1EQKA

Solution structure of oryzacystatin-i, a cysteine proteinase inhibitor of the rice, oryza sativa l. japonica
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
MSSDGGPVLGGVEPVGNENDLHLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPVDASANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords ORYZACYSTATIN-I
publication title Three-dimensional solution structure of oryzacystatin-I, a cysteine proteinase inhibitor of the rice, Oryza sativa L. japonica.
pubmed doi rcsb
source organism Oryza sativa japonica group
total genus 18
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2000-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1eqkA00
1N5PA 2BO9B 1ROAA 4N6TA 2W9QA 1R4CA 4N6NB 1CEWI 3SVAA 4EYCA 4N6V0 4LZIA 4N6MA 1GD3A 4ZM8A 1YVBI 3KFQC 1NB3I 2OCTA 5ELUA 1STFI 1RN7A 1M9GA 3PXMA 1MOLA 3GAXA 3QRDA 3LH4A 5EQLA 2O9UX 1A67A 1EQKA 4N6UA 1CYUA 1PFPA 1DVDA 2W9PA 2KXGA 1GD4A 3NX0A 3UL5A 1WNHA 3IMAB 4IT7A 3Q2PA 3KSED 1DVCA 1MNLA 1IV7A 1TIJA 5LC6A 1IV9A 3S67A 1N9JA 3MWZA 1N5HA 1NB5I 4CCVA 1FA3A 1CYVA 5A0OB 5LC7A 5ELJA 4N6LA 1FUWA 1LXEA 1KWIA 3PS8A 3K9MC 3UL6A 3PYJA 1A90A 2CH9A 4N6OB 4TX4A 3L0RA 1G96A
chains in the Genus database with same CATH superfamily
1YJW3 1VQP3 1N5PA 2BO9B 3SOYA 1AY7A 1RGLA 1VQQA 1LNIA 4HBRA 4CPKA 4N6TA 2XH9A 2CG1A 1R4CA 1L5GB 4HAAA 3FG3A 1CEWI 1BGSA 2R4IA 3FSDA 3LMLA 4EYCA 3CC43 4QWTA 3GZBA 1RCKA 2UUGC 1EKMA 3LYGA 1D6UA 1GD3A 1G0TA 2QGUA 1PY3A 2WOFA 1CQSA 1TU5A 4FR9A 4DKIA 1I8VA 1DETA 3EJVA 4BL3A 3T8UA 2I9WA 3KFQC 3SX1A 1VQ63 3LTDA 4WYKA 2AAEA 2D42A 2XRXB 1QVF2 1B27A 1FZUA 1T3BA 3KSPA 1STFI 2IUJA 3WMDA 4IPBA 3K5TA 4HYZA 3M8CA 2V1LA 2O3OA 5BU4A 3PXMA 3DGYA 1MOLA 3LH4A 4O8SA 3JUPA 2CHCA 1OHPA 4LSOA 4XM4A 1ZGXA 3CD63 3Q1CA 3OXAA 1MWTA 1QJGA 4R9LA 5IG0A 2L4VA 1N8QA 3AMOA 3MG1A 1JV2B 1K41A 2WGQA 5G2GA 1EQKA 2B1XB 1I3IA 1B20A 1CH0A 2AADA 7STDA 4AKZA 1DMNA 1NWWA 3BU4A 4BTXA 1FYSA 3AHWA 3RNTA 3NBBA 1DVDA 1UW1A 2HMKB 1G02A 2CFDA 5AIGA 3HI7A 1TRQA 2FXTA 2F5MA 1GD4A 3OWUA 2F99A 4HOHA 2R41A 3CPW2 2BNGA 4L8PA 3G713 3CNXA 4R1KA 2XSOB 3UL5A 3ROBA 1Y4KA 3TDGA 1GY5A 3CU3A 3O8YA 2CWVA 1RDSA 1N8R4 5IW9A 1AR0A 3JUQA 3GZYB 2INXA 3X3XA 2IY2A 4XBTA 3ZG0A 1VQ43 1KQS2 1JB5A 3A5EA 3LTBA 3WODG 4R4KA 1UCLA 2GU1A 3CCE3 1JB2A 2BT3A 1JRQA 5M19A 3V99A 3CCU3 1A2VA 1BNIA 2KF3A 2CC3A 1W7CA 2ML6A 1RKYA 1JN5B 3DGMA 3ZFZA 1RGCA 3HOHA 1B2UA 3K7CA 1VQL3 1A2KA 3STDA 3N9HA 3UB1A 2OOVC 3JUNA 4MMYB 1BRHA 2P05A 1BANA 1NDOB 5JPPA 1BNGA 1RNTA 1BSAA 1I3FA 1CYVA 1N9EA 1K28A 1SQWA 2CWUA 2HMMB 1LOYA 3D79A 4NREA 1IK3A 1YHQ3 5BIRA 5AYSC 3B4OA 1JBRA 2F86B 5ELJA 4N6LA 4EV5A 2QA43 1M1K4 1KD14 3CPOA 3MHEA 3N54B 1JZOA 1VQK3 1KWIA 1IT7A 1LRAA 4WWUC 1ZO2A 1VQ93 4WFOA 1QMAA 1RGGA 4BU4A 5JPUA 1QAKA 3KCHA 2XGNA 3DUKA 4N3VA 2HOHA 1OF5B 1SARA 1RGAA 3NM2A 4RNYA 1W02A 3PYJA 3SYUA 1NNVA 2Q07A 2W56B 1IVVA 2CFGA 2RGQA 3MSOA 4PEJA 1X1UA 2XSHB 2KF5A 4XDVA 3CCV3 1K9M4 1JBSA 3B8LA 3X3YA 1JKGB 2WO0A 4KFEA 1LQMB 2P38A 3EX9A 3NQYA 3WOEB 5IEPA 5KP1A 3CCS3 1IYYA 2Z77A 2GU3A 2W9QA 3CNMA 3FCSB 5BVBA 2K3DA 1BRJA 1NO3A 2H0HA 1IVUA 3G4S3 1I70A 2MC8A 2CFKA 2QEX3 2SARA 3F14A 4N6MA 1IVWA 1U8CB 4GHOA 3HK4A 1VQ53 1ZS7A 3EHCA 8RNTA 3HZPA 2W04A 1OGZA 1QAFA 2OOVA 1NB3I 3NUVA 3VGNA 3RGAA 1VQ83 5ELUA 2FGTA 1BUJA 2XFTA 1EG9B 1RN1A 1RN4A 2ZL8A 4K1UA 1T2IA 1B2MA 1RN7A 2C4BA 5D83A 3WA3A 2CWTA 1Q7Y4 1FUSA 3A76A 4O2HA 1U5OA 2ZDJA 3G0KA 3LT9A 1VQ73 1MGWA 1S5AA 3EBTA 1DYUA 1JB4A 3F8HA 4BTWA 2B24B 2YFIB 1A67A 4GB5A 1OPYA 1OF5A 2Y73A 1FGMA 1W6CA 1WMOA 4N6UA 3G16A 4RBNA 1NJI4 2W56A 1SPUA 1FGRA 3IJEB 3NQZA 4FMDA 4HM7B 4H61A 1JKGA 1ULIB 1JNQA 1IDPA 3UNLA 1STDA 1Z1SA 2IA7A 4NPBA 4O02B 1EEJA 1I0XA 2HMLB 2PZVA 1RMSA 3FH1A 1WMNA 1W2ZA 2E2TA 3KZTA 2GEXA 1TP6A 4NHFA 4IT7A 4RNTA 1HYFA 2RBIA 1I2EA 1YGWA 1LNHA 3FG4A 3LZAA 3PZWA 4KZ1A 2IYJA 3VSYA 1K8A4 4HM0B 2CX0A 2Z6BA 4FCJA 4OK0A 1MNLA 1UCIA 2IMJA 4HJLB 1MGRA 3N8BA 1TIJA 4R80A 1IVXA 1FGTA 5RNTA 1V74A 2W2CA 1SIHA 2GBXB 1I2GA 1N5HA 2LYXA 2YX9A 3OWSA 1NB5I 3OX9A 1JZDA 2KAAA 3FF0A 4KFDA 4I5QA 3KN4A 1TFOA 4CDLA 4J5KA 4KFFA 3VF1A 3DXOA 3X42A 1UGIA 3J7Yd 1FA3A 5A0OB 2KRTA 4EC6A 1UCKA 1I2FA 1B2ZA 1O7PB 5D82A 5DREA 3I0YA 4RNZA 2KF4A 4XBXA 1O7WB 8CHOA 2WOHA 3FLJA 1S723 1ISKA 1O7GB 3EC9A 1AVKA 2BIRA 5FGOA 5AYRB 3DMCA 3U97A 1AVLA 1T2HA 3KKGA 2H0GA 3FKAA 1PU4A 3G6E3 3PGBA 3PS8A 7RNTA 3ECFA 1RGFA 1UDII 2WGOA 5AEWB 5CF1A 5CLKA 3ZG5A 1TUHA 2OWPA 2W03A 3UL6A 3WOFB 3KE7A 5CF2A 5IG3A 1W2B2 2YFJB 4TX4A 2C11A 1ULJB 6STDA 3L0RA 3RGRA 2BHMA 5BXQA 7GSPA 2F56A 1RHLA 2Z7AA 4L8OA 4LYLB 3HIGA 1BRSA 3BNDA 4L7KA 1O7HB 2YFLB 5IEOA 4OVMA 3CCR3 4K61A 5AIFA 1BOXA 3S28A 1HKXA 3F9SA 3CCL3 2F98A 1GOVA 3SXXA 1RGHA 2GSPA 2HMJB 2OTJ3 3K63A 4LGQA 1FGQA 4N6V0 2P0MA 2BMQB 4MJDA 1YIT3 1GY7A 3BNBA 3B7CA 1RJOA 1OUNA 3GZXB 3EN8A 3KIIA 1BNRA 4ZM8A 1BRGA 4HM8B 1OHOA 5HGRA 1YVBI 4EW5A 4Q53A 2RSXA 3BNEA 2BMRB 1UCJA 5DRVA 1DMQA 2XGLA 3EQQB 3X41A 1BSEA 1RRHA 1GYBA 4HM1B 1FGOA 3Q3FA 3GZRA 5G1LA 1ROVA 2GBWB 1C7HA 1BVIA 2MF7A 4K90B 3DGNA 3GAXA 3MG3A 2HMNB 1US1A 2K54A 1EUIC 3QRDA 3F7SA 1IU7A 1YVSA 2O9UX 4EV2A 3PCSA 1TFKA 2STDA 4XBYA 2D1WA 3D9RA 2K0MA 2ML5A 3CC73 1Q40B 3NBJA 4KVHA 3SLUA 3ER7A 4GL6A 3U1WA 2JQ5A 4HM6B 3MPHA 2CFLA 3Q90A 1CYUA 3GRDA 1YI23 4FMAA 1VQN3 1JN5A 1TTOA 4ORLA 1GMRA 4JF8A 5HOHA 1M904 4AEQA 1PFPA 2M7OA 3T8NA 3CCQ3 3CMA3 1W00A 2PNCA 3EE1A 5KP3A 2W9PA 1EA2A 2KXGA 1KSIA 2RFRA 2OQEC 4HM3B 1Q824 4HZ9B 2ZHXB 3H51A 3NX0A 4WP5A 1WNHA 1B3SA 1OACA 2W0QA 1YIJ3 3IMAB 1NU3A 3K0ZA 1LQGC 4FCMA 4X2HA 2CKFB 4BIRA 1Q9EA 1X1XA 3H3HA 1B21A 3AGOA 3E99A 1UUWB 1RCLA 3KSED 1IT8A 3LOYA 3Q2PA 3CXC2 3URPA 5CXOA 1WTHA 1W6YA 4O3VA 4MMZB 2UGIA 3BNCA 2P09A 4EXRA 1BUQA 1UGHI 5EEOA 1RNBA 3OW22 1A2PA 1E3VA 1MWSA 2OTL3 1RLSA 2CK3H 2GEYA 3ALAA 1PYLA 1QVG2 3OWYA 2P0XA 1FW7A 5JBSA 5IG4A 1GOYA 3JUMA 1T5YA 1O7MB 1N9JA 3MWZA 5IERA 3MKIA 5IENA 3LTCA 1Q42A 5AI1A 1HZ1A 2KF6A 1OH0A 1Q40A 3RDEA 1M1XB 4CCVA 3T0UA 6RNTA 1BRIA 1RRLA 1GMQA 4XDWA 3SEDA 4FMCA 1AQZA 1OGXA 3X40A 3WR2A 1D6YA 2RCDA 9RNTA 1FUWA 5EVHA 4LMIA 1UI7A 1GOUA 5FW5A 1W5ZA 4GSPA 1K734 1Q7HA 4FCZA 3FGYA 1BSBA 3B4PA 1GMPA 1RSNA 3LT8A 2IUKA 1RTUA 3NM7A 4IIAA 2OQEA 1QALA 2A15A 3DY5A 4BTYA 3D5IA 1RGEA 5M18A 3UJMA 3LTAA 3EBYA 3IPTA 1O7NB 4X2OA 4STDA 3BIRA 3HX8A 1SIIA 1G96A 1F8NA 2XFSA 3JUOA 1Q814 1GS3A 1ASKA 2HMOB 3S5CA 3V98A 1GSPA 1DE3A 3S29A 3JVCA 1VZZA 1ROAA 4EBGA 6GSPA 3HIIA 2UX0A 3DM8A 4N6NB 3BLZA 1BU4A 3SVAA 1IQ8A 3MYTA 2FNQA 3WHOA 2BMOB 4LZIA 2H0IA 3V92A 1GY6A 3OV4A 5AIIA 1BNJA 3GWRA 1VQO3 1E3RA 2CW9A 4WHAA 4MEIA 5M1AA 2BU4A 5GSPA 2OCTA 2KCDA 3FF2A 3F7XA 1MWUA 1JBTA 3EB8A 4HKVB 2JDIH 4I4KA 1SJWA 3CCM3 1YGEA 1WQLB 1M9GA 1W6GA 3DZLA 1LOVA 3D5GA 4G1MB 1X1YA 1LOWA 4OUQA 5IG5A 2J8XB 4CJNA 5STDA 5EQLA 1J2BA 3S27A 3NHXA 1BNSA 3D3LA 4HM4B 2SBLA 3DH2A 5TGNA 4RZMA 1C54A 3FZWA 3GSPA 1WMPA 1BNFA 1DMMA 2F4YA 2GXFA 3EF8A 1R4YA 1V57A 1V58A 4JRFA 4J5GA 4KT3B 1UI8A 2C10A 1UUGB 4R9KA 2F5WA 2CIUA 4ILFA 3EN1B 1JJ22 5AIHA 1E97A 1YNVX 1BRNL 3AHSA 5KP4A 3AGNA 2L1SA 2ZA4A 3FG1A 5I97A 5D81A 1BNEA 1AV4A 4HVNA 2E2UA 2CX1A 2XR8B 1BRKA 3LXUX 1ZX2A 3MG2A 4J9AA 4XB5A 1IQXA 4MMXB 1LVNA 4J8TA 1Q864 3PCRA 1DVCA 3NV0B 2W6JH 1YJ93 1W4NA 2Y74A 1I0VA 5CK6A 3WA2X 4BL2A 1IV7A 4H3UA 1B2SA 2CG0A 3BB9A 5LC6A 4K1VA 2Z76A 3DGOA 1IV9A 3S67A 1IQYA 3D4AA 4U13A 3CME3 1X1WA 3SOAA 1BAOA 3CCJ3 3WDGB 3NXJA 1OHSA 4FMBA 3F8XA 2CFWA 3CC23 4HZBB 2LQVA 2RNTA 1B2XA 4HM5B 4AKYA 4WYKB 1KC84 1YJN3 1BIRA 1MWRA 2QIYA 3DGLA 5LC7A 5AEUB 3I553 1LXEA 1TRPA 1RGKA 2E2VA 1TJDA 1D6ZA 3X3ZA 2XEPA 3I563 3NBRA 1BSCA 1FUTA 1OCVA 1W01A 5G1KA 4HM2B 1LOXA 3AMOB 3F40A 2XF3A 3K9MC 5IF6A 1BSDA 1A90A 1UUVB 2CH9A 3G8ZA 4LEHA 4N6OB 1HU9A 1VQM3 3QK9A 3NV0A
chains in the Genus database with same CATH topology
1YJW3 1VQP3 1N5PA 2BO9B 3SOYA 4HBRA 4N6TA 2XH9A 2CG1A 1R4CA 1L5GB 3FG3A 1CEWI 2R4IA 3FSDA 3LMLA 4EYCA 3CC43 4QWTA 3GZBA 1EKMA 3LYGA 1D6UA 1GD3A 2QGUA 2WOFA 1CQSA 1TU5A 4FR9A 3EJVA 3T8UA 2I9WA 3KFQC 3SX1A 1VQ63 3LTDA 4WYKA 2D42A 2XRXB 1QVF2 3WMDA 3KSPA 2IUJA 1STFI 4IPBA 3K5TA 4HYZA 3M8CA 2V1LA 2O3OA 3PXMA 1MOLA 3LH4A 4O8SA 3JUPA 2CHCA 1OHPA 4LSOA 4XM4A 3CD63 3Q1CA 3OXAA 1QJGA 4R9LA 5IG0A 2L4VA 1N8QA 3AMOA 3MG1A 1JV2B 1K41A 2WGQA 5G2GA 1EQKA 2B1XB 7STDA 4AKZA 1DMNA 1NWWA 4BTXA 3NBBA 1DVDA 1UW1A 2HMKB 2CFDA 5AIGA 3HI7A 2FXTA 1GD4A 3OWUA 2F99A 3CPW2 2BNGA 4L8PA 3G713 3CNXA 4R1KA 2XSOB 3UL5A 3ROBA 1Y4KA 3TDGA 1GY5A 3CU3A 3O8YA 2CWVA 1N8R4 5IW9A 1AR0A 3JUQA 3GZYB 2INXA 3X3XA 4XBTA 1VQ43 1KQS2 1JB5A 3LTBA 3WODG 4R4KA 3CCE3 2GU1A 1JB2A 2BT3A 1JRQA 3V99A 3CCU3 1A2VA 2CC3A 1W7CA 2ML6A 1RKYA 1JN5B 3DGMA 3K7CA 1VQL3 1A2KA 3STDA 3N9HA 3UB1A 2OOVC 3JUNA 4MMYB 2P05A 1NDOB 5JPPA 5IG4A 1CYVA 1N9EA 1K28A 1SQWA 2CWUA 2HMMB 1IK3A 4NREA 1YHQ3 5AYSC 3B4OA 2F86B 5ELJA 4N6LA 4EV5A 2QA43 1M1K4 1KD14 3CPOA 3MHEA 3N54B 1VQK3 1KWIA 1IT7A 4WWUC 1ZO2A 1VQ93 4WFOA 1QMAA 5JPUA 1QAKA 2XGNA 3DUKA 4N3VA 1OF5B 3NM2A 4RNYA 1W02A 3PYJA 2Q07A 2W56B 1IVVA 2CFGA 2RGQA 3MSOA 4PEJA 2XSHB 3CCV3 4XDVA 1K9M4 3B8LA 3X3YA 1JKGB 2WO0A 4KFEA 3WOEB 2P38A 3EX9A 3NQYA 5IEPA 5KP1A 3CCS3 2Z77A 2GU3A 2W9QA 3CNMA 3FCSB 5BVBA 1NO3A 3G4S3 1IVUA 2MC8A 2CFKA 2QEX3 3F14A 4N6MA 1IVWA 1U8CB 3HK4A 1VQ53 3EHCA 3HZPA 2W04A 1OGZA 1QAFA 2OOVA 1NB3I 3NUVA 3VGNA 3RGAA 1VQ83 5ELUA 2FGTA 2XFTA 1EG9B 4K1UA 2ZL8A 1RN7A 5D83A 3WA3A 2CWTA 1Q7Y4 3A76A 4O2HA 1U5OA 2ZDJA 3G0KA 3LT9A 1VQ73 1S5AA 3EBTA 1DYUA 1JB4A 3F8HA 4BTWA 2B24B 2YFIB 1A67A 4GB5A 1OPYA 1OF5A 2Y73A 1FGMA 1W6CA 1WMOA 4N6UA 3G16A 4RBNA 1NJI4 2W56A 1SPUA 1FGRA 3IJEB 3NQZA 4FMDA 4HM7B 4H61A 1JKGA 1ULIB 1JNQA 1IDPA 3UNLA 1STDA 1Z1SA 2IA7A 4O02B 2HMLB 2PZVA 3FH1A 1WMNA 1W2ZA 2E2TA 3KZTA 2GEXA 1TP6A 4NHFA 4IT7A 1LNHA 3FG4A 3LZAA 3PZWA 4KZ1A 3VSYA 1K8A4 4HM0B 2Z6BA 4FCJA 4OK0A 1MNLA 2IMJA 4HJLB 3N8BA 1TIJA 4R80A 1IVXA 1FGTA 1V74A 2W2CA 1SIHA 2GBXB 1N5HA 2LYXA 2YX9A 3OWSA 1NB5I 3OX9A 3FF0A 4KFDA 3KN4A 1TFOA 4CDLA 4KFFA 3VF1A 3DXOA 3X42A 3J7Yd 1FA3A 5A0OB 2KRTA 4EC6A 1O7PB 5D82A 5DREA 3I0YA 4RNZA 4XBXA 1O7WB 8CHOA 2WOHA 3FLJA 1S723 1ISKA 1O7GB 3EC9A 1AVKA 5FGOA 5AYRB 3DMCA 3U97A 1AVLA 3KKGA 3G6E3 3FKAA 1PU4A 3PGBA 3PS8A 3ECFA 2WGOA 5AEWB 5CF1A 5CLKA 1TUHA 2OWPA 2W03A 3UL6A 3WOFB 3KE7A 5CF2A 5IG3A 1W2B2 2YFJB 4TX4A 2C11A 1ULJB 6STDA 3L0RA 3RGRA 2BHMA 5BXQA 2Z7AA 4L8OA 3HIGA 4L7KA 3BNDA 5IEOA 1O7HB 2YFLB 3CCR3 4OVMA 4K61A 5AIFA 3S28A 3CCL3 1HKXA 3F9SA 2F98A 3SXXA 2HMJB 2OTJ3 3K63A 4LGQA 1FGQA 4N6V0 2P0MA 2BMQB 4MJDA 1YIT3 1GY7A 3BNBA 3B7CA 1RJOA 1OUNA 3GZXB 3EN8A 3KIIA 4ZM8A 4HM8B 1OHOA 5HGRA 1YVBI 4Q53A 2RSXA 3BNEA 2BMRB 5DRVA 1DMQA 2XGLA 3EQQB 3X41A 1RRHA 1GYBA 4HM1B 1FGOA 3GZRA 2MF7A 1ROVA 1C7HA 2GBWB 4K90B 3DGNA 3GAXA 3MG3A 2HMNB 1US1A 2K54A 3QRDA 3F7SA 1IU7A 4EV2A 2O9UX 3PCSA 1TFKA 2STDA 4XBYA 2D1WA 3D9RA 2K0MA 2ML5A 3CC73 1Q40B 3NBJA 4KVHA 3SLUA 3ER7A 4GL6A 3U1WA 2JQ5A 4HM6B 3MPHA 2CFLA 3Q90A 1CYUA 3GRDA 1YI23 4FMAA 1VQN3 1JN5A 4ORLA 4JF8A 1M904 4AEQA 1PFPA 2M7OA 3T8NA 3CCQ3 3CMA3 1W00A 2PNCA 3EE1A 5KP3A 2W9PA 1EA2A 2KXGA 1KSIA 2RFRA 2OQEC 4HM3B 1Q824 4HZ9B 3H51A 3NX0A 4WP5A 1WNHA 1OACA 2W0QA 1YIJ3 3IMAB 1NU3A 3K0ZA 4FCMA 4X2HA 2CKFB 3H3HA 3Q2PA 3CXC2 3E99A 1UUWB 3KSED 1IT8A 3LOYA 5CXOA 1WTHA 1W6YA 4O3VA 4MMZB 3BNCA 2P09A 4EXRA 1BUQA 5EEOA 3OW22 1E3VA 2OTL3 2CK3H 1QVG2 2GEYA 3ALAA 3OWYA 2P0XA 5JBSA 3JUMA 1T5YA 1O7MB 1N9JA 3MWZA 5IERA 3MKIA 5IENA 3LTCA 1Q42A 5AI1A 1OH0A 1Q40A 3RDEA 1M1XB 4CCVA 3T0UA 1RRLA 4XDWA 3SEDA 4FMCA 1OGXA 3X40A 1D6YA 2RCDA 1FUWA 5EVHA 4LMIA 1UI7A 5FW5A 1W5ZA 1K734 4FCZA 3FGYA 3B4PA 3LT8A 2IUKA 3NM7A 4IIAA 2OQEA 1QALA 2A15A 3DY5A 4BTYA 3UJMA 3LTAA 3EBYA 3IPTA 1O7NB 4X2OA 4STDA 3HX8A 1SIIA 1G96A 1F8NA 2XFSA 3JUOA 1Q814 1GS3A 1ASKA 2HMOB 3S5CA 3V98A 3S29A 3JVCA 1VZZA 1ROAA 4EBGA 3HIIA 2UX0A 3DM8A 4N6NB 3BLZA 3SVAA 1IQ8A 3MYTA 2FNQA 2BMOB 4LZIA 3V92A 1GY6A 3OV4A 5AIIA 3GWRA 1VQO3 1E3RA 2CW9A 4WHAA 4MEIA 2OCTA 2KCDA 3FF2A 3F7XA 3EB8A 4HKVB 2JDIH 4I4KA 1SJWA 3CCM3 1WQLB 1YGEA 1M9GA 1W6GA 3DZLA 4G1MB 4OUQA 5IG5A 5STDA 5EQLA 1J2BA 3S27A 3NHXA 3D3LA 4HM4B 2SBLA 5TGNA 4RZMA 3FZWA 1WMPA 1DMMA 2GXFA 3EF8A 4JRFA 1UI8A 2C10A 4R9KA 2CIUA 3EN1B 1JJ22 5AIHA 1E97A 5KP4A 3FG1A 5I97A 5D81A 1AV4A 4HVNA 2E2UA 2XR8B 3LXUX 1ZX2A 3MG2A 4J9AA 4XB5A 1IQXA 4MMXB 1LVNA 4J8TA 1Q864 3PCRA 1DVCA 3NV0B 2W6JH 1YJ93 1W4NA 2Y74A 5CK6A 3WA2X 1IV7A 4H3UA 2CG0A 3BB9A 5LC6A 4K1VA 2Z76A 3DGOA 1IV9A 3S67A 1IQYA 4U13A 3CME3 3SOAA 3CCJ3 3WDGB 3NXJA 1OHSA 4FMBA 3F8XA 2CFWA 3CC23 4HZBB 2LQVA 4AKYA 1KC84 4HM5B 4WYKB 1YJN3 2QIYA 3DGLA 5LC7A 5AEUB 3I553 1LXEA 2E2VA 1D6ZA 3X3ZA 2XEPA 3I563 3NBRA 1OCVA 1W01A 4HM2B 1LOXA 3AMOB 3F40A 2XF3A 3K9MC 5IF6A 1A90A 1UUVB 2CH9A 3G8ZA 4LEHA 4N6OB 1HU9A 1VQM3 3QK9A 3NV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5P A;  2BO9 B;  1ROA A;  4N6T A;  2W9Q A;  1R4C A;  4N6N B;  1CEW I;  3SVA A;  4EYC A;  4N6V 0;  4LZI A;  4N6M A;  1GD3 A;  4ZM8 A;  1YVB I;  3KFQ C;  1NB3 I;  2OCT A;  5ELU A;  1STF I;  1RN7 A;  1M9G A;  3PXM A;  1MOL A;  3GAX A;  3QRD A;  3LH4 A;  5EQL A;  2O9U X;  1A67 A;  1EQK A;  4N6U A;  1CYU A;  1PFP A;  1DVD A;  2W9P A;  2KXG A;  1GD4 A;  3NX0 A;  3UL5 A;  1WNH A;  3IMA B;  4IT7 A;  3Q2P A;  3KSE D;  1DVC A;  1MNL A;  1IV7 A;  1TIJ A;  5LC6 A;  1IV9 A;  3S67 A;  1N9J A;  3MWZ A;  1N5H A;  1NB5 I;  4CCV A;  1FA3 A;  1CYV A;  5A0O B;  5LC7 A;  5ELJ A;  4N6L A;  1FUW A;  1LXE A;  1KWI A;  3PS8 A;  3K9M C;  3UL6 A;  3PYJ A;  1A90 A;  2CH9 A;  4N6O B;  4TX4 A;  3L0R A;  1G96 A; 
#chains in the Genus database with same CATH topology
 1YJW 3;  1VQP 3;  1N5P A;  2BO9 B;  3SOY A;  1AY7 A;  1RGL A;  1VQQ A;  1LNI A;  4HBR A;  4CPK A;  4N6T A;  2XH9 A;  2CG1 A;  1R4C A;  1L5G B;  4HAA A;  3FG3 A;  1CEW I;  1BGS A;  2R4I A;  3FSD A;  3LML A;  4EYC A;  3CC4 3;  4QWT A;  3GZB A;  1RCK A;  2UUG C;  1EKM A;  3LYG A;  1D6U A;  1GD3 A;  1G0T A;  2QGU A;  1PY3 A;  2WOF A;  1CQS A;  1TU5 A;  4FR9 A;  4DKI A;  1I8V A;  1DET A;  3EJV A;  4BL3 A;  3T8U A;  2I9W A;  3KFQ C;  3SX1 A;  1VQ6 3;  3LTD A;  4WYK A;  2AAE A;  2D42 A;  2XRX B;  1QVF 2;  1B27 A;  1FZU A;  1T3B A;  3KSP A;  1STF I;  2IUJ A;  3WMD A;  4IPB A;  3K5T A;  4HYZ A;  3M8C A;  2V1L A;  2O3O A;  5BU4 A;  3PXM A;  3DGY A;  1MOL A;  3LH4 A;  4O8S A;  3JUP A;  2CHC A;  1OHP A;  4LSO A;  4XM4 A;  1ZGX A;  3CD6 3;  3Q1C A;  3OXA A;  1MWT A;  1QJG A;  4R9L A;  5IG0 A;  2L4V A;  1N8Q A;  3AMO A;  3MG1 A;  1JV2 B;  1K41 A;  2WGQ A;  5G2G A;  1EQK A;  2B1X B;  1I3I A;  1B20 A;  1CH0 A;  2AAD A;  7STD A;  4AKZ A;  1DMN A;  1NWW A;  3BU4 A;  4BTX A;  1FYS A;  3AHW A;  3RNT A;  3NBB A;  1DVD A;  1UW1 A;  2HMK B;  1G02 A;  2CFD A;  5AIG A;  3HI7 A;  1TRQ A;  2FXT A;  2F5M A;  1GD4 A;  3OWU A;  2F99 A;  4HOH A;  2R41 A;  3CPW 2;  2BNG A;  4L8P A;  3G71 3;  3CNX A;  4R1K A;  2XSO B;  3UL5 A;  3ROB A;  1Y4K A;  3TDG A;  1GY5 A;  3CU3 A;  3O8Y A;  2CWV A;  1RDS A;  1N8R 4;  5IW9 A;  1AR0 A;  3JUQ A;  3GZY B;  2INX A;  3X3X A;  2IY2 A;  4XBT A;  3ZG0 A;  1VQ4 3;  1KQS 2;  1JB5 A;  3A5E A;  3LTB A;  3WOD G;  4R4K A;  1UCL A;  2GU1 A;  3CCE 3;  1JB2 A;  2BT3 A;  1JRQ A;  5M19 A;  3V99 A;  3CCU 3;  1A2V A;  1BNI A;  2KF3 A;  2CC3 A;  1W7C A;  2ML6 A;  1RKY A;  1JN5 B;  3DGM A;  3ZFZ A;  1RGC A;  3HOH A;  1B2U A;  3K7C A;  1VQL 3;  1A2K A;  3STD A;  3N9H A;  3UB1 A;  2OOV C;  3JUN A;  4MMY B;  1BRH A;  2P05 A;  1BAN A;  1NDO B;  5JPP A;  1BNG A;  1RNT A;  1BSA A;  1I3F A;  1CYV A;  1N9E A;  1K28 A;  1SQW A;  2CWU A;  2HMM B;  1LOY A;  3D79 A;  4NRE A;  1IK3 A;  1YHQ 3;  5BIR A;  5AYS C;  3B4O A;  1JBR A;  2F86 B;  5ELJ A;  4N6L A;  4EV5 A;  2QA4 3;  1M1K 4;  1KD1 4;  3CPO A;  3MHE A;  3N54 B;  1JZO A;  1VQK 3;  1KWI A;  1IT7 A;  1LRA A;  4WWU C;  1ZO2 A;  1VQ9 3;  4WFO A;  1QMA A;  1RGG A;  4BU4 A;  5JPU A;  1QAK A;  3KCH A;  2XGN A;  3DUK A;  4N3V A;  2HOH A;  1OF5 B;  1SAR A;  1RGA A;  3NM2 A;  4RNY A;  1W02 A;  3PYJ A;  3SYU A;  1NNV A;  2Q07 A;  2W56 B;  1IVV A;  2CFG A;  2RGQ A;  3MSO A;  4PEJ A;  1X1U A;  2XSH B;  2KF5 A;  4XDV A;  3CCV 3;  1K9M 4;  1JBS A;  3B8L A;  3X3Y A;  1JKG B;  2WO0 A;  4KFE A;  1LQM B;  2P38 A;  3EX9 A;  3NQY A;  3WOE B;  5IEP A;  5KP1 A;  3CCS 3;  1IYY A;  2Z77 A;  2GU3 A;  2W9Q A;  3CNM A;  3FCS B;  5BVB A;  2K3D A;  1BRJ A;  1NO3 A;  2H0H A;  1IVU A;  3G4S 3;  1I70 A;  2MC8 A;  2CFK A;  2QEX 3;  2SAR A;  3F14 A;  4N6M A;  1IVW A;  1U8C B;  4GHO A;  3HK4 A;  1VQ5 3;  1ZS7 A;  3EHC A;  8RNT A;  3HZP A;  2W04 A;  1OGZ A;  1QAF A;  2OOV A;  1NB3 I;  3NUV A;  3VGN A;  3RGA A;  1VQ8 3;  5ELU A;  2FGT A;  1BUJ A;  2XFT A;  1EG9 B;  1RN1 A;  1RN4 A;  2ZL8 A;  4K1U A;  1T2I A;  1B2M A;  1RN7 A;  2C4B A;  5D83 A;  3WA3 A;  2CWT A;  1Q7Y 4;  1FUS A;  3A76 A;  4O2H A;  1U5O A;  2ZDJ A;  3G0K A;  3LT9 A;  1VQ7 3;  1MGW A;  1S5A A;  3EBT A;  1DYU A;  1JB4 A;  3F8H A;  4BTW A;  2B24 B;  2YFI B;  1A67 A;  4GB5 A;  1OPY A;  1OF5 A;  2Y73 A;  1FGM A;  1W6C A;  1WMO A;  4N6U A;  3G16 A;  4RBN A;  1NJI 4;  2W56 A;  1SPU A;  1FGR A;  3IJE B;  3NQZ A;  4FMD A;  4HM7 B;  4H61 A;  1JKG A;  1ULI B;  1JNQ A;  1IDP A;  3UNL A;  1STD A;  1Z1S A;  2IA7 A;  4NPB A;  4O02 B;  1EEJ A;  1I0X A;  2HML B;  2PZV A;  1RMS A;  3FH1 A;  1WMN A;  1W2Z A;  2E2T A;  3KZT A;  2GEX A;  1TP6 A;  4NHF A;  4IT7 A;  4RNT A;  1HYF A;  2RBI A;  1I2E A;  1YGW A;  1LNH A;  3FG4 A;  3LZA A;  3PZW A;  4KZ1 A;  2IYJ A;  3VSY A;  1K8A 4;  4HM0 B;  2CX0 A;  2Z6B A;  4FCJ A;  4OK0 A;  1MNL A;  1UCI A;  2IMJ A;  4HJL B;  1MGR A;  3N8B A;  1TIJ A;  4R80 A;  1IVX A;  1FGT A;  5RNT A;  1V74 A;  2W2C A;  1SIH A;  2GBX B;  1I2G A;  1N5H A;  2LYX A;  2YX9 A;  3OWS A;  1NB5 I;  3OX9 A;  1JZD A;  2KAA A;  3FF0 A;  4KFD A;  4I5Q A;  3KN4 A;  1TFO A;  4CDL A;  4J5K A;  4KFF A;  3VF1 A;  3DXO A;  3X42 A;  1UGI A;  3J7Y d;  1FA3 A;  5A0O B;  2KRT A;  4EC6 A;  1UCK A;  1I2F A;  1B2Z A;  1O7P B;  5D82 A;  5DRE A;  3I0Y A;  4RNZ A;  2KF4 A;  4XBX A;  1O7W B;  8CHO A;  2WOH A;  3FLJ A;  1S72 3;  1ISK A;  1O7G B;  3EC9 A;  1AVK A;  2BIR A;  5FGO A;  5AYR B;  3DMC A;  3U97 A;  1AVL A;  1T2H A;  3KKG A;  2H0G A;  3FKA A;  1PU4 A;  3G6E 3;  3PGB A;  3PS8 A;  7RNT A;  3ECF A;  1RGF A;  1UDI I;  2WGO A;  5AEW B;  5CF1 A;  5CLK A;  3ZG5 A;  1TUH A;  2OWP A;  2W03 A;  3UL6 A;  3WOF B;  3KE7 A;  5CF2 A;  5IG3 A;  1W2B 2;  2YFJ B;  4TX4 A;  2C11 A;  1ULJ B;  6STD A;  3L0R A;  3RGR A;  2BHM A;  5BXQ A;  7GSP A;  2F56 A;  1RHL A;  2Z7A A;  4L8O A;  4LYL B;  3HIG A;  1BRS A;  3BND A;  4L7K A;  1O7H B;  2YFL B;  5IEO A;  4OVM A;  3CCR 3;  4K61 A;  5AIF A;  1BOX A;  3S28 A;  1HKX A;  3F9S A;  3CCL 3;  2F98 A;  1GOV A;  3SXX A;  1RGH A;  2GSP A;  2HMJ B;  2OTJ 3;  3K63 A;  4LGQ A;  1FGQ A;  4N6V 0;  2P0M A;  2BMQ B;  4MJD A;  1YIT 3;  1GY7 A;  3BNB A;  3B7C A;  1RJO A;  1OUN A;  3GZX B;  3EN8 A;  3KII A;  1BNR A;  4ZM8 A;  1BRG A;  4HM8 B;  1OHO A;  5HGR A;  1YVB I;  4EW5 A;  4Q53 A;  2RSX A;  3BNE A;  2BMR B;  1UCJ A;  5DRV A;  1DMQ A;  2XGL A;  3EQQ B;  3X41 A;  1BSE A;  1RRH A;  1GYB A;  4HM1 B;  1FGO A;  3Q3F A;  3GZR A;  5G1L A;  1ROV A;  2GBW B;  1C7H A;  1BVI A;  2MF7 A;  4K90 B;  3DGN A;  3GAX A;  3MG3 A;  2HMN B;  1US1 A;  2K54 A;  1EUI C;  3QRD A;  3F7S A;  1IU7 A;  1YVS A;  2O9U X;  4EV2 A;  3PCS A;  1TFK A;  2STD A;  4XBY A;  2D1W A;  3D9R A;  2K0M A;  2ML5 A;  3CC7 3;  1Q40 B;  3NBJ A;  4KVH A;  3SLU A;  3ER7 A;  4GL6 A;  3U1W A;  2JQ5 A;  4HM6 B;  3MPH A;  2CFL A;  3Q90 A;  1CYU A;  3GRD A;  1YI2 3;  4FMA A;  1VQN 3;  1JN5 A;  1TTO A;  4ORL A;  1GMR A;  4JF8 A;  5HOH A;  1M90 4;  4AEQ A;  1PFP A;  2M7O A;  3T8N A;  3CCQ 3;  3CMA 3;  1W00 A;  2PNC A;  3EE1 A;  5KP3 A;  2W9P A;  1EA2 A;  2KXG A;  1KSI A;  2RFR A;  2OQE C;  4HM3 B;  1Q82 4;  4HZ9 B;  2ZHX B;  3H51 A;  3NX0 A;  4WP5 A;  1WNH A;  1B3S A;  1OAC A;  2W0Q A;  1YIJ 3;  3IMA B;  1NU3 A;  3K0Z A;  1LQG C;  4FCM A;  4X2H A;  2CKF B;  4BIR A;  1Q9E A;  1X1X A;  3H3H A;  1B21 A;  3AGO A;  3E99 A;  1UUW B;  1RCL A;  3KSE D;  1IT8 A;  3LOY A;  3Q2P A;  3CXC 2;  3URP A;  5CXO A;  1WTH A;  1W6Y A;  4O3V A;  4MMZ B;  2UGI A;  3BNC A;  2P09 A;  4EXR A;  1BUQ A;  1UGH I;  5EEO A;  1RNB A;  3OW2 2;  1A2P A;  1E3V A;  1MWS A;  2OTL 3;  1RLS A;  2CK3 H;  2GEY A;  3ALA A;  1PYL A;  1QVG 2;  3OWY A;  2P0X A;  1FW7 A;  5JBS A;  5IG4 A;  1GOY A;  3JUM A;  1T5Y A;  1O7M B;  1N9J A;  3MWZ A;  5IER A;  3MKI A;  5IEN A;  3LTC A;  1Q42 A;  5AI1 A;  1HZ1 A;  2KF6 A;  1OH0 A;  1Q40 A;  3RDE A;  1M1X B;  4CCV A;  3T0U A;  6RNT A;  1BRI A;  1RRL A;  1GMQ A;  4XDW A;  3SED A;  4FMC A;  1AQZ A;  1OGX A;  3X40 A;  3WR2 A;  1D6Y A;  2RCD A;  9RNT A;  1FUW A;  5EVH A;  4LMI A;  1UI7 A;  1GOU A;  5FW5 A;  1W5Z A;  4GSP A;  1K73 4;  1Q7H A;  4FCZ A;  3FGY A;  1BSB A;  3B4P A;  1GMP A;  1RSN A;  3LT8 A;  2IUK A;  1RTU A;  3NM7 A;  4IIA A;  2OQE A;  1QAL A;  2A15 A;  3DY5 A;  4BTY A;  3D5I A;  1RGE A;  5M18 A;  3UJM A;  3LTA A;  3EBY A;  3IPT A;  1O7N B;  4X2O A;  4STD A;  3BIR A;  3HX8 A;  1SII A;  1G96 A;  1F8N A;  2XFS A;  3JUO A;  1Q81 4;  1GS3 A;  1ASK A;  2HMO B;  3S5C A;  3V98 A;  1GSP A;  1DE3 A;  3S29 A;  3JVC A;  1VZZ A;  1ROA A;  4EBG A;  6GSP A;  3HII A;  2UX0 A;  3DM8 A;  4N6N B;  3BLZ A;  1BU4 A;  3SVA A;  1IQ8 A;  3MYT A;  2FNQ A;  3WHO A;  2BMO B;  4LZI A;  2H0I A;  3V92 A;  1GY6 A;  3OV4 A;  5AII A;  1BNJ A;  3GWR A;  1VQO 3;  1E3R A;  2CW9 A;  4WHA A;  4MEI A;  5M1A A;  2BU4 A;  5GSP A;  2OCT A;  2KCD A;  3FF2 A;  3F7X A;  1MWU A;  1JBT A;  3EB8 A;  4HKV B;  2JDI H;  4I4K A;  1SJW A;  3CCM 3;  1YGE A;  1WQL B;  1M9G A;  1W6G A;  3DZL A;  1LOV A;  3D5G A;  4G1M B;  1X1Y A;  1LOW A;  4OUQ A;  5IG5 A;  2J8X B;  4CJN A;  5STD A;  5EQL A;  1J2B A;  3S27 A;  3NHX A;  1BNS A;  3D3L A;  4HM4 B;  2SBL A;  3DH2 A;  5TGN A;  4RZM A;  1C54 A;  3FZW A;  3GSP A;  1WMP A;  1BNF A;  1DMM A;  2F4Y A;  2GXF A;  3EF8 A;  1R4Y A;  1V57 A;  1V58 A;  4JRF A;  4J5G A;  4KT3 B;  1UI8 A;  2C10 A;  1UUG B;  4R9K A;  2F5W A;  2CIU A;  4ILF A;  3EN1 B;  1JJ2 2;  5AIH A;  1E97 A;  1YNV X;  1BRN L;  3AHS A;  5KP4 A;  3AGN A;  2L1S A;  2ZA4 A;  3FG1 A;  5I97 A;  5D81 A;  1BNE A;  1AV4 A;  4HVN A;  2E2U A;  2CX1 A;  2XR8 B;  1BRK A;  3LXU X;  1ZX2 A;  3MG2 A;  4J9A A;  4XB5 A;  1IQX A;  4MMX B;  1LVN A;  4J8T A;  1Q86 4;  3PCR A;  1DVC A;  3NV0 B;  2W6J H;  1YJ9 3;  1W4N A;  2Y74 A;  1I0V A;  5CK6 A;  3WA2 X;  4BL2 A;  1IV7 A;  4H3U A;  1B2S A;  2CG0 A;  3BB9 A;  5LC6 A;  4K1V A;  2Z76 A;  3DGO A;  1IV9 A;  3S67 A;  1IQY A;  3D4A A;  4U13 A;  3CME 3;  1X1W A;  3SOA A;  1BAO A;  3CCJ 3;  3WDG B;  3NXJ A;  1OHS A;  4FMB A;  3F8X A;  2CFW A;  3CC2 3;  4HZB B;  2LQV A;  2RNT A;  1B2X A;  4HM5 B;  4AKY A;  4WYK B;  1KC8 4;  1YJN 3;  1BIR A;  1MWR A;  2QIY A;  3DGL A;  5LC7 A;  5AEU B;  3I55 3;  1LXE A;  1TRP A;  1RGK A;  2E2V A;  1TJD A;  1D6Z A;  3X3Z A;  2XEP A;  3I56 3;  3NBR A;  1BSC A;  1FUT A;  1OCV A;  1W01 A;  5G1K A;  4HM2 B;  1LOX A;  3AMO B;  3F40 A;  2XF3 A;  3K9M C;  5IF6 A;  1BSD A;  1A90 A;  1UUV B;  2CH9 A;  3G8Z A;  4LEH A;  4N6O B;  1HU9 A;  1VQM 3;  3QK9 A;  3NV0 A; 
#chains in the Genus database with same CATH homology
 1YJW 3;  1VQP 3;  1N5P A;  2BO9 B;  3SOY A;  4HBR A;  4N6T A;  2XH9 A;  2CG1 A;  1R4C A;  1L5G B;  3FG3 A;  1CEW I;  2R4I A;  3FSD A;  3LML A;  4EYC A;  3CC4 3;  4QWT A;  3GZB A;  1EKM A;  3LYG A;  1D6U A;  1GD3 A;  2QGU A;  2WOF A;  1CQS A;  1TU5 A;  4FR9 A;  3EJV A;  3T8U A;  2I9W A;  3KFQ C;  3SX1 A;  1VQ6 3;  3LTD A;  4WYK A;  2D42 A;  2XRX B;  1QVF 2;  3WMD A;  3KSP A;  2IUJ A;  1STF I;  4IPB A;  3K5T A;  4HYZ A;  3M8C A;  2V1L A;  2O3O A;  3PXM A;  1MOL A;  3LH4 A;  4O8S A;  3JUP A;  2CHC A;  1OHP A;  4LSO A;  4XM4 A;  3CD6 3;  3Q1C A;  3OXA A;  1QJG A;  4R9L A;  5IG0 A;  2L4V A;  1N8Q A;  3AMO A;  3MG1 A;  1JV2 B;  1K41 A;  2WGQ A;  5G2G A;  1EQK A;  2B1X B;  7STD A;  4AKZ A;  1DMN A;  1NWW A;  4BTX A;  3NBB A;  1DVD A;  1UW1 A;  2HMK B;  2CFD A;  5AIG A;  3HI7 A;  2FXT A;  1GD4 A;  3OWU A;  2F99 A;  3CPW 2;  2BNG A;  4L8P A;  3G71 3;  3CNX A;  4R1K A;  2XSO B;  3UL5 A;  3ROB A;  1Y4K A;  3TDG A;  1GY5 A;  3CU3 A;  3O8Y A;  2CWV A;  1N8R 4;  5IW9 A;  1AR0 A;  3JUQ A;  3GZY B;  2INX A;  3X3X A;  4XBT A;  1VQ4 3;  1KQS 2;  1JB5 A;  3LTB A;  3WOD G;  4R4K A;  3CCE 3;  2GU1 A;  1JB2 A;  2BT3 A;  1JRQ A;  3V99 A;  3CCU 3;  1A2V A;  2CC3 A;  1W7C A;  2ML6 A;  1RKY A;  1JN5 B;  3DGM A;  3K7C A;  1VQL 3;  1A2K A;  3STD A;  3N9H A;  3UB1 A;  2OOV C;  3JUN A;  4MMY B;  2P05 A;  1NDO B;  5JPP A;  5IG4 A;  1CYV A;  1N9E A;  1K28 A;  1SQW A;  2CWU A;  2HMM B;  1IK3 A;  4NRE A;  1YHQ 3;  5AYS C;  3B4O A;  2F86 B;  5ELJ A;  4N6L A;  4EV5 A;  2QA4 3;  1M1K 4;  1KD1 4;  3CPO A;  3MHE A;  3N54 B;  1VQK 3;  1KWI A;  1IT7 A;  4WWU C;  1ZO2 A;  1VQ9 3;  4WFO A;  1QMA A;  5JPU A;  1QAK A;  2XGN A;  3DUK A;  4N3V A;  1OF5 B;  3NM2 A;  4RNY A;  1W02 A;  3PYJ A;  2Q07 A;  2W56 B;  1IVV A;  2CFG A;  2RGQ A;  3MSO A;  4PEJ A;  2XSH B;  3CCV 3;  4XDV A;  1K9M 4;  3B8L A;  3X3Y A;  1JKG B;  2WO0 A;  4KFE A;  3WOE B;  2P38 A;  3EX9 A;  3NQY A;  5IEP A;  5KP1 A;  3CCS 3;  2Z77 A;  2GU3 A;  2W9Q A;  3CNM A;  3FCS B;  5BVB A;  1NO3 A;  3G4S 3;  1IVU A;  2MC8 A;  2CFK A;  2QEX 3;  3F14 A;  4N6M A;  1IVW A;  1U8C B;  3HK4 A;  1VQ5 3;  3EHC A;  3HZP A;  2W04 A;  1OGZ A;  1QAF A;  2OOV A;  1NB3 I;  3NUV A;  3VGN A;  3RGA A;  1VQ8 3;  5ELU A;  2FGT A;  2XFT A;  1EG9 B;  4K1U A;  2ZL8 A;  1RN7 A;  5D83 A;  3WA3 A;  2CWT A;  1Q7Y 4;  3A76 A;  4O2H A;  1U5O A;  2ZDJ A;  3G0K A;  3LT9 A;  1VQ7 3;  1S5A A;  3EBT A;  1DYU A;  1JB4 A;  3F8H A;  4BTW A;  2B24 B;  2YFI B;  1A67 A;  4GB5 A;  1OPY A;  1OF5 A;  2Y73 A;  1FGM A;  1W6C A;  1WMO A;  4N6U A;  3G16 A;  4RBN A;  1NJI 4;  2W56 A;  1SPU A;  1FGR A;  3IJE B;  3NQZ A;  4FMD A;  4HM7 B;  4H61 A;  1JKG A;  1ULI B;  1JNQ A;  1IDP A;  3UNL A;  1STD A;  1Z1S A;  2IA7 A;  4O02 B;  2HML B;  2PZV A;  3FH1 A;  1WMN A;  1W2Z A;  2E2T A;  3KZT A;  2GEX A;  1TP6 A;  4NHF A;  4IT7 A;  1LNH A;  3FG4 A;  3LZA A;  3PZW A;  4KZ1 A;  3VSY A;  1K8A 4;  4HM0 B;  2Z6B A;  4FCJ A;  4OK0 A;  1MNL A;  2IMJ A;  4HJL B;  3N8B A;  1TIJ A;  4R80 A;  1IVX A;  1FGT A;  1V74 A;  2W2C A;  1SIH A;  2GBX B;  1N5H A;  2LYX A;  2YX9 A;  3OWS A;  1NB5 I;  3OX9 A;  3FF0 A;  4KFD A;  3KN4 A;  1TFO A;  4CDL A;  4KFF A;  3VF1 A;  3DXO A;  3X42 A;  3J7Y d;  1FA3 A;  5A0O B;  2KRT A;  4EC6 A;  1O7P B;  5D82 A;  5DRE A;  3I0Y A;  4RNZ A;  4XBX A;  1O7W B;  8CHO A;  2WOH A;  3FLJ A;  1S72 3;  1ISK A;  1O7G B;  3EC9 A;  1AVK A;  5FGO A;  5AYR B;  3DMC A;  3U97 A;  1AVL A;  3KKG A;  3G6E 3;  3FKA A;  1PU4 A;  3PGB A;  3PS8 A;  3ECF A;  2WGO A;  5AEW B;  5CF1 A;  5CLK A;  1TUH A;  2OWP A;  2W03 A;  3UL6 A;  3WOF B;  3KE7 A;  5CF2 A;  5IG3 A;  1W2B 2;  2YFJ B;  4TX4 A;  2C11 A;  1ULJ B;  6STD A;  3L0R A;  3RGR A;  2BHM A;  5BXQ A;  2Z7A A;  4L8O A;  3HIG A;  4L7K A;  3BND A;  5IEO A;  1O7H B;  2YFL B;  3CCR 3;  4OVM A;  4K61 A;  5AIF A;  3S28 A;  3CCL 3;  1HKX A;  3F9S A;  2F98 A;  3SXX A;  2HMJ B;  2OTJ 3;  3K63 A;  4LGQ A;  1FGQ A;  4N6V 0;  2P0M A;  2BMQ B;  4MJD A;  1YIT 3;  1GY7 A;  3BNB A;  3B7C A;  1RJO A;  1OUN A;  3GZX B;  3EN8 A;  3KII A;  4ZM8 A;  4HM8 B;  1OHO A;  5HGR A;  1YVB I;  4Q53 A;  2RSX A;  3BNE A;  2BMR B;  5DRV A;  1DMQ A;  2XGL A;  3EQQ B;  3X41 A;  1RRH A;  1GYB A;  4HM1 B;  1FGO A;  3GZR A;  2MF7 A;  1ROV A;  1C7H A;  2GBW B;  4K90 B;  3DGN A;  3GAX A;  3MG3 A;  2HMN B;  1US1 A;  2K54 A;  3QRD A;  3F7S A;  1IU7 A;  4EV2 A;  2O9U X;  3PCS A;  1TFK A;  2STD A;  4XBY A;  2D1W A;  3D9R A;  2K0M A;  2ML5 A;  3CC7 3;  1Q40 B;  3NBJ A;  4KVH A;  3SLU A;  3ER7 A;  4GL6 A;  3U1W A;  2JQ5 A;  4HM6 B;  3MPH A;  2CFL A;  3Q90 A;  1CYU A;  3GRD A;  1YI2 3;  4FMA A;  1VQN 3;  1JN5 A;  4ORL A;  4JF8 A;  1M90 4;  4AEQ A;  1PFP A;  2M7O A;  3T8N A;  3CCQ 3;  3CMA 3;  1W00 A;  2PNC A;  3EE1 A;  5KP3 A;  2W9P A;  1EA2 A;  2KXG A;  1KSI A;  2RFR A;  2OQE C;  4HM3 B;  1Q82 4;  4HZ9 B;  3H51 A;  3NX0 A;  4WP5 A;  1WNH A;  1OAC A;  2W0Q A;  1YIJ 3;  3IMA B;  1NU3 A;  3K0Z A;  4FCM A;  4X2H A;  2CKF B;  3H3H A;  3Q2P A;  3CXC 2;  3E99 A;  1UUW B;  3KSE D;  1IT8 A;  3LOY A;  5CXO A;  1WTH A;  1W6Y A;  4O3V A;  4MMZ B;  3BNC A;  2P09 A;  4EXR A;  1BUQ A;  5EEO A;  3OW2 2;  1E3V A;  2OTL 3;  2CK3 H;  1QVG 2;  2GEY A;  3ALA A;  3OWY A;  2P0X A;  5JBS A;  3JUM A;  1T5Y A;  1O7M B;  1N9J A;  3MWZ A;  5IER A;  3MKI A;  5IEN A;  3LTC A;  1Q42 A;  5AI1 A;  1OH0 A;  1Q40 A;  3RDE A;  1M1X B;  4CCV A;  3T0U A;  1RRL A;  4XDW A;  3SED A;  4FMC A;  1OGX A;  3X40 A;  1D6Y A;  2RCD A;  1FUW A;  5EVH A;  4LMI A;  1UI7 A;  5FW5 A;  1W5Z A;  1K73 4;  4FCZ A;  3FGY A;  3B4P A;  3LT8 A;  2IUK A;  3NM7 A;  4IIA A;  2OQE A;  1QAL A;  2A15 A;  3DY5 A;  4BTY A;  3UJM A;  3LTA A;  3EBY A;  3IPT A;  1O7N B;  4X2O A;  4STD A;  3HX8 A;  1SII A;  1G96 A;  1F8N A;  2XFS A;  3JUO A;  1Q81 4;  1GS3 A;  1ASK A;  2HMO B;  3S5C A;  3V98 A;  3S29 A;  3JVC A;  1VZZ A;  1ROA A;  4EBG A;  3HII A;  2UX0 A;  3DM8 A;  4N6N B;  3BLZ A;  3SVA A;  1IQ8 A;  3MYT A;  2FNQ A;  2BMO B;  4LZI A;  3V92 A;  1GY6 A;  3OV4 A;  5AII A;  3GWR A;  1VQO 3;  1E3R A;  2CW9 A;  4WHA A;  4MEI A;  2OCT A;  2KCD A;  3FF2 A;  3F7X A;  3EB8 A;  4HKV B;  2JDI H;  4I4K A;  1SJW A;  3CCM 3;  1WQL B;  1YGE A;  1M9G A;  1W6G A;  3DZL A;  4G1M B;  4OUQ A;  5IG5 A;  5STD A;  5EQL A;  1J2B A;  3S27 A;  3NHX A;  3D3L A;  4HM4 B;  2SBL A;  5TGN A;  4RZM A;  3FZW A;  1WMP A;  1DMM A;  2GXF A;  3EF8 A;  4JRF A;  1UI8 A;  2C10 A;  4R9K A;  2CIU A;  3EN1 B;  1JJ2 2;  5AIH A;  1E97 A;  5KP4 A;  3FG1 A;  5I97 A;  5D81 A;  1AV4 A;  4HVN A;  2E2U A;  2XR8 B;  3LXU X;  1ZX2 A;  3MG2 A;  4J9A A;  4XB5 A;  1IQX A;  4MMX B;  1LVN A;  4J8T A;  1Q86 4;  3PCR A;  1DVC A;  3NV0 B;  2W6J H;  1YJ9 3;  1W4N A;  2Y74 A;  5CK6 A;  3WA2 X;  1IV7 A;  4H3U A;  2CG0 A;  3BB9 A;  5LC6 A;  4K1V A;  2Z76 A;  3DGO A;  1IV9 A;  3S67 A;  1IQY A;  4U13 A;  3CME 3;  3SOA A;  3CCJ 3;  3WDG B;  3NXJ A;  1OHS A;  4FMB A;  3F8X A;  2CFW A;  3CC2 3;  4HZB B;  2LQV A;  4AKY A;  1KC8 4;  4HM5 B;  4WYK B;  1YJN 3;  2QIY A;  3DGL A;  5LC7 A;  5AEU B;  3I55 3;  1LXE A;  2E2V A;  1D6Z A;  3X3Z A;  2XEP A;  3I56 3;  3NBR A;  1OCV A;  1W01 A;  4HM2 B;  1LOX A;  3AMO B;  3F40 A;  2XF3 A;  3K9M C;  5IF6 A;  1A90 A;  1UUV B;  2CH9 A;  3G8Z A;  4LEH A;  4N6O B;  1HU9 A;  1VQM 3;  3QK9 A;  3NV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...