1EQKA

Solution structure of oryzacystatin-i, a cysteine proteinase inhibitor of the rice, oryza sativa l. japonica
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
MSSDGGPVLGGVEPVGNENDLHLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPVDASANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORYZACYSTATIN-I
publication title Three-dimensional solution structure of oryzacystatin-I, a cysteine proteinase inhibitor of the rice, Oryza sativa L. japonica.
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase inhibitor
total genus 18
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2000-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1eqkA00
1PFPA 1NB3I 3PXMA 1CEWI 3PS8A 1GD4A 4N6OB 3QRDA 3MWZA 2KXGA 4IT7A 5LC7A 1CYUA 4N6V0 1CYVA 1KWIA 5LC6A 3UL6A 3UL5A 2W9PA 4TX4A 1YVBI 3S67A 1A90A 2BO9B 2OCTA 1STFI 4CCVA 1M9GA 3PYJA 1MNLA 5EQLA 1N5HA 1ROAA 1GD3A 3K9MC 3NX0A 3KFQC 1G96A 1DVDA 2CH9A 3GAXA 1N5PA 4N6UA 1FUWA 1NB5I 2W9QA 1RN7A 5A0OB 3KSED 1LXEA 5ELUA 1DVCA 1N9JA 4N6MA 5ELJA 3IMAB 1TIJA 3LH4A 4N6NB 2O9UX 4EYCA 4N6TA 4N6LA 1FA3A 1IV7A 1IV9A 1A67A 1R4CA 1MOLA 1EQKA 4ZM8A 3SVAA 1WNHA 3Q2PA 3L0RA 4LZIA
chains in the Genus database with same CATH superfamily
2CX0A 2XFSA 1PFPA 4OUQA 2RCDA 3HZPA 3DGYA 3EHCA 3CD63 8CHOA 2W2CA 2FNQA 1T5YA 1IVVA 1CEWI 1LNHA 2JQ5A 1YGEA 1B2ZA 1MGRA 2XGLA 3AGNA 2XF3A 3NXJA 5KP3A 3X3YA 1VQO3 1PY3A 2GXFA 2IY2A 7RNTA 4L8OA 3QRDA 1K734 2I9WA 3CC73 4IPBA 1BRGA 1K9M4 1RN1A 1BUQA 1TFKA 3BNEA 2SBLA 2P38A 1VQM3 2XFTA 1NJI4 1X1UA 4R9KA 2BHMA 2F5MA 3PCSA 5LC6A 1U8CB 7STDA 4ILFA 3CME3 2LQVA 5AIIA 1ZGXA 2IMJA 1JBSA 5D83A 3JVCA 2GEXA 3Q1CA 4MMYB 1FGRA 1VQN3 2ML6A 1OGZA 1WMPA 2GSPA 1KC84 2CC3A 1OHPA 4RNZA 3CCJ3 3D79A 4R9LA 2D42A 9RNTA 1Q864 3I0YA 1UDII 1FZUA 3MPHA 2UX0A 3NQZA 4LSOA 5D82A 4CCVA 1M9GA 1ZS7A 2CFDA 1W4NA 1N8R4 3CCV3 2XH9A 4HOHA 3A5EA 3DM8A 3F8XA 3S28A 3X42A 1BSDA 1LRAA 3OX9A 3DGMA 1N9EA 2B1XB 2ZL8A 3KN4A 2WGQA 3F7SA 1GD3A 2SARA 3K9MC 1N8QA 1EEJA 3NX0A 4EW5A 3J7Yd 1OHOA 4RZMA 1JV2B 1SJWA 3UJMA 3V92A 4HM4B 1QMAA 2V1LA 4R80A 3SXXA 1W5ZA 2CH9A 5IG5A 5RNTA 1BUJA 4H3UA 1SPUA 1N5PA 1UI7A 4U13A 3N8BA 3DUKA 1L5GB 1RGGA 2W6JH 2Y73A 5TGNA 2QA43 1AR0A 1Q7HA 1TRPA 2BT3A 1RN7A 1OACA 1WTHA 2KF4A 5A0OB 5CLKA 3EX9A 1LXEA 1IT8A 2XRXB 3D3LA 1DVCA 1N9JA 4N6MA 3T8NA 1IT7A 3IMAB 3Q90A 1RNTA 3D5GA 3LH4A 4KFEA 3K63A 1UCIA 3DZLA 4EYCA 3RGRA 1MWTA 1O7HB 5CF1A 4QWTA 4IIAA 3ZG5A 3LTCA 1LQGC 1UUWB 2ZHXB 1CH0A 1JRQA 2FGTA 1FW7A 5AIHA 1NDOB 1IVWA 3GRDA 1JN5B 1V58A 1EA2A 2P0XA 4HM8B 1EKMA 3LXUX 3NBRA 1BNIA 1HKXA 1LOVA 1IV9A 1LNIA 1HU9A 2CX1A 1BRIA 2WGOA 3CCM3 2R4IA 3MHEA 1M1XB 1W01A 5DREA 1A67A 3WODG 1UI8A 2Z7AA 3WR2A 5IENA 3F8HA 1BSAA 2E2TA 4XM4A 1RHLA 3LTDA 4HAAA 2BIRA 1I8VA 6STDA 1WMNA 5STDA 3AHSA 3D5IA 4AKYA 4EV5A 1S723 2P0MA 3L0RA 3LT8A 2E2VA 2GEYA 4LZIA 3GZBA 1VQL3 1UCJA 3V99A 1VQ53 1UUVB 1GY6A 3I553 1RCKA 1X1YA 1ASKA 3EB8A 3LOYA 1JN5A 1Q40B 2K54A 3NV0B 2GBXB 3MG1A 3M8CA 2CKFB 1JJ22 3OXAA 1RN4A 4HM6B 1YIT3 1GMRA 4HKVB 1YJN3 1VQQA 1RTUA 1BRSA 2KXGA 1JB5A 3NM7A 1DMQA 4N3VA 1BNGA 4FMCA 1X1XA 3EBTA 3AMOB 1I70A 4OK0A 4BIRA 1JZDA 3URPA 2GBWB 2Y74A 4KZ1A 3SOAA 1LOWA 1Q9EA 1BNSA 1KWIA 1WMOA 2HMLB 2HMNB 3DGNA 5AIGA 4MMZB 4RNTA 2RNTA 1Q42A 1NO3A 3FG3A 4HM5B 3QK9A 3NV0A 3H51A 1TTOA 5CK6A 1M904 3CXC2 1OCVA 1BNFA 1OF5A 1STDA 1IQXA 2B24B 1I3FA 3CPOA 3EN8A 2L4VA 4MMXB 3MG2A 1HYFA 2BNGA 3X3XA 3CC43 3A76A 1JBTA 4LGQA 4LYLB 4X2HA 1MWUA 3BIRA 1A90A 1B20A 4EC6A 3CPW2 1JB2A 1DE3A 4BTYA 1GS3A 1STFI 3AMOA 1RGLA 1JNQA 2KF5A 1GMQA 1A2KA 4J5GA 4KFFA 4L7KA 4XBTA 3S5CA 3I563 3GZYB 3KE7A 4XB5A 3IPTA 2CG1A 2E2UA 3S29A 1FGOA 1WQLB 1ISKA 5EVHA 2Z76A 1SIIA 2IA7A 2INXA 2ZDJA 3EQQB 3WDGB 4PEJA 1ULJB 3BNBA 3CU3A 4K61A 1YI23 3F7XA 1G96A 1RRLA 2H0IA 1YVSA 7GSPA 1AVLA 2YFLB 3CNXA 1FUSA 3LYGA 3CCE3 1VQK3 3HK4A 3SLUA 1W2ZA 1Y4KA 5IEOA 1KD14 3JUOA 1E97A 4K1UA 1GY7A 1LOXA 3FCSB 2IUJA 3U97A 1I3IA 2K0MA 3OWYA 2RSXA 4EXRA 3PZWA 3BLZA 2KCDA 1TU5A 3DXOA 1O7NB 1TIJA 1I2FA 2OQEC 1BRHA 3CMA3 1VZZA 1UCLA 4J8TA 5IEPA 3OV4A 3EC9A 4FMBA 1VQ63 1OPYA 1BRNL 1G0TA 1W7CA 2CFWA 2W56B 2J8XB 3HIGA 3F40A 1IQ8A 1W6CA 4KFDA 1VQ43 3STDA 2KRTA 4WHAA 1IYYA 2FXTA 4N6LA 4ORLA 5CF2A 5G2GA 3FKAA 1GOUA 1C54A 1MWRA 5BIRA 5M1AA 2F98A 1DMNA 1CQSA 2PZVA 4GL6A 1RSNA 4BL2A 1O7GB 1R4CA 1MOLA 4HZBB 1Q7Y4 3H3HA 1BSBA 3NUVA 3D4AA 1D6ZA 2YFIB 3NHXA 2CIUA 3ZG0A 2OTL3 1LOYA 1RMSA 1JZOA 3CNMA 5GSPA 6GSPA 1BSEA 3NBBA 3VSYA 1W6YA 2C10A 4DKIA 3AGOA 2QIYA 4WYKB 4CJNA 1OGXA 1TFOA 2WO0A 1BNJA 2OWPA 1R4YA 1JB4A 2K3DA 1NB3I 2H0GA 2C11A 3CC23 3CCU3 1YJ93 5JPUA 2OOVC 3OW22 1RLSA 1FGQA 3PS8A 1YIJ3 6RNTA 1BIRA 3G8ZA 1VQ93 3V98A 3EE1A 3FG1A 1OH0A 1W6GA 3MWZA 1Z1SA 4AKZA 4CDLA 1RRHA 3DY5A 3LTAA 1G02A 1CYUA 1U5OA 4EBGA 1BRKA 2KF3A 2P05A 2HMOB 3MYTA 4N6V0 4BL3A 3FGYA 1AQZA 1VQ83 4HM1B 4O8SA 5AYSC 4GHOA 3FF2A 4HJLB 1TJDA 2O3OA 4HZ9B 5FGOA 3WHOA 5JPPA 1AVKA 2KAAA 3K0ZA 2W9PA 5IERA 1ZO2A 4JRFA 4O3VA 1UCKA 1TUHA 4HM2B 5CXOA 4EV2A 5BU4A 1RKYA 3GWRA 4TX4A 1UUGB 1BRJA 1YVBI 2Z6BA 3F14A 4KT3B 2CW9A 3FZWA 1VQP3 2OQEA 1US1A 2CHCA 4I5QA 2Q07A 1DMMA 1J2BA 1LQMB 3LTBA 2QEX3 2BO9B 2OCTA 1O7PB 3K7CA 3DMCA 1NU3A 5HGRA 3X3ZA 1V57A 3ECFA 3OWUA 2BMQB 3O8YA 1IU7A 2STDA 3PYJA 3T8UA 2Z77A 1I0VA 1IQYA 5I97A 1BSCA 1B2SA 1N5HA 1RGEA 1RGCA 3DGLA 1ROAA 2AAEA 1HZ1A 3DGOA 3KZTA 1B3SA 3ALAA 1QVF2 2H0HA 1PU4A 5IG0A 1MWSA 3FF0A 1RGHA 3WA2X 1M1K4 5FW5A 2HMMB 3KFQC 1Q40A 2CFGA 3VGNA 2OTJ3 3JUMA 3GAXA 4L8PA 4RBNA 4XDWA 5EEOA 1FUWA 1PYLA 1K8A4 1NB5I 2W9QA 3GZRA 2D1WA 1GOVA 3KSED 3X41A 1F8NA 5AI1A 2MF7A 1FUTA 3KIIA 4GB5A 3FG4A 1BU4A 1YJW3 1FGTA 3DH2A 5ELUA 1BNEA 1X1WA 5ELJA 1SIHA 1EG9B 3EF8A 5AIFA 4J9AA 4N6NB 1GMPA 2A15A 2RGQA 4I4KA 1B2MA 3BU4A 3SOYA 3HOHA 1FGMA 4N6TA 4XDVA 3ZFZA 3G4S3 4HYZA 1JBRA 1IV7A 2IUKA 1W00A 2UGIA 2WOHA 1T2HA 2ZA4A 4BTXA 3B7CA 2UUGC 1QVG2 3NBJA 5M18A 2W0QA 2ML5A 2BMOB 2CWVA 1NWWA 4HM3B 3AHWA 2F4YA 2KF6A 1GYBA 1T3BA 4K1VA 4FR9A 4X2OA 3EJVA 4ZM8A 5BXQA 4R4KA 2GU1A 2CG0A 1RDSA 3IJEB 3UB1A 3JUQA 1B2XA 3Q2PA 3TDGA 2CWTA 3GSPA 4HM7B 3KCHA 4XBYA 1NNVA 1IVUA 3N9HA 1RNBA 3HI7A 1IK3A 3PXMA 1C7HA 2YX9A 4FMDA 1B21A 4WWUC 1RGFA 1BGSA 2JDIH 1GD4A 4N6OB 1YGWA 4MEIA 4R1KA 1SQWA 3FH1A 2HMKB 4AEQA 2F86B 2CFLA 5IF6A 3BNCA 4HBRA 1YNVX 4J5KA 2F99A 4IT7A 1IDPA 1FYSA 5LC7A 4BU4A 2W03A 5AYRB 2RBIA 3MSOA 3ROBA 1BAOA 2WOFA 3FLJA 5D81A 3UNLA 3SEDA 3RDEA 3CCR3 3G16A 1QAFA 5KP1A 1CYVA 1E3VA 2R41A 3BB9A 3HX8A 2BU4A 4O02B 2W56A 3CCL3 1I2EA 2CK3H 4JF8A 5KP4A 3Q3FA 3UL6A 3UL5A 4LMIA 4XBXA 1AV4A 5BVBA 1RGKA 2M7OA 3G713 1QJGA 1MGWA 2F56A 3CCQ3 3RNTA 5IW9A 3KKGA 3LT9A 2MC8A 3S67A 4FCJA 2CWUA 4GSPA 1W02A 1D6UA 1LVNA 1YHQ3 2XSOB 1RGAA 1Q814 1EUIC 1D6YA 1OHSA 3EN1B 4H61A 2HOHA 1GY5A 1TP6A 3K5TA 1AY7A 3U1WA 5G1LA 1RCLA 3F9SA 4BTWA 1QAKA 1BANA 1MNLA 2CFKA 3PCRA 1UGIA 3E99A 1Q824 1OUNA 1O7MB 5EQLA 3B4OA 4WYKA 1DETA 2PNCA 3S27A 3B4PA 1BNRA 2C4BA 4NPBA 3G0KA 2AADA 2BMRB 1W2B2 3VF1A 1JKGB 2XSHB 4K90B 3SYUA 1KQS2 1ULIB 1UW1A 1V74A 4O2HA 4OVMA 2F5WA 4FCMA 1E3RA 3G6E3 2LYXA 1A2PA 4N6UA 4NHFA 3OWSA 1B2UA 1T2IA 3HIIA 3SX1A 4FMAA 4WP5A 4WFOA 3JUPA 1RJOA 1ZX2A 1TRQA 5DRVA 3GZXB 5G1KA 5IG3A 4G1MB 4LEHA 2L1SA 3BNDA 2RFRA 5IG4A 2QGUA 3LZAA 3FSDA 3MG3A 2YFJB 1ROVA 3EBYA 4RNYA 1BVIA 3D9RA 3KSPA 2HMJB 2O9UX 2W04A 5AEUB 1JKGA 1UGHI 3ER7A 3N54B 3LMLA 1IVXA 3RGAA 4STDA 1DVDA 2XR8B 3JUNA 1FA3A 1GSPA 5M19A 2P09A 1OF5B 3CCS3 1VQ73 5JBSA 3WA3A 4Q53A 1DYUA 1K41A 4HVNA 1QALA 2XEPA 1A2VA 3X40A 5HOHA 3WOEB 2IYJA 1B27A 3T0UA 1EQKA 1GOYA 3NM2A 3PGBA 4HM0B 4MJDA 4KVHA 4NREA 8RNTA 1S5AA 1O7WB 1KSIA 1BOXA 1I2GA 3WMDA 1SARA 2GU3A 3B8LA 3WOFB 3SVAA 4FCZA 2OOVA 1WNHA 3MKIA 1K28A 4CPKA 5AEWB 1I0XA 3NQYA 2XGNA
chains in the Genus database with same CATH topology
2XFSA 1PFPA 4OUQA 2RCDA 3HZPA 3EHCA 3CD63 8CHOA 2W2CA 2FNQA 1T5YA 1IVVA 1CEWI 1LNHA 2JQ5A 1YGEA 3NXJA 2XGLA 3X3YA 2XF3A 5KP3A 1VQO3 2GXFA 4L8OA 3QRDA 1K734 2I9WA 3CC73 4IPBA 1K9M4 1BUQA 1TFKA 3BNEA 2SBLA 2P38A 1VQM3 2XFTA 1NJI4 4R9KA 2BHMA 3PCSA 5LC6A 1U8CB 7STDA 3CME3 2LQVA 5AIIA 2IMJA 5D83A 3JVCA 2GEXA 3Q1CA 4MMYB 1FGRA 1VQN3 2ML6A 1OGZA 1WMPA 1KC84 2CC3A 1OHPA 4RNZA 3CCJ3 4R9LA 2D42A 1Q864 3I0YA 3NQZA 3MPHA 4LSOA 2UX0A 5D82A 4CCVA 1M9GA 2CFDA 1N8R4 1W4NA 3CCV3 2XH9A 3DM8A 3F8XA 3S28A 3X42A 3OX9A 3DGMA 1N9EA 2B1XB 2ZL8A 3KN4A 2WGQA 3F7SA 1GD3A 3K9MC 1N8QA 3NX0A 3J7Yd 1OHOA 4RZMA 1JV2B 1SJWA 3UJMA 3V92A 4HM4B 1QMAA 2V1LA 4R80A 3SXXA 1W5ZA 2CH9A 5IG5A 1DVDA 4H3UA 1SPUA 1N5PA 1UI7A 4U13A 3N8BA 3DUKA 1L5GB 2W6JH 2Y73A 5TGNA 2QA43 1AR0A 2BT3A 1RN7A 1OACA 1WTHA 5A0OB 5CLKA 3EX9A 1LXEA 1IT8A 2XRXB 3D3LA 1DVCA 1N9JA 4N6MA 3T8NA 1IT7A 3IMAB 3Q90A 3LH4A 4KFEA 3K63A 3DZLA 4EYCA 3RGRA 1O7HB 5CF1A 4QWTA 4IIAA 3LTCA 1UUWB 1JRQA 2FGTA 5AIHA 1NDOB 1IVWA 3GRDA 1JN5B 1EA2A 2P0XA 4HM8B 1EKMA 3LXUX 3NBRA 4O02B 1HKXA 1IV9A 2WGOA 1HU9A 3CCM3 1A67A 2R4IA 3MHEA 1M1XB 1W01A 5DREA 3WODG 1UI8A 2Z7AA 5IENA 3F8HA 2E2TA 4XM4A 3LTDA 6STDA 1WMNA 5STDA 4AKYA 4EV5A 1S723 2P0MA 3L0RA 3LT8A 2GEYA 2E2VA 4LZIA 3GZBA 1VQL3 3V99A 1VQ53 1UUVB 1GY6A 3I553 3LOYA 1ASKA 3EB8A 1JN5A 1Q40B 2K54A 3NV0B 2GBXB 3MG1A 3M8CA 2CKFB 1JJ22 3OXAA 4HM6B 1YIT3 4HKVB 1YJN3 2KXGA 1JB5A 3NM7A 1DMQA 4N3VA 4FMCA 3EBTA 3AMOB 4OK0A 2GBWB 2Y74A 4KZ1A 3SOAA 1KWIA 2HMLB 1WMOA 2HMNB 3DGNA 5AIGA 4MMZB 1Q42A 1NO3A 3FG3A 4HM5B 3QK9A 3NV0A 3H51A 5CK6A 1M904 3CXC2 1OCVA 1OF5A 1STDA 2B24B 1IQXA 3CPOA 3EN8A 4MMXB 3CC43 2L4VA 3MG2A 3X3XA 2BNGA 3A76A 4LGQA 4X2HA 1A90A 4EC6A 3CPW2 1JB2A 4BTYA 1GS3A 1STFI 3AMOA 4XBTA 1JNQA 4KFFA 1A2KA 4L7KA 3I563 3S5CA 3GZYB 3KE7A 4XB5A 3IPTA 2CG1A 2E2UA 3S29A 1FGOA 1WQLB 1ISKA 5EVHA 2Z76A 1SIIA 2IA7A 2INXA 2ZDJA 3EQQB 3WDGB 4PEJA 1ULJB 3BNBA 3CU3A 4K61A 1YI23 3F7XA 1G96A 1RRLA 1AVLA 2YFLB 3CNXA 3LYGA 3CCE3 1VQK3 3HK4A 3SLUA 1W2ZA 1Y4KA 5IEOA 1KD14 3JUOA 1E97A 4K1UA 1GY7A 1LOXA 3FCSB 2IUJA 3U97A 2K0MA 3OWYA 2RSXA 4EXRA 3PZWA 3BLZA 2KCDA 1TU5A 3DXOA 1O7NB 1TIJA 2OQEC 3CMA3 1VZZA 4J8TA 5IEPA 3OV4A 3EC9A 4FMBA 1VQ63 1OPYA 1W7CA 2CFWA 2W56B 3HIGA 1IK3A 1M1K4 3F40A 1IQ8A 1W6CA 4KFDA 1VQ43 3STDA 2KRTA 4WHAA 2FXTA 4N6LA 4ORLA 5CF2A 5G2GA 3FKAA 2F98A 1DMNA 1CQSA 2PZVA 4GL6A 1O7GB 1R4CA 1MOLA 4HZBB 1Q7Y4 3H3HA 3NUVA 1D6ZA 2YFIB 3NHXA 2CIUA 2OTL3 3CNMA 3NBBA 3VSYA 1W6YA 2C10A 2QIYA 4WYKB 1OGXA 1TFOA 2WO0A 2OWPA 1JB4A 1NB3I 2C11A 3CC23 3CCU3 1YJ93 5JPUA 2OOVC 3OW22 1FGQA 3PS8A 1YIJ3 3G8ZA 1VQ93 3V98A 3EE1A 3FG1A 1OH0A 1W6GA 3MWZA 1Z1SA 4AKZA 4CDLA 1RRHA 3DY5A 3LTAA 1CYUA 1U5OA 4EBGA 4N6V0 2P05A 2HMOB 3MYTA 3FGYA 1VQ83 4HM1B 4O8SA 5AYSC 3FF2A 4HJLB 2O3OA 4HZ9B 5FGOA 5JPPA 1AVKA 5IERA 3K0ZA 2W9PA 1ZO2A 4JRFA 4O3VA 1RKYA 1TUHA 4HM2B 5CXOA 4EV2A 3GWRA 4TX4A 1YVBI 2Z6BA 3F14A 2CW9A 3FZWA 1VQP3 2OQEA 1US1A 2CHCA 2Q07A 1DMMA 1J2BA 3LTBA 2QEX3 2BO9B 2OCTA 1O7PB 3K7CA 3DMCA 1NU3A 5HGRA 3X3ZA 3ECFA 3OWUA 2BMQB 3O8YA 1IU7A 2STDA 3PYJA 3T8UA 2Z77A 1IQYA 5I97A 1N5HA 3DGLA 1ROAA 3DGOA 3KZTA 3ALAA 1QVF2 1PU4A 5IG0A 3FF0A 3WA2X 5FW5A 2HMMB 3KFQC 1Q40A 2CFGA 3VGNA 2OTJ3 3JUMA 3GAXA 4L8PA 4RBNA 4XDWA 5EEOA 1FUWA 1K8A4 1NB5I 2W9QA 3GZRA 2D1WA 3KSED 3X41A 1F8NA 5AI1A 2MF7A 3KIIA 4GB5A 3FG4A 1YJW3 1FGTA 5ELUA 5ELJA 1SIHA 1EG9B 3EF8A 5AIFA 4J9AA 4N6NB 2A15A 2RGQA 4I4KA 3SOYA 1FGMA 4N6TA 4XDVA 3G4S3 4HYZA 1IV7A 2IUKA 1W00A 2WOHA 4BTXA 3B7CA 1QVG2 3NBJA 2W0QA 2ML5A 2BMOB 2CWVA 1NWWA 4HM3B 1GYBA 4K1VA 4FR9A 4X2OA 3EJVA 4ZM8A 5BXQA 4R4KA 2GU1A 2CG0A 3IJEB 3UB1A 3JUQA 3Q2PA 3TDGA 2CWTA 4HM7B 4XBYA 1IVUA 3N9HA 3HI7A 3PXMA 1C7HA 2YX9A 4FMDA 4WWUC 2JDIH 1GD4A 4N6OB 4MEIA 4R1KA 1SQWA 3FH1A 2HMKB 4AEQA 2F86B 2CFLA 5IF6A 3BNCA 4HBRA 2F99A 4IT7A 1IDPA 5LC7A 2W03A 5AYRB 3MSOA 3ROBA 2WOFA 3FLJA 5D81A 3UNLA 3SEDA 3RDEA 3CCR3 3G16A 1QAFA 5KP1A 1CYVA 1E3VA 3BB9A 3HX8A 2W56A 3CCL3 2CK3H 4JF8A 5KP4A 3UL6A 3UL5A 4LMIA 4XBXA 1AV4A 5BVBA 2M7OA 3G713 1QJGA 3CCQ3 5IW9A 3KKGA 3LT9A 2MC8A 3S67A 4FCJA 2CWUA 1W02A 1D6UA 1LVNA 1YHQ3 2XSOB 1Q814 1D6YA 1OHSA 3EN1B 4H61A 1GY5A 1TP6A 3K5TA 3U1WA 3F9SA 4BTWA 1QAKA 3PCRA 1MNLA 2CFKA 3E99A 1Q824 1OUNA 1O7MB 5EQLA 3B4OA 4WYKA 2PNCA 3S27A 3B4PA 3G0KA 2BMRB 1W2B2 3VF1A 1JKGB 2XSHB 4K90B 1KQS2 1ULIB 1UW1A 1V74A 4O2HA 4OVMA 4FCMA 1E3RA 3G6E3 2LYXA 4N6UA 4NHFA 3OWSA 3HIIA 3SX1A 4FMAA 4WP5A 4WFOA 3JUPA 1RJOA 1ZX2A 5DRVA 3GZXB 5IG3A 4G1MB 4LEHA 3BNDA 2RFRA 5IG4A 2QGUA 3LZAA 3FSDA 3MG3A 2YFJB 1ROVA 3EBYA 4RNYA 3D9RA 3KSPA 2HMJB 2O9UX 2W04A 5AEUB 1JKGA 3ER7A 3N54B 3LMLA 1IVXA 3RGAA 4STDA 2XR8B 3JUNA 1FA3A 2P09A 1OF5B 3CCS3 1VQ73 5JBSA 3WA3A 4Q53A 1DYUA 1K41A 4HVNA 1QALA 2XEPA 1A2VA 3X40A 3WOEB 3T0UA 1EQKA 3NM2A 3PGBA 4HM0B 4MJDA 4KVHA 4NREA 1S5AA 1O7WB 1KSIA 3WMDA 2GU3A 3B8LA 3WOFB 3SVAA 4FCZA 2OOVA 1WNHA 3MKIA 1K28A 5AEWB 3NQYA 2XGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFP A;  1NB3 I;  3PXM A;  1CEW I;  3PS8 A;  1GD4 A;  4N6O B;  3QRD A;  3MWZ A;  2KXG A;  4IT7 A;  5LC7 A;  1CYU A;  4N6V 0;  1CYV A;  1KWI A;  5LC6 A;  3UL6 A;  3UL5 A;  2W9P A;  4TX4 A;  1YVB I;  3S67 A;  1A90 A;  2BO9 B;  2OCT A;  1STF I;  4CCV A;  1M9G A;  3PYJ A;  1MNL A;  5EQL A;  1N5H A;  1ROA A;  1GD3 A;  3K9M C;  3NX0 A;  3KFQ C;  1G96 A;  1DVD A;  2CH9 A;  3GAX A;  1N5P A;  4N6U A;  1FUW A;  1NB5 I;  2W9Q A;  1RN7 A;  5A0O B;  3KSE D;  1LXE A;  5ELU A;  1DVC A;  1N9J A;  4N6M A;  5ELJ A;  3IMA B;  1TIJ A;  3LH4 A;  4N6N B;  2O9U X;  4EYC A;  4N6T A;  4N6L A;  1FA3 A;  1IV7 A;  1IV9 A;  1A67 A;  1R4C A;  1MOL A;  1EQK A;  4ZM8 A;  3SVA A;  1WNH A;  3Q2P A;  3L0R A;  4LZI A; 
#chains in the Genus database with same CATH topology
 2CX0 A;  2XFS A;  1PFP A;  4OUQ A;  2RCD A;  3HZP A;  3DGY A;  3EHC A;  3CD6 3;  8CHO A;  2W2C A;  2FNQ A;  1T5Y A;  1IVV A;  1CEW I;  1LNH A;  2JQ5 A;  1YGE A;  1B2Z A;  1MGR A;  2XGL A;  3AGN A;  2XF3 A;  3NXJ A;  5KP3 A;  3X3Y A;  1VQO 3;  1PY3 A;  2GXF A;  2IY2 A;  7RNT A;  4L8O A;  3QRD A;  1K73 4;  2I9W A;  3CC7 3;  4IPB A;  1BRG A;  1K9M 4;  1RN1 A;  1BUQ A;  1TFK A;  3BNE A;  2SBL A;  2P38 A;  1VQM 3;  2XFT A;  1NJI 4;  1X1U A;  4R9K A;  2BHM A;  2F5M A;  3PCS A;  5LC6 A;  1U8C B;  7STD A;  4ILF A;  3CME 3;  2LQV A;  5AII A;  1ZGX A;  2IMJ A;  1JBS A;  5D83 A;  3JVC A;  2GEX A;  3Q1C A;  4MMY B;  1FGR A;  1VQN 3;  2ML6 A;  1OGZ A;  1WMP A;  2GSP A;  1KC8 4;  2CC3 A;  1OHP A;  4RNZ A;  3CCJ 3;  3D79 A;  4R9L A;  2D42 A;  9RNT A;  1Q86 4;  3I0Y A;  1UDI I;  1FZU A;  3MPH A;  2UX0 A;  3NQZ A;  4LSO A;  5D82 A;  4CCV A;  1M9G A;  1ZS7 A;  2CFD A;  1W4N A;  1N8R 4;  3CCV 3;  2XH9 A;  4HOH A;  3A5E A;  3DM8 A;  3F8X A;  3S28 A;  3X42 A;  1BSD A;  1LRA A;  3OX9 A;  3DGM A;  1N9E A;  2B1X B;  2ZL8 A;  3KN4 A;  2WGQ A;  3F7S A;  1GD3 A;  2SAR A;  3K9M C;  1N8Q A;  1EEJ A;  3NX0 A;  4EW5 A;  3J7Y d;  1OHO A;  4RZM A;  1JV2 B;  1SJW A;  3UJM A;  3V92 A;  4HM4 B;  1QMA A;  2V1L A;  4R80 A;  3SXX A;  1W5Z A;  2CH9 A;  5IG5 A;  5RNT A;  1BUJ A;  4H3U A;  1SPU A;  1N5P A;  1UI7 A;  4U13 A;  3N8B A;  3DUK A;  1L5G B;  1RGG A;  2W6J H;  2Y73 A;  5TGN A;  2QA4 3;  1AR0 A;  1Q7H A;  1TRP A;  2BT3 A;  1RN7 A;  1OAC A;  1WTH A;  2KF4 A;  5A0O B;  5CLK A;  3EX9 A;  1LXE A;  1IT8 A;  2XRX B;  3D3L A;  1DVC A;  1N9J A;  4N6M A;  3T8N A;  1IT7 A;  3IMA B;  3Q90 A;  1RNT A;  3D5G A;  3LH4 A;  4KFE A;  3K63 A;  1UCI A;  3DZL A;  4EYC A;  3RGR A;  1MWT A;  1O7H B;  5CF1 A;  4QWT A;  4IIA A;  3ZG5 A;  3LTC A;  1LQG C;  1UUW B;  2ZHX B;  1CH0 A;  1JRQ A;  2FGT A;  1FW7 A;  5AIH A;  1NDO B;  1IVW A;  3GRD A;  1JN5 B;  1V58 A;  1EA2 A;  2P0X A;  4HM8 B;  1EKM A;  3LXU X;  3NBR A;  1BNI A;  1HKX A;  1LOV A;  1IV9 A;  1LNI A;  1HU9 A;  2CX1 A;  1BRI A;  2WGO A;  3CCM 3;  2R4I A;  3MHE A;  1M1X B;  1W01 A;  5DRE A;  1A67 A;  3WOD G;  1UI8 A;  2Z7A A;  3WR2 A;  5IEN A;  3F8H A;  1BSA A;  2E2T A;  4XM4 A;  1RHL A;  3LTD A;  4HAA A;  2BIR A;  1I8V A;  6STD A;  1WMN A;  5STD A;  3AHS A;  3D5I A;  4AKY A;  4EV5 A;  1S72 3;  2P0M A;  3L0R A;  3LT8 A;  2E2V A;  2GEY A;  4LZI A;  3GZB A;  1VQL 3;  1UCJ A;  3V99 A;  1VQ5 3;  1UUV B;  1GY6 A;  3I55 3;  1RCK A;  1X1Y A;  1ASK A;  3EB8 A;  3LOY A;  1JN5 A;  1Q40 B;  2K54 A;  3NV0 B;  2GBX B;  3MG1 A;  3M8C A;  2CKF B;  1JJ2 2;  3OXA A;  1RN4 A;  4HM6 B;  1YIT 3;  1GMR A;  4HKV B;  1YJN 3;  1VQQ A;  1RTU A;  1BRS A;  2KXG A;  1JB5 A;  3NM7 A;  1DMQ A;  4N3V A;  1BNG A;  4FMC A;  1X1X A;  3EBT A;  3AMO B;  1I70 A;  4OK0 A;  4BIR A;  1JZD A;  3URP A;  2GBW B;  2Y74 A;  4KZ1 A;  3SOA A;  1LOW A;  1Q9E A;  1BNS A;  1KWI A;  1WMO A;  2HML B;  2HMN B;  3DGN A;  5AIG A;  4MMZ B;  4RNT A;  2RNT A;  1Q42 A;  1NO3 A;  3FG3 A;  4HM5 B;  3QK9 A;  3NV0 A;  3H51 A;  1TTO A;  5CK6 A;  1M90 4;  3CXC 2;  1OCV A;  1BNF A;  1OF5 A;  1STD A;  1IQX A;  2B24 B;  1I3F A;  3CPO A;  3EN8 A;  2L4V A;  4MMX B;  3MG2 A;  1HYF A;  2BNG A;  3X3X A;  3CC4 3;  3A76 A;  1JBT A;  4LGQ A;  4LYL B;  4X2H A;  1MWU A;  3BIR A;  1A90 A;  1B20 A;  4EC6 A;  3CPW 2;  1JB2 A;  1DE3 A;  4BTY A;  1GS3 A;  1STF I;  3AMO A;  1RGL A;  1JNQ A;  2KF5 A;  1GMQ A;  1A2K A;  4J5G A;  4KFF A;  4L7K A;  4XBT A;  3S5C A;  3I56 3;  3GZY B;  3KE7 A;  4XB5 A;  3IPT A;  2CG1 A;  2E2U A;  3S29 A;  1FGO A;  1WQL B;  1ISK A;  5EVH A;  2Z76 A;  1SII A;  2IA7 A;  2INX A;  2ZDJ A;  3EQQ B;  3WDG B;  4PEJ A;  1ULJ B;  3BNB A;  3CU3 A;  4K61 A;  1YI2 3;  3F7X A;  1G96 A;  1RRL A;  2H0I A;  1YVS A;  7GSP A;  1AVL A;  2YFL B;  3CNX A;  1FUS A;  3LYG A;  3CCE 3;  1VQK 3;  3HK4 A;  3SLU A;  1W2Z A;  1Y4K A;  5IEO A;  1KD1 4;  3JUO A;  1E97 A;  4K1U A;  1GY7 A;  1LOX A;  3FCS B;  2IUJ A;  3U97 A;  1I3I A;  2K0M A;  3OWY A;  2RSX A;  4EXR A;  3PZW A;  3BLZ A;  2KCD A;  1TU5 A;  3DXO A;  1O7N B;  1TIJ A;  1I2F A;  2OQE C;  1BRH A;  3CMA 3;  1VZZ A;  1UCL A;  4J8T A;  5IEP A;  3OV4 A;  3EC9 A;  4FMB A;  1VQ6 3;  1OPY A;  1BRN L;  1G0T A;  1W7C A;  2CFW A;  2W56 B;  2J8X B;  3HIG A;  3F40 A;  1IQ8 A;  1W6C A;  4KFD A;  1VQ4 3;  3STD A;  2KRT A;  4WHA A;  1IYY A;  2FXT A;  4N6L A;  4ORL A;  5CF2 A;  5G2G A;  3FKA A;  1GOU A;  1C54 A;  1MWR A;  5BIR A;  5M1A A;  2F98 A;  1DMN A;  1CQS A;  2PZV A;  4GL6 A;  1RSN A;  4BL2 A;  1O7G B;  1R4C A;  1MOL A;  4HZB B;  1Q7Y 4;  3H3H A;  1BSB A;  3NUV A;  3D4A A;  1D6Z A;  2YFI B;  3NHX A;  2CIU A;  3ZG0 A;  2OTL 3;  1LOY A;  1RMS A;  1JZO A;  3CNM A;  5GSP A;  6GSP A;  1BSE A;  3NBB A;  3VSY A;  1W6Y A;  2C10 A;  4DKI A;  3AGO A;  2QIY A;  4WYK B;  4CJN A;  1OGX A;  1TFO A;  2WO0 A;  1BNJ A;  2OWP A;  1R4Y A;  1JB4 A;  2K3D A;  1NB3 I;  2H0G A;  2C11 A;  3CC2 3;  3CCU 3;  1YJ9 3;  5JPU A;  2OOV C;  3OW2 2;  1RLS A;  1FGQ A;  3PS8 A;  1YIJ 3;  6RNT A;  1BIR A;  3G8Z A;  1VQ9 3;  3V98 A;  3EE1 A;  3FG1 A;  1OH0 A;  1W6G A;  3MWZ A;  1Z1S A;  4AKZ A;  4CDL A;  1RRH A;  3DY5 A;  3LTA A;  1G02 A;  1CYU A;  1U5O A;  4EBG A;  1BRK A;  2KF3 A;  2P05 A;  2HMO B;  3MYT A;  4N6V 0;  4BL3 A;  3FGY A;  1AQZ A;  1VQ8 3;  4HM1 B;  4O8S A;  5AYS C;  4GHO A;  3FF2 A;  4HJL B;  1TJD A;  2O3O A;  4HZ9 B;  5FGO A;  3WHO A;  5JPP A;  1AVK A;  2KAA A;  3K0Z A;  2W9P A;  5IER A;  1ZO2 A;  4JRF A;  4O3V A;  1UCK A;  1TUH A;  4HM2 B;  5CXO A;  4EV2 A;  5BU4 A;  1RKY A;  3GWR A;  4TX4 A;  1UUG B;  1BRJ A;  1YVB I;  2Z6B A;  3F14 A;  4KT3 B;  2CW9 A;  3FZW A;  1VQP 3;  2OQE A;  1US1 A;  2CHC A;  4I5Q A;  2Q07 A;  1DMM A;  1J2B A;  1LQM B;  3LTB A;  2QEX 3;  2BO9 B;  2OCT A;  1O7P B;  3K7C A;  3DMC A;  1NU3 A;  5HGR A;  3X3Z A;  1V57 A;  3ECF A;  3OWU A;  2BMQ B;  3O8Y A;  1IU7 A;  2STD A;  3PYJ A;  3T8U A;  2Z77 A;  1I0V A;  1IQY A;  5I97 A;  1BSC A;  1B2S A;  1N5H A;  1RGE A;  1RGC A;  3DGL A;  1ROA A;  2AAE A;  1HZ1 A;  3DGO A;  3KZT A;  1B3S A;  3ALA A;  1QVF 2;  2H0H A;  1PU4 A;  5IG0 A;  1MWS A;  3FF0 A;  1RGH A;  3WA2 X;  1M1K 4;  5FW5 A;  2HMM B;  3KFQ C;  1Q40 A;  2CFG A;  3VGN A;  2OTJ 3;  3JUM A;  3GAX A;  4L8P A;  4RBN A;  4XDW A;  5EEO A;  1FUW A;  1PYL A;  1K8A 4;  1NB5 I;  2W9Q A;  3GZR A;  2D1W A;  1GOV A;  3KSE D;  3X41 A;  1F8N A;  5AI1 A;  2MF7 A;  1FUT A;  3KII A;  4GB5 A;  3FG4 A;  1BU4 A;  1YJW 3;  1FGT A;  3DH2 A;  5ELU A;  1BNE A;  1X1W A;  5ELJ A;  1SIH A;  1EG9 B;  3EF8 A;  5AIF A;  4J9A A;  4N6N B;  1GMP A;  2A15 A;  2RGQ A;  4I4K A;  1B2M A;  3BU4 A;  3SOY A;  3HOH A;  1FGM A;  4N6T A;  4XDV A;  3ZFZ A;  3G4S 3;  4HYZ A;  1JBR A;  1IV7 A;  2IUK A;  1W00 A;  2UGI A;  2WOH A;  1T2H A;  2ZA4 A;  4BTX A;  3B7C A;  2UUG C;  1QVG 2;  3NBJ A;  5M18 A;  2W0Q A;  2ML5 A;  2BMO B;  2CWV A;  1NWW A;  4HM3 B;  3AHW A;  2F4Y A;  2KF6 A;  1GYB A;  1T3B A;  4K1V A;  4FR9 A;  4X2O A;  3EJV A;  4ZM8 A;  5BXQ A;  4R4K A;  2GU1 A;  2CG0 A;  1RDS A;  3IJE B;  3UB1 A;  3JUQ A;  1B2X A;  3Q2P A;  3TDG A;  2CWT A;  3GSP A;  4HM7 B;  3KCH A;  4XBY A;  1NNV A;  1IVU A;  3N9H A;  1RNB A;  3HI7 A;  1IK3 A;  3PXM A;  1C7H A;  2YX9 A;  4FMD A;  1B21 A;  4WWU C;  1RGF A;  1BGS A;  2JDI H;  1GD4 A;  4N6O B;  1YGW A;  4MEI A;  4R1K A;  1SQW A;  3FH1 A;  2HMK B;  4AEQ A;  2F86 B;  2CFL A;  5IF6 A;  3BNC A;  4HBR A;  1YNV X;  4J5K A;  2F99 A;  4IT7 A;  1IDP A;  1FYS A;  5LC7 A;  4BU4 A;  2W03 A;  5AYR B;  2RBI A;  3MSO A;  3ROB A;  1BAO A;  2WOF A;  3FLJ A;  5D81 A;  3UNL A;  3SED A;  3RDE A;  3CCR 3;  3G16 A;  1QAF A;  5KP1 A;  1CYV A;  1E3V A;  2R41 A;  3BB9 A;  3HX8 A;  2BU4 A;  4O02 B;  2W56 A;  3CCL 3;  1I2E A;  2CK3 H;  4JF8 A;  5KP4 A;  3Q3F A;  3UL6 A;  3UL5 A;  4LMI A;  4XBX A;  1AV4 A;  5BVB A;  1RGK A;  2M7O A;  3G71 3;  1QJG A;  1MGW A;  2F56 A;  3CCQ 3;  3RNT A;  5IW9 A;  3KKG A;  3LT9 A;  2MC8 A;  3S67 A;  4FCJ A;  2CWU A;  4GSP A;  1W02 A;  1D6U A;  1LVN A;  1YHQ 3;  2XSO B;  1RGA A;  1Q81 4;  1EUI C;  1D6Y A;  1OHS A;  3EN1 B;  4H61 A;  2HOH A;  1GY5 A;  1TP6 A;  3K5T A;  1AY7 A;  3U1W A;  5G1L A;  1RCL A;  3F9S A;  4BTW A;  1QAK A;  1BAN A;  1MNL A;  2CFK A;  3PCR A;  1UGI A;  3E99 A;  1Q82 4;  1OUN A;  1O7M B;  5EQL A;  3B4O A;  4WYK A;  1DET A;  2PNC A;  3S27 A;  3B4P A;  1BNR A;  2C4B A;  4NPB A;  3G0K A;  2AAD A;  2BMR B;  1W2B 2;  3VF1 A;  1JKG B;  2XSH B;  4K90 B;  3SYU A;  1KQS 2;  1ULI B;  1UW1 A;  1V74 A;  4O2H A;  4OVM A;  2F5W A;  4FCM A;  1E3R A;  3G6E 3;  2LYX A;  1A2P A;  4N6U A;  4NHF A;  3OWS A;  1B2U A;  1T2I A;  3HII A;  3SX1 A;  4FMA A;  4WP5 A;  4WFO A;  3JUP A;  1RJO A;  1ZX2 A;  1TRQ A;  5DRV A;  3GZX B;  5G1K A;  5IG3 A;  4G1M B;  4LEH A;  2L1S A;  3BND A;  2RFR A;  5IG4 A;  2QGU A;  3LZA A;  3FSD A;  3MG3 A;  2YFJ B;  1ROV A;  3EBY A;  4RNY A;  1BVI A;  3D9R A;  3KSP A;  2HMJ B;  2O9U X;  2W04 A;  5AEU B;  1JKG A;  1UGH I;  3ER7 A;  3N54 B;  3LML A;  1IVX A;  3RGA A;  4STD A;  1DVD A;  2XR8 B;  3JUN A;  1FA3 A;  1GSP A;  5M19 A;  2P09 A;  1OF5 B;  3CCS 3;  1VQ7 3;  5JBS A;  3WA3 A;  4Q53 A;  1DYU A;  1K41 A;  4HVN A;  1QAL A;  2XEP A;  1A2V A;  3X40 A;  5HOH A;  3WOE B;  2IYJ A;  1B27 A;  3T0U A;  1EQK A;  1GOY A;  3NM2 A;  3PGB A;  4HM0 B;  4MJD A;  4KVH A;  4NRE A;  8RNT A;  1S5A A;  1O7W B;  1KSI A;  1BOX A;  1I2G A;  3WMD A;  1SAR A;  2GU3 A;  3B8L A;  3WOF B;  3SVA A;  4FCZ A;  2OOV A;  1WNH A;  3MKI A;  1K28 A;  4CPK A;  5AEW B;  1I0X A;  3NQY A;  2XGN A; 
#chains in the Genus database with same CATH homology
 2XFS A;  1PFP A;  4OUQ A;  2RCD A;  3HZP A;  3EHC A;  3CD6 3;  8CHO A;  2W2C A;  2FNQ A;  1T5Y A;  1IVV A;  1CEW I;  1LNH A;  2JQ5 A;  1YGE A;  3NXJ A;  2XGL A;  3X3Y A;  2XF3 A;  5KP3 A;  1VQO 3;  2GXF A;  4L8O A;  3QRD A;  1K73 4;  2I9W A;  3CC7 3;  4IPB A;  1K9M 4;  1BUQ A;  1TFK A;  3BNE A;  2SBL A;  2P38 A;  1VQM 3;  2XFT A;  1NJI 4;  4R9K A;  2BHM A;  3PCS A;  5LC6 A;  1U8C B;  7STD A;  3CME 3;  2LQV A;  5AII A;  2IMJ A;  5D83 A;  3JVC A;  2GEX A;  3Q1C A;  4MMY B;  1FGR A;  1VQN 3;  2ML6 A;  1OGZ A;  1WMP A;  1KC8 4;  2CC3 A;  1OHP A;  4RNZ A;  3CCJ 3;  4R9L A;  2D42 A;  1Q86 4;  3I0Y A;  3NQZ A;  3MPH A;  4LSO A;  2UX0 A;  5D82 A;  4CCV A;  1M9G A;  2CFD A;  1N8R 4;  1W4N A;  3CCV 3;  2XH9 A;  3DM8 A;  3F8X A;  3S28 A;  3X42 A;  3OX9 A;  3DGM A;  1N9E A;  2B1X B;  2ZL8 A;  3KN4 A;  2WGQ A;  3F7S A;  1GD3 A;  3K9M C;  1N8Q A;  3NX0 A;  3J7Y d;  1OHO A;  4RZM A;  1JV2 B;  1SJW A;  3UJM A;  3V92 A;  4HM4 B;  1QMA A;  2V1L A;  4R80 A;  3SXX A;  1W5Z A;  2CH9 A;  5IG5 A;  1DVD A;  4H3U A;  1SPU A;  1N5P A;  1UI7 A;  4U13 A;  3N8B A;  3DUK A;  1L5G B;  2W6J H;  2Y73 A;  5TGN A;  2QA4 3;  1AR0 A;  2BT3 A;  1RN7 A;  1OAC A;  1WTH A;  5A0O B;  5CLK A;  3EX9 A;  1LXE A;  1IT8 A;  2XRX B;  3D3L A;  1DVC A;  1N9J A;  4N6M A;  3T8N A;  1IT7 A;  3IMA B;  3Q90 A;  3LH4 A;  4KFE A;  3K63 A;  3DZL A;  4EYC A;  3RGR A;  1O7H B;  5CF1 A;  4QWT A;  4IIA A;  3LTC A;  1UUW B;  1JRQ A;  2FGT A;  5AIH A;  1NDO B;  1IVW A;  3GRD A;  1JN5 B;  1EA2 A;  2P0X A;  4HM8 B;  1EKM A;  3LXU X;  3NBR A;  4O02 B;  1HKX A;  1IV9 A;  2WGO A;  1HU9 A;  3CCM 3;  1A67 A;  2R4I A;  3MHE A;  1M1X B;  1W01 A;  5DRE A;  3WOD G;  1UI8 A;  2Z7A A;  5IEN A;  3F8H A;  2E2T A;  4XM4 A;  3LTD A;  6STD A;  1WMN A;  5STD A;  4AKY A;  4EV5 A;  1S72 3;  2P0M A;  3L0R A;  3LT8 A;  2GEY A;  2E2V A;  4LZI A;  3GZB A;  1VQL 3;  3V99 A;  1VQ5 3;  1UUV B;  1GY6 A;  3I55 3;  3LOY A;  1ASK A;  3EB8 A;  1JN5 A;  1Q40 B;  2K54 A;  3NV0 B;  2GBX B;  3MG1 A;  3M8C A;  2CKF B;  1JJ2 2;  3OXA A;  4HM6 B;  1YIT 3;  4HKV B;  1YJN 3;  2KXG A;  1JB5 A;  3NM7 A;  1DMQ A;  4N3V A;  4FMC A;  3EBT A;  3AMO B;  4OK0 A;  2GBW B;  2Y74 A;  4KZ1 A;  3SOA A;  1KWI A;  2HML B;  1WMO A;  2HMN B;  3DGN A;  5AIG A;  4MMZ B;  1Q42 A;  1NO3 A;  3FG3 A;  4HM5 B;  3QK9 A;  3NV0 A;  3H51 A;  5CK6 A;  1M90 4;  3CXC 2;  1OCV A;  1OF5 A;  1STD A;  2B24 B;  1IQX A;  3CPO A;  3EN8 A;  4MMX B;  3CC4 3;  2L4V A;  3MG2 A;  3X3X A;  2BNG A;  3A76 A;  4LGQ A;  4X2H A;  1A90 A;  4EC6 A;  3CPW 2;  1JB2 A;  4BTY A;  1GS3 A;  1STF I;  3AMO A;  4XBT A;  1JNQ A;  4KFF A;  1A2K A;  4L7K A;  3I56 3;  3S5C A;  3GZY B;  3KE7 A;  4XB5 A;  3IPT A;  2CG1 A;  2E2U A;  3S29 A;  1FGO A;  1WQL B;  1ISK A;  5EVH A;  2Z76 A;  1SII A;  2IA7 A;  2INX A;  2ZDJ A;  3EQQ B;  3WDG B;  4PEJ A;  1ULJ B;  3BNB A;  3CU3 A;  4K61 A;  1YI2 3;  3F7X A;  1G96 A;  1RRL A;  1AVL A;  2YFL B;  3CNX A;  3LYG A;  3CCE 3;  1VQK 3;  3HK4 A;  3SLU A;  1W2Z A;  1Y4K A;  5IEO A;  1KD1 4;  3JUO A;  1E97 A;  4K1U A;  1GY7 A;  1LOX A;  3FCS B;  2IUJ A;  3U97 A;  2K0M A;  3OWY A;  2RSX A;  4EXR A;  3PZW A;  3BLZ A;  2KCD A;  1TU5 A;  3DXO A;  1O7N B;  1TIJ A;  2OQE C;  3CMA 3;  1VZZ A;  4J8T A;  5IEP A;  3OV4 A;  3EC9 A;  4FMB A;  1VQ6 3;  1OPY A;  1W7C A;  2CFW A;  2W56 B;  3HIG A;  1IK3 A;  1M1K 4;  3F40 A;  1IQ8 A;  1W6C A;  4KFD A;  1VQ4 3;  3STD A;  2KRT A;  4WHA A;  2FXT A;  4N6L A;  4ORL A;  5CF2 A;  5G2G A;  3FKA A;  2F98 A;  1DMN A;  1CQS A;  2PZV A;  4GL6 A;  1O7G B;  1R4C A;  1MOL A;  4HZB B;  1Q7Y 4;  3H3H A;  3NUV A;  1D6Z A;  2YFI B;  3NHX A;  2CIU A;  2OTL 3;  3CNM A;  3NBB A;  3VSY A;  1W6Y A;  2C10 A;  2QIY A;  4WYK B;  1OGX A;  1TFO A;  2WO0 A;  2OWP A;  1JB4 A;  1NB3 I;  2C11 A;  3CC2 3;  3CCU 3;  1YJ9 3;  5JPU A;  2OOV C;  3OW2 2;  1FGQ A;  3PS8 A;  1YIJ 3;  3G8Z A;  1VQ9 3;  3V98 A;  3EE1 A;  3FG1 A;  1OH0 A;  1W6G A;  3MWZ A;  1Z1S A;  4AKZ A;  4CDL A;  1RRH A;  3DY5 A;  3LTA A;  1CYU A;  1U5O A;  4EBG A;  4N6V 0;  2P05 A;  2HMO B;  3MYT A;  3FGY A;  1VQ8 3;  4HM1 B;  4O8S A;  5AYS C;  3FF2 A;  4HJL B;  2O3O A;  4HZ9 B;  5FGO A;  5JPP A;  1AVK A;  5IER A;  3K0Z A;  2W9P A;  1ZO2 A;  4JRF A;  4O3V A;  1RKY A;  1TUH A;  4HM2 B;  5CXO A;  4EV2 A;  3GWR A;  4TX4 A;  1YVB I;  2Z6B A;  3F14 A;  2CW9 A;  3FZW A;  1VQP 3;  2OQE A;  1US1 A;  2CHC A;  2Q07 A;  1DMM A;  1J2B A;  3LTB A;  2QEX 3;  2BO9 B;  2OCT A;  1O7P B;  3K7C A;  3DMC A;  1NU3 A;  5HGR A;  3X3Z A;  3ECF A;  3OWU A;  2BMQ B;  3O8Y A;  1IU7 A;  2STD A;  3PYJ A;  3T8U A;  2Z77 A;  1IQY A;  5I97 A;  1N5H A;  3DGL A;  1ROA A;  3DGO A;  3KZT A;  3ALA A;  1QVF 2;  1PU4 A;  5IG0 A;  3FF0 A;  3WA2 X;  5FW5 A;  2HMM B;  3KFQ C;  1Q40 A;  2CFG A;  3VGN A;  2OTJ 3;  3JUM A;  3GAX A;  4L8P A;  4RBN A;  4XDW A;  5EEO A;  1FUW A;  1K8A 4;  1NB5 I;  2W9Q A;  3GZR A;  2D1W A;  3KSE D;  3X41 A;  1F8N A;  5AI1 A;  2MF7 A;  3KII A;  4GB5 A;  3FG4 A;  1YJW 3;  1FGT A;  5ELU A;  5ELJ A;  1SIH A;  1EG9 B;  3EF8 A;  5AIF A;  4J9A A;  4N6N B;  2A15 A;  2RGQ A;  4I4K A;  3SOY A;  1FGM A;  4N6T A;  4XDV A;  3G4S 3;  4HYZ A;  1IV7 A;  2IUK A;  1W00 A;  2WOH A;  4BTX A;  3B7C A;  1QVG 2;  3NBJ A;  2W0Q A;  2ML5 A;  2BMO B;  2CWV A;  1NWW A;  4HM3 B;  1GYB A;  4K1V A;  4FR9 A;  4X2O A;  3EJV A;  4ZM8 A;  5BXQ A;  4R4K A;  2GU1 A;  2CG0 A;  3IJE B;  3UB1 A;  3JUQ A;  3Q2P A;  3TDG A;  2CWT A;  4HM7 B;  4XBY A;  1IVU A;  3N9H A;  3HI7 A;  3PXM A;  1C7H A;  2YX9 A;  4FMD A;  4WWU C;  2JDI H;  1GD4 A;  4N6O B;  4MEI A;  4R1K A;  1SQW A;  3FH1 A;  2HMK B;  4AEQ A;  2F86 B;  2CFL A;  5IF6 A;  3BNC A;  4HBR A;  2F99 A;  4IT7 A;  1IDP A;  5LC7 A;  2W03 A;  5AYR B;  3MSO A;  3ROB A;  2WOF A;  3FLJ A;  5D81 A;  3UNL A;  3SED A;  3RDE A;  3CCR 3;  3G16 A;  1QAF A;  5KP1 A;  1CYV A;  1E3V A;  3BB9 A;  3HX8 A;  2W56 A;  3CCL 3;  2CK3 H;  4JF8 A;  5KP4 A;  3UL6 A;  3UL5 A;  4LMI A;  4XBX A;  1AV4 A;  5BVB A;  2M7O A;  3G71 3;  1QJG A;  3CCQ 3;  5IW9 A;  3KKG A;  3LT9 A;  2MC8 A;  3S67 A;  4FCJ A;  2CWU A;  1W02 A;  1D6U A;  1LVN A;  1YHQ 3;  2XSO B;  1Q81 4;  1D6Y A;  1OHS A;  3EN1 B;  4H61 A;  1GY5 A;  1TP6 A;  3K5T A;  3U1W A;  3F9S A;  4BTW A;  1QAK A;  3PCR A;  1MNL A;  2CFK A;  3E99 A;  1Q82 4;  1OUN A;  1O7M B;  5EQL A;  3B4O A;  4WYK A;  2PNC A;  3S27 A;  3B4P A;  3G0K A;  2BMR B;  1W2B 2;  3VF1 A;  1JKG B;  2XSH B;  4K90 B;  1KQS 2;  1ULI B;  1UW1 A;  1V74 A;  4O2H A;  4OVM A;  4FCM A;  1E3R A;  3G6E 3;  2LYX A;  4N6U A;  4NHF A;  3OWS A;  3HII A;  3SX1 A;  4FMA A;  4WP5 A;  4WFO A;  3JUP A;  1RJO A;  1ZX2 A;  5DRV A;  3GZX B;  5IG3 A;  4G1M B;  4LEH A;  3BND A;  2RFR A;  5IG4 A;  2QGU A;  3LZA A;  3FSD A;  3MG3 A;  2YFJ B;  1ROV A;  3EBY A;  4RNY A;  3D9R A;  3KSP A;  2HMJ B;  2O9U X;  2W04 A;  5AEU B;  1JKG A;  3ER7 A;  3N54 B;  3LML A;  1IVX A;  3RGA A;  4STD A;  2XR8 B;  3JUN A;  1FA3 A;  2P09 A;  1OF5 B;  3CCS 3;  1VQ7 3;  5JBS A;  3WA3 A;  4Q53 A;  1DYU A;  1K41 A;  4HVN A;  1QAL A;  2XEP A;  1A2V A;  3X40 A;  3WOE B;  3T0U A;  1EQK A;  3NM2 A;  3PGB A;  4HM0 B;  4MJD A;  4KVH A;  4NRE A;  1S5A A;  1O7W B;  1KSI A;  3WMD A;  2GU3 A;  3B8L A;  3WOF B;  3SVA A;  4FCZ A;  2OOV A;  1WNH A;  3MKI A;  1K28 A;  5AEW B;  3NQY A;  2XGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...