1EQKA

Solution structure of oryzacystatin-i, a cysteine proteinase inhibitor of the rice, oryza sativa l. japonica
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
b'MSSDGGPVLGGVEPVGNENDLHLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPVDASANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORYZACYSTATIN-I
publication title Three-dimensional solution structure of oryzacystatin-I, a cysteine proteinase inhibitor of the rice, Oryza sativa L. japonica.
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase inhibitor
total genus 18
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2000-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1eqkA00
1ROAA 3KSED 1DVCA 1NB3I 1CYUA 4CCVA 3UL5A 4N6NB 3NX0A 1N5PA 1FA3A 4N6UA 1A67A 3PYJA 1KWIA 3IMAB 1IV7A 5LC6A 4TX4A 2W9QA 5LC7A 2W9PA 3K9MC 1CEWI 3S67A 1G96A 1A90A 4N6OB 1FUWA 4EYCA 1TIJA 1RN7A 3GAXA 3UL6A 5ELJA 1CYVA 5EQLA 2BO9B 2OCTA 1N9JA 3PXMA 1PFPA 3LH4A 1WNHA 3PS8A 3L0RA 4N6TA 1M9GA 1GD3A 4ZM8A 1EQKA 5ELUA 3SVAA 4N6MA 4N6LA 1YVBI 1N5HA 2KXGA 1R4CA 1GD4A 5A0OB 3KFQC 1DVDA 1NB5I 3Q2PA 4LZIA 1MNLA 2O9UX 2CH9A 4IT7A 1LXEA 1IV9A 3QRDA 1STFI 1MOLA 3MWZA 4N6V0
chains in the Genus database with same CATH superfamily
1ROAA 1BNSA 1JN5A 2E2UA 1YJ93 3G4S3 3Q90A 4PEJA 2BIRA 2IUKA 1K9M4 4AKZA 3I0YA 1B2UA 1FYSA 1DVCA 1UI8A 1Y4KA 2IY2A 3ALAA 1JRQA 4JRFA 2UGIA 5EVHA 5IW9A 1GY7A 3RGAA 4LGQA 2OQEA 1AQZA 1IVXA 1OF5A 2YX9A 3SOYA 1ULJB 5STDA 4J8TA 1O7HB 2LYXA 4HM6B 4RBNA 1QALA 1RN1A 2MC8A 3F8XA 1GOVA 4N6NB 1QVG2 1W6CA 2FGTA 3F7XA 2STDA 4K61A 2W56B 5AEUB 1OPYA 3SLUA 1Q814 1BSBA 1O7GB 3CXC2 3JUNA 1BUJA 4ORLA 5G1LA 2AAEA 2XF3A 3VSYA 1GY6A 1BNIA 1N5PA 3DGOA 4N6UA 3EQQB 1A67A 3TDGA 3GSPA 1JBTA 3PYJA 5GSPA 1F8NA 3URPA 1EKMA 2LQVA 3BNBA 3IMAB 5M18A 3FG4A 3T8UA 4EBGA 5LC6A 5BIRA 1Q40B 5I97A 3X3XA 1BNJA 4J9AA 2UX0A 4BL3A 3RGRA 4TX4A 2W9QA 1T3BA 3KE7A 5D83A 1BRNL 1I8VA 2J8XB 5CF2A 1N8R4 1FUTA 1VQN3 3PZWA 2CKFB 3K9MC 1K28A 4RZMA 1AVKA 1OHPA 3CNXA 4HBRA 3D4AA 3M8CA 1W2ZA 3KKGA 3V99A 2P0MA 1TFKA 1RGAA 3OV4A 1YIJ3 3CCQ3 1ASKA 1RSNA 4O8SA 2CK3H 2E2VA 5CF1A 1UUWB 2GU1A 3BU4A 2UUGC 3EB8A 1TIJA 1W02A 4LEHA 4EYCA 2GXFA 2OTJ3 4MMXB 1MWUA 3OWUA 3AGOA 3BIRA 8RNTA 3UL6A 1A2KA 2XRXB 2C11A 2CWVA 2WGQA 2HMOB 1EA2A 3PXMA 3OWSA 2KF5A 1RGHA 3DZLA 1RCKA 2D42A 4LYLB 2KF6A 3Q3FA 3UJMA 4KT3B 4XBYA 3L0RA 2BHMA 4L7KA 3RDEA 1MGWA 1KC84 3VGNA 4XM4A 3DH2A 4ZM8A 4WYKA 2W03A 3NV0A 1NJI4 1PU4A 1IT7A 2BMRB 2XEPA 5RNTA 1T2IA 1O7WB 2OWPA 4KVHA 3CC23 2CFGA 1BIRA 1TRPA 2W0QA 3KIIA 1ROVA 3NBBA 4KFFA 4N6LA 7GSPA 3EC9A 3N9HA 1YVBI 4GB5A 3MKIA 3FG3A 1LVNA 2HOHA 2IUJA 2KXGA 3K63A 1AVLA 2GEXA 1K8A4 1RTUA 1RRHA 8CHOA 5FGOA 2P38A 1HKXA 1VQ83 3HX8A 1TTOA 1TFOA 5AIIA 1BRIA 3FG1A 2CH9A 2P05A 2OTL3 1BRJA 3PCSA 2QA43 2Z76A 1DMNA 1LOYA 3JUOA 1STFI 1UUVB 3CCR3 4FMCA 4WWUC 1JB4A 3KCHA 1FGQA 5G1KA 1PYLA 4N6V0 2CIUA 1TRQA 3GZXB 1RGCA 1SARA 4R80A 1O7PB 3B4OA 3FLJA 1WQLB 1I2GA 1JBRA 4XBTA 1SPUA 3G8ZA 3QK9A 1HU9A 3WOEB 1VQ93 4R9LA 3D5GA 3CCU3 2OQEC 1OCVA 2H0IA 1B2XA 1S5AA 2ZHXB 1W00A 3NM7A 3NM2A 3SEDA 2H0GA 3LT8A 4LMIA 1O7MB 2CFKA 3KSED 3SX1A 2MF7A 3LOYA 3T0UA 5IF6A 3GRDA 3MHEA 2SARA 3BNCA 3UB1A 1EG9B 2Z6BA 3D79A 1DYUA 4CCVA 4N3VA 1IYYA 4H3UA 2W2CA 4EV5A 3LZAA 1ZGXA 1Q864 3DGLA 3HIGA 1UUGB 2BMOB 4WFOA 2E2TA 4MJDA 2HMLB 4X2OA 2YFLB 1GS3A 1LQGC 3EX9A 1IQYA 1M904 4HYZA 1MWTA 2K0MA 3F9SA 2F4YA 3BB9A 1V74A 1Q40A 1Q42A 3MPHA 2C10A 1RNBA 1IV7A 1SIIA 6GSPA 1BRKA 4RNYA 1Z1SA 3GWRA 4HOHA 3ECFA 4RNZA 3S27A 3OWYA 3Q1CA 3FZWA 1HYFA 2PZVA 1B27A 1SJWA 1JBSA 1M1K4 2CWUA 1LOVA 4R9KA 2ZL8A 3F7SA 1W2B2 1A2VA 4NREA 1DMMA 6RNTA 1UCIA 3EE1A 3JUPA 3S67A 2KF4A 1BOXA 1I3IA 3MG3A 1T2HA 1DMQA 1FGMA 3AHSA 3JVCA 4K90B 4HM4B 1X1UA 5D82A 3I563 1KD14 1UDII 1W4NA 4HKVB 3CU3A 1JKGA 4BIRA 3GAXA 7STDA 2GSPA 1LRAA 3EN1B 1BNFA 3WOFB 3KN4A 3OXAA 5EQLA 2OCTA 1N9JA 4O3VA 4IIAA 3DY5A 3FH1A 3JUQA 4XDWA 1Q824 1WMOA 3DGNA 3GZRA 3PS8A 3MG1A 1HZ1A 3D9RA 1IQXA 1RGKA 2ML5A 2R41A 1GD3A 1RRLA 3S29A 3K0ZA 1KSIA 5CXOA 2Z77A 1MWRA 2XGNA 1E3VA 2ZA4A 5DREA 1X1WA 3SYUA 1GYBA 1LOWA 5CK6A 1FGRA 4J5KA 7RNTA 1N8QA 4R4KA 4FMDA 2XFTA 4HM7B 1OH0A 4XBXA 4EC6A 4IPBA 1R4CA 3B4PA 1JN5B 1FZUA 1UGHI 2CFWA 4MMYB 5TGNA 3Q2PA 1NB5I 1M1XB 4LZIA 3LMLA 3UNLA 4OVMA 4CDLA 5IG0A 2O9UX 1K41A 1Q7HA 3U97A 1IVUA 1ZO2A 4AKYA 5IG3A 1US1A 1U8CB 2HMMB 2H0HA 3GZBA 4MEIA 4BTXA 4O2HA 4HM1B 1BRHA 2CG0A 3GZYB 3AMOB 5JPPA 3MWZA 1DE3A 5M19A 3CC73 1I0VA 3WODG 1UCKA 1BSDA 4FR9A 1GY5A 5IEPA 2RBIA 3NBRA 1A2PA 1CQSA 3CCL3 4EW5A 1UI7A 1T5YA 3EJVA 1JB5A 2D1WA 1YVSA 4K1UA 4HVNA 5IG5A 2CX0A 4K1VA 2OOVA 4H61A 2CX1A 1W6GA 1NB3I 2YFIB 4EV2A 1SIHA 1FGOA 1BSEA 1CYUA 1ULIB 3X3ZA 2AADA 4FCMA 1RDSA 1VQQA 4BL2A 3J7Yd 1YJW3 4FCZA 1RGFA 2GBWB 1EUIC 3A5EA 3FSDA 1X1YA 1U5OA 3NX0A 5KP1A 2RCDA 1RN4A 4Q53A 1FA3A 3RNTA 2QIYA 5BU4A 1K734 1V57A 1GOYA 2INXA 5AEWB 1GMPA 3ROBA 5EEOA 4WHAA 1I3FA 1BNEA 4L8OA 2WGOA 3A76A 1QAFA 3G713 1W7CA 4CJNA 2W9PA 2GBXB 3NBJA 2F56A 3MYTA 4KFEA 2BU4A 1DETA 4XB5A 1NDOB 1BRSA 2P09A 3HZPA 1B20A 3FF0A 3NV0B 3HI7A 4OK0A 2W56A 5AYSC 4O02B 2O3OA 4HM5B 1JB2A 1A90A 2R4IA 1IVVA 2JDIH 1ZX2A 3NUVA 3WR2A 3WDGB 5JBSA 5AI1A 3LTAA 2B1XB 2IA7A 4HJLB 1AR0A 1GSPA 4GSPA 1AV4A 1TUHA 4LSOA 2QGUA 3ZG5A 5JPUA 1VQM3 1MWSA 2RGQA 3CNMA 2BO9B 1VQ73 3KSPA 1RGLA 4HM2B 1TU5A 1PY3A 1PFPA 2KRTA 3LH4A 2RSXA 4G1MB 1S723 1ISKA 1WNHA 2IMJA 3I553 1LNHA 1OGZA 3V98A 1FW7A 1FUSA 3CD63 3H3HA 1MGRA 1EQKA 3X3YA 1NWWA 1JZOA 1OACA 3HK4A 3IJEB 2HMNB 1LOXA 4FMAA 4N6MA 1BANA 3EBTA 3HIIA 2XFSA 1KQS2 3X41A 3DM8A 1I2EA 1VZZA 1Q7Y4 3NQZA 3CCM3 1B2SA 1W01A 2CHCA 1UCLA 1RNTA 1YGEA 1YGWA 1GMRA 2KF3A 3PGBA 2C4BA 1VQ63 1YJN3 3HOHA 1YNVX 5A0OB 1GMQA 1B3SA 3KFQC 2K3DA 1W6YA 1WMPA 4EXRA 3E99A 1TP6A 1MNLA 3O8YA 3CCJ3 2BMQB 3B7CA 3DXOA 1JZDA 4WP5A 1BVIA 4KZ1A 5CLKA 1FGTA 3LYGA 1LXEA 2XGLA 4HZBB 1IV9A 3QRDA 1VQO3 2CC3A 5BXQA 3D5IA 3AMOA 1MOLA 2CG1A 3WA3A 1I0XA 3ER7A 4FCJA 2V1LA 2BT3A 3X40A 4BU4A 3NXJA 5M1AA 2OOVC 2Y73A 3BNDA 3DMCA 3WA2X 3LTBA 1B2ZA 2RFRA 2F86B 1LNIA 2F5WA 2XH9A 1W5ZA 3OX9A 5AIGA 3CMA3 1OUNA 3G0KA 3MSOA 3V92A 3LTCA 2WOHA 4HM3B 4NPBA 3G6E3 2GEYA 1BUQA 1BAOA 1VQK3 1RKYA 4XDVA 3KZTA 5KP4A 1OHOA 2HMJB 2CFLA 3UL5A 5AYRB 1RCLA 2F98A 4U13A 1QAKA 1I2FA 1OF5B 1VQL3 2CWTA 2L4VA 3BLZA 4NHFA 1TJDA 5DRVA 5IERA 1O7NB 1B2MA 1IU7A 1BU4A 1UCJA 1J2BA 2YFJB 1OHSA 1E97A 3EN8A 3N54B 1IVWA 6STDA 1G02A 1IDPA 3PCRA 3AGNA 1JKGB 3DGMA 1KWIA 3FF2A 5IENA 1RMSA 3F8HA 2PNCA 3LT9A 5IEOA 1ZS7A 3CCE3 4J5GA 3H51A 1N9EA 4AEQA 3CC43 5LC7A 4L8PA 1YI23 2CW9A 4I4KA 3CCS3 3U1WA 3SXXA 1CEWI 1BNRA 1RGGA 3FKAA 1BNGA 2JQ5A 2WOFA 5D81A 1OGXA 1WMNA 4CPKA 1V58A 1G96A 1LQMB 2FXTA 2ZDJA 1L5GB 3S5CA 5BVBA 4N6OB 5HOHA 2QEX3 1YHQ3 1BSCA 1RJOA 1JV2B 1FUWA 5G2GA 4DKIA 1RN7A 3FGYA 5KP3A 3K5TA 3AHWA 5ELJA 1D6UA 1G0TA 2Y74A 1CYVA 2CFDA 1VQ53 1AY7A 3DGYA 4X2HA 4HM8B 1VQ43 4R1KA 1YIT3 1E3RA 2HMKB 2IYJA 3SOAA 4ILFA 2W6JH 1GOUA 2B24B 3WHOA 3EHCA 5IG4A 4N6TA 1M9GA 1NU3A 3WMDA 3VF1A 1QVF2 2F99A 1RHLA 1RLSA 1BGSA 2P0XA 3F14A 3LTDA 5AIFA 9RNTA 5ELUA 3G16A 1JNQA 1STDA 3SVAA 2I9WA 1X1XA 2BNGA 4WYKB 4BTYA 2L1SA 4RNTA 1BSAA 4HAAA 2RNTA 3DUKA 2KCDA 3OW22 2XSHB 3CCV3 3ZG0A 1JJ22 3CPW2 4GL6A 1N5HA 2XR8B 3EF8A 2F5MA 4KFDA 5HGRA 1GD4A 1D6YA 1QJGA 2K54A 1UW1A 1DVDA 1EEJA 3D3LA 3CME3 4GHOA 1IT8A 1IQ8A 1R4YA 2KAAA 4OUQA 4HZ9B 3F40A 4HM0B 2ML6A 2Q07A 1D6ZA 2M7OA 1VQP3 2Z7AA 2A15A 2SBLA 3X42A 4MMZB 4BTWA 1I70A 4IT7A 4STDA 3IPTA 2XSOB 1NNVA 2GU3A 3MG2A 3LXUX 3N8BA 3B8LA 3FCSB 3NHXA 3K7CA 2WO0A 1C7HA 3ZFZA 1CH0A 3BNEA 3STDA 1B21A 4QWTA 1UGIA 3S28A 1IK3A 3EBYA 2FNQA 1RGEA 3NQYA 3JUMA 4I5QA 4JF8A 1BRGA 4FMBA 5AIHA 3T8NA 1NO3A 1QMAA 1SQWA 1WTHA 1C54A 5FW5A 1Q9EA 3CPOA 2W04A
chains in the Genus database with same CATH topology
1ROAA 1JN5A 2E2UA 1YJ93 3G4S3 3Q90A 4PEJA 2IUKA 1K9M4 4AKZA 3I0YA 1UI8A 1DVCA 4JRFA 1Y4KA 3ALAA 5EVHA 1JRQA 5IW9A 1GY7A 3RGAA 4LGQA 2OQEA 1IVXA 1OF5A 2YX9A 3SOYA 1ULJB 5STDA 4J8TA 1O7HB 2LYXA 4HM6B 4RBNA 1QALA 2MC8A 3F8XA 4N6NB 1QVG2 1W6CA 2FGTA 3F7XA 2STDA 4K61A 2W56B 5AEUB 1OPYA 3SLUA 1Q814 1O7GB 3CXC2 3JUNA 4ORLA 2XF3A 3VSYA 1GY6A 1N5PA 3DGOA 4N6UA 3EQQB 1A67A 3TDGA 3PYJA 1F8NA 1EKMA 2LQVA 3BNBA 3IMAB 3FG4A 3T8UA 4EBGA 5LC6A 1Q40B 5I97A 3X3XA 4J9AA 2UX0A 3RGRA 4TX4A 2W9QA 3KE7A 5D83A 5CF2A 1N8R4 1VQN3 3PZWA 2CKFB 3K9MC 1K28A 4RZMA 1AVKA 1OHPA 3CNXA 4HBRA 3M8CA 1W2ZA 3KKGA 3V99A 2P0MA 1TFKA 3OV4A 1YIJ3 3CCQ3 1ASKA 4O8SA 2CK3H 2E2VA 5CF1A 1UUWB 2GU1A 3EB8A 4EYCA 1TIJA 1W02A 4LEHA 2GXFA 2OTJ3 4MMXB 3OWUA 3UL6A 1A2KA 2XRXB 2C11A 2CWVA 2WGQA 2HMOB 1EA2A 3PXMA 3OWSA 3DZLA 2D42A 3UJMA 4XBYA 3L0RA 2BHMA 4L7KA 3RDEA 1KC84 3VGNA 4XM4A 4ZM8A 4WYKA 2W03A 3NV0A 1NJI4 1PU4A 1IT7A 2BMRB 2XEPA 1O7WB 2OWPA 4KVHA 3CC23 2CFGA 2W0QA 3KIIA 1ROVA 3NBBA 4KFFA 4N6LA 1QVF2 3EC9A 3N9HA 1YVBI 4GB5A 3MKIA 3FG3A 1LVNA 2IUJA 2KXGA 3K63A 1AVLA 2GEXA 1K8A4 1RRHA 8CHOA 5FGOA 2P38A 1HKXA 1VQ83 3HX8A 1TFOA 5AIIA 3FG1A 2CH9A 2P05A 2OTL3 3PCSA 2QA43 2Z76A 1DMNA 3JUOA 1STFI 1UUVB 3CCR3 4FMCA 4WWUC 1JB4A 1FGQA 4N6V0 2CIUA 3GZXB 4R80A 1O7PB 3B4OA 3FLJA 1WQLB 4XBTA 1SPUA 3G8ZA 3QK9A 1HU9A 3WOEB 1VQ93 4R9LA 3CCU3 2OQEC 1OCVA 1S5AA 3NM7A 3NM2A 1W00A 3SX1A 3SXXA 3SEDA 3LT8A 4LMIA 3T0UA 1O7MB 2CFKA 3KSED 2MF7A 3LOYA 5IF6A 3GRDA 3MHEA 3BNCA 3UB1A 1EG9B 2Z6BA 1DYUA 4CCVA 4N3VA 4H3UA 2W2CA 4EV5A 3LZAA 1Q864 3DGLA 3HIGA 2BMOB 4WFOA 2E2TA 4MJDA 2HMLB 4X2OA 2YFLB 1GS3A 3EX9A 1IQYA 1M904 4HYZA 2K0MA 3F9SA 3BB9A 1V74A 1Q40A 1Q42A 3MPHA 2C10A 1IV7A 1SIIA 4RNYA 1Z1SA 3GWRA 3ECFA 4RNZA 3S27A 3OWYA 3Q1CA 3FZWA 2PZVA 1SJWA 1M1K4 2CWUA 4R9KA 2ZL8A 3F7SA 1W2B2 1A2VA 4NREA 1DMMA 3EE1A 3JUPA 3S67A 3MG3A 1DMQA 1FGMA 3JVCA 4K90B 4HM4B 5D82A 3I563 1KD14 1W4NA 4HKVB 3CU3A 1JKGA 3GAXA 7STDA 3EN1B 3WOFB 3KN4A 3OXAA 5EQLA 2OCTA 1N9JA 4O3VA 4IIAA 3DY5A 3FH1A 3JUQA 4XDWA 1Q824 1WMOA 3DGNA 3GZRA 3PS8A 3MG1A 3D9RA 1IQXA 2ML5A 1GD3A 1RRLA 3S29A 3K0ZA 1KSIA 5CXOA 2Z77A 2XGNA 1E3VA 5DREA 1GYBA 5CK6A 1FGRA 1N8QA 4R4KA 4FMDA 2XFTA 4HM7B 1OH0A 4XBXA 4EC6A 4IPBA 1R4CA 3B4PA 1JN5B 2CFWA 4MMYB 5TGNA 3Q2PA 1NB5I 1M1XB 4LZIA 3LMLA 3UNLA 4OVMA 4CDLA 5IG0A 2O9UX 1K41A 3U97A 1IVUA 1ZO2A 4AKYA 5IG3A 1US1A 1U8CB 2HMMB 3GZBA 4MEIA 4BTXA 4O2HA 4HM1B 2CG0A 3GZYB 3AMOB 5JPPA 3MWZA 3CC73 3WODG 4FR9A 1GY5A 5IEPA 3CCL3 3NBRA 1CQSA 1UI7A 1T5YA 3EJVA 1JB5A 2D1WA 4K1UA 4HVNA 5IG5A 4K1VA 2OOVA 4H61A 1W6GA 1NB3I 2YFIB 4EV2A 1SIHA 1FGOA 1CYUA 1ULIB 3X3ZA 4FCMA 3J7Yd 1YJW3 4FCZA 2GBWB 3FSDA 3NX0A 1U5OA 5KP1A 2RCDA 4Q53A 1FA3A 2QIYA 1K734 2INXA 5AEWB 3ROBA 5EEOA 4WHAA 4L8OA 2WGOA 3A76A 1QAFA 3G713 1W7CA 2W9PA 2GBXB 3NBJA 3MYTA 4KFEA 4XB5A 1NDOB 2P09A 3HZPA 3FF0A 3NV0B 3HI7A 4OK0A 2W56A 5AYSC 4O02B 2O3OA 4HM5B 1JB2A 1A90A 2R4IA 1IVVA 2JDIH 1ZX2A 3NUVA 3WDGB 5JBSA 5AI1A 3LTAA 2B1XB 2IA7A 4HJLB 1AR0A 4LSOA 1AV4A 1TUHA 5JPUA 2QGUA 1VQM3 2RGQA 3CNMA 2BO9B 1VQ73 3KSPA 4HM2B 1TU5A 1PFPA 2KRTA 3LH4A 2RSXA 4G1MB 1S723 1ISKA 1WNHA 2IMJA 3I553 1LNHA 1OGZA 3V98A 3CD63 3H3HA 1EQKA 3X3YA 1NWWA 1OACA 3HK4A 3IJEB 2HMNB 1LOXA 4FMAA 4N6MA 3EBTA 3HIIA 2XFSA 1KQS2 3X41A 3DM8A 1VZZA 1Q7Y4 3NQZA 3CCM3 1W01A 2CHCA 1YGEA 3PGBA 1VQ63 1YJN3 5A0OB 3KFQC 1W6YA 1WMPA 4EXRA 3E99A 1TP6A 1MNLA 3O8YA 3CCJ3 2BMQB 3B7CA 3DXOA 4WP5A 5CLKA 4KZ1A 1FGTA 3LYGA 1LXEA 2XGLA 4HZBB 1IV9A 3QRDA 1VQO3 2CC3A 5BXQA 3AMOA 1MOLA 2CG1A 3WA3A 3ER7A 4FCJA 2V1LA 2BT3A 3X40A 3NXJA 2OOVC 2Y73A 3BNDA 3DMCA 3WA2X 3LTBA 2RFRA 3OX9A 2F86B 5AIGA 2XH9A 1W5ZA 3CMA3 1OUNA 3G0KA 3MSOA 3V92A 3LTCA 2WOHA 4HM3B 3G6E3 2GEYA 1BUQA 1VQK3 1RKYA 4XDVA 3KZTA 5KP4A 1OHOA 2HMJB 2CFLA 3UL5A 5AYRB 2F98A 4U13A 1QAKA 1OF5B 1VQL3 2CWTA 2L4VA 3BLZA 4NHFA 5DRVA 5IERA 1O7NB 1IU7A 1J2BA 2YFJB 1OHSA 1E97A 3EN8A 3N54B 1IVWA 6STDA 1IDPA 3PCRA 1JKGB 3DGMA 1KWIA 3FF2A 5IENA 3F8HA 2PNCA 3LT9A 5IEOA 3CCE3 3H51A 1N9EA 4AEQA 3CC43 5LC7A 4L8PA 1YI23 2CW9A 4I4KA 3CCS3 3U1WA 1CEWI 3FKAA 2JQ5A 2WOFA 5D81A 1OGXA 1WMNA 1G96A 2FXTA 1L5GB 2ZDJA 3S5CA 5BVBA 4N6OB 1YHQ3 2QEX3 1RJOA 1JV2B 1FUWA 5G2GA 1RN7A 3FGYA 5KP3A 3K5TA 5ELJA 1D6UA 2Y74A 1CYVA 2CFDA 1VQ53 4X2HA 4HM8B 1VQ43 4R1KA 1YIT3 1E3RA 2HMKB 3SOAA 2W6JH 2B24B 3EHCA 5IG4A 4N6TA 1M9GA 1NU3A 3WMDA 3VF1A 2F99A 3F14A 2P0XA 3LTDA 5AIFA 5ELUA 3G16A 1JNQA 1STDA 3SVAA 2I9WA 2BNGA 4WYKB 4BTYA 3DUKA 2KCDA 3OW22 2XSHB 3CCV3 1JJ22 3CPW2 4GL6A 1N5HA 2XR8B 3EF8A 4KFDA 5HGRA 1GD4A 1D6YA 1QJGA 2K54A 1UW1A 1DVDA 3D3LA 3CME3 1IT8A 1IQ8A 4OUQA 4HZ9B 3F40A 4HM0B 2ML6A 2Q07A 1D6ZA 2M7OA 1VQP3 2Z7AA 2A15A 2SBLA 3X42A 4MMZB 4BTWA 4IT7A 4STDA 3IPTA 2XSOB 2GU3A 3MG2A 3LXUX 3N8BA 3B8LA 3FCSB 3NHXA 3K7CA 2WO0A 1C7HA 3BNEA 3STDA 4QWTA 3S28A 1IK3A 3EBYA 2FNQA 3NQYA 3JUMA 3T8NA 4JF8A 4FMBA 5AIHA 1NO3A 1QMAA 1SQWA 1WTHA 5FW5A 3CPOA 2W04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROA A;  3KSE D;  1DVC A;  1NB3 I;  1CYU A;  4CCV A;  3UL5 A;  4N6N B;  3NX0 A;  1N5P A;  1FA3 A;  4N6U A;  1A67 A;  3PYJ A;  1KWI A;  3IMA B;  1IV7 A;  5LC6 A;  4TX4 A;  2W9Q A;  5LC7 A;  2W9P A;  3K9M C;  1CEW I;  3S67 A;  1G96 A;  1A90 A;  4N6O B;  1FUW A;  4EYC A;  1TIJ A;  1RN7 A;  3GAX A;  3UL6 A;  5ELJ A;  1CYV A;  5EQL A;  2BO9 B;  2OCT A;  1N9J A;  3PXM A;  1PFP A;  3LH4 A;  1WNH A;  3PS8 A;  3L0R A;  4N6T A;  1M9G A;  1GD3 A;  4ZM8 A;  1EQK A;  5ELU A;  3SVA A;  4N6M A;  4N6L A;  1YVB I;  1N5H A;  2KXG A;  1R4C A;  1GD4 A;  5A0O B;  3KFQ C;  1DVD A;  1NB5 I;  3Q2P A;  4LZI A;  1MNL A;  2O9U X;  2CH9 A;  4IT7 A;  1LXE A;  1IV9 A;  3QRD A;  1STF I;  1MOL A;  3MWZ A;  4N6V 0; 
#chains in the Genus database with same CATH topology
 1ROA A;  1BNS A;  1JN5 A;  2E2U A;  1YJ9 3;  3G4S 3;  3Q90 A;  4PEJ A;  2BIR A;  2IUK A;  1K9M 4;  4AKZ A;  3I0Y A;  1B2U A;  1FYS A;  1DVC A;  1UI8 A;  1Y4K A;  2IY2 A;  3ALA A;  1JRQ A;  4JRF A;  2UGI A;  5EVH A;  5IW9 A;  1GY7 A;  3RGA A;  4LGQ A;  2OQE A;  1AQZ A;  1IVX A;  1OF5 A;  2YX9 A;  3SOY A;  1ULJ B;  5STD A;  4J8T A;  1O7H B;  2LYX A;  4HM6 B;  4RBN A;  1QAL A;  1RN1 A;  2MC8 A;  3F8X A;  1GOV A;  4N6N B;  1QVG 2;  1W6C A;  2FGT A;  3F7X A;  2STD A;  4K61 A;  2W56 B;  5AEU B;  1OPY A;  3SLU A;  1Q81 4;  1BSB A;  1O7G B;  3CXC 2;  3JUN A;  1BUJ A;  4ORL A;  5G1L A;  2AAE A;  2XF3 A;  3VSY A;  1GY6 A;  1BNI A;  1N5P A;  3DGO A;  4N6U A;  3EQQ B;  1A67 A;  3TDG A;  3GSP A;  1JBT A;  3PYJ A;  5GSP A;  1F8N A;  3URP A;  1EKM A;  2LQV A;  3BNB A;  3IMA B;  5M18 A;  3FG4 A;  3T8U A;  4EBG A;  5LC6 A;  5BIR A;  1Q40 B;  5I97 A;  3X3X A;  1BNJ A;  4J9A A;  2UX0 A;  4BL3 A;  3RGR A;  4TX4 A;  2W9Q A;  1T3B A;  3KE7 A;  5D83 A;  1BRN L;  1I8V A;  2J8X B;  5CF2 A;  1N8R 4;  1FUT A;  1VQN 3;  3PZW A;  2CKF B;  3K9M C;  1K28 A;  4RZM A;  1AVK A;  1OHP A;  3CNX A;  4HBR A;  3D4A A;  3M8C A;  1W2Z A;  3KKG A;  3V99 A;  2P0M A;  1TFK A;  1RGA A;  3OV4 A;  1YIJ 3;  3CCQ 3;  1ASK A;  1RSN A;  4O8S A;  2CK3 H;  2E2V A;  5CF1 A;  1UUW B;  2GU1 A;  3BU4 A;  2UUG C;  3EB8 A;  1TIJ A;  1W02 A;  4LEH A;  4EYC A;  2GXF A;  2OTJ 3;  4MMX B;  1MWU A;  3OWU A;  3AGO A;  3BIR A;  8RNT A;  3UL6 A;  1A2K A;  2XRX B;  2C11 A;  2CWV A;  2WGQ A;  2HMO B;  1EA2 A;  3PXM A;  3OWS A;  2KF5 A;  1RGH A;  3DZL A;  1RCK A;  2D42 A;  4LYL B;  2KF6 A;  3Q3F A;  3UJM A;  4KT3 B;  4XBY A;  3L0R A;  2BHM A;  4L7K A;  3RDE A;  1MGW A;  1KC8 4;  3VGN A;  4XM4 A;  3DH2 A;  4ZM8 A;  4WYK A;  2W03 A;  3NV0 A;  1NJI 4;  1PU4 A;  1IT7 A;  2BMR B;  2XEP A;  5RNT A;  1T2I A;  1O7W B;  2OWP A;  4KVH A;  3CC2 3;  2CFG A;  1BIR A;  1TRP A;  2W0Q A;  3KII A;  1ROV A;  3NBB A;  4KFF A;  4N6L A;  7GSP A;  3EC9 A;  3N9H A;  1YVB I;  4GB5 A;  3MKI A;  3FG3 A;  1LVN A;  2HOH A;  2IUJ A;  2KXG A;  3K63 A;  1AVL A;  2GEX A;  1K8A 4;  1RTU A;  1RRH A;  8CHO A;  5FGO A;  2P38 A;  1HKX A;  1VQ8 3;  3HX8 A;  1TTO A;  1TFO A;  5AII A;  1BRI A;  3FG1 A;  2CH9 A;  2P05 A;  2OTL 3;  1BRJ A;  3PCS A;  2QA4 3;  2Z76 A;  1DMN A;  1LOY A;  3JUO A;  1STF I;  1UUV B;  3CCR 3;  4FMC A;  4WWU C;  1JB4 A;  3KCH A;  1FGQ A;  5G1K A;  1PYL A;  4N6V 0;  2CIU A;  1TRQ A;  3GZX B;  1RGC A;  1SAR A;  4R80 A;  1O7P B;  3B4O A;  3FLJ A;  1WQL B;  1I2G A;  1JBR A;  4XBT A;  1SPU A;  3G8Z A;  3QK9 A;  1HU9 A;  3WOE B;  1VQ9 3;  4R9L A;  3D5G A;  3CCU 3;  2OQE C;  1OCV A;  2H0I A;  1B2X A;  1S5A A;  2ZHX B;  1W00 A;  3NM7 A;  3NM2 A;  3SED A;  2H0G A;  3LT8 A;  4LMI A;  1O7M B;  2CFK A;  3KSE D;  3SX1 A;  2MF7 A;  3LOY A;  3T0U A;  5IF6 A;  3GRD A;  3MHE A;  2SAR A;  3BNC A;  3UB1 A;  1EG9 B;  2Z6B A;  3D79 A;  1DYU A;  4CCV A;  4N3V A;  1IYY A;  4H3U A;  2W2C A;  4EV5 A;  3LZA A;  1ZGX A;  1Q86 4;  3DGL A;  3HIG A;  1UUG B;  2BMO B;  4WFO A;  2E2T A;  4MJD A;  2HML B;  4X2O A;  2YFL B;  1GS3 A;  1LQG C;  3EX9 A;  1IQY A;  1M90 4;  4HYZ A;  1MWT A;  2K0M A;  3F9S A;  2F4Y A;  3BB9 A;  1V74 A;  1Q40 A;  1Q42 A;  3MPH A;  2C10 A;  1RNB A;  1IV7 A;  1SII A;  6GSP A;  1BRK A;  4RNY A;  1Z1S A;  3GWR A;  4HOH A;  3ECF A;  4RNZ A;  3S27 A;  3OWY A;  3Q1C A;  3FZW A;  1HYF A;  2PZV A;  1B27 A;  1SJW A;  1JBS A;  1M1K 4;  2CWU A;  1LOV A;  4R9K A;  2ZL8 A;  3F7S A;  1W2B 2;  1A2V A;  4NRE A;  1DMM A;  6RNT A;  1UCI A;  3EE1 A;  3JUP A;  3S67 A;  2KF4 A;  1BOX A;  1I3I A;  3MG3 A;  1T2H A;  1DMQ A;  1FGM A;  3AHS A;  3JVC A;  4K90 B;  4HM4 B;  1X1U A;  5D82 A;  3I56 3;  1KD1 4;  1UDI I;  1W4N A;  4HKV B;  3CU3 A;  1JKG A;  4BIR A;  3GAX A;  7STD A;  2GSP A;  1LRA A;  3EN1 B;  1BNF A;  3WOF B;  3KN4 A;  3OXA A;  5EQL A;  2OCT A;  1N9J A;  4O3V A;  4IIA A;  3DY5 A;  3FH1 A;  3JUQ A;  4XDW A;  1Q82 4;  1WMO A;  3DGN A;  3GZR A;  3PS8 A;  3MG1 A;  1HZ1 A;  3D9R A;  1IQX A;  1RGK A;  2ML5 A;  2R41 A;  1GD3 A;  1RRL A;  3S29 A;  3K0Z A;  1KSI A;  5CXO A;  2Z77 A;  1MWR A;  2XGN A;  1E3V A;  2ZA4 A;  5DRE A;  1X1W A;  3SYU A;  1GYB A;  1LOW A;  5CK6 A;  1FGR A;  4J5K A;  7RNT A;  1N8Q A;  4R4K A;  4FMD A;  2XFT A;  4HM7 B;  1OH0 A;  4XBX A;  4EC6 A;  4IPB A;  1R4C A;  3B4P A;  1JN5 B;  1FZU A;  1UGH I;  2CFW A;  4MMY B;  5TGN A;  3Q2P A;  1NB5 I;  1M1X B;  4LZI A;  3LML A;  3UNL A;  4OVM A;  4CDL A;  5IG0 A;  2O9U X;  1K41 A;  1Q7H A;  3U97 A;  1IVU A;  1ZO2 A;  4AKY A;  5IG3 A;  1US1 A;  1U8C B;  2HMM B;  2H0H A;  3GZB A;  4MEI A;  4BTX A;  4O2H A;  4HM1 B;  1BRH A;  2CG0 A;  3GZY B;  3AMO B;  5JPP A;  3MWZ A;  1DE3 A;  5M19 A;  3CC7 3;  1I0V A;  3WOD G;  1UCK A;  1BSD A;  4FR9 A;  1GY5 A;  5IEP A;  2RBI A;  3NBR A;  1A2P A;  1CQS A;  3CCL 3;  4EW5 A;  1UI7 A;  1T5Y A;  3EJV A;  1JB5 A;  2D1W A;  1YVS A;  4K1U A;  4HVN A;  5IG5 A;  2CX0 A;  4K1V A;  2OOV A;  4H61 A;  2CX1 A;  1W6G A;  1NB3 I;  2YFI B;  4EV2 A;  1SIH A;  1FGO A;  1BSE A;  1CYU A;  1ULI B;  3X3Z A;  2AAD A;  4FCM A;  1RDS A;  1VQQ A;  4BL2 A;  3J7Y d;  1YJW 3;  4FCZ A;  1RGF A;  2GBW B;  1EUI C;  3A5E A;  3FSD A;  1X1Y A;  1U5O A;  3NX0 A;  5KP1 A;  2RCD A;  1RN4 A;  4Q53 A;  1FA3 A;  3RNT A;  2QIY A;  5BU4 A;  1K73 4;  1V57 A;  1GOY A;  2INX A;  5AEW B;  1GMP A;  3ROB A;  5EEO A;  4WHA A;  1I3F A;  1BNE A;  4L8O A;  2WGO A;  3A76 A;  1QAF A;  3G71 3;  1W7C A;  4CJN A;  2W9P A;  2GBX B;  3NBJ A;  2F56 A;  3MYT A;  4KFE A;  2BU4 A;  1DET A;  4XB5 A;  1NDO B;  1BRS A;  2P09 A;  3HZP A;  1B20 A;  3FF0 A;  3NV0 B;  3HI7 A;  4OK0 A;  2W56 A;  5AYS C;  4O02 B;  2O3O A;  4HM5 B;  1JB2 A;  1A90 A;  2R4I A;  1IVV A;  2JDI H;  1ZX2 A;  3NUV A;  3WR2 A;  3WDG B;  5JBS A;  5AI1 A;  3LTA A;  2B1X B;  2IA7 A;  4HJL B;  1AR0 A;  1GSP A;  4GSP A;  1AV4 A;  1TUH A;  4LSO A;  2QGU A;  3ZG5 A;  5JPU A;  1VQM 3;  1MWS A;  2RGQ A;  3CNM A;  2BO9 B;  1VQ7 3;  3KSP A;  1RGL A;  4HM2 B;  1TU5 A;  1PY3 A;  1PFP A;  2KRT A;  3LH4 A;  2RSX A;  4G1M B;  1S72 3;  1ISK A;  1WNH A;  2IMJ A;  3I55 3;  1LNH A;  1OGZ A;  3V98 A;  1FW7 A;  1FUS A;  3CD6 3;  3H3H A;  1MGR A;  1EQK A;  3X3Y A;  1NWW A;  1JZO A;  1OAC A;  3HK4 A;  3IJE B;  2HMN B;  1LOX A;  4FMA A;  4N6M A;  1BAN A;  3EBT A;  3HII A;  2XFS A;  1KQS 2;  3X41 A;  3DM8 A;  1I2E A;  1VZZ A;  1Q7Y 4;  3NQZ A;  3CCM 3;  1B2S A;  1W01 A;  2CHC A;  1UCL A;  1RNT A;  1YGE A;  1YGW A;  1GMR A;  2KF3 A;  3PGB A;  2C4B A;  1VQ6 3;  1YJN 3;  3HOH A;  1YNV X;  5A0O B;  1GMQ A;  1B3S A;  3KFQ C;  2K3D A;  1W6Y A;  1WMP A;  4EXR A;  3E99 A;  1TP6 A;  1MNL A;  3O8Y A;  3CCJ 3;  2BMQ B;  3B7C A;  3DXO A;  1JZD A;  4WP5 A;  1BVI A;  4KZ1 A;  5CLK A;  1FGT A;  3LYG A;  1LXE A;  2XGL A;  4HZB B;  1IV9 A;  3QRD A;  1VQO 3;  2CC3 A;  5BXQ A;  3D5I A;  3AMO A;  1MOL A;  2CG1 A;  3WA3 A;  1I0X A;  3ER7 A;  4FCJ A;  2V1L A;  2BT3 A;  3X40 A;  4BU4 A;  3NXJ A;  5M1A A;  2OOV C;  2Y73 A;  3BND A;  3DMC A;  3WA2 X;  3LTB A;  1B2Z A;  2RFR A;  2F86 B;  1LNI A;  2F5W A;  2XH9 A;  1W5Z A;  3OX9 A;  5AIG A;  3CMA 3;  1OUN A;  3G0K A;  3MSO A;  3V92 A;  3LTC A;  2WOH A;  4HM3 B;  4NPB A;  3G6E 3;  2GEY A;  1BUQ A;  1BAO A;  1VQK 3;  1RKY A;  4XDV A;  3KZT A;  5KP4 A;  1OHO A;  2HMJ B;  2CFL A;  3UL5 A;  5AYR B;  1RCL A;  2F98 A;  4U13 A;  1QAK A;  1I2F A;  1OF5 B;  1VQL 3;  2CWT A;  2L4V A;  3BLZ A;  4NHF A;  1TJD A;  5DRV A;  5IER A;  1O7N B;  1B2M A;  1IU7 A;  1BU4 A;  1UCJ A;  1J2B A;  2YFJ B;  1OHS A;  1E97 A;  3EN8 A;  3N54 B;  1IVW A;  6STD A;  1G02 A;  1IDP A;  3PCR A;  3AGN A;  1JKG B;  3DGM A;  1KWI A;  3FF2 A;  5IEN A;  1RMS A;  3F8H A;  2PNC A;  3LT9 A;  5IEO A;  1ZS7 A;  3CCE 3;  4J5G A;  3H51 A;  1N9E A;  4AEQ A;  3CC4 3;  5LC7 A;  4L8P A;  1YI2 3;  2CW9 A;  4I4K A;  3CCS 3;  3U1W A;  3SXX A;  1CEW I;  1BNR A;  1RGG A;  3FKA A;  1BNG A;  2JQ5 A;  2WOF A;  5D81 A;  1OGX A;  1WMN A;  4CPK A;  1V58 A;  1G96 A;  1LQM B;  2FXT A;  2ZDJ A;  1L5G B;  3S5C A;  5BVB A;  4N6O B;  5HOH A;  2QEX 3;  1YHQ 3;  1BSC A;  1RJO A;  1JV2 B;  1FUW A;  5G2G A;  4DKI A;  1RN7 A;  3FGY A;  5KP3 A;  3K5T A;  3AHW A;  5ELJ A;  1D6U A;  1G0T A;  2Y74 A;  1CYV A;  2CFD A;  1VQ5 3;  1AY7 A;  3DGY A;  4X2H A;  4HM8 B;  1VQ4 3;  4R1K A;  1YIT 3;  1E3R A;  2HMK B;  2IYJ A;  3SOA A;  4ILF A;  2W6J H;  1GOU A;  2B24 B;  3WHO A;  3EHC A;  5IG4 A;  4N6T A;  1M9G A;  1NU3 A;  3WMD A;  3VF1 A;  1QVF 2;  2F99 A;  1RHL A;  1RLS A;  1BGS A;  2P0X A;  3F14 A;  3LTD A;  5AIF A;  9RNT A;  5ELU A;  3G16 A;  1JNQ A;  1STD A;  3SVA A;  2I9W A;  1X1X A;  2BNG A;  4WYK B;  4BTY A;  2L1S A;  4RNT A;  1BSA A;  4HAA A;  2RNT A;  3DUK A;  2KCD A;  3OW2 2;  2XSH B;  3CCV 3;  3ZG0 A;  1JJ2 2;  3CPW 2;  4GL6 A;  1N5H A;  2XR8 B;  3EF8 A;  2F5M A;  4KFD A;  5HGR A;  1GD4 A;  1D6Y A;  1QJG A;  2K54 A;  1UW1 A;  1DVD A;  1EEJ A;  3D3L A;  3CME 3;  4GHO A;  1IT8 A;  1IQ8 A;  1R4Y A;  2KAA A;  4OUQ A;  4HZ9 B;  3F40 A;  4HM0 B;  2ML6 A;  2Q07 A;  1D6Z A;  2M7O A;  1VQP 3;  2Z7A A;  2A15 A;  2SBL A;  3X42 A;  4MMZ B;  4BTW A;  1I70 A;  4IT7 A;  4STD A;  3IPT A;  2XSO B;  1NNV A;  2GU3 A;  3MG2 A;  3LXU X;  3N8B A;  3B8L A;  3FCS B;  3NHX A;  3K7C A;  2WO0 A;  1C7H A;  3ZFZ A;  1CH0 A;  3BNE A;  3STD A;  1B21 A;  4QWT A;  1UGI A;  3S28 A;  1IK3 A;  3EBY A;  2FNQ A;  1RGE A;  3NQY A;  3JUM A;  4I5Q A;  4JF8 A;  1BRG A;  4FMB A;  5AIH A;  3T8N A;  1NO3 A;  1QMA A;  1SQW A;  1WTH A;  1C54 A;  5FW5 A;  1Q9E A;  3CPO A;  2W04 A; 
#chains in the Genus database with same CATH homology
 1ROA A;  1JN5 A;  2E2U A;  1YJ9 3;  3G4S 3;  3Q90 A;  4PEJ A;  2IUK A;  1K9M 4;  4AKZ A;  3I0Y A;  1UI8 A;  1DVC A;  4JRF A;  1Y4K A;  3ALA A;  5EVH A;  1JRQ A;  5IW9 A;  1GY7 A;  3RGA A;  4LGQ A;  2OQE A;  1IVX A;  1OF5 A;  2YX9 A;  3SOY A;  1ULJ B;  5STD A;  4J8T A;  1O7H B;  2LYX A;  4HM6 B;  4RBN A;  1QAL A;  2MC8 A;  3F8X A;  4N6N B;  1QVG 2;  1W6C A;  2FGT A;  3F7X A;  2STD A;  4K61 A;  2W56 B;  5AEU B;  1OPY A;  3SLU A;  1Q81 4;  1O7G B;  3CXC 2;  3JUN A;  4ORL A;  2XF3 A;  3VSY A;  1GY6 A;  1N5P A;  3DGO A;  4N6U A;  3EQQ B;  1A67 A;  3TDG A;  3PYJ A;  1F8N A;  1EKM A;  2LQV A;  3BNB A;  3IMA B;  3FG4 A;  3T8U A;  4EBG A;  5LC6 A;  1Q40 B;  5I97 A;  3X3X A;  4J9A A;  2UX0 A;  3RGR A;  4TX4 A;  2W9Q A;  3KE7 A;  5D83 A;  5CF2 A;  1N8R 4;  1VQN 3;  3PZW A;  2CKF B;  3K9M C;  1K28 A;  4RZM A;  1AVK A;  1OHP A;  3CNX A;  4HBR A;  3M8C A;  1W2Z A;  3KKG A;  3V99 A;  2P0M A;  1TFK A;  3OV4 A;  1YIJ 3;  3CCQ 3;  1ASK A;  4O8S A;  2CK3 H;  2E2V A;  5CF1 A;  1UUW B;  2GU1 A;  3EB8 A;  4EYC A;  1TIJ A;  1W02 A;  4LEH A;  2GXF A;  2OTJ 3;  4MMX B;  3OWU A;  3UL6 A;  1A2K A;  2XRX B;  2C11 A;  2CWV A;  2WGQ A;  2HMO B;  1EA2 A;  3PXM A;  3OWS A;  3DZL A;  2D42 A;  3UJM A;  4XBY A;  3L0R A;  2BHM A;  4L7K A;  3RDE A;  1KC8 4;  3VGN A;  4XM4 A;  4ZM8 A;  4WYK A;  2W03 A;  3NV0 A;  1NJI 4;  1PU4 A;  1IT7 A;  2BMR B;  2XEP A;  1O7W B;  2OWP A;  4KVH A;  3CC2 3;  2CFG A;  2W0Q A;  3KII A;  1ROV A;  3NBB A;  4KFF A;  4N6L A;  1QVF 2;  3EC9 A;  3N9H A;  1YVB I;  4GB5 A;  3MKI A;  3FG3 A;  1LVN A;  2IUJ A;  2KXG A;  3K63 A;  1AVL A;  2GEX A;  1K8A 4;  1RRH A;  8CHO A;  5FGO A;  2P38 A;  1HKX A;  1VQ8 3;  3HX8 A;  1TFO A;  5AII A;  3FG1 A;  2CH9 A;  2P05 A;  2OTL 3;  3PCS A;  2QA4 3;  2Z76 A;  1DMN A;  3JUO A;  1STF I;  1UUV B;  3CCR 3;  4FMC A;  4WWU C;  1JB4 A;  1FGQ A;  4N6V 0;  2CIU A;  3GZX B;  4R80 A;  1O7P B;  3B4O A;  3FLJ A;  1WQL B;  4XBT A;  1SPU A;  3G8Z A;  3QK9 A;  1HU9 A;  3WOE B;  1VQ9 3;  4R9L A;  3CCU 3;  2OQE C;  1OCV A;  1S5A A;  3NM7 A;  3NM2 A;  1W00 A;  3SX1 A;  3SXX A;  3SED A;  3LT8 A;  4LMI A;  3T0U A;  1O7M B;  2CFK A;  3KSE D;  2MF7 A;  3LOY A;  5IF6 A;  3GRD A;  3MHE A;  3BNC A;  3UB1 A;  1EG9 B;  2Z6B A;  1DYU A;  4CCV A;  4N3V A;  4H3U A;  2W2C A;  4EV5 A;  3LZA A;  1Q86 4;  3DGL A;  3HIG A;  2BMO B;  4WFO A;  2E2T A;  4MJD A;  2HML B;  4X2O A;  2YFL B;  1GS3 A;  3EX9 A;  1IQY A;  1M90 4;  4HYZ A;  2K0M A;  3F9S A;  3BB9 A;  1V74 A;  1Q40 A;  1Q42 A;  3MPH A;  2C10 A;  1IV7 A;  1SII A;  4RNY A;  1Z1S A;  3GWR A;  3ECF A;  4RNZ A;  3S27 A;  3OWY A;  3Q1C A;  3FZW A;  2PZV A;  1SJW A;  1M1K 4;  2CWU A;  4R9K A;  2ZL8 A;  3F7S A;  1W2B 2;  1A2V A;  4NRE A;  1DMM A;  3EE1 A;  3JUP A;  3S67 A;  3MG3 A;  1DMQ A;  1FGM A;  3JVC A;  4K90 B;  4HM4 B;  5D82 A;  3I56 3;  1KD1 4;  1W4N A;  4HKV B;  3CU3 A;  1JKG A;  3GAX A;  7STD A;  3EN1 B;  3WOF B;  3KN4 A;  3OXA A;  5EQL A;  2OCT A;  1N9J A;  4O3V A;  4IIA A;  3DY5 A;  3FH1 A;  3JUQ A;  4XDW A;  1Q82 4;  1WMO A;  3DGN A;  3GZR A;  3PS8 A;  3MG1 A;  3D9R A;  1IQX A;  2ML5 A;  1GD3 A;  1RRL A;  3S29 A;  3K0Z A;  1KSI A;  5CXO A;  2Z77 A;  2XGN A;  1E3V A;  5DRE A;  1GYB A;  5CK6 A;  1FGR A;  1N8Q A;  4R4K A;  4FMD A;  2XFT A;  4HM7 B;  1OH0 A;  4XBX A;  4EC6 A;  4IPB A;  1R4C A;  3B4P A;  1JN5 B;  2CFW A;  4MMY B;  5TGN A;  3Q2P A;  1NB5 I;  1M1X B;  4LZI A;  3LML A;  3UNL A;  4OVM A;  4CDL A;  5IG0 A;  2O9U X;  1K41 A;  3U97 A;  1IVU A;  1ZO2 A;  4AKY A;  5IG3 A;  1US1 A;  1U8C B;  2HMM B;  3GZB A;  4MEI A;  4BTX A;  4O2H A;  4HM1 B;  2CG0 A;  3GZY B;  3AMO B;  5JPP A;  3MWZ A;  3CC7 3;  3WOD G;  4FR9 A;  1GY5 A;  5IEP A;  3CCL 3;  3NBR A;  1CQS A;  1UI7 A;  1T5Y A;  3EJV A;  1JB5 A;  2D1W A;  4K1U A;  4HVN A;  5IG5 A;  4K1V A;  2OOV A;  4H61 A;  1W6G A;  1NB3 I;  2YFI B;  4EV2 A;  1SIH A;  1FGO A;  1CYU A;  1ULI B;  3X3Z A;  4FCM A;  3J7Y d;  1YJW 3;  4FCZ A;  2GBW B;  3FSD A;  3NX0 A;  1U5O A;  5KP1 A;  2RCD A;  4Q53 A;  1FA3 A;  2QIY A;  1K73 4;  2INX A;  5AEW B;  3ROB A;  5EEO A;  4WHA A;  4L8O A;  2WGO A;  3A76 A;  1QAF A;  3G71 3;  1W7C A;  2W9P A;  2GBX B;  3NBJ A;  3MYT A;  4KFE A;  4XB5 A;  1NDO B;  2P09 A;  3HZP A;  3FF0 A;  3NV0 B;  3HI7 A;  4OK0 A;  2W56 A;  5AYS C;  4O02 B;  2O3O A;  4HM5 B;  1JB2 A;  1A90 A;  2R4I A;  1IVV A;  2JDI H;  1ZX2 A;  3NUV A;  3WDG B;  5JBS A;  5AI1 A;  3LTA A;  2B1X B;  2IA7 A;  4HJL B;  1AR0 A;  4LSO A;  1AV4 A;  1TUH A;  5JPU A;  2QGU A;  1VQM 3;  2RGQ A;  3CNM A;  2BO9 B;  1VQ7 3;  3KSP A;  4HM2 B;  1TU5 A;  1PFP A;  2KRT A;  3LH4 A;  2RSX A;  4G1M B;  1S72 3;  1ISK A;  1WNH A;  2IMJ A;  3I55 3;  1LNH A;  1OGZ A;  3V98 A;  3CD6 3;  3H3H A;  1EQK A;  3X3Y A;  1NWW A;  1OAC A;  3HK4 A;  3IJE B;  2HMN B;  1LOX A;  4FMA A;  4N6M A;  3EBT A;  3HII A;  2XFS A;  1KQS 2;  3X41 A;  3DM8 A;  1VZZ A;  1Q7Y 4;  3NQZ A;  3CCM 3;  1W01 A;  2CHC A;  1YGE A;  3PGB A;  1VQ6 3;  1YJN 3;  5A0O B;  3KFQ C;  1W6Y A;  1WMP A;  4EXR A;  3E99 A;  1TP6 A;  1MNL A;  3O8Y A;  3CCJ 3;  2BMQ B;  3B7C A;  3DXO A;  4WP5 A;  5CLK A;  4KZ1 A;  1FGT A;  3LYG A;  1LXE A;  2XGL A;  4HZB B;  1IV9 A;  3QRD A;  1VQO 3;  2CC3 A;  5BXQ A;  3AMO A;  1MOL A;  2CG1 A;  3WA3 A;  3ER7 A;  4FCJ A;  2V1L A;  2BT3 A;  3X40 A;  3NXJ A;  2OOV C;  2Y73 A;  3BND A;  3DMC A;  3WA2 X;  3LTB A;  2RFR A;  3OX9 A;  2F86 B;  5AIG A;  2XH9 A;  1W5Z A;  3CMA 3;  1OUN A;  3G0K A;  3MSO A;  3V92 A;  3LTC A;  2WOH A;  4HM3 B;  3G6E 3;  2GEY A;  1BUQ A;  1VQK 3;  1RKY A;  4XDV A;  3KZT A;  5KP4 A;  1OHO A;  2HMJ B;  2CFL A;  3UL5 A;  5AYR B;  2F98 A;  4U13 A;  1QAK A;  1OF5 B;  1VQL 3;  2CWT A;  2L4V A;  3BLZ A;  4NHF A;  5DRV A;  5IER A;  1O7N B;  1IU7 A;  1J2B A;  2YFJ B;  1OHS A;  1E97 A;  3EN8 A;  3N54 B;  1IVW A;  6STD A;  1IDP A;  3PCR A;  1JKG B;  3DGM A;  1KWI A;  3FF2 A;  5IEN A;  3F8H A;  2PNC A;  3LT9 A;  5IEO A;  3CCE 3;  3H51 A;  1N9E A;  4AEQ A;  3CC4 3;  5LC7 A;  4L8P A;  1YI2 3;  2CW9 A;  4I4K A;  3CCS 3;  3U1W A;  1CEW I;  3FKA A;  2JQ5 A;  2WOF A;  5D81 A;  1OGX A;  1WMN A;  1G96 A;  2FXT A;  1L5G B;  2ZDJ A;  3S5C A;  5BVB A;  4N6O B;  1YHQ 3;  2QEX 3;  1RJO A;  1JV2 B;  1FUW A;  5G2G A;  1RN7 A;  3FGY A;  5KP3 A;  3K5T A;  5ELJ A;  1D6U A;  2Y74 A;  1CYV A;  2CFD A;  1VQ5 3;  4X2H A;  4HM8 B;  1VQ4 3;  4R1K A;  1YIT 3;  1E3R A;  2HMK B;  3SOA A;  2W6J H;  2B24 B;  3EHC A;  5IG4 A;  4N6T A;  1M9G A;  1NU3 A;  3WMD A;  3VF1 A;  2F99 A;  3F14 A;  2P0X A;  3LTD A;  5AIF A;  5ELU A;  3G16 A;  1JNQ A;  1STD A;  3SVA A;  2I9W A;  2BNG A;  4WYK B;  4BTY A;  3DUK A;  2KCD A;  3OW2 2;  2XSH B;  3CCV 3;  1JJ2 2;  3CPW 2;  4GL6 A;  1N5H A;  2XR8 B;  3EF8 A;  4KFD A;  5HGR A;  1GD4 A;  1D6Y A;  1QJG A;  2K54 A;  1UW1 A;  1DVD A;  3D3L A;  3CME 3;  1IT8 A;  1IQ8 A;  4OUQ A;  4HZ9 B;  3F40 A;  4HM0 B;  2ML6 A;  2Q07 A;  1D6Z A;  2M7O A;  1VQP 3;  2Z7A A;  2A15 A;  2SBL A;  3X42 A;  4MMZ B;  4BTW A;  4IT7 A;  4STD A;  3IPT A;  2XSO B;  2GU3 A;  3MG2 A;  3LXU X;  3N8B A;  3B8L A;  3FCS B;  3NHX A;  3K7C A;  2WO0 A;  1C7H A;  3BNE A;  3STD A;  4QWT A;  3S28 A;  1IK3 A;  3EBY A;  2FNQ A;  3NQY A;  3JUM A;  3T8N A;  4JF8 A;  4FMB A;  5AIH A;  1NO3 A;  1QMA A;  1SQW A;  1WTH A;  5FW5 A;  3CPO A;  2W04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...