD0A 4XSZF 2ZJQF 3A02A 2OQEA 4A3KJ 1NNVA 2DT5A 1A6IA 4MJDA 1QVG2 4RA2A 3ERED 1HBXG 4D1QA 3ABTA 1FZPB 2STWA 3HDDA 4K90B 3N9HA 2XC7A 3B6CA 2E2UA 4ZDLA 4AVPA 1MMDA 2UV1A 2K54A 1P7IA 1FP2A 1YNVX 2WOFA 2R7QA 3KEQA 3QPTA 1ZQ3P 3K1PA 2Z2SB 4AIHA 2A05A 4J00A 5IEOA 2CJJA 2BHYA 1IRXA 4GYGA 3PO3J 2YFJB 4N6TA 1STZA 5G1KA 2EB7A 2D5VA 3MG2A 1RN1A 5BIRA 3G713 2W1OA 6STDA 3QOEA 2FMYA 4XLCA 4DBQA 2E5NA 1K734 3TW7A 5J47A 4RZMA 2XSJC 2BMRB 3WODF 3N8BA 3KE7A 3WTZA 1B72B 1BI0A 1U0JA 3KYLA 1NDOB 4ZC3A 4IHWA 4FX0A 2JA7J 4PDKA 3BTIA 1YYVA 2VT2A 8RNTA 1QA6A 2IW5A 5FKNA 3BR0A 2BMOB 1LE8B 2R7VA 1S5LC 4K1UA 2M9HA 2DMUA 1S8NA 2GBWB 1U5TA 4X2OA 2VBYA 3JRHA 4AIKA 4MMYB 3CJRB 3VSYA 2KRCA 1B2UA 4L9JA 3LSMA 4YIFA 3PYJA 5JPUA 2TCTA 1ON2A 2FD5A 4FHTA 1AR0A 4CCNA 2G0EA 2DI3A 3VYTB 2O8KA 3QRFF 1LOXA 3E5UA 1VQ63 1TRQA 4MLOA 4BBSJ 4AKZA 1GOYA 3J81Z 3ABKH 3K0ZA 4G9YA 1FBUA 4LD5A 1RC9A 3VYRB 4BHBA 4M71A 2EIKH 1REPC 1LVNA 3DPLC 4S05A 3A0BC 1G96A 4BHCA 1P6RA 3KCCA 1F5TA 3EQLF 3TO7A 2E35A 4S04A 3DFGA 3F8CA 5CF1A 1IN6A 4XNFA 2EBIA 4HF1A 5CKTA 4A3DJ 5JLXA 1L0OC 5LHGA 4XKWA 5HOHA 2FBIA 2E1CA 1WQLB 4O2HA 3C2GA 3MAJA 5ED4A 4MTEA 3REOA 3S28A 3OSGA 1IXRC 2ZMEC 3DEUA 5ICCA 4MHGA 1TC3C 2CGPA 1BNJA 4U0WA 1EUIC 1YVSA 1D0ZA 4BE2A 3C7JA 3JUMA 5IG5A 3C3WA 3ZQQA 1MMGA 4KITB 1SQWA 2Q1ZB 5L3GA 3WA3A 6RNTA 4R1HA 4HDVA 3OYEA 1ZGJA 1CYUA 3CC73 3EETA 2BY0A 1BW6A 2XPUA 4KT3B 4ENJA 1ZRCA 2F5CA 2PZVA 1R7JA 4RAGA 3WTUC 1JUPA 5K7HA 5HLGA 1XGOA 4IL6C 1GT0C 3RZOJ 2P6TA 2ME6A 1B2MA 4LGWA 1YS7A 3BZ6A 2M4KA 2PX9A 1B3SA 3QPLA 4F93B 3IRRA 5GAGJ 1GSPA 1EJ9A 1MWSA 1WTHA 3PIOF 1HLVA 2DU9A 3KEYA 4J5GA 3HYIA 4HX4A 2C4BA 1PP8F 4XLHA 5JHFA 1KSIA 1LPQA 5BPIA 4CA0A 1B72A 3RPQA 3AHWA 1R6RA 2D42A 3ZP5A 5J40A 3T8UA 3TBIA 3X3YA 2R3SA 4S0HB 2K3DA 4KFEA 4RB0A 1ETVA 4RLFA 1P4XA 5BS6A 4BL2A 1KYWA 2DMNA 1JBSA 3WE3A 2HR3A 3LSRA 2V1DA 1B6AA 3L00A 4BNCA 1Z6TA 2STDA 4KN4X 3IMAB 5FKLA 3NHXA 3TQNA 4EXRA 3FWEA 3SQNA 4QLCU 3S2DJ 1OMIA 4BU2A 4E7ZA 3JRFA 1GHCA 1N5HA 3CP8A 2IVMA 1JKOC 3GLXA 4IHSA 1D8KA 1BSCA 1I70A 1SVMA 2VKVA 1W6CA 1YVBI 1XD7A 3GTLJ 2LRDA 3L2UA 3BG7A 5L3FA 2L54A 5LGUA 2VASA 3FXJA 1LQMB 4JX4A 3CCQ3 4I02A 4AYBA 4AM3A 5D5UB 5FGOA 2VXDA 3MPHA 1RGEA 3CMMA 3KCHA 3NM7A 4FR9A 5AIGA 5JPPA 3RCOA 5DD8A 1E17A 4LOCA 4MGRA 5F64A 4BQOA 3F8XA 3LZAA 5JBSA 3CCU3 1GUUA 1A67A 3C2BA 1TQPA 2E2TA 4O02B 2OWPA 1YJWI 2GSPA 1X1DA 1BRKA 2RNGA 1N75A 1LQ1A 3QP5A 1QVTA 3BR5A 1G3SA 5EEOA 1CH0A 2DCEA 1KGSA 3CCM3 5J8CA 2HMOB 4GB5A 3Q90A 3G2BA 3DMCA 2DFFA 1S7EA 2AXLA 3IKVA 3BY6A 1RN7A 3P5JA 3OYAA 3DWLE 2EJRA 4BXXJ 3CZ6A 4M3EA 1K9M4 2OQEC 1YJN3 1ETXA 2B0LA 2IPQX 2X1DA 1V74A 1ZO2A 2M34A 4Y33A 3B8LA 3RKWA 2R7XA 2VBWA 3IC7A 1B59A 5JR3A 4CCJA 3M1CA 1Y8QB 1PDNC 3CCS3 1XMKA 2HVQA 2VXZA 2OC6A 2DBBA 2FBHA 4P9UA 1ZAOA 4ZTFA 2DDAA 2Z1DA 1A2PA 1SANA 4MTDA 1UUGB 5J6XA 1WNHA 2E71A 1HCRA 4B3XA 1SPUA 2RNJA 4RGRA 1ZR4A 3KN4A 3BP8A 2QSFX 3P9IA 2ADUA 2QGUA 3DTKA 3O2PE 1JKGB 3E99A 3H3ZA 2H8WA 4XR6A 2JQ7A 2QIYA 3GVAA 4F92B 2K9LA 1HSTA 4BACA 3URPA 4XKVA 1VQ83 2VODA 5HNFA 3ZQFA 1FOXA 3T8TA 4I01A 2XB5A 4PSWA 3DXJF 1FUSA 2AAEA 1QPMA 3I4NJ 3W6KB 3K5TA 2WV0A 1BNEA 1VQ43 1SARA 1R5ID 1U5TC 2WA0A 1YITI 2VQLA 2LF8A 1YE9A 3PSIA 3H0DA 4J01A 4CDLA 3AG4H 1NWWA 1RGFA 1MH3A 3WTWC 1K28A 2BNGA 1ZARA 1IJWC 1ZK8A 4R9KA 2KRFA 1M904 3JR9A 4UVAA 1LNWA 1X3WB 4N0BA 4L0ZB 3DM8A 5IP7J 2HQNA 4CDGA 1A6QA 5L3DA 3QU6A 4FETA 3PS8A 1LDDA 4TV7A 4L8OA 4ZZLA 1OYWA 3CMAI 5M18A 2GWRA 3ZMSA 3SFZA 4A3LJ 2F86B 3ZMDA 4NPBA 4XLNF 3BR3A 3KFWX 3G6EI 5KP1A 1SAUA 1GXPA 3U1KA 1AVLA 4QPOA 5M5YJ 1D0XA 2L7ZA 4M9XA 2Y69H 2M5WA 4DZJA 4XKCA 3L2WA 4AC0A 2ISZA 3LMLA 2IS6A 1YFHA 2FRHA 2EV5A 3KP6A 4PCQA 1QMAA 4M72A 1DVDA 2LBFA 3I4MJ 3C18A 3VGNA 2OTL3 4WP5A 3OY9A 5M1AA 1XMXA 2XF7A 1UDII 3NBJA 2DA5A 2LK2A 4XN3A 3G4SI 1R23A 2V9PA 3ZMTA 1ZS7A 2KHMA 3EBTA 1GDTA 1I2EA 1RTUA 2L2OA 2F5MA 2ELHA 2MGQA 1VQK3 1R00A 5A2QZ 1X2MA 2HOHA 1WJFA 2F4YA 2QCOA 5FKMA 2Y30A 2ZNZA 4FCYA 4MMXB 4MFDA 3T0YA 4IOCF 2W04A 2R4IA 2GZWA 2V7FA 4BTWA 1HKTA 2K9NA 1YW9A 4HNVA 3LXUX 2PMUA 1KZHA 2OZ6A 5GPAA 3DGMA 2GA1A 4Q47A 4BIRA 3HSEA 1QAKA 4KJZA 1YGEA 2HTJA 2NXNB 4QIWN 1LKXA 3L7WA 1W36D 2Q0OA 5D6EA 2Q2EA 5IG4A 2JVGA 5HLIA 1W5SA 3FHNA 4CJNA 1TU5A 1IDPA 1JKGA 3ERMA 1N8R4 2E19A 2XRLA 3BR1A 4A6DA 4WHAA 3B73A 4DKIA 3CUQB 5J8FA 3S17J 4XLPF 2ID6A 4EEFG 1JHHA 5DUIA 1US1A 2KF6A 3K4LA 1QZYA 3OYNA 5LC7A 1RDSA 3CU3A 2OQGA 3CCMI 4HF2A 3S8PA 3DLLF 2CO5A 2YU9J 1GD4A 1BSEA 1MDMB 3K9MC 1RESA 1Z7LA 1U8BA 3BIRA 3NWTA 5STDA 4EV5A 2QEX3 2XHKA 1YHQ3 3GX4X 2LYXA 2OU2A 2CG0A 2JUCA 4Y13A 3DU5A 3BPVA 2JMWA 1J2XA 3K4NA 1HW2A 3SXYA 1JKRC 1PUFA 1DDNA 1V5EA 4QWQA 3GWZA 2JQ5A 3CPW2 1MBEA 2Y0SN 3FXQA 3SEQA 1DMNA 1O7MB 3VOEA 3TOBA 3BCBA 2SARA 2LTPA 3L9FA 4BXUA 3WHOA 4M3GA 1WCMJ 2NS7A 1UHWA 5J1YA 4H61A 3COAC 3STDA 1SFXA 1R36A 1T33A 2O9UX 3DH2A 1HKSA 4IKFA 4A0XA 3LNQA 3HK4A 2GA2A 3ZR8X 5D83A 1W6GA 3AMOB 2HPMA 2A5YB 2P6SA 2KP6A 1XG1A 3L2CA 1S6LA 5CVUA 5GP9A 4AU7A 1N78A 4UUVA 4EW5A 1K79A 3M1EA 5M19A 5E1ZB 3MYTA 1EKEA 2Y74A 1K4SA 3I563 3FF2A 4ZZDA 3HRUA 4GGGA 1JTYA 2ZDJA 2H6CA 4F52A 2KKOA 2F2EA 3OWTA 1ZTRA 4LLGF 4D0PA 4A0ZA 3V8KA 5EVHA 2IGNA 2ECCA 4KVHA 4ZYHA 5CK6A 4ORLA 1I1GA 3BZCA 4KDPA 4B8XA 2JRTA 1D6YA 1Z3XA 4ZYGA 4HM2B 3RQ4A 2EFQA 1PYVA 4NC7A 1O7PB 1CF7B 2CU7A 1N9JA 2HMLB 5EZHA 1I3AA 2W85A 5L3BA 3I58A 3FH1A 4UNOA 4IF4A 1WSUA 2CFKA 1IUFA 2E2VA 4NB5A 2DA7A 2Q07A 1KONA 3H35A 1FNNA 3E6BA 4GCVA 5FKKA 2R7WA 2Y0MA 3BJ6A 1ZG1A 3HRMA 3RI4A 1Q9EA 5K1YA 3SJMA 1U3EM 4A3JJ 3ONQA 2I5UA 4BE1A 1VQP3 2WO0A 4IXAA 2A6TA 1Q40B 3CUQA 3SX1A 2WV1A 2LMDA 4BYYA 2NNYA 2OOVA 3DKYA 3U21A 4DW6A 1FGOA 1F36A 2ZSIB 3GZ6A 3HGYA 4EQQA 3S3NA 2F5WA 1GMRA 2ZMEB 2RKHA 2XGXA 3AG2H 1F43A 1I6XA 2D2WA 4G7OF 2B24B 2IMJA 3IJEB 4DQ2A 1SD5A 3ZRGA 4KMUX 1MDMA 2DOFA 1UGIA 3PCRA 3FKIJ 1IVWA 1UGHI 3JRBA 1TTYA 4L9VA 3CF5F 1Q864 3N4MA 1FOWA 4PSXA 2B63J 1GOVA 2CQNA 4L9NA 4OINF 2K9QA 4BGDA 1B8IB 2IRFG 1I3FA 3MG1A 1UCJA 3K9TA 1B2XA 5CJ9A 1ZLKA 5KCMA 4UHTA 2MC4A 4EJVA 4UB8C 3QYFA 5FB2A 2X4HA 2LR8A 3U1DA 1LXEA 2P5LC 4I6ZA 3NQOA 5DM6F 1OGXA 3BLZA 2BGCA 2D1WA 1AU7A 2LY2A 1B2SA 2GXFA 1OJLA 1IN5A 1QNTA 4OK0A 1FZUA 2A68F 1E3RA 5AIHA 3R61A 4XOPA 4U0VA 4A12A 1OF5A 3BG3A 1IG7A 4DNCA 3MKWB 3OWYA 1MMAA 4YEJA 5FFZA 4HG2A 3HB9A 5CQEA 2M4GA 4I2OA 6PAXA 2L7FP 4ZYDA 2F99A 4LG0B 3Q5FA 3DBLB 1R1VA 2XV4S 1YJNI 3M9AA 3ULQB 5F27A 2BZTA 3V8LA 4RBOA 4UXNA 4WF2A 1UG0A 4BS9A 2BW3A 1N25A 2EZIA 1P9QC 1XS9A 2BT3A 5BVBA 5K7FA 5EEGA 4A3CJ 1NTCA 2EZKA 5B3SH 2W9PA 3FXUA 4HF0A 1FW7A 1LUJB 2CV2A 4NDLA 4WYKA 2E60A 4XLEA 4CZCA 3V98A 1RUNA 1SD6A 3UKGA 1RLSA 3DUKA 1ETYA 1Q1VA 1SVLA 1XN7A 2DJIA 2LC2A 3R0AA 2Y75A 3GZNB 4B47A 2UGIA 1X2NA 3HHGA 3BR2A 1W36C 4LK1F 1FY7A 2GQQA 3PM1A 4P1WA 2HWVA 2H1KA 4EV0A 5FRMA 1BSBA 1JN5A 3LSHA 2PMZA 4AIJA 3AGOA 1VI0A 5KAIC 1AWCA 3S2HJ 2YS9A 2JJ7A 1DYUA 5A0OB 1OKRA 1PY3A 5GSPA 3OYDA 2P7CB 2L4MA 3MEXA 1QGPA 5KHDA 1R49A 1D8JA 2JSCA 2WADA 3FBNB 3FLJA 2WY8Q 2R7OA 5E3LA 5EF6A 1AV4A 1W5TA 3MCZA 4P5OA 3I59A 3AL0C 1HA8A 4G6DA 1A2VA 1OPYA 1D1AA 3NQZA 3T5XA 2QM3A 2R92J 2LQVA 1HKQA 3GLLA 1R1UA 3BROA 3MQ0A 3DY5A 3FZVA 1E3OC 3J7AO 4RBNA 2X51A 5HS7A 3U9GA 3DXOA 2VQCA 1VQ93 5BNGA 1Q7Y4 1HDPA 1VQL3 3I55I 3NWSA 3WGGA 1XCBA 4KIFA 4CICA 5AIQA 1A36A 1W2ZA 5F0CA 5B66C 3DGLA 3SLUA 3HSFA 1Z1SA 1BRJA 3DGNA 4LYLB 2VOPA 3IKTA 3E6MA 3JUOA 4IZZA 5DTDA 3CLOA 5F08A 4CPKA 3JRAA 1FP1D 3G3ZA 4PJJA 1C0WA 1W7PA 2OBPA 2P0WA 2ML6A 1S3JA 2FUG2 2P0XA 2JK3A 2WAQN 3L2VA 4A0YA 1IN7A 1W7PD 2X6OA 2MW8A 2LOOA 2OD5A 1IQYA 2R7ZJ 1TJDA 4UB6C 4FCJA 5F0FA 5D82A 1IXCA 2E36A 4A3FJ 3Q9SA 1GVDA 4EM1A 1MNLA 1MOLA 3S3MA 2IUJA 5J1UA 4DYQA 3HIGA 1U5TB 3MSOA 2EIMH 2W24A 4F3QA 4Z2YA 1BRGA 3KP3A 4N6UA 1NJI4 2PG4A 1D5YA 4LMIA 1ROAA 1TNTA 5D5XB 4HM1B 2YX9A 1Z77A 3Q2PA 4F91B 3CC23 3UL6A 1VZ0A 3ECHA 3L0RA 4MEIA 5IG3A 3I5UA 4RS8A 4XKBA 5TRDA 3DCFA 2KF5A 1F1ZA 4II2A 2RDPA 3CF2A 4U7DA 1IK3A 1MNDA 3FXOA 2KIFA 3PFYA 2V1LA 1YIJ3 4ETSA 4M6XA 4L7KA 3CCLI 2HMNB 1G2HA 4FE4A 4IT7A 3DPUA 2IYJA 2E2HJ 1E0EA 3G1LA 1XGSA 1B1BA 3HIFA 2QKLB 3PNYA 2IGMA 1YX5A 3WHBA 5FKOA 2HOTA 3SEZA 1EV7A 1FMWA 1Y8RB 2XPVA 4ZH4F 3HOTA 1G59A 3LA2A 3WGIA 2RREA 3DF8A 1X1PA 3E5QA 1R71A 4EM0B 3CUQC 3F72A 1BM9A 1KQ8A 3FZWA 1B2ZA 2OOVC 2STTA 2DDBA 2HFHA 2M1BA 1K6YA 4ESFA 4C2TA 1Q42A 2X9DA 3NBRA 4DOZA 1CGPA 3B4PA 4R80A 2CX0A 1BI1A 5AYRB 2I8DA 4HM6B 3WU0A 4H3UA 4LJZF 3BTJA 2XAJA 3ZFZA 2UWMA 1FYLA 1STFI 2IGKA 2LY9A 2L9NA 2JRMA 2Z76A 2OAZA 2VJ4A 4IQJA 2ZJRF 3O8YA 1RGGA 4HAAA 3RKXA 3EJVA 5FFXA 4BHPA 4DYCA 1JKQC 4HZFA 1TQIA 3JRIA 5E3NA 4G12A 3IHUA 1SIHA 1WJCA 1AOYA 3H3HA 3HHHA 3FKJA 4JX6A 1WFXA 2UXXA 1YO5C 3JAMZ 2AQEA 3HOVJ 3V8JA 5IG0A 2NVUB 2IS4A 4R4KA 5D6FA 3K4CA 3S5CA 1DU0A 3LFKA 3DKWA 2Q8KA 1XX5A 1KU2A 2W2CA 1VQQA 5CVRA 4C30A 2MA3A 2HVRA 4XK4A 3UJMA 3DP7A 2RBIA 1KD14 2CFDA 1ZN2A 2L0KA 3SDBA 5IT9Z 5E79C 3IWFA 5L3EA 2CRGA 1I8VA 4X1EA 3EBYA 1RGKA 3MZYA 2E1NA 4KUMA 3FF0A 2HYGD 3PQJA 5E3MA 4D5CA 5G2GA 2MC3A 4IIAA 5AYSC 3CMYA 1J7KA 3F14A 2KISA 2ICWG 1FEXA 1N9EA 3IAS2 4WX9A 3GFLA 4N9IA 1S7OA 1WRJA 1TWAJ 5M3MJ 3ER7A 1BOAA 5GADJ 3E5XA 4HYEA 2J5OA 3J7ZI 2C6YA 2JPBA 1T39A 2EK5A 4FMAA 1RUOA 2VKDA 2LSOA 1MKMA 1G8XA 1WJAA 1QVUA 2F4OB 4DIQA 4WWCA 2Y2ZA 3TO6A 5HS8A 5C4XJ 2VL8A 2KZGA 5DV5A 4DJAA 2K5CA 3LSJA 1TZLA 3OR1C 3JRCA 3EX9A 1S723 5EYRA 2CC3A 4HLYA 2TDXA 2OCEA 1ZGWA 2ZB9A 1XC5A 1W0TA 1HDDC 2EWNA 4CO8A 1PYLA 1UI8A 2Z5UA 1P4AA 5JVTA 1T2KA 4LEHA 1IT8A 5FLXZ 1E97A 1NB3I 3GZXB 2ISYA 1TRPA 2ZXHA 4H4KC 2RFRA 5CQGA 4GSPA 3LSPA 3V7RA 5CVVA 3PIPF 1OCOH 2OF7A 1R4YA 2CV0A 2ESHA 1TWCJ 4G7HF 1J0RA 1ETWA 1MMNA 1Z9CA 1VF9A 1SFOJ 2IEKA 1EA3A 3OYFA 4BDYA 1BNSA 1ZLJA 4HAMA 3Q3FA 3QYBA 3PGBA 4Q5SF 4XBTA 3FX3A 3LWFA 4KN7X 4B44A 1IT7A 3P9CA 5LFAA 3F40A 4HM5B 3G0KA 4H0EA 3G16A 2P09A 3I4PA 1HSJA 4XLAA 1A2KA 3DZLA 2JPCA 4FX4A 1JGGA 3HIIA 3GTKJ 3K4MA 3I54A 4ABZA 3LSKA 4LIVA 2JA5J 3GEZA 3Q1CA 4ILFA 3J80K 1CQTA 2NRAC 2FE3A 3ECFA 4X2HA 3CCVI 2V9KA 2DK5A 3FMQA 1LB2A 1Z3YA 3S1RJ 3EYIA 1TT5B 1IV9A 1POGA 2Z7AA 4KFDA 4B48A 4M3DA 2P38A 2BY2A 1QAFA 3BU4A 2E5ZA 1VQMI 3VEPA 4A5NA 1RHLA 5LHHA 3K63A 2R7FA 1JV2B 1WMOA 2P0MA 3CDHA 4PJLA 4K61A 1IGNA 3K6GA 4P55A 5KNLA 1VZZA 5LHIA 1K83J 1UZCA 1VQO3 4RGXA 2HPIA 5IP9J 3OOPA 1WH5A 4M9ZA 4U7BA 4CYCB 4HSTA 2KXGA 4N4NB 4XBXA 3S93A 1V5FA 4D7NA 1W00A 2GEXA 4E7KA 2D1HA 2DMPA 3IUOA 1BVIA 2LNBA 2HMMB 4MFEA 4LLNA 2X1CA 2YX4A 1J09A 1HXDA 2Z99A 3DTIA 2AS5F 2PMHA 2ZCWA 1RKWA 3W3CA 1RZ4A 1B4AA 2IA1A 3RTRA 1XSXA 3ABMH 2QSHX 4YFXF 1WH7A 4E7JA 1MW7A 1AA7A 1ULIB 2GXBA 1DPRA 4L5EA 2CH9A 3G1MA 2NS0A 3GFJA 4EJUA 3FDYA 1RNLA 2VE9A 1HYFA 3E0JB 1JKPC 2Y48A 2ZFWA 3KX2A 3ZQGA 1LNIA 4N6OB 2CMPA 4RNTA 4W1UA 3JUQA 3UNLA 5CPRB 3LL7A 4UUTA 1ACIA 4OAZA 2KJCA 1AVKA 4XRMA 2HGCA 1B20A 3H9JA 2EQRA 2NS8A 5IW9A 3A4CA 4ZYEA 3E97A 2L9SA 3HM5A 1QZEA 2LKSA 2X1EA 2LBFB 4FMBA 4RLQA 1TT0A 1Z67A 2R5ZA 4HM8B 4HZBB 2G9WA 1X19A 3ECOA 3EF8A 2R7RA 1Z21A 1M1XB 1BIRA 3CME3 2ML5A 3LTBA 3S1MJ 3CC4I 2W9QA 4II3A 1SFKA 4EGZA 2ZHXB 4YFNF 4EJOA 1Y4KA 3M8CA 3RZDJ 4JBAA 4I76A 4PEJA 3F0CA 4EM2A 4CCKA 4C2UA 3JCUC 2H27A 1MMSA 5D4SA 2RN7A 2GXGA 4PJMA 2UXNA 3LAPA 5E8IA 3OV4A 3M07A 2V6EA 1VQN3 3OX9A 3IL2A 1QHHD 4J9AA 1LRAA 4N6LA 1BR4A 3WOEB 3R6SA 3GF2A 4FE7A 2W57A 1XB4A 2NVTJ 5ILSA 4KFCA 2MABA 2M3AA 1RRJA 2FMLA 2Q2EB 4L5JA 1BNIA 3CCE3 1JBRA 5LRRA 1LVAA 1U9OA 2COMA 2M45A 1OCCH 1ZRFA 2LD5A 1LOWA 2QENA 3V92A 2L3DA 2F4MB 3M8JA 3BNEA 4N6MA 4IEJA 2VT3A 4GHOA 3ML6A 2IGOA 1ULJB 2NVXJ 3RIRA 4BEHA 5FW5A 1SD7A 2NNNA 2H94A 3I0TA 3OIQA 3AL0B 1T98A 1K7AA 3WHCA 1K61A 4CYCA 3J7YJ 1LQGC 1TL8A 2F5FA 1YIOA 1W4MA 1IRFA 5I97A 7RNTA 2IUKA 3X2QH 1U8CB 2ZJ2A 2VQGA 3K1NA 4V19K 4N6NB 4O6JA 2DYRH 1RPWA 3LYGA 3H9QA 4L5IA 2KIUA 4G8XA 5CYVA 1T2HA 4BJ5C 3KP7A 1PUFB 1CQSA 1V3FA 1ZKGA 3WG9A 2DN0A 1XCVA 1YJ93 2WC2A 1GYBA 3IRQA 2RQQA 3OV8A 2IY2A 4IJAA 4Y17A 4RGUA 3CCJI 2IBDA 3CTAA 1VQ53 3HEFA 2QWWA 3I3LA 3BG6A 5BMZA 1R4CA 1EKMA 3AHSA 1TFOA 2O61A 3SZGA 2DFEA 1OHPA 3F23A 1R4MB 1WQ2A 2VC1A 3JSPA 3F21A 1FYSA 1RSNA 4BTXA 5CVIA 4AIDA 1ENHA 2DO7A 1HU9A 1WHUA 1HW1A 3GWRA 1LOYA 2BO9B 4KZ1A 4L9TA 4TX4A 3SHFA 4EJTA 4I5QA 2LLKA 2X85A 1Y1VJ 5F0HA 1Z91A 3K7CA 2DA3A 5DM7F 4I0BA 5AONA 1A31A 1MSFC 2NVQJ 1TWHJ 4NC8A 3D9RA 1ZR2A 1G0TA 1LVKA 1Z1DA 4QPQA 1SD4A 1SMTA 3OL3A 4Y15A 2IT0A 4IX7A 1W7CA 3F6OA 3J7Yd 1WGXA 3ABLH 3DBRB 1VQ73 3M7GA 2KIQA 4HV5A 3R0JA 4OUQA 1OFCX 2V9VA 2JVHA 2LREA 3VYUB 3A76A 2LDUA 3FISA 4KIGA 1KU7A 1BL0A 1Y6IA 4GFBA 3M8EA 3AKZA 3FG4A 5D8LB 2RV8A 2FGTA 3G71I 5IOYA 3HKZN 3BJOA 2DT6A
chains in the Genus database with same CATH topology
5LC6A 1KQS2 1ISKA 4OK0A 1J2BA 2I9WA 1E3RA 5AIHA 1QJGA 2CWTA 4O8SA 1OF5A 2ZL8A 2CFLA 3OWYA 1D6ZA 1FGQA 1QVF2 1BUQA 1JRQA 4WFOA 1O7GB 3F7SA 2F99A 1C7HA 1JB5A 2OQEA 2UX0A 2FNQA 4MJDA 2GBXB 1QVG2 3CD63 3S29A 5IENA 1SJWA 2MF7A 4K90B 4STDA 1CEWI 3N9HA 5CF2A 2Z77A 2E2UA 2K0MA 2BT3A 5BVBA 2K54A 3U97A 2WOFA 5IEOA 4WYKA 5AIFA 4RNYA 3V98A 1NO3A 2YFJB 3LTAA 4N6TA 3MG2A 3G713 3DUKA 3I0YA 6STDA 2CK3H 5AYRB 2PNCA 1K734 3RGAA 4RZMA 2BMRB 3N8BA 3KE7A 1KWIA 1JN5A 1NDOB 1O7HB 3LTDA 1DVCA 1CYVA 4ZM8A 1OUNA 2BMOB 3MG3A 5IEPA 2QA43 5A0OB 1DYUA 4G1MB 4K1UA 1OF5B 3FLJA 2GBWB 3NXJA 4X2OA 3SOAA 2WGOA 4MMYB 1AV4A 1A2VA 1OPYA 4HZ9B 3VSYA 1GS3A 3NQZA 1DMQA 1M1K4 2LQVA 4FCZA 3PYJA 2WGQA 4BTYA 3DY5A 5JPUA 1AR0A 3BNBA 4RBNA 5ELUA 1LOXA 3DXOA 1VQ93 5IERA 1Q7Y4 3GAXA 4AKZA 1VQL3 1VQ63 1W2ZA 3K0ZA 1N8QA 3DGLA 3SLUA 1LVNA 4WYKB 1Z1SA 3DGNA 1G96A 3JUOA 3T8NA 3WMDA 5CF1A 5ELJA 3EB8A 3FG3A 2ML6A 4AKYA 1GY5A 1GY6A 2P0XA 4R9LA 3UL5A 3LT8A 1JN5B 4XM4A 1JNQA 1IQYA 1WQLB 3EN8A 4O2HA 4FCJA 5D82A 3S28A 3B4OA 3WODG 2OCTA 1MNLA 5TGNA 1W6YA 1MOLA 5IG5A 3JUMA 3HIGA 3PZWA 3NV0B 2IUJA 3MSOA 2IA7A 1W2B2 1SQWA 3RGRA 1HKXA 4N6UA 3WA3A 1NJI4 4LMIA 1CYUA 3CC73 1ROAA 5AIIA 3I553 2CWVA 4HM1B 2YX9A 3CC23 3Q2PA 2JDIH 3UL6A 3L0RA 2PZVA 4MEIA 5IG3A 1Q824 2OTJ3 1IQXA 3JUPA 1UUVB 1EG9B 1SIIA 3WDGB 3HI7A 1WTHA 3KZTA 1IK3A 3HX8A 2V1LA 1YIJ3 2CIUA 4L7KA 2HMNB 1KSIA 4IT7A 1N5PA 3FSDA 3OXAA 2D42A 3FCSB 1TFKA 1UI7A 4LSOA 3T8UA 3X3YA 2W9PA 3SEDA 3NX0A 4KFEA 1FGTA 3S27A 2STDA 3FZWA 3IMAB 1O7WB 2OOVC 3NHXA 4EXRA 1Q42A 3NBRA 1N5HA 3EC9A 2BHMA 3B4PA 4R80A 5AEWB 1W6CA 1YVBI 3LTCA 1W01A 4HM6B 3G8ZA 4H3UA 1KC84 1STFI 3WA2X 3CCQ3 1PFPA 2C11A 2Z76A 3O8YA 5FGOA 1RKYA 3MPHA 1E3VA 2L4VA 3EJVA 3U1WA 4FR9A 3NM7A 5AIGA 5JPPA 3CCR3 2W03A 3EQQB 3LZAA 5JBSA 3F8XA 3CCL3 1SIHA 5D81A 3HZPA 5KP3A 3H3HA 4XDVA 3CCU3 1A67A 3NBBA 2E2TA 4O02B 2OWPA 5IG0A 1UUWB 4R4KA 5EEOA 2M7OA 3S5CA 3X42A 2HMOB 4GB5A 1L5GB 3Q90A 1W5ZA 2W2CA 4HM7B 5AEUB 3DMCA 2GU3A 4HYZA 5CXOA 3SOYA 2F98A 1RN7A 4NHFA 3GRDA 1F8NA 3OWSA 3UJMA 4AEQA 3GZYB 2CFWA 1KD14 2CFDA 1STDA 1K9M4 2OQEC 1YJN3 1OCVA 1TP6A 4FMCA 3EBYA 4EC6A 3NV0A 1ZO2A 1V74A 4CCVA 1TUHA 3B8LA 3KKGA 5G2GA 4IIAA 5AYSC 2XSOB 3F14A 2HMJB 3CCS3 1Q814 1N9EA 2XGLA 3WOFB 3TDGA 1JJ22 4K1VA 3ER7A 3KFQC 3X3XA 1OH0A 1OGZA 1WNHA 3FF0A 4FMAA 1GY7A 1SPUA 3OW22 1YJW3 3KN4A 4LGQA 3OWUA 2QGUA 1RRLA 1JKGB 3E99A 3EX9A 1S723 2QIYA 2CC3A 3D3LA 2YFIB 4OVMA 1VQ83 4L8PA 2XH9A 1UI8A 4LEHA 3FG1A 1IT8A 1EQKA 1NB3I 1E97A 3GZXB 4XB5A 3K5TA 2RFRA 1VQ43 3KIIA 5DREA 1FUWA 4HJLB 3CNXA 3NQYA 3I563 4CDLA 1NWWA 2A15A 3V99A 1K28A 2BNGA 3PGBA 4R9KA 4XBTA 1M904 1UW1A 4HM5B 3DM8A 1IT7A 3F40A 3G0KA 2CFGA 1D6UA 2FXTA 2P09A 2XF3A 3G16A 3MWZA 3PS8A 1A2KA 3DZLA 4L8OA 3N54B 3HIIA 3LH4A 2RCDA 3B7CA 2F86B 1FGMA 7STDA 3Q1CA 2C10A 2W56B 3H51A 1ASKA 4HM3B 5KP1A 4MMZB 3ECFA 4X2HA 5IF6A 1AVLA 1W4NA 3ROBA 1IV9A 2Z7AA 4KFDA 3KSPA 5KP4A 2P38A 3EHCA 1QAFA 3LMLA 3CNMA 1QMAA 3UB1A 4N3VA 2KRTA 3K63A 1DVDA 1JV2B 1WMOA 2P0MA 3QK9A 4IPBA 4EV2A 4K61A 3VGNA 2OTL3 1IQ8A 4WP5A 3BB9A 1VZZA 3NBJA 1YIT3 4HBRA 3X40A 1TIJA 3F9SA 1VQO3 3EBTA 4O3VA 2YFLB 3RDEA 2Z6BA 2KXGA 4XBXA 3F7XA 5DRVA 1W00A 2GEXA 1VQK3 4EYCA 4JF8A 2HMMB 2XEPA 3CMA3 4GL6A 1JB2A 4MMXB 1ZX2A 2W04A 4KFFA 2R4IA 4BTWA 3LXUX 1K8A4 3CCV3 2XR8B 3DGMA 3SXXA 1ULIB 1QAKA 1U5OA 1YGEA 2CH9A 3BNDA 3PXMA 3GZRA 4HKVB 3GZBA 5HGRA 1VQM3 5IG4A 1N8R4 4N6OB 1TU5A 3S67A 1IDPA 1JKGA 1RJOA 2INXA 3JUQA 4RNZA 3UNLA 3AMOA 4WHAA 1LNHA 5AI1A 1AVKA 3LT9A 3MKIA 1US1A 3G4S3 1O7NB 3F8HA 5IW9A 1FA3A 1YI23 4FMBA 1NB5I 4HZBB 3JVCA 4HM8B 5LC7A 3CU3A 1GD4A 1T5YA 3K9MC 5STDA 4EV5A 4FCMA 4FMDA 3EF8A 4XBYA 5BXQA 2CG1A 1PU4A 4JRFA 2QEX3 1YHQ3 3T0UA 2LYXA 1M1XB 3CME3 2CG0A 2ML5A 3BNCA 3LTBA 2W9QA 4HM4B 2MC8A 2KCDA 1RRHA 2BMQB 1Y4KA 3JUNA 3M8CA 3CPOA 1IU7A 4PEJA 2JQ5A 3CPW2 2XFTA 4WWUC 3SVAA 3X3ZA 1DMNA 1O7MB 4I4KA 1OACA 4U13A 2W56A 1WMNA 2O3OA 1NU3A 3OV4A 1VQN3 2RGQA 1DMMA 3OX9A 4J9AA 4H61A 3PCSA 4N6LA 3STDA 2O9UX 3WOEB 1K41A 1Q40A 1EA2A 2RSXA 3CCE3 2CHCA 3HK4A 3V92A 5D83A 8CHOA 1W6GA 3AMOB 3CCM3 3X41A 3FGYA 3BNEA 4N6MA 4NREA 1ULJB 3IPTA 3MYTA 2Y74A 5FW5A 3FF2A 3CC43 4J8TA 2ZDJA 4XDWA 3ALAA 5CLKA 2GEYA 4HVNA 5EVHA 5I97A 1IVXA 2IUKA 1U8CB 3QRDA 2SBLA 4KVHA 5CK6A 4ORLA 2CWUA 4N6NB 2CW9A 4LZIA 1D6YA 4HM2B 1OHSA 1JB4A 3LYGA 1GD3A 1O7PB 2B1XB 1N9JA 2HMLB 1CQSA 3CXC2 4Q53A 1YJ93 1GYBA 3FH1A 1IV7A 2CFKA 2E2VA 2Q07A 1VQ53 1R4CA 1EKMA 1TFOA 2WOHA 1IVUA 1OHOA 4HM0B 1OHPA 4BTXA 2HMKB 2P05A 1VQP3 2WO0A 1HU9A 2XRXB 3EE1A 3GWRA 3DGOA 1Q40B 2BO9B 2Y73A 4KZ1A 5EQLA 3SX1A 3NM2A 4TX4A 2OOVA 1FGOA 2CKFB 2XGNA 3FKAA 3K7CA 1QALA 2IMJA 2B24B 3VF1A 3IJEB 4N6V0 1W02A 1A90A 3D9RA 3PCRA 4R1KA 3LOYA 1IVWA 1Q864 1W7CA 3NUVA 3J7Yd 2GU1A 1ROVA 1VQ73 3MG1A 1S5AA 4OUQA 1FGRA 3A76A 3MHEA 4EBGA 1M9GA 2W6JH 3KSED 2XSHB 3EN1B 1LXEA 3FG4A 3CCJ3 2FGTA 1OGXA 2W0QA 2XFSA 3BLZA 4QWTA 2D1WA 1IVVA 2GXFA 3G6E3 1WMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISK A;  2I9W A;  1E3R A;  5AIH A;  1QJG A;  1OF5 A;  3OWY A;  1BUQ A;  1O7G B;  3F7S A;  2F99 A;  1C7H A;  1JB5 A;  2UX0 A;  4MJD A;  2GBX B;  5IEN A;  1SJW A;  4STD A;  5CF2 A;  2Z77 A;  5BVB A;  2K54 A;  5IEO A;  4WYK A;  5AIF A;  2YFJ B;  3MG2 A;  3DUK A;  3I0Y A;  6STD A;  3RGA A;  4RZM A;  2BMR B;  3KE7 A;  1JN5 A;  1NDO B;  1O7H B;  1OUN A;  2BMO B;  3MG3 A;  5IEP A;  4K1U A;  1OF5 B;  3FLJ A;  2GBW B;  3NXJ A;  4X2O A;  3SOA A;  1OPY A;  4HZ9 B;  3VSY A;  1GS3 A;  1DMQ A;  5JPU A;  1AR0 A;  3DXO A;  5IER A;  3K0Z A;  4WYK B;  1Z1S A;  3JUO A;  3T8N A;  3WMD A;  5CF1 A;  1GY5 A;  1GY6 A;  4R9L A;  1JN5 B;  4XM4 A;  1WQL B;  3EN8 A;  4FCJ A;  5D82 A;  3B4O A;  5TGN A;  1W6Y A;  5IG5 A;  3JUM A;  3NV0 B;  3MSO A;  3RGR A;  1HKX A;  4LMI A;  5AII A;  4HM1 B;  2PZV A;  5IG3 A;  3JUP A;  1UUV B;  1EG9 B;  3KZT A;  3HX8 A;  4L7K A;  2HMN B;  3FSD A;  3OXA A;  3T8U A;  3SED A;  2STD A;  3FZW A;  1O7W B;  3NHX A;  1Q42 A;  3NBR A;  3EC9 A;  3B4P A;  5AEW B;  1W01 A;  4HM6 B;  3G8Z A;  4H3U A;  2Z76 A;  1E3V A;  3EJV A;  5AIG A;  5JPP A;  3EQQ B;  3LZA A;  3F8X A;  5D81 A;  3HZP A;  5KP3 A;  3H3H A;  4XDV A;  2OWP A;  5IG0 A;  1UUW B;  3S5C A;  2HMO B;  4GB5 A;  3Q90 A;  2W2C A;  4HM7 B;  5AEU B;  3DMC A;  3SOY A;  5CXO A;  2F98 A;  3GRD A;  3UJM A;  3OWS A;  3GZY B;  1STD A;  1OCV A;  1TP6 A;  3EBY A;  3NV0 A;  1ZO2 A;  1TUH A;  3B8L A;  3KKG A;  5G2G A;  4IIA A;  2XSO B;  3F14 A;  2HMJ B;  4K1V A;  3ER7 A;  1OH0 A;  1OGZ A;  3FF0 A;  1GY7 A;  4LGQ A;  3OWU A;  2QGU A;  1JKG B;  3E99 A;  3EX9 A;  2QIY A;  2YFI B;  4OVM A;  4L8P A;  4LEH A;  3GZX B;  1E97 A;  4XB5 A;  2RFR A;  5DRE A;  4HJL B;  3CNX A;  4CDL A;  1NWW A;  2A15 A;  2BNG A;  4R9K A;  4XBT A;  4HM5 B;  3DM8 A;  3F40 A;  3G0K A;  3G16 A;  1A2K A;  3DZL A;  4L8O A;  2RCD A;  3B7C A;  2F86 B;  7STD A;  3H51 A;  1ASK A;  4HM3 B;  5KP1 A;  3ECF A;  4X2H A;  5IF6 A;  3ROB A;  2Z7A A;  3KSP A;  5KP4 A;  3EHC A;  3CNM A;  1QMA A;  4N3V A;  3VGN A;  4WP5 A;  3BB9 A;  1VZZ A;  3F9S A;  3EBT A;  2YFL B;  4XBX A;  3F7X A;  5DRV A;  1W00 A;  2GEX A;  2HMM B;  1JB2 A;  1ZX2 A;  2R4I A;  2XR8 B;  1ULI B;  1U5O A;  3GZR A;  4HKV B;  5HGR A;  3GZB A;  5IG4 A;  1IDP A;  1JKG A;  2INX A;  3JUQ A;  3UNL A;  5AI1 A;  3MKI A;  1O7N B;  3F8H A;  4HZB B;  4HM8 B;  3CU3 A;  5STD A;  4XBY A;  4FCM A;  3EF8 A;  5BXQ A;  4HM4 B;  2BMQ B;  3M8C A;  3JUN A;  4PEJ A;  2JQ5 A;  4WWU C;  1DMN A;  1O7M B;  4I4K A;  4U13 A;  1NU3 A;  3OV4 A;  2RGQ A;  1DMM A;  3OX9 A;  4J9A A;  3STD A;  1Q40 A;  1K41 A;  1EA2 A;  2CHC A;  3HK4 A;  5D83 A;  8CHO A;  3FGY A;  1ULJ B;  3IPT A;  3MYT A;  5FW5 A;  3FF2 A;  4J8T A;  4XDW A;  5CLK A;  2GEY A;  4HVN A;  5EVH A;  4KVH A;  5CK6 A;  4ORL A;  4HM2 B;  1OHS A;  1JB4 A;  3LYG A;  1O7P B;  2B1X B;  2HML B;  1CQS A;  4Q53 A;  1GYB A;  3FH1 A;  1OHO A;  4HM0 B;  1OHP A;  2HMK B;  2XRX B;  3GWR A;  1Q40 B;  3NM2 A;  2CKF B;  3FKA A;  3K7C A;  2IMJ A;  2B24 B;  1W02 A;  3D9R A;  4R1K A;  3NUV A;  3MG1 A;  1S5A A;  4OUQ A;  3A76 A;  3MHE A;  2XSH B;  3EN1 B;  1OGX A;  3BLZ A;  2GXF A;  3CPO A; 
#chains in the Genus database with same CATH topology
 3TO9 A;  1KQS 2;  1ISK A;  4GDF A;  3S1Q J;  1DPU A;  2MSY A;  4OAY A;  2KQR A;  1XSV A;  3OSF A;  2V79 A;  1JXS A;  3LST A;  2CWT A;  2RQP A;  2ZL8 A;  1FWZ A;  2CFL A;  1X58 A;  1I39 A;  2DOE A;  1D6Z A;  1FGQ A;  1XMA A;  1S7A A;  1QVF 2;  4M74 A;  5C3E J;  1JRQ A;  1O7G B;  2WB1 A;  3F7S A;  2LYC A;  4WCG A;  5D5V B;  3UR3 C;  5ERI A;  1RKT A;  2KZV A;  2GBX B;  1MWR A;  3CD6 3;  5LGN A;  5IEN A;  4IRI A;  1SJW A;  4STD A;  1CEW I;  5CF2 A;  3BWG A;  4A3E J;  2Z77 A;  5EGO B;  3GXO A;  4Y7N J;  2FX0 A;  2K3P A;  2CUJ A;  2H6B A;  2DA2 A;  2L7K A;  3NAU A;  4XL9 A;  1FOK A;  4NBQ A;  4LG3 A;  2N8G A;  3LTA A;  1BI3 A;  1VQ6 I;  4HSR A;  4KMF A;  3D5R C;  1T0F A;  5F6F A;  2KL4 A;  3CES A;  1Z7U A;  3FK6 A;  3FMR A;  5HDN A;  3IV5 A;  2PQ8 A;  2HU9 A;  2R5Y A;  4RB1 A;  1KWI A;  2ZSH B;  3S16 J;  1JJ8 C;  2W00 A;  1FSH A;  1O7H B;  3CDI A;  1ORK A;  5EDN A;  3HG9 A;  1D0Y A;  1ETO A;  2O0Y A;  3OYG A;  1NK3 P;  1CYV A;  1OUN A;  4ZM8 A;  1D5V A;  1BJA A;  4BY7 J;  1P4W A;  2W25 A;  5IEP A;  2QA4 3;  5DYM A;  4G1M B;  2VJ5 A;  4YFK F;  4ZDO A;  1WPK A;  4XBF A;  1OQY A;  3BTL A;  4GXO A;  1OF5 B;  2KJB A;  3BG5 A;  1MBH A;  3FBI B;  3ZXS A;  3NXJ A;  3SOA A;  4HX7 A;  1I3I A;  1H9G A;  4HPQ A;  1DP7 P;  1ULY A;  4YEL A;  4EVI A;  1M1K 4;  1AQZ A;  4FCZ A;  1DGW Y;  1MJ9 A;  2WGQ A;  3DGY A;  1T95 A;  2Z9O A;  2M0C A;  3ESW B;  1U8R A;  2A07 F;  2QF7 A;  3BNB A;  2BW3 B;  3GBG A;  2OUM A;  4RMN A;  3CC7 I;  5IPA A;  5G1L A;  5GPC A;  3GTJ J;  4WYK B;  1JZD A;  1VTN C;  2PI0 A;  6GSP A;  2EFW A;  1W1W E;  3LSG A;  3P7N A;  3WMD A;  5ELJ A;  2ESN A;  4BKX A;  4WXH A;  2L5Q A;  3FG3 A;  1ZG5 A;  2BY3 A;  4AKY A;  3OYI A;  1MJA A;  3UL5 A;  1J5Y A;  2VJJ A;  4JX5 A;  3LT8 A;  1JN5 B;  3MFK A;  1RGH A;  4XM4 A;  4EMS A;  1JNQ A;  1UCI A;  1TNS A;  3MKZ A;  4JP0 A;  2G7H A;  2BVM A;  3EN8 A;  3NAR A;  4BL0 B;  1G4D A;  1HOM A;  1LDK B;  2OCT A;  4A69 C;  3SDG A;  2JWT A;  3NV0 B;  2JA6 J;  5RNT A;  2HDC A;  2XAU A;  1BAO A;  2IA7 A;  1X3U A;  2DTZ A;  2LH9 A;  4U87 A;  1W5C C;  2GBY A;  3I59 B;  1HKX A;  1IRZ A;  2MD5 A;  1IDY A;  3HC7 A;  3O3K A;  1TTO A;  3BC8 A;  1D3Y A;  5AII A;  5TJJ A;  4LFU A;  5EGO A;  2JDI H;  4RB3 C;  4R8H A;  5HLH A;  1T3B A;  2X6X A;  1G3T A;  2CH0 A;  3KZI C;  1XGN A;  1IQX A;  4ON0 A;  3JUP A;  4B1R A;  1UUV B;  3CCQ I;  1BW5 A;  2E2I J;  4IHX A;  3MD2 A;  1LEA A;  3ZG5 A;  1TW3 A;  3VYS B;  4C2M J;  3OYH A;  3KZT A;  1MBJ A;  2DMQ A;  5HOO A;  3WR2 A;  2JT1 A;  3PNT A;  3W2W A;  4BQN A;  5M5X J;  3ZQL A;  3HRS A;  1IAW A;  4B43 A;  4WXC A;  3CCU I;  1YGW A;  2QVO A;  2DT7 B;  1N5P A;  1X1Y A;  3FSD A;  4D9J A;  1TFK A;  1W7P B;  1XDS A;  1UI7 A;  3PUF A;  2NOG A;  3KPH A;  3HGG A;  4ZTJ A;  5EG0 A;  1T8I A;  3FM5 A;  3HPG A;  3ZMZ A;  3J80 Z;  1RMS A;  1X3Z B;  2GOX B;  3Q0W A;  3QPS A;  4I0A A;  3ZOB A;  5DEQ A;  2Z33 A;  4G6T B;  3EC9 A;  2BHM A;  2Y9Y A;  3GFM A;  1T6S A;  1ZG3 A;  2EV6 A;  3TKY A;  1I2F A;  4I99 C;  3LTC A;  1W01 A;  3G8Z A;  1KC8 4;  2XGC A;  2LFB A;  2K3F A;  1WJ5 A;  3WA2 X;  1XDU A;  4M3B A;  2QLZ A;  1RKY A;  3CCS I;  2FF4 A;  2M87 A;  2MYS A;  1PUE E;  2BY1 A;  2MFZ A;  2L4V A;  2EH3 A;  3K1M A;  3KEO A;  3ZQH A;  1IC8 A;  3CCR 3;  2K4B A;  1R5H A;  4MQV A;  2B9S A;  3JRG A;  3EQQ B;  5GTH C;  2CUZ A;  3TP0 A;  4G7Z F;  1IF1 A;  1MBF A;  5D81 A;  5IT3 A;  3HZP A;  5KP3 A;  4XDV A;  2KAA A;  4AVZ A;  3NBB A;  1BR2 A;  1BR1 A;  4B4C A;  1NK2 P;  3TW6 A;  2DA4 A;  5TIS C;  4RM3 A;  4MIM A;  3MN2 A;  3ZQC A;  1UUW B;  1B27 A;  1QQI A;  4XQF A;  3IH2 A;  2NOJ B;  2M7O A;  3X42 A;  1L5G B;  3BG9 A;  1EH7 A;  2HZT A;  4ZDP A;  2FNP A;  2EZH A;  3CCY A;  4HYZ A;  5CXO A;  1VQ8 I;  1V55 H;  3BPX A;  3RQI A;  3DBH B;  2F98 A;  2EIJ H;  4NHF A;  1FTT A;  1D1B A;  1F8N A;  4KT6 A;  1O3T A;  3OWS A;  3SED A;  4AEQ A;  4U0Y A;  3GTQ J;  4B09 A;  2LKP A;  3GFI A;  2X6W A;  3DEW A;  3HJE A;  1QU3 A;  2E7X A;  3WTS C;  2MG4 A;  3S15 J;  4OIQ F;  4O3M A;  3NV0 A;  1VQ4 I;  3KLN A;  5FJ8 J;  1SFU A;  4F55 A;  1TUH A;  3HOX J;  4Q48 A;  1I0X A;  4IRH A;  3PQK A;  1X4O A;  2XSO B;  5ILV A;  2DPD A;  1Q7H A;  4CXF A;  5F1J A;  1FBQ A;  2IAI A;  3RDI A;  1MBG A;  3WOF B;  3TDG A;  2CW0 F;  1JJ2 2;  2CG4 A;  4E7H A;  3X3X A;  3BR6 A;  1FMV A;  1YS6 A;  1I6H J;  4F7Z A;  2XUB A;  1K6O A;  1T0F C;  2DLL A;  1BGS A;  1OGZ A;  2Y9Z A;  3F3X A;  1GY7 A;  1TW2 A;  1YJW 3;  2HYF A;  3A01 A;  2W7N A;  1XSD A;  1BSA A;  1RGA A;  2ZXJ A;  2HQ5 A;  2FJ1 A;  3LA7 A;  4XON A;  1BBY A;  2IJL A;  2JA2 A;  3QP6 A;  1ONV A;  4RAZ A;  1USS A;  3A2K A;  4OIR F;  3EYY A;  1OCZ H;  3E3V A;  3E6D A;  3W2A A;  1C54 A;  4OVM A;  1YLF A;  4L8P A;  5H6R A;  2XH9 A;  1NH3 A;  4LB5 A;  4FT8 A;  3IP4 B;  1DE3 A;  3ZCO A;  2OTL I;  3JTH A;  3KII A;  3GW2 A;  1OIS A;  4WK8 F;  1IRG A;  3S32 A;  1FUW A;  2DA1 A;  1A5J A;  2A15 A;  1O7F A;  3V99 A;  3DPT A;  1UFM A;  2L9V A;  5LGT A;  2GM4 A;  2CS3 A;  5E1X A;  4R79 A;  4A3G J;  1JT0 A;  3VPR A;  2CFG A;  1VQK I;  1D6U A;  3D0S A;  4UVC A;  1B9N A;  5DCM A;  4ENK A;  4GYI A;  1FTZ A;  4X0G A;  1FSE A;  1DP3 A;  5FD5 A;  3N54 B;  2XAS A;  3K4J A;  2K02 A;  2RCD A;  4L18 B;  2ID3 A;  3MWM A;  7STD A;  2C10 A;  2W56 B;  2M8E A;  1ZRD A;  5E17 F;  3H51 A;  2GIZ A;  1IN4 A;  5IF6 A;  3O8H A;  1O7L A;  1BIA A;  4OOI A;  4KIC A;  3KSP A;  4LB6 B;  3CJQ B;  5KP4 A;  1JHF A;  3EHC A;  1BN5 A;  2VUM J;  1BC7 C;  4M73 A;  4OMZ A;  1MGT A;  4BE0 A;  1RR8 C;  2KRT A;  3QK9 A;  2IA2 A;  5AIP A;  3E7L A;  1JJ6 C;  3VFZ A;  3BB9 A;  3KYC B;  1U78 A;  1P2F A;  4HBR A;  3X40 A;  1YIT 3;  2ME0 A;  4BL3 A;  2VE8 A;  4C3J J;  1TIJ A;  2FNA A;  2GAU A;  2JA8 J;  3KP4 A;  2DQR A;  3D5G A;  2IS1 A;  4O3V A;  1YW7 A;  1IZ1 A;  3RDE A;  2M8G X;  3HZJ A;  4M6V A;  4EJW A;  2O7O A;  3K10 A;  2E1M B;  2OA4 A;  3FIW A;  5J4V A;  5C4J J;  3GSP A;  2EZL A;  4HX8 A;  2OZU A;  2QEX I;  2FOW A;  1GMP A;  1YHQ I;  1FYM A;  4EYC A;  2PJR A;  3QPH A;  3HRT A;  3HTS B;  2XEP A;  3CMA 3;  2D1V A;  4RM2 A;  1BRH A;  4GL6 A;  3D1N I;  3V4G A;  2KMU A;  1NHA A;  1ZX2 A;  4KFF A;  2PMZ N;  4BJT A;  1E3P A;  2ZKZ A;  1OYI A;  2FQ3 A;  1SMY F;  3CUO A;  3WTT C;  2ZXI A;  1U2W A;  3PJR A;  2R93 J;  2EA2 A;  4P96 A;  2UUZ A;  4BDZ A;  1DQU A;  3PL8 A;  4LIT A;  1QBJ A;  2MBF A;  3BND A;  2M0M A;  3K4B A;  1R9T J;  2H8R A;  4XIC A;  2RVC A;  5M5W J;  5HGR A;  1HF0 A;  3MZ8 A;  5FRN A;  3K0L A;  1V58 A;  2W82 A;  4A3I J;  2M7B A;  3D5S C;  3JW4 A;  3RSN A;  4RNZ A;  2CUF A;  2CYY A;  2VQH A;  4XLF A;  4M3F A;  1P7J A;  1LNH A;  3K4K A;  2ACJ A;  1B21 A;  2L01 A;  3SZT A;  1H0M A;  1DUX C;  3LT9 A;  4NQW B;  3MKI A;  1YOV B;  3G4S 3;  1O7N B;  1T38 A;  4KYW A;  4X6A J;  3NEU A;  4M9S A;  1YI2 3;  2R7T A;  1F9N A;  3JVC A;  2CQQ A;  4BQA A;  2Y31 A;  1JTX A;  1UJ8 A;  3M4O J;  2H09 A;  2JSP A;  4FCM A;  4FMD A;  5IYD J;  2QYO A;  3OL4 A;  1YRN A;  2XAF A;  3T0U A;  1HW5 A;  2K86 A;  4CUG A;  1AKH A;  4I98 B;  4HM4 B;  4FAS D;  4RB2 C;  4UUS A;  2KCD A;  3VSL A;  2BV6 A;  2XSD C;  1U6G A;  3LFU A;  3JUN A;  4BXF A;  1FT9 A;  3HXL A;  2I10 A;  1X1B A;  4BAY A;  5JLW A;  2KF4 A;  4WWU C;  3W6J B;  3SVA A;  4I4K A;  2W56 A;  3PNV A;  2O3O A;  1NU3 A;  3LSI A;  1GV5 A;  2RGQ A;  1DMM A;  1JBT A;  2FU4 A;  4HEA 2;  2A5W A;  1K41 A;  2YUS A;  4MEY F;  1IV8 A;  1RIO H;  2EIL H;  1EA2 A;  2EFN A;  3TED A;  2CHC A;  1ON1 A;  4HQM A;  4E6K G;  1FX7 A;  5E1W A;  1JE8 A;  4ZYA A;  3ZN0 A;  4AUX A;  4CCM A;  3TP3 A;  1I5Z A;  1VQP I;  4XN0 A;  3IWZ A;  2HQR A;  2PN6 A;  1UMQ A;  4NNJ A;  4B3A A;  4OMY A;  3FGY A;  2XAQ A;  4NRE A;  2YR2 A;  4Y52 J;  1BI2 A;  4MNU A;  2H0H A;  2R5Z B;  1IW7 F;  1S29 A;  2HKX A;  3RPU A;  4AWX B;  4J8T A;  4YII A;  2COB A;  2FQ4 A;  2IS2 A;  2K4J A;  1GLN A;  2QQA A;  1R22 A;  1A04 A;  3ALA A;  2AQF A;  2R4G A;  3RPU D;  1N77 A;  4XDW A;  4HVN A;  5CLK A;  1BIB A;  2QQB A;  3RKY A;  1YW8 A;  2M30 A;  2AO9 A;  4C3I J;  1DGR M;  3QRD A;  3WTY C;  1BOB A;  4LZI A;  1GD3 A;  3FF5 A;  2B1X B;  2R7D A;  2HS5 A;  4JK1 X;  4XMY A;  2KPM A;  3P9K A;  5E20 A;  2J8X B;  2FXA A;  1UCL A;  2QBY A;  2W4S A;  2DOD A;  1LJ9 A;  4CGZ A;  1VFC A;  2CW8 A;  4LLL A;  1XTA A;  2QQ9 A;  2CQX A;  2DFI A;  3Q0V A;  1UB9 A;  4U88 A;  1AHD P;  1OCT C;  1T2I A;  2JTV A;  1P92 A;  2AHQ A;  3QYE A;  2GOM A;  2XGD A;  4HA8 A;  3WU1 B;  2HMK B;  2P05 A;  3DV8 A;  1UEL B;  2XPW A;  3C2H A;  3FM3 A;  3I71 A;  3H92 A;  5HLT A;  2K85 A;  4IO9 F;  2E2J J;  2XRO A;  1I1S A;  2XRX B;  2Y73 A;  2RC4 A;  3DGO A;  4HOB A;  3DKX A;  3BOQ A;  3LA3 A;  5EQL A;  3NM2 A;  2VKH A;  4NQW A;  4HBL A;  1YTY A;  3LQR A;  2CKF B;  5LD2 C;  3CLQ A;  3BQZ A;  1QAL A;  3EUK L;  2P5K A;  3VF1 A;  2Z16 A;  2XVC A;  3VWB A;  4GRI A;  5LRS A;  4BEH B;  2CV1 A;  2HDD A;  1A90 A;  1KYZ A;  4HW0 A;  4ANJ A;  3LOY A;  4HNU A;  3PO2 J;  3WTV C;  3NUV A;  2VBX A;  2NAZ A;  2HNH A;  2XRN A;  4IQ4 A;  3KE2 A;  1V4R A;  3K70 D;  4GO1 A;  3WGH A;  1S5A A;  1FGR A;  4O5V A;  3DTE A;  4CCO A;  3D5I A;  5C44 J;  2KFD A;  3CCR I;  4EBG A;  1ZGA A;  1M9G A;  3LMM A;  5ICE A;  2W6J H;  3I64 A;  3KSE D;  3EDP A;  2W0Q A;  4QWT A;  3QU3 A;  2X0L A;  2HYJ A;  3U2R A;  3FXR A;  4ENN A;  2DW4 A;  2HOE A;  5IYB J;  1JZO A;  1WMP A;  2BU4 A;  1TWG J;  3CPO A;  1GOU A;  5LC6 A;  4BBR J;  2TRT A;  2GLO A;  1J2B A;  2DJN A;  1LE8 A;  1DU6 A;  1QJG A;  1J75 A;  3D79 A;  4RAF A;  4O8S A;  4CCL A;  4QTR A;  1UG2 A;  2BIR A;  5LEJ A;  4E7I A;  1G3W A;  5LEK A;  3BZK A;  3EUA A;  3W6V A;  3CJN A;  2O9L A;  2MLG A;  2VI6 A;  2K9S A;  3DU6 A;  4MQ9 F;  5ICG A;  1C7H A;  2O03 A;  1MGR A;  3FK7 A;  2P4W A;  5CLS A;  1JB5 A;  2KF3 A;  2UUG C;  2FNQ A;  2UX0 A;  1LFP A;  2WAE A;  2V1U A;  4G6Q A;  1KA8 A;  4C9Y A;  3G73 A;  2R41 A;  3S29 A;  4XRS G;  2MF7 A;  4ITV A;  4JOM A;  4OIP F;  3OS0 A;  2K0M A;  2L9R A;  4IPA A;  2PFB A;  4MEX F;  3TOA A;  3F8F A;  3U97 A;  2K7L A;  1EH6 A;  2X48 A;  2F5E A;  4L0Y B;  1RCK A;  1WJB A;  2DAO A;  3SFI A;  4RNY A;  5AIF A;  2KIM A;  3JTG A;  1NO3 A;  2L02 A;  3OIO A;  1VQ9 I;  1VQL I;  1TBX A;  3I0Y A;  1WKM A;  2HOS A;  1L3L A;  3HOZ J;  1KQ0 A;  4IOA F;  3KIO A;  4E7S A;  2V1X A;  3PUB A;  4KT5 C;  4OU0 A;  4PGH A;  5FD6 A;  2CK3 H;  2PNC A;  3RGA A;  5LBQ A;  2P5V A;  2ZC2 A;  3GCM A;  4ENM A;  5KK1 A;  2XDV A;  2DA6 A;  2CW7 A;  3LTD A;  1DVC A;  3H9G A;  3HKZ A;  5GAE J;  1FPQ A;  2RGV A;  4HQE A;  5K5R A;  1R4N B;  2QUF A;  1BUJ A;  3MG3 A;  3TL4 X;  1MJB A;  4D7M A;  2K27 A;  4E4H A;  2J5P A;  3ZQ7 A;  2V4J C;  1E3H A;  2XAH A;  2HZD A;  4BQQ A;  3DQV C;  3BCA A;  4DGW B;  2XKP A;  1UCK A;  2WGO A;  3S1N J;  4HZ9 B;  1OPC A;  1GS3 A;  2F5D A;  1DMQ A;  1Y56 A;  2CQ7 A;  2Z3Y A;  4BTY A;  3ZN1 A;  4DYR A;  5D4R A;  5ICF A;  2W84 A;  1BRI A;  1G6N A;  1Z05 A;  1PVE A;  3HBL A;  3K2Z A;  3ZQI A;  3VOD A;  5ELU A;  5FRO A;  2B7E A;  2PLY A;  5IER A;  3GAX A;  1BRS A;  1MH4 A;  3CC2 I;  1NG6 A;  2V6C A;  1N8Q A;  4LIU A;  1JGS A;  3ASO H;  7GSP A;  3TMO A;  4YG2 F;  3QAH A;  3F6V A;  2HXI A;  3A03 A;  3W2V A;  3T8N A;  5GTI C;  4N4O B;  3EB8 A;  3ZPL A;  3S14 J;  1GY5 A;  3R60 A;  1GY6 A;  1MBK A;  3OMY A;  3WG7 H;  1YIJ I;  1UHS A;  2R5Y B;  1QPI A;  4R9L A;  3VDX A;  1FIA A;  2G7U A;  1LEB A;  3QWL A;  2FA5 A;  1IO2 A;  2XF5 A;  1HC8 A;  2Y0S A;  5L3C A;  2AAD A;  1BA5 A;  3IH3 A;  2FOK A;  3B4O A;  5F1R A;  4QSH A;  3WOD G;  1MGW A;  1ODD A;  2OCC H;  1W6Y A;  5TGN A;  2UZK A;  3PZW A;  1OLT A;  3JRD A;  2DK8 A;  1W2B 2;  3RGR A;  3KYD B;  4AYB N;  2DTR A;  3BJA A;  1HZ1 A;  2BBY A;  2ELK A;  2ECB A;  1APL C;  3F8N A;  3J7A Y;  3I55 3;  2CWV A;  3GME A;  4PFP A;  5IP6 A;  2E1M C;  1GMQ A;  1FUT A;  2DOA A;  1Q82 4;  2OTJ 3;  2F5V A;  4E7L A;  1ZYR F;  2KLO A;  2A61 A;  4P9F A;  4RAY A;  3AG3 H;  1EG9 B;  4Y4R A;  1ETK A;  3Q3S A;  4UV8 A;  1SII A;  3D4A A;  5FLV A;  3HI7 A;  3WDG B;  5HS9 A;  1MWT A;  3KP2 A;  1BJZ A;  3OOU A;  4BUP A;  2RNT A;  3HX8 A;  3BLY A;  3UNG C;  5J4Y A;  4OIO F;  2CIU A;  4A3B J;  1EF4 A;  4HNT A;  4EAT A;  9ANT A;  5ILU A;  2P7V B;  3HOH A;  3ABU A;  3OXA A;  4LSO A;  3FCS B;  1YQA A;  2A69 F;  4XOT A;  2M2E A;  4JYK A;  3NX0 A;  5B5E C;  1FGT A;  5DCF A;  2VC0 A;  3S27 A;  1YI2 I;  1U9N A;  5EZG A;  2DYS H;  1O7W B;  3WU2 C;  1SEU A;  1G3Y A;  1OYY A;  4HV6 A;  1WJD A;  1SAX A;  5J3L A;  3MKY B;  2NYX A;  3GO5 A;  2AXT C;  3HL2 A;  5HVQ C;  5AEW B;  1QO0 D;  5HNH A;  2VBZ A;  2EFO A;  2OQR A;  5E18 F;  3JAM K;  3GTM J;  5EJC A;  2OPT A;  5JFR A;  1I3Q J;  3K70 C;  1FLI A;  3NRV A;  2WAF A;  4UY8 I;  2MLK A;  1RN4 A;  3BQY A;  2GXA A;  3ASN H;  1EH8 A;  3L1P A;  1PFP A;  2C11 A;  5CVJ A;  4KIS A;  5H2F C;  1H88 C;  1E3V A;  3U1W A;  1JI8 A;  1KQ9 A;  3ISP A;  3O6B B;  3HOS A;  2W03 A;  3SZP A;  5IT9 K;  2H0G A;  1LFU P;  5EEA A;  3CCL 3;  2QZ8 A;  4NUB A;  4KIB A;  3RYR A;  4DBR A;  3KZZ A;  2VJI A;  3SOY A;  1QZZ A;  1SC7 A;  1IXS B;  4AD9 A;  5TGT A;  2KT0 A;  1X1U A;  4PUS A;  3OYL A;  5BU4 A;  3CP2 A;  3VB2 A;  1S72 I;  2EA4 A;  4FTH A;  4LK0 F;  1IYY A;  2RAE A;  1W5Z A;  2EV0 A;  4HM7 B;  5AEU B;  3B6A A;  2GU3 A;  3V7S A;  3OS1 A;  1IN8 A;  3H3V K;  5EG0 B;  3GRD A;  4XM3 A;  3J81 K;  1RGC A;  3GZY B;  2CFW A;  3A1Y A;  3C1D A;  3ELK A;  3F9K A;  1STD A;  1UAA A;  2JZY A;  1OCV A;  1TP6 A;  4FMC A;  4EC6 A;  4CCV A;  4DZP A;  1EEJ A;  3SYU A;  3KKG A;  1HQC A;  3PSF A;  4V2F A;  1MIJ A;  3TDZ C;  5HOD A;  3OYM A;  2KRH A;  1FC3 A;  3OYK A;  3I56 I;  4MO7 A;  2CWE A;  1YX3 A;  1GV2 A;  3EUH A;  2HMJ B;  1RET A;  1Q81 4;  5BPD A;  2DFH A;  2LY1 A;  1ZGX A;  2XGL A;  1ZHF A;  2GIV A;  4IHY A;  5E3O A;  3JSO A;  4K1V A;  3LQQ A;  3L2R A;  3KFQ C;  5FLX K;  5HDK A;  2L4A A;  4A93 J;  1OH0 A;  3HUG B;  1MSE C;  1Z0X A;  5B1A H;  1X1C A;  2LF7 A;  4A2U A;  3OW2 2;  5IY5 H;  3O8G A;  1WZ2 A;  2WTE A;  2DMT A;  4LGQ A;  2VIX A;  3OWU A;  1RRL A;  2F56 A;  3ZMV A;  2DQL A;  1OCR H;  3WE2 A;  5J1R A;  1MWU A;  3D3L A;  2YFI B;  1JUS A;  2W48 A;  3S2W A;  5DDG A;  2O6G E;  3MVP A;  4PGG A;  1SFE A;  2R7U A;  3FG1 A;  3FHZ A;  5D8K B;  5BQT A;  4EGY A;  1OR7 A;  2VPL A;  3RNT A;  1EQK A;  4XB5 A;  4RGS A;  1WWX A;  3WTX C;  1RGL A;  5DRE A;  3M3Y J;  4HJL B;  1I27 A;  3T1B A;  1UST A;  1OCP A;  3K69 A;  2XIG A;  5FLM J;  3CNX A;  3NQY A;  2VPR A;  1I50 J;  4YRV A;  2VB6 A;  1VQO I;  1Y0N A;  1QHG A;  2CQK A;  2A6H F;  1TWF J;  1X1X A;  3N97 A;  2IXS A;  1UW1 A;  1FOY A;  1PP7 U;  1RNB A;  4YIR X;  1BC8 C;  2ETH A;  2WWY A;  2FXT A;  2XF3 A;  1WI3 A;  3AG1 H;  2BVL A;  2FBK A;  3H1C A;  3MKL A;  2X6Y A;  1E2X A;  4WXD A;  3KP5 A;  3CQZ J;  1MNM C;  4CHU A;  1BNR A;  1PJR A;  2ZA4 A;  1JT6 A;  2P8T A;  3M8F A;  3GYH X;  2LKX A;  2K40 A;  4HRI A;  3B7C A;  3LH4 A;  2IA0 A;  1V54 H;  2A6E F;  3TDU C;  1ZRE A;  2QKM B;  1FGM A;  4UV9 A;  1BAN A;  2WB1 N;  1ASK A;  4HM3 B;  4MMZ B;  5IOZ A;  1W4N A;  2M7A A;  1LFB A;  3IAM 2;  4IVN A;  5D5W B;  3HOU J;  4BY1 J;  3ROB A;  1DET A;  3A01 B;  3H5N A;  5DD4 A;  3CO6 C;  1H8A C;  1K78 B;  2KDO A;  2K9M A;  3I53 A;  3CNM A;  2OJE D;  3LOC A;  3HOW J;  3UB1 A;  4N3V A;  4Q4Z F;  4CSW A;  2BOL A;  3TGN A;  1V57 A;  2HXO A;  3EE1 A;  4IPB A;  4EV2 A;  2VKE A;  2VN2 A;  1O3R A;  1F4K A;  3SYT A;  1KU3 A;  1VND A;  4UVB A;  1IQ8 A;  2LG4 A;  2ZJP F;  2NVY J;  1X1A A;  2BHZ A;  3F9S A;  4J19 A;  2WAQ A;  2F6C A;  2YFL B;  2VOO A;  3BDD A;  3ROU A;  1A35 A;  3D5L A;  2BXY A;  2Z6B A;  4Y3O A;  3H5A A;  3F7X A;  5DRV A;  1H9T A;  1WI9 A;  2HQA A;  2YU3 A;  2YX7 A;  1X4P A;  2L7M P;  2ZBK A;  3KLO A;  4K2E A;  4KA4 A;  1Q1H A;  2PEX A;  3CME I;  4JF8 A;  2HKO A;  4ZJZ A;  3FMS A;  2L1S A;  1RI7 A;  3MMY B;  2DPU A;  4IRG A;  3RYP A;  2FSW A;  1JB2 A;  5K5Q A;  5FO5 A;  3F8M A;  2VLA A;  3QQA A;  2O5R A;  3DEE A;  5DCM B;  2QSG X;  1K8A 4;  5EEH A;  4A5M A;  4A3M J;  2XR8 B;  3SXX A;  1O4X A;  3HUG A;  3CCV 3;  2R0Q C;  3KZY A;  5B1B H;  1U5O A;  3PXM A;  4I09 A;  3GZR A;  4HKV B;  3HTU A;  3I9V 2;  4HOH A;  1MNE A;  3GZB A;  2MH9 A;  2QQ8 A;  1VQM 3;  3Q0U A;  3S67 A;  2E34 A;  5K7Z A;  1RJO A;  2INX A;  4A6E A;  1VQN I;  5K5O A;  3AMO A;  2EIN H;  4NC6 A;  2DXI A;  5AI1 A;  2XF6 A;  1ZH5 A;  3A0H C;  5DS9 A;  2H1L A;  1QRY A;  3CCE I;  1J9I A;  3F8H A;  1FA3 A;  3GUD A;  3HOY J;  1Y1W J;  1NB5 I;  1D1C A;  4D5F A;  4CYD A;  2EFP A;  1T5Y A;  4BJ6 C;  5JI6 A;  1I2G A;  4XBY A;  5BXQ A;  1PU4 A;  4NHJ A;  2CG1 A;  1BNG A;  4JRF A;  5HDG A;  2ELJ A;  3BNC A;  3OIP A;  1BNF A;  2YPR A;  2KDZ A;  2MC8 A;  3AGN A;  1RRH A;  2BMQ B;  1YG2 A;  3OS2 A;  1R5G A;  1RR7 A;  2JN6 A;  4HDU A;  3IH4 A;  1CF7 A;  2WY7 Q;  4V2G A;  2FEZ A;  2O3F A;  3N05 A;  3H5R A;  2D45 A;  2HTS A;  2PJR B;  3HPH A;  1FYK A;  3R4K A;  1IU7 A;  1T08 B;  2P81 A;  1K4T A;  2HVS A;  2WBM A;  2XFT A;  1R1T A;  3X3Z A;  4PZJ A;  4BH9 A;  4XID A;  1FJL A;  1OAC A;  3OR2 C;  3S3O A;  2H0I A;  4U13 A;  1WMN A;  3EPZ A;  4W97 A;  1IV6 A;  2XAG A;  3RJP A;  1AY7 A;  1Z6R A;  1YJ9 I;  1BSD A;  1BRN L;  3PCS A;  2ZNY A;  4ESJ A;  2CFX A;  4ASN A;  1Q40 A;  2BYV E;  1VQ5 I;  2RSX A;  2CSO A;  5E8G A;  3DLA A;  5KAF C;  1K78 A;  2PBI A;  4CZZ A;  3ZMU A;  4HLX A;  1G02 A;  8CHO A;  4XRS A;  2EPF A;  1GXQ A;  3LAJ A;  2ZME A;  3X41 A;  4KNY A;  2LVS A;  2VON A;  2R7S A;  1J59 A;  1JUM A;  5LLQ A;  1ITY A;  3IPT A;  4XOR A;  4BU4 A;  1O3S A;  1O3Q A;  1UHM A;  3B02 A;  1LOV A;  1MZB A;  3G1O A;  3CC4 3;  3JRE A;  3OYJ A;  4FIS A;  4E70 A;  1S9H A;  3AFH A;  2O8X A;  4XRF A;  1M1E B;  1B8I A;  5BOX A;  3H36 A;  2GEY A;  3FXK A;  1YRN B;  1IVX A;  3E6C C;  1NG7 A;  2HEO A;  2OTJ I;  2SBL A;  3GTG J;  4PK4 A;  1AKH B;  5H20 A;  3EUH C;  5JHU A;  3OYC A;  4UUS B;  1XPX A;  2CW9 A;  2CWU A;  1B9M A;  3CO7 C;  1OHS A;  1JB4 A;  1VQ7 I;  1SVO A;  1R58 A;  2BXZ A;  3PFI A;  3CXC 2;  3H3U A;  2V26 A;  2HOA A;  4N9H A;  1LDJ A;  5F04 A;  3T8R A;  3MZH A;  2F4I A;  4Q53 A;  3F22 A;  1H89 C;  4M6Y A;  1IV7 A;  2YSR A;  3ZGK A;  1KU9 A;  1RNT A;  1FIP A;  2WOH A;  1IVU A;  2CUE A;  3AAF A;  1OHO A;  2CX1 A;  4HM0 B;  1T56 A;  2HDW A;  1Y39 A;  3K2A A;  2MD0 A;  1TLH B;  2XGE A;  1W0U A;  1O57 A;  4RDU A;  4LG0 A;  3QOD A;  5M3F J;  5A2Q K;  1IUY A;  2BEO A;  3RKQ A;  2A3S A;  2F48 A;  1OR7 C;  3Q9V A;  5H6Q A;  1Y0U A;  5IYC J;  1X1W A;  5DUK A;  4FQG A;  2XGN A;  3FKA A;  4I7H A;  3KET A;  1TP4 A;  2BE5 F;  2PJP A;  2ZO4 A;  3GTO J;  1I0V A;  4N6V 0;  1W02 A;  4Z6Y A;  4CH7 A;  3H0G J;  5JVG F;  4PFO A;  1ERD A;  4R1K A;  2CFO A;  3CD6 I;  3CDL A;  1FBS A;  2E1O A;  2OV7 A;  3CJT B;  2ZFU A;  3ZG0 A;  3A5E A;  2GU1 A;  3VSK A;  4J5K A;  1ETQ A;  1ROV A;  3L09 A;  4C3H J;  3FXL A;  3OYB A;  4IHV A;  3BT9 A;  3FXM A;  2HI3 A;  1WVR A;  3GZ5 A;  3MHE A;  4LMY A;  2XB0 X;  2LP0 A;  1GVJ A;  2XSH B;  4PJ0 C;  3EN1 B;  1IDZ A;  1BOX A;  3CCJ 3;  1TQM A;  2IP2 A;  9RNT A;  2XFS A;  4OWR B;  3BTC A;  1XGM A;  1IVV A;  2V1N A;  2JUG A;  5KVR A;  1RCL A;  3G6E 3;  4JQF A;  1WJE A;  3V7C A;  2QBY B;  2ZXW H;  3E1S A;  5GAH J;  2I9W A;  1V5G A;  2MH2 A;  5FGM A;  4G94 A;  4ESB A;  3L2Q A;  4IHT A;  3V42 A;  1UCR A;  2XKO A;  1BU4 A;  3F8B A;  1BUQ A;  2E7W A;  1ZEL A;  3HSR A;  3MWZ A;  3QOP A;  4XSX F;  2QA4 I;  4WFO A;  3GTP J;  3K7A J;  4PJN A;  1MD0 A;  4XSZ F;  2ZJQ F;  3A02 A;  2OQE A;  4A3K J;  1NNV A;  2DT5 A;  1A6I A;  4MJD A;  1QVG 2;  4RA2 A;  3ERE D;  1HBX G;  4D1Q A;  3ABT A;  1FZP B;  2STW A;  3HDD A;  4K90 B;  3N9H A;  2XC7 A;  3B6C A;  2E2U A;  4ZDL A;  4AVP A;  1MMD A;  2UV1 A;  2K54 A;  1P7I A;  1FP2 A;  1YNV X;  2WOF A;  2R7Q A;  3KEQ A;  3QPT A;  1ZQ3 P;  3K1P A;  2Z2S B;  4AIH A;  2A05 A;  4J00 A;  5IEO A;  2CJJ A;  2BHY A;  1IRX A;  4GYG A;  3PO3 J;  2YFJ B;  4N6T A;  1STZ A;  5G1K A;  2EB7 A;  2D5V A;  3MG2 A;  1RN1 A;  5BIR A;  3G71 3;  2W1O A;  6STD A;  3QOE A;  2FMY A;  4XLC A;  4DBQ A;  2E5N A;  1K73 4;  3TW7 A;  5J47 A;  4RZM A;  2XSJ C;  2BMR B;  3WOD F;  3N8B A;  3KE7 A;  3WTZ A;  1B72 B;  1BI0 A;  1U0J A;  3KYL A;  1NDO B;  4ZC3 A;  4IHW A;  4FX0 A;  2JA7 J;  4PDK A;  3BTI A;  1YYV A;  2VT2 A;  8RNT A;  1QA6 A;  2IW5 A;  5FKN A;  3BR0 A;  2BMO B;  1LE8 B;  2R7V A;  1S5L C;  4K1U A;  2M9H A;  2DMU A;  1S8N A;  2GBW B;  1U5T A;  4X2O A;  2VBY A;  3JRH A;  4AIK A;  4MMY B;  3CJR B;  3VSY A;  2KRC A;  1B2U A;  4L9J A;  3LSM A;  4YIF A;  3PYJ A;  5JPU A;  2TCT A;  1ON2 A;  2FD5 A;  4FHT A;  1AR0 A;  4CCN A;  2G0E A;  2DI3 A;  3VYT B;  2O8K A;  3QRF F;  1LOX A;  3E5U A;  1VQ6 3;  1TRQ A;  4MLO A;  4BBS J;  4AKZ A;  1GOY A;  3J81 Z;  3ABK H;  3K0Z A;  4G9Y A;  1FBU A;  4LD5 A;  1RC9 A;  3VYR B;  4BHB A;  4M71 A;  2EIK H;  1REP C;  1LVN A;  3DPL C;  4S05 A;  3A0B C;  1G96 A;  4BHC A;  1P6R A;  3KCC A;  1F5T A;  3EQL F;  3TO7 A;  2E35 A;  4S04 A;  3DFG A;  3F8C A;  5CF1 A;  1IN6 A;  4XNF A;  2EBI A;  4HF1 A;  5CKT A;  4A3D J;  5JLX A;  1L0O C;  5LHG A;  4XKW A;  5HOH A;  2FBI A;  2E1C A;  1WQL B;  4O2H A;  3C2G A;  3MAJ A;  5ED4 A;  4MTE A;  3REO A;  3S28 A;  3OSG A;  1IXR C;  2ZME C;  3DEU A;  5ICC A;  4MHG A;  1TC3 C;  2CGP A;  1BNJ A;  4U0W A;  1EUI C;  1YVS A;  1D0Z A;  4BE2 A;  3C7J A;  3JUM A;  5IG5 A;  3C3W A;  3ZQQ A;  1MMG A;  4KIT B;  1SQW A;  2Q1Z B;  5L3G A;  3WA3 A;  6RNT A;  4R1H A;  4HDV A;  3OYE A;  1ZGJ A;  1CYU A;  3CC7 3;  3EET A;  2BY0 A;  1BW6 A;  2XPU A;  4KT3 B;  4ENJ A;  1ZRC A;  2F5C A;  2PZV A;  1R7J A;  4RAG A;  3WTU C;  1JUP A;  5K7H A;  5HLG A;  1XGO A;  4IL6 C;  1GT0 C;  3RZO J;  2P6T A;  2ME6 A;  1B2M A;  4LGW A;  1YS7 A;  3BZ6 A;  2M4K A;  2PX9 A;  1B3S A;  3QPL A;  4F93 B;  3IRR A;  5GAG J;  1GSP A;  1EJ9 A;  1MWS A;  1WTH A;  3PIO F;  1HLV A;  2DU9 A;  3KEY A;  4J5G A;  3HYI A;  4HX4 A;  2C4B A;  1PP8 F;  4XLH A;  5JHF A;  1KSI A;  1LPQ A;  5BPI A;  4CA0 A;  1B72 A;  3RPQ A;  3AHW A;  1R6R A;  2D42 A;  3ZP5 A;  5J40 A;  3T8U A;  3TBI A;  3X3Y A;  2R3S A;  4S0H B;  2K3D A;  4KFE A;  4RB0 A;  1ETV A;  4RLF A;  1P4X A;  5BS6 A;  4BL2 A;  1KYW A;  2DMN A;  1JBS A;  3WE3 A;  2HR3 A;  3LSR A;  2V1D A;  1B6A A;  3L00 A;  4BNC A;  1Z6T A;  2STD A;  4KN4 X;  3IMA B;  5FKL A;  3NHX A;  3TQN A;  4EXR A;  3FWE A;  3SQN A;  4QLC U;  3S2D J;  1OMI A;  4BU2 A;  4E7Z A;  3JRF A;  1GHC A;  1N5H A;  3CP8 A;  2IVM A;  1JKO C;  3GLX A;  4IHS A;  1D8K A;  1BSC A;  1I70 A;  1SVM A;  2VKV A;  1W6C A;  1YVB I;  1XD7 A;  3GTL J;  2LRD A;  3L2U A;  3BG7 A;  5L3F A;  2L54 A;  5LGU A;  2VAS A;  3FXJ A;  1LQM B;  4JX4 A;  3CCQ 3;  4I02 A;  4AYB A;  4AM3 A;  5D5U B;  5FGO A;  2VXD A;  3MPH A;  1RGE A;  3CMM A;  3KCH A;  3NM7 A;  4FR9 A;  5AIG A;  5JPP A;  3RCO A;  5DD8 A;  1E17 A;  4LOC A;  4MGR A;  5F64 A;  4BQO A;  3F8X A;  3LZA A;  5JBS A;  3CCU 3;  1GUU A;  1A67 A;  3C2B A;  1TQP A;  2E2T A;  4O02 B;  2OWP A;  1YJW I;  2GSP A;  1X1D A;  1BRK A;  2RNG A;  1N75 A;  1LQ1 A;  3QP5 A;  1QVT A;  3BR5 A;  1G3S A;  5EEO A;  1CH0 A;  2DCE A;  1KGS A;  3CCM 3;  5J8C A;  2HMO B;  4GB5 A;  3Q90 A;  3G2B A;  3DMC A;  2DFF A;  1S7E A;  2AXL A;  3IKV A;  3BY6 A;  1RN7 A;  3P5J A;  3OYA A;  3DWL E;  2EJR A;  4BXX J;  3CZ6 A;  4M3E A;  1K9M 4;  2OQE C;  1YJN 3;  1ETX A;  2B0L A;  2IPQ X;  2X1D A;  1V74 A;  1ZO2 A;  2M34 A;  4Y33 A;  3B8L A;  3RKW A;  2R7X A;  2VBW A;  3IC7 A;  1B59 A;  5JR3 A;  4CCJ A;  3M1C A;  1Y8Q B;  1PDN C;  3CCS 3;  1XMK A;  2HVQ A;  2VXZ A;  2OC6 A;  2DBB A;  2FBH A;  4P9U A;  1ZAO A;  4ZTF A;  2DDA A;  2Z1D A;  1A2P A;  1SAN A;  4MTD A;  1UUG B;  5J6X A;  1WNH A;  2E71 A;  1HCR A;  4B3X A;  1SPU A;  2RNJ A;  4RGR A;  1ZR4 A;  3KN4 A;  3BP8 A;  2QSF X;  3P9I A;  2ADU A;  2QGU A;  3DTK A;  3O2P E;  1JKG B;  3E99 A;  3H3Z A;  2H8W A;  4XR6 A;  2JQ7 A;  2QIY A;  3GVA A;  4F92 B;  2K9L A;  1HST A;  4BAC A;  3URP A;  4XKV A;  1VQ8 3;  2VOD A;  5HNF A;  3ZQF A;  1FOX A;  3T8T A;  4I01 A;  2XB5 A;  4PSW A;  3DXJ F;  1FUS A;  2AAE A;  1QPM A;  3I4N J;  3W6K B;  3K5T A;  2WV0 A;  1BNE A;  1VQ4 3;  1SAR A;  1R5I D;  1U5T C;  2WA0 A;  1YIT I;  2VQL A;  2LF8 A;  1YE9 A;  3PSI A;  3H0D A;  4J01 A;  4CDL A;  3AG4 H;  1NWW A;  1RGF A;  1MH3 A;  3WTW C;  1K28 A;  2BNG A;  1ZAR A;  1IJW C;  1ZK8 A;  4R9K A;  2KRF A;  1M90 4;  3JR9 A;  4UVA A;  1LNW A;  1X3W B;  4N0B A;  4L0Z B;  3DM8 A;  5IP7 J;  2HQN A;  4CDG A;  1A6Q A;  5L3D A;  3QU6 A;  4FET A;  3PS8 A;  1LDD A;  4TV7 A;  4L8O A;  4ZZL A;  1OYW A;  3CMA I;  5M18 A;  2GWR A;  3ZMS A;  3SFZ A;  4A3L J;  2F86 B;  3ZMD A;  4NPB A;  4XLN F;  3BR3 A;  3KFW X;  3G6E I;  5KP1 A;  1SAU A;  1GXP A;  3U1K A;  1AVL A;  4QPO A;  5M5Y J;  1D0X A;  2L7Z A;  4M9X A;  2Y69 H;  2M5W A;  4DZJ A;  4XKC A;  3L2W A;  4AC0 A;  2ISZ A;  3LML A;  2IS6 A;  1YFH A;  2FRH A;  2EV5 A;  3KP6 A;  4PCQ A;  1QMA A;  4M72 A;  1DVD A;  2LBF A;  3I4M J;  3C18 A;  3VGN A;  2OTL 3;  4WP5 A;  3OY9 A;  5M1A A;  1XMX A;  2XF7 A;  1UDI I;  3NBJ A;  2DA5 A;  2LK2 A;  4XN3 A;  3G4S I;  1R23 A;  2V9P A;  3ZMT A;  1ZS7 A;  2KHM A;  3EBT A;  1GDT A;  1I2E A;  1RTU A;  2L2O A;  2F5M A;  2ELH A;  2MGQ A;  1VQK 3;  1R00 A;  5A2Q Z;  1X2M A;  2HOH A;  1WJF A;  2F4Y A;  2QCO A;  5FKM A;  2Y30 A;  2ZNZ A;  4FCY A;  4MMX B;  4MFD A;  3T0Y A;  4IOC F;  2W04 A;  2R4I A;  2GZW A;  2V7F A;  4BTW A;  1HKT A;  2K9N A;  1YW9 A;  4HNV A;  3LXU X;  2PMU A;  1KZH A;  2OZ6 A;  5GPA A;  3DGM A;  2GA1 A;  4Q47 A;  4BIR A;  3HSE A;  1QAK A;  4KJZ A;  1YGE A;  2HTJ A;  2NXN B;  4QIW N;  1LKX A;  3L7W A;  1W36 D;  2Q0O A;  5D6E A;  2Q2E A;  5IG4 A;  2JVG A;  5HLI A;  1W5S A;  3FHN A;  4CJN A;  1TU5 A;  1IDP A;  1JKG A;  3ERM A;  1N8R 4;  2E19 A;  2XRL A;  3BR1 A;  4A6D A;  4WHA A;  3B73 A;  4DKI A;  3CUQ B;  5J8F A;  3S17 J;  4XLP F;  2ID6 A;  4EEF G;  1JHH A;  5DUI A;  1US1 A;  2KF6 A;  3K4L A;  1QZY A;  3OYN A;  5LC7 A;  1RDS A;  3CU3 A;  2OQG A;  3CCM I;  4HF2 A;  3S8P A;  3DLL F;  2CO5 A;  2YU9 J;  1GD4 A;  1BSE A;  1MDM B;  3K9M C;  1RES A;  1Z7L A;  1U8B A;  3BIR A;  3NWT A;  5STD A;  4EV5 A;  2QEX 3;  2XHK A;  1YHQ 3;  3GX4 X;  2LYX A;  2OU2 A;  2CG0 A;  2JUC A;  4Y13 A;  3DU5 A;  3BPV A;  2JMW A;  1J2X A;  3K4N A;  1HW2 A;  3SXY A;  1JKR C;  1PUF A;  1DDN A;  1V5E A;  4QWQ A;  3GWZ A;  2JQ5 A;  3CPW 2;  1MBE A;  2Y0S N;  3FXQ A;  3SEQ A;  1DMN A;  1O7M B;  3VOE A;  3TOB A;  3BCB A;  2SAR A;  2LTP A;  3L9F A;  4BXU A;  3WHO A;  4M3G A;  1WCM J;  2NS7 A;  1UHW A;  5J1Y A;  4H61 A;  3COA C;  3STD A;  1SFX A;  1R36 A;  1T33 A;  2O9U X;  3DH2 A;  1HKS A;  4IKF A;  4A0X A;  3LNQ A;  3HK4 A;  2GA2 A;  3ZR8 X;  5D83 A;  1W6G A;  3AMO B;  2HPM A;  2A5Y B;  2P6S A;  2KP6 A;  1XG1 A;  3L2C A;  1S6L A;  5CVU A;  5GP9 A;  4AU7 A;  1N78 A;  4UUV A;  4EW5 A;  1K79 A;  3M1E A;  5M19 A;  5E1Z B;  3MYT A;  1EKE A;  2Y74 A;  1K4S A;  3I56 3;  3FF2 A;  4ZZD A;  3HRU A;  4GGG A;  1JTY A;  2ZDJ A;  2H6C A;  4F52 A;  2KKO A;  2F2E A;  3OWT A;  1ZTR A;  4LLG F;  4D0P A;  4A0Z A;  3V8K A;  5EVH A;  2IGN A;  2ECC A;  4KVH A;  4ZYH A;  5CK6 A;  4ORL A;  1I1G A;  3BZC A;  4KDP A;  4B8X A;  2JRT A;  1D6Y A;  1Z3X A;  4ZYG A;  4HM2 B;  3RQ4 A;  2EFQ A;  1PYV A;  4NC7 A;  1O7P B;  1CF7 B;  2CU7 A;  1N9J A;  2HML B;  5EZH A;  1I3A A;  2W85 A;  5L3B A;  3I58 A;  3FH1 A;  4UNO A;  4IF4 A;  1WSU A;  2CFK A;  1IUF A;  2E2V A;  4NB5 A;  2DA7 A;  2Q07 A;  1KON A;  3H35 A;  1FNN A;  3E6B A;  4GCV A;  5FKK A;  2R7W A;  2Y0M A;  3BJ6 A;  1ZG1 A;  3HRM A;  3RI4 A;  1Q9E A;  5K1Y A;  3SJM A;  1U3E M;  4A3J J;  3ONQ A;  2I5U A;  4BE1 A;  1VQP 3;  2WO0 A;  4IXA A;  2A6T A;  1Q40 B;  3CUQ A;  3SX1 A;  2WV1 A;  2LMD A;  4BYY A;  2NNY A;  2OOV A;  3DKY A;  3U21 A;  4DW6 A;  1FGO A;  1F36 A;  2ZSI B;  3GZ6 A;  3HGY A;  4EQQ A;  3S3N A;  2F5W A;  1GMR A;  2ZME B;  2RKH A;  2XGX A;  3AG2 H;  1F43 A;  1I6X A;  2D2W A;  4G7O F;  2B24 B;  2IMJ A;  3IJE B;  4DQ2 A;  1SD5 A;  3ZRG A;  4KMU X;  1MDM A;  2DOF A;  1UGI A;  3PCR A;  3FKI J;  1IVW A;  1UGH I;  3JRB A;  1TTY A;  4L9V A;  3CF5 F;  1Q86 4;  3N4M A;  1FOW A;  4PSX A;  2B63 J;  1GOV A;  2CQN A;  4L9N A;  4OIN F;  2K9Q A;  4BGD A;  1B8I B;  2IRF G;  1I3F A;  3MG1 A;  1UCJ A;  3K9T A;  1B2X A;  5CJ9 A;  1ZLK A;  5KCM A;  4UHT A;  2MC4 A;  4EJV A;  4UB8 C;  3QYF A;  5FB2 A;  2X4H A;  2LR8 A;  3U1D A;  1LXE A;  2P5L C;  4I6Z A;  3NQO A;  5DM6 F;  1OGX A;  3BLZ A;  2BGC A;  2D1W A;  1AU7 A;  2LY2 A;  1B2S A;  2GXF A;  1OJL A;  1IN5 A;  1QNT A;  4OK0 A;  1FZU A;  2A68 F;  1E3R A;  5AIH A;  3R61 A;  4XOP A;  4U0V A;  4A12 A;  1OF5 A;  3BG3 A;  1IG7 A;  4DNC A;  3MKW B;  3OWY A;  1MMA A;  4YEJ A;  5FFZ A;  4HG2 A;  3HB9 A;  5CQE A;  2M4G A;  4I2O A;  6PAX A;  2L7F P;  4ZYD A;  2F99 A;  4LG0 B;  3Q5F A;  3DBL B;  1R1V A;  2XV4 S;  1YJN I;  3M9A A;  3ULQ B;  5F27 A;  2BZT A;  3V8L A;  4RBO A;  4UXN A;  4WF2 A;  1UG0 A;  4BS9 A;  2BW3 A;  1N25 A;  2EZI A;  1P9Q C;  1XS9 A;  2BT3 A;  5BVB A;  5K7F A;  5EEG A;  4A3C J;  1NTC A;  2EZK A;  5B3S H;  2W9P A;  3FXU A;  4HF0 A;  1FW7 A;  1LUJ B;  2CV2 A;  4NDL A;  4WYK A;  2E60 A;  4XLE A;  4CZC A;  3V98 A;  1RUN A;  1SD6 A;  3UKG A;  1RLS A;  3DUK A;  1ETY A;  1Q1V A;  1SVL A;  1XN7 A;  2DJI A;  2LC2 A;  3R0A A;  2Y75 A;  3GZN B;  4B47 A;  2UGI A;  1X2N A;  3HHG A;  3BR2 A;  1W36 C;  4LK1 F;  1FY7 A;  2GQQ A;  3PM1 A;  4P1W A;  2HWV A;  2H1K A;  4EV0 A;  5FRM A;  1BSB A;  1JN5 A;  3LSH A;  2PMZ A;  4AIJ A;  3AGO A;  1VI0 A;  5KAI C;  1AWC A;  3S2H J;  2YS9 A;  2JJ7 A;  1DYU A;  5A0O B;  1OKR A;  1PY3 A;  5GSP A;  3OYD A;  2P7C B;  2L4M A;  3MEX A;  1QGP A;  5KHD A;  1R49 A;  1D8J A;  2JSC A;  2WAD A;  3FBN B;  3FLJ A;  2WY8 Q;  2R7O A;  5E3L A;  5EF6 A;  1AV4 A;  1W5T A;  3MCZ A;  4P5O A;  3I59 A;  3AL0 C;  1HA8 A;  4G6D A;  1A2V A;  1OPY A;  1D1A A;  3NQZ A;  3T5X A;  2QM3 A;  2R92 J;  2LQV A;  1HKQ A;  3GLL A;  1R1U A;  3BRO A;  3MQ0 A;  3DY5 A;  3FZV A;  1E3O C;  3J7A O;  4RBN A;  2X51 A;  5HS7 A;  3U9G A;  3DXO A;  2VQC A;  1VQ9 3;  5BNG A;  1Q7Y 4;  1HDP A;  1VQL 3;  3I55 I;  3NWS A;  3WGG A;  1XCB A;  4KIF A;  4CIC A;  5AIQ A;  1A36 A;  1W2Z A;  5F0C A;  5B66 C;  3DGL A;  3SLU A;  3HSF A;  1Z1S A;  1BRJ A;  3DGN A;  4LYL B;  2VOP A;  3IKT A;  3E6M A;  3JUO A;  4IZZ A;  5DTD A;  3CLO A;  5F08 A;  4CPK A;  3JRA A;  1FP1 D;  3G3Z A;  4PJJ A;  1C0W A;  1W7P A;  2OBP A;  2P0W A;  2ML6 A;  1S3J A;  2FUG 2;  2P0X A;  2JK3 A;  2WAQ N;  3L2V A;  4A0Y A;  1IN7 A;  1W7P D;  2X6O A;  2MW8 A;  2LOO A;  2OD5 A;  1IQY A;  2R7Z J;  1TJD A;  4UB6 C;  4FCJ A;  5F0F A;  5D82 A;  1IXC A;  2E36 A;  4A3F J;  3Q9S A;  1GVD A;  4EM1 A;  1MNL A;  1MOL A;  3S3M A;  2IUJ A;  5J1U A;  4DYQ A;  3HIG A;  1U5T B;  3MSO A;  2EIM H;  2W24 A;  4F3Q A;  4Z2Y A;  1BRG A;  3KP3 A;  4N6U A;  1NJI 4;  2PG4 A;  1D5Y A;  4LMI A;  1ROA A;  1TNT A;  5D5X B;  4HM1 B;  2YX9 A;  1Z77 A;  3Q2P A;  4F91 B;  3CC2 3;  3UL6 A;  1VZ0 A;  3ECH A;  3L0R A;  4MEI A;  5IG3 A;  3I5U A;  4RS8 A;  4XKB A;  5TRD A;  3DCF A;  2KF5 A;  1F1Z A;  4II2 A;  2RDP A;  3CF2 A;  4U7D A;  1IK3 A;  1MND A;  3FXO A;  2KIF A;  3PFY A;  2V1L A;  1YIJ 3;  4ETS A;  4M6X A;  4L7K A;  3CCL I;  2HMN B;  1G2H A;  4FE4 A;  4IT7 A;  3DPU A;  2IYJ A;  2E2H J;  1E0E A;  3G1L A;  1XGS A;  1B1B A;  3HIF A;  2QKL B;  3PNY A;  2IGM A;  1YX5 A;  3WHB A;  5FKO A;  2HOT A;  3SEZ A;  1EV7 A;  1FMW A;  1Y8R B;  2XPV A;  4ZH4 F;  3HOT A;  1G59 A;  3LA2 A;  3WGI A;  2RRE A;  3DF8 A;  1X1P A;  3E5Q A;  1R71 A;  4EM0 B;  3CUQ C;  3F72 A;  1BM9 A;  1KQ8 A;  3FZW A;  1B2Z A;  2OOV C;  2STT A;  2DDB A;  2HFH A;  2M1B A;  1K6Y A;  4ESF A;  4C2T A;  1Q42 A;  2X9D A;  3NBR A;  4DOZ A;  1CGP A;  3B4P A;  4R80 A;  2CX0 A;  1BI1 A;  5AYR B;  2I8D A;  4HM6 B;  3WU0 A;  4H3U A;  4LJZ F;  3BTJ A;  2XAJ A;  3ZFZ A;  2UWM A;  1FYL A;  1STF I;  2IGK A;  2LY9 A;  2L9N A;  2JRM A;  2Z76 A;  2OAZ A;  2VJ4 A;  4IQJ A;  2ZJR F;  3O8Y A;  1RGG A;  4HAA A;  3RKX A;  3EJV A;  5FFX A;  4BHP A;  4DYC A;  1JKQ C;  4HZF A;  1TQI A;  3JRI A;  5E3N A;  4G12 A;  3IHU A;  1SIH A;  1WJC A;  1AOY A;  3H3H A;  3HHH A;  3FKJ A;  4JX6 A;  1WFX A;  2UXX A;  1YO5 C;  3JAM Z;  2AQE A;  3HOV J;  3V8J A;  5IG0 A;  2NVU B;  2IS4 A;  4R4K A;  5D6F A;  3K4C A;  3S5C A;  1DU0 A;  3LFK A;  3DKW A;  2Q8K A;  1XX5 A;  1KU2 A;  2W2C A;  1VQQ A;  5CVR A;  4C30 A;  2MA3 A;  2HVR A;  4XK4 A;  3UJM A;  3DP7 A;  2RBI A;  1KD1 4;  2CFD A;  1ZN2 A;  2L0K A;  3SDB A;  5IT9 Z;  5E79 C;  3IWF A;  5L3E A;  2CRG A;  1I8V A;  4X1E A;  3EBY A;  1RGK A;  3MZY A;  2E1N A;  4KUM A;  3FF0 A;  2HYG D;  3PQJ A;  5E3M A;  4D5C A;  5G2G A;  2MC3 A;  4IIA A;  5AYS C;  3CMY A;  1J7K A;  3F14 A;  2KIS A;  2ICW G;  1FEX A;  1N9E A;  3IAS 2;  4WX9 A;  3GFL A;  4N9I A;  1S7O A;  1WRJ A;  1TWA J;  5M3M J;  3ER7 A;  1BOA A;  5GAD J;  3E5X A;  4HYE A;  2J5O A;  3J7Z I;  2C6Y A;  2JPB A;  1T39 A;  2EK5 A;  4FMA A;  1RUO A;  2VKD A;  2LSO A;  1MKM A;  1G8X A;  1WJA A;  1QVU A;  2F4O B;  4DIQ A;  4WWC A;  2Y2Z A;  3TO6 A;  5HS8 A;  5C4X J;  2VL8 A;  2KZG A;  5DV5 A;  4DJA A;  2K5C A;  3LSJ A;  1TZL A;  3OR1 C;  3JRC A;  3EX9 A;  1S72 3;  5EYR A;  2CC3 A;  4HLY A;  2TDX A;  2OCE A;  1ZGW A;  2ZB9 A;  1XC5 A;  1W0T A;  1HDD C;  2EWN A;  4CO8 A;  1PYL A;  1UI8 A;  2Z5U A;  1P4A A;  5JVT A;  1T2K A;  4LEH A;  1IT8 A;  5FLX Z;  1E97 A;  1NB3 I;  3GZX B;  2ISY A;  1TRP A;  2ZXH A;  4H4K C;  2RFR A;  5CQG A;  4GSP A;  3LSP A;  3V7R A;  5CVV A;  3PIP F;  1OCO H;  2OF7 A;  1R4Y A;  2CV0 A;  2ESH A;  1TWC J;  4G7H F;  1J0R A;  1ETW A;  1MMN A;  1Z9C A;  1VF9 A;  1SFO J;  2IEK A;  1EA3 A;  3OYF A;  4BDY A;  1BNS A;  1ZLJ A;  4HAM A;  3Q3F A;  3QYB A;  3PGB A;  4Q5S F;  4XBT A;  3FX3 A;  3LWF A;  4KN7 X;  4B44 A;  1IT7 A;  3P9C A;  5LFA A;  3F40 A;  4HM5 B;  3G0K A;  4H0E A;  3G16 A;  2P09 A;  3I4P A;  1HSJ A;  4XLA A;  1A2K A;  3DZL A;  2JPC A;  4FX4 A;  1JGG A;  3HII A;  3GTK J;  3K4M A;  3I54 A;  4ABZ A;  3LSK A;  4LIV A;  2JA5 J;  3GEZ A;  3Q1C A;  4ILF A;  3J80 K;  1CQT A;  2NRA C;  2FE3 A;  3ECF A;  4X2H A;  3CCV I;  2V9K A;  2DK5 A;  3FMQ A;  1LB2 A;  1Z3Y A;  3S1R J;  3EYI A;  1TT5 B;  1IV9 A;  1POG A;  2Z7A A;  4KFD A;  4B48 A;  4M3D A;  2P38 A;  2BY2 A;  1QAF A;  3BU4 A;  2E5Z A;  1VQM I;  3VEP A;  4A5N A;  1RHL A;  5LHH A;  3K63 A;  2R7F A;  1JV2 B;  1WMO A;  2P0M A;  3CDH A;  4PJL A;  4K61 A;  1IGN A;  3K6G A;  4P55 A;  5KNL A;  1VZZ A;  5LHI A;  1K83 J;  1UZC A;  1VQO 3;  4RGX A;  2HPI A;  5IP9 J;  3OOP A;  1WH5 A;  4M9Z A;  4U7B A;  4CYC B;  4HST A;  2KXG A;  4N4N B;  4XBX A;  3S93 A;  1V5F A;  4D7N A;  1W00 A;  2GEX A;  4E7K A;  2D1H A;  2DMP A;  3IUO A;  1BVI A;  2LNB A;  2HMM B;  4MFE A;  4LLN A;  2X1C A;  2YX4 A;  1J09 A;  1HXD A;  2Z99 A;  3DTI A;  2AS5 F;  2PMH A;  2ZCW A;  1RKW A;  3W3C A;  1RZ4 A;  1B4A A;  2IA1 A;  3RTR A;  1XSX A;  3ABM H;  2QSH X;  4YFX F;  1WH7 A;  4E7J A;  1MW7 A;  1AA7 A;  1ULI B;  2GXB A;  1DPR A;  4L5E A;  2CH9 A;  3G1M A;  2NS0 A;  3GFJ A;  4EJU A;  3FDY A;  1RNL A;  2VE9 A;  1HYF A;  3E0J B;  1JKP C;  2Y48 A;  2ZFW A;  3KX2 A;  3ZQG A;  1LNI A;  4N6O B;  2CMP A;  4RNT A;  4W1U A;  3JUQ A;  3UNL A;  5CPR B;  3LL7 A;  4UUT A;  1ACI A;  4OAZ A;  2KJC A;  1AVK A;  4XRM A;  2HGC A;  1B20 A;  3H9J A;  2EQR A;  2NS8 A;  5IW9 A;  3A4C A;  4ZYE A;  3E97 A;  2L9S A;  3HM5 A;  1QZE A;  2LKS A;  2X1E A;  2LBF B;  4FMB A;  4RLQ A;  1TT0 A;  1Z67 A;  2R5Z A;  4HM8 B;  4HZB B;  2G9W A;  1X19 A;  3ECO A;  3EF8 A;  2R7R A;  1Z21 A;  1M1X B;  1BIR A;  3CME 3;  2ML5 A;  3LTB A;  3S1M J;  3CC4 I;  2W9Q A;  4II3 A;  1SFK A;  4EGZ A;  2ZHX B;  4YFN F;  4EJO A;  1Y4K A;  3M8C A;  3RZD J;  4JBA A;  4I76 A;  4PEJ A;  3F0C A;  4EM2 A;  4CCK A;  4C2U A;  3JCU C;  2H27 A;  1MMS A;  5D4S A;  2RN7 A;  2GXG A;  4PJM A;  2UXN A;  3LAP A;  5E8I A;  3OV4 A;  3M07 A;  2V6E A;  1VQN 3;  3OX9 A;  3IL2 A;  1QHH D;  4J9A A;  1LRA A;  4N6L A;  1BR4 A;  3WOE B;  3R6S A;  3GF2 A;  4FE7 A;  2W57 A;  1XB4 A;  2NVT J;  5ILS A;  4KFC A;  2MAB A;  2M3A A;  1RRJ A;  2FML A;  2Q2E B;  4L5J A;  1BNI A;  3CCE 3;  1JBR A;  5LRR A;  1LVA A;  1U9O A;  2COM A;  2M45 A;  1OCC H;  1ZRF A;  2LD5 A;  1LOW A;  2QEN A;  3V92 A;  2L3D A;  2F4M B;  3M8J A;  3BNE A;  4N6M A;  4IEJ A;  2VT3 A;  4GHO A;  3ML6 A;  2IGO A;  1ULJ B;  2NVX J;  3RIR A;  4BEH A;  5FW5 A;  1SD7 A;  2NNN A;  2H94 A;  3I0T A;  3OIQ A;  3AL0 B;  1T98 A;  1K7A A;  3WHC A;  1K61 A;  4CYC A;  3J7Y J;  1LQG C;  1TL8 A;  2F5F A;  1YIO A;  1W4M A;  1IRF A;  5I97 A;  7RNT A;  2IUK A;  3X2Q H;  1U8C B;  2ZJ2 A;  2VQG A;  3K1N A;  4V19 K;  4N6N B;  4O6J A;  2DYR H;  1RPW A;  3LYG A;  3H9Q A;  4L5I A;  2KIU A;  4G8X A;  5CYV A;  1T2H A;  4BJ5 C;  3KP7 A;  1PUF B;  1CQS A;  1V3F A;  1ZKG A;  3WG9 A;  2DN0 A;  1XCV A;  1YJ9 3;  2WC2 A;  1GYB A;  3IRQ A;  2RQQ A;  3OV8 A;  2IY2 A;  4IJA A;  4Y17 A;  4RGU A;  3CCJ I;  2IBD A;  3CTA A;  1VQ5 3;  3HEF A;  2QWW A;  3I3L A;  3BG6 A;  5BMZ A;  1R4C A;  1EKM A;  3AHS A;  1TFO A;  2O61 A;  3SZG A;  2DFE A;  1OHP A;  3F23 A;  1R4M B;  1WQ2 A;  2VC1 A;  3JSP A;  3F21 A;  1FYS A;  1RSN A;  4BTX A;  5CVI A;  4AID A;  1ENH A;  2DO7 A;  1HU9 A;  1WHU A;  1HW1 A;  3GWR A;  1LOY A;  2BO9 B;  4KZ1 A;  4L9T A;  4TX4 A;  3SHF A;  4EJT A;  4I5Q A;  2LLK A;  2X85 A;  1Y1V J;  5F0H A;  1Z91 A;  3K7C A;  2DA3 A;  5DM7 F;  4I0B A;  5AON A;  1A31 A;  1MSF C;  2NVQ J;  1TWH J;  4NC8 A;  3D9R A;  1ZR2 A;  1G0T A;  1LVK A;  1Z1D A;  4QPQ A;  1SD4 A;  1SMT A;  3OL3 A;  4Y15 A;  2IT0 A;  4IX7 A;  1W7C A;  3F6O A;  3J7Y d;  1WGX A;  3ABL H;  3DBR B;  1VQ7 3;  3M7G A;  2KIQ A;  4HV5 A;  3R0J A;  4OUQ A;  1OFC X;  2V9V A;  2JVH A;  2LRE A;  3VYU B;  3A76 A;  2LDU A;  3FIS A;  4KIG A;  1KU7 A;  1BL0 A;  1Y6I A;  4GFB A;  3M8E A;  3AKZ A;  3FG4 A;  5D8L B;  2RV8 A;  2FGT A;  3G71 I;  5IOY A;  3HKZ N;  3BJO A;  2DT6 A; 
#chains in the Genus database with same CATH homology
 5LC6 A;  1KQS 2;  1ISK A;  4OK0 A;  1J2B A;  2I9W A;  1E3R A;  5AIH A;  1QJG A;  2CWT A;  4O8S A;  1OF5 A;  2ZL8 A;  2CFL A;  3OWY A;  1D6Z A;  1FGQ A;  1QVF 2;  1BUQ A;  1JRQ A;  4WFO A;  1O7G B;  3F7S A;  2F99 A;  1C7H A;  1JB5 A;  2OQE A;  2UX0 A;  2FNQ A;  4MJD A;  2GBX B;  1QVG 2;  3CD6 3;  3S29 A;  5IEN A;  1SJW A;  2MF7 A;  4K90 B;  4STD A;  1CEW I;  3N9H A;  5CF2 A;  2Z77 A;  2E2U A;  2K0M A;  2BT3 A;  5BVB A;  2K54 A;  3U97 A;  2WOF A;  5IEO A;  4WYK A;  5AIF A;  4RNY A;  3V98 A;  1NO3 A;  2YFJ B;  3LTA A;  4N6T A;  3MG2 A;  3G71 3;  3DUK A;  3I0Y A;  6STD A;  2CK3 H;  5AYR B;  2PNC A;  1K73 4;  3RGA A;  4RZM A;  2BMR B;  3N8B A;  3KE7 A;  1KWI A;  1JN5 A;  1NDO B;  1O7H B;  3LTD A;  1DVC A;  1CYV A;  4ZM8 A;  1OUN A;  2BMO B;  3MG3 A;  5IEP A;  2QA4 3;  5A0O B;  1DYU A;  4G1M B;  4K1U A;  1OF5 B;  3FLJ A;  2GBW B;  3NXJ A;  4X2O A;  3SOA A;  2WGO A;  4MMY B;  1AV4 A;  1A2V A;  1OPY A;  4HZ9 B;  3VSY A;  1GS3 A;  3NQZ A;  1DMQ A;  1M1K 4;  2LQV A;  4FCZ A;  3PYJ A;  2WGQ A;  4BTY A;  3DY5 A;  5JPU A;  1AR0 A;  3BNB A;  4RBN A;  5ELU A;  1LOX A;  3DXO A;  1VQ9 3;  5IER A;  1Q7Y 4;  3GAX A;  4AKZ A;  1VQL 3;  1VQ6 3;  1W2Z A;  3K0Z A;  1N8Q A;  3DGL A;  3SLU A;  1LVN A;  4WYK B;  1Z1S A;  3DGN A;  1G96 A;  3JUO A;  3T8N A;  3WMD A;  5CF1 A;  5ELJ A;  3EB8 A;  3FG3 A;  2ML6 A;  4AKY A;  1GY5 A;  1GY6 A;  2P0X A;  4R9L A;  3UL5 A;  3LT8 A;  1JN5 B;  4XM4 A;  1JNQ A;  1IQY A;  1WQL B;  3EN8 A;  4O2H A;  4FCJ A;  5D82 A;  3S28 A;  3B4O A;  3WOD G;  2OCT A;  1MNL A;  5TGN A;  1W6Y A;  1MOL A;  5IG5 A;  3JUM A;  3HIG A;  3PZW A;  3NV0 B;  2IUJ A;  3MSO A;  2IA7 A;  1W2B 2;  1SQW A;  3RGR A;  1HKX A;  4N6U A;  3WA3 A;  1NJI 4;  4LMI A;  1CYU A;  3CC7 3;  1ROA A;  5AII A;  3I55 3;  2CWV A;  4HM1 B;  2YX9 A;  3CC2 3;  3Q2P A;  2JDI H;  3UL6 A;  3L0R A;  2PZV A;  4MEI A;  5IG3 A;  1Q82 4;  2OTJ 3;  1IQX A;  3JUP A;  1UUV B;  1EG9 B;  1SII A;  3WDG B;  3HI7 A;  1WTH A;  3KZT A;  1IK3 A;  3HX8 A;  2V1L A;  1YIJ 3;  2CIU A;  4L7K A;  2HMN B;  1KSI A;  4IT7 A;  1N5P A;  3FSD A;  3OXA A;  2D42 A;  3FCS B;  1TFK A;  1UI7 A;  4LSO A;  3T8U A;  3X3Y A;  2W9P A;  3SED A;  3NX0 A;  4KFE A;  1FGT A;  3S27 A;  2STD A;  3FZW A;  3IMA B;  1O7W B;  2OOV C;  3NHX A;  4EXR A;  1Q42 A;  3NBR A;  1N5H A;  3EC9 A;  2BHM A;  3B4P A;  4R80 A;  5AEW B;  1W6C A;  1YVB I;  3LTC A;  1W01 A;  4HM6 B;  3G8Z A;  4H3U A;  1KC8 4;  1STF I;  3WA2 X;  3CCQ 3;  1PFP A;  2C11 A;  2Z76 A;  3O8Y A;  5FGO A;  1RKY A;  3MPH A;  1E3V A;  2L4V A;  3EJV A;  3U1W A;  4FR9 A;  3NM7 A;  5AIG A;  5JPP A;  3CCR 3;  2W03 A;  3EQQ B;  3LZA A;  5JBS A;  3F8X A;  3CCL 3;  1SIH A;  5D81 A;  3HZP A;  5KP3 A;  3H3H A;  4XDV A;  3CCU 3;  1A67 A;  3NBB A;  2E2T A;  4O02 B;  2OWP A;  5IG0 A;  1UUW B;  4R4K A;  5EEO A;  2M7O A;  3S5C A;  3X42 A;  2HMO B;  4GB5 A;  1L5G B;  3Q90 A;  1W5Z A;  2W2C A;  4HM7 B;  5AEU B;  3DMC A;  2GU3 A;  4HYZ A;  5CXO A;  3SOY A;  2F98 A;  1RN7 A;  4NHF A;  3GRD A;  1F8N A;  3OWS A;  3UJM A;  4AEQ A;  3GZY B;  2CFW A;  1KD1 4;  2CFD A;  1STD A;  1K9M 4;  2OQE C;  1YJN 3;  1OCV A;  1TP6 A;  4FMC A;  3EBY A;  4EC6 A;  3NV0 A;  1ZO2 A;  1V74 A;  4CCV A;  1TUH A;  3B8L A;  3KKG A;  5G2G A;  4IIA A;  5AYS C;  2XSO B;  3F14 A;  2HMJ B;  3CCS 3;  1Q81 4;  1N9E A;  2XGL A;  3WOF B;  3TDG A;  1JJ2 2;  4K1V A;  3ER7 A;  3KFQ C;  3X3X A;  1OH0 A;  1OGZ A;  1WNH A;  3FF0 A;  4FMA A;  1GY7 A;  1SPU A;  3OW2 2;  1YJW 3;  3KN4 A;  4LGQ A;  3OWU A;  2QGU A;  1RRL A;  1JKG B;  3E99 A;  3EX9 A;  1S72 3;  2QIY A;  2CC3 A;  3D3L A;  2YFI B;  4OVM A;  1VQ8 3;  4L8P A;  2XH9 A;  1UI8 A;  4LEH A;  3FG1 A;  1IT8 A;  1EQK A;  1NB3 I;  1E97 A;  3GZX B;  4XB5 A;  3K5T A;  2RFR A;  1VQ4 3;  3KII A;  5DRE A;  1FUW A;  4HJL B;  3CNX A;  3NQY A;  3I56 3;  4CDL A;  1NWW A;  2A15 A;  3V99 A;  1K28 A;  2BNG A;  3PGB A;  4R9K A;  4XBT A;  1M90 4;  1UW1 A;  4HM5 B;  3DM8 A;  1IT7 A;  3F40 A;  3G0K A;  2CFG A;  1D6U A;  2FXT A;  2P09 A;  2XF3 A;  3G16 A;  3MWZ A;  3PS8 A;  1A2K A;  3DZL A;  4L8O A;  3N54 B;  3HII A;  3LH4 A;  2RCD A;  3B7C A;  2F86 B;  1FGM A;  7STD A;  3Q1C A;  2C10 A;  2W56 B;  3H51 A;  1ASK A;  4HM3 B;  5KP1 A;  4MMZ B;  3ECF A;  4X2H A;  5IF6 A;  1AVL A;  1W4N A;  3ROB A;  1IV9 A;  2Z7A A;  4KFD A;  3KSP A;  5KP4 A;  2P38 A;  3EHC A;  1QAF A;  3LML A;  3CNM A;  1QMA A;  3UB1 A;  4N3V A;  2KRT A;  3K63 A;  1DVD A;  1JV2 B;  1WMO A;  2P0M A;  3QK9 A;  4IPB A;  4EV2 A;  4K61 A;  3VGN A;  2OTL 3;  1IQ8 A;  4WP5 A;  3BB9 A;  1VZZ A;  3NBJ A;  1YIT 3;  4HBR A;  3X40 A;  1TIJ A;  3F9S A;  1VQO 3;  3EBT A;  4O3V A;  2YFL B;  3RDE A;  2Z6B A;  2KXG A;  4XBX A;  3F7X A;  5DRV A;  1W00 A;  2GEX A;  1VQK 3;  4EYC A;  4JF8 A;  2HMM B;  2XEP A;  3CMA 3;  4GL6 A;  1JB2 A;  4MMX B;  1ZX2 A;  2W04 A;  4KFF A;  2R4I A;  4BTW A;  3LXU X;  1K8A 4;  3CCV 3;  2XR8 B;  3DGM A;  3SXX A;  1ULI B;  1QAK A;  1U5O A;  1YGE A;  2CH9 A;  3BND A;  3PXM A;  3GZR A;  4HKV B;  3GZB A;  5HGR A;  1VQM 3;  5IG4 A;  1N8R 4;  4N6O B;  1TU5 A;  3S67 A;  1IDP A;  1JKG A;  1RJO A;  2INX A;  3JUQ A;  4RNZ A;  3UNL A;  3AMO A;  4WHA A;  1LNH A;  5AI1 A;  1AVK A;  3LT9 A;  3MKI A;  1US1 A;  3G4S 3;  1O7N B;  3F8H A;  5IW9 A;  1FA3 A;  1YI2 3;  4FMB A;  1NB5 I;  4HZB B;  3JVC A;  4HM8 B;  5LC7 A;  3CU3 A;  1GD4 A;  1T5Y A;  3K9M C;  5STD A;  4EV5 A;  4FCM A;  4FMD A;  3EF8 A;  4XBY A;  5BXQ A;  2CG1 A;  1PU4 A;  4JRF A;  2QEX 3;  1YHQ 3;  3T0U A;  2LYX A;  1M1X B;  3CME 3;  2CG0 A;  2ML5 A;  3BNC A;  3LTB A;  2W9Q A;  4HM4 B;  2MC8 A;  2KCD A;  1RRH A;  2BMQ B;  1Y4K A;  3JUN A;  3M8C A;  3CPO A;  1IU7 A;  4PEJ A;  2JQ5 A;  3CPW 2;  2XFT A;  4WWU C;  3SVA A;  3X3Z A;  1DMN A;  1O7M B;  4I4K A;  1OAC A;  4U13 A;  2W56 A;  1WMN A;  2O3O A;  1NU3 A;  3OV4 A;  1VQN 3;  2RGQ A;  1DMM A;  3OX9 A;  4J9A A;  4H61 A;  3PCS A;  4N6L A;  3STD A;  2O9U X;  3WOE B;  1K41 A;  1Q40 A;  1EA2 A;  2RSX A;  3CCE 3;  2CHC A;  3HK4 A;  3V92 A;  5D83 A;  8CHO A;  1W6G A;  3AMO B;  3CCM 3;  3X41 A;  3FGY A;  3BNE A;  4N6M A;  4NRE A;  1ULJ B;  3IPT A;  3MYT A;  2Y74 A;  5FW5 A;  3FF2 A;  3CC4 3;  4J8T A;  2ZDJ A;  4XDW A;  3ALA A;  5CLK A;  2GEY A;  4HVN A;  5EVH A;  5I97 A;  1IVX A;  2IUK A;  1U8C B;  3QRD A;  2SBL A;  4KVH A;  5CK6 A;  4ORL A;  2CWU A;  4N6N B;  2CW9 A;  4LZI A;  1D6Y A;  4HM2 B;  1OHS A;  1JB4 A;  3LYG A;  1GD3 A;  1O7P B;  2B1X B;  1N9J A;  2HML B;  1CQS A;  3CXC 2;  4Q53 A;  1YJ9 3;  1GYB A;  3FH1 A;  1IV7 A;  2CFK A;  2E2V A;  2Q07 A;  1VQ5 3;  1R4C A;  1EKM A;  1TFO A;  2WOH A;  1IVU A;  1OHO A;  4HM0 B;  1OHP A;  4BTX A;  2HMK B;  2P05 A;  1VQP 3;  2WO0 A;  1HU9 A;  2XRX B;  3EE1 A;  3GWR A;  3DGO A;  1Q40 B;  2BO9 B;  2Y73 A;  4KZ1 A;  5EQL A;  3SX1 A;  3NM2 A;  4TX4 A;  2OOV A;  1FGO A;  2CKF B;  2XGN A;  3FKA A;  3K7C A;  1QAL A;  2IMJ A;  2B24 B;  3VF1 A;  3IJE B;  4N6V 0;  1W02 A;  1A90 A;  3D9R A;  3PCR A;  4R1K A;  3LOY A;  1IVW A;  1Q86 4;  1W7C A;  3NUV A;  3J7Y d;  2GU1 A;  1ROV A;  1VQ7 3;  3MG1 A;  1S5A A;  4OUQ A;  1FGR A;  3A76 A;  3MHE A;  4EBG A;  1M9G A;  2W6J H;  3KSE D;  2XSH B;  3EN1 B;  1LXE A;  3FG4 A;  3CCJ 3;  2FGT A;  1OGX A;  2W0Q A;  2XFS A;  3BLZ A;  4QWT A;  2D1W A;  1IVV A;  2GXF A;  3G6E 3;  1WMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...