3CC43

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cc4300
1VQN3 1M904 1N8R4 3G6E3 1VQK3 1JJ22 1KQS2 1YJN3 1VQL3 1QVF2 1Q824 3CCS3 3CPW2 1Q864 3I553 1YI23 2OTL3 3CCR3 1KD14 3CMA3 1K734 1VQ83 1VQP3 2QA43 1YIT3 1YIJ3 3CD63 3CCE3 3CCQ3 2QEX3 1VQO3 1M1K4 1W2B2 1VQ63 3CCJ3 3OW22 3CCM3 3CC73 1Q814 1KC84 1YJW3 1VQ93 3CME3 1VQ73 1YHQ3 1VQ53 3CXC2 3CCV3 1Q7Y4 1VQ43 1S723 3CC43 1NJI4 1VQM3 1K9M4 3CC23 3G4S3 1YJ93 1K8A4 2OTJ3 3CCL3 3I563 1QVG2 3CCU3 3G713
chains in the Genus database with same CATH superfamily
1RGHA 2CX1A 1UW1A 3BB9A 5HOHA 4CCVA 3G16A 4LGQA 3SOAA 5AEUB 5JPUA 1RCKA 1UUGB 3K63A 2OWPA 3CMA3 1Q9EA 1VQ83 1BSAA 2QA43 1LOXA 3CD63 5D82A 2PNCA 3LTCA 4CJNA 3CCE3 3E99A 1I3IA 4H61A 2W03A 1JB5A 1OF5B 2ML6A 4WYKA 4EC6A 3LH4A 5IG0A 1STDA 1TJDA 4CDLA 3UJMA 3GSPA 2MC8A 1RGLA 2P0XA 1OHOA 3PZWA 2HMNB 4ILFA 3G8ZA 3OV4A 1IQ8A 1A2VA 2RFRA 3N9HA 2P0MA 1VQQA 1HYFA 2OOVC 1FZUA 3B4PA 3EF8A 3NV0A 3CC23 3MYTA 1K8A4 3D5IA 1OHSA 5AEWB 1ROVA 4WP5A 2Z76A 1PFPA 3EX9A 2FXTA 4HM2B 1FUTA 3EN8A 5AIIA 1RLSA 4BTYA 2XFTA 3BLZA 2CX0A 3LT8A 3FGYA 1HU9A 1OH0A 3OWSA 3PGBA 3PXMA 4FCJA 4KVHA 3MKIA 4IIAA 4R1KA 2W9PA 3RDEA 3RGAA 3ECFA 1SIIA 2OOVA 3AGNA 3T8NA 1IV9A 5DRVA 2OQEA 1EKMA 4XBXA 3X3XA 1MWUA 3I563 1BUQA 4R4KA 1R4YA 1NB5I 3UL5A 1LQGC 1BRIA 3CCV3 3VSYA 1D6UA 2F86B 2GU3A 4LEHA 4LYLB 2CG1A 4HZ9B 3FG4A 1BRNL 1BNEA 3DZLA 2CK3H 1NB3I 2Y73A 4GSPA 1OCVA 3NXJA 1LRAA 1UCIA 3ROBA 2CG0A 1AY7A 5CLKA 1UCLA 2BMOB 3K5TA 1LVNA 3BNEA 1W4NA 3LXUX 3OX9A 2Z6BA 2OCTA 3RGRA 1GD4A 2QEX3 4K90B 2IUJA 4JF8A 3MG1A 5JPPA 1BOXA 5A0OB 4KT3B 5G2GA 3CCM3 3NBBA 2KRTA 1O7WB 2RCDA 1IVXA 3NUVA 1MOLA 4X2HA 1CQSA 1GOVA 1I8VA 1LOYA 1LXEA 2BO9B 4OK0A 3S67A 3ZG5A 1ISKA 2SBLA 3H3HA 3QRDA 1SARA 1FW7A 1EEJA 3GAXA 3B8LA 3DM8A 1SIHA 3EN1B 1M1XB 3G0KA 4LSOA 4NHFA 2ML5A 3CCR3 1O7GB 3SXXA 3CCU3 1JBTA 4N6UA 1IYYA 1T2IA 1BNJA 3G6E3 3I0YA 4HM7B 3EC9A 2L1SA 1KSIA 4HOHA 1YI23 1JKGB 3A5EA 1B27A 3N8BA 1KD14 3HZPA 2BMQB 3JUOA 1IV7A 1O7NB 1BNIA 1DYUA 3DXOA 3PCRA 8RNTA 1DVDA 3A76A 3ZFZA 1VQO3 1BANA 5BVBA 3TDGA 3V99A 1TIJA 2HMOB 1W7CA 4KFFA 4KFDA 1RGAA 3CC73 3SLUA 3HIGA 2F5WA 1TTOA 2LQVA 1BVIA 2UGIA 4Q53A 2SARA 4N6MA 1RDSA 1W6CA 5IENA 1G96A 3D9RA 2OTJ3 3ER7A 3FF0A 4HM1B 3KIIA 1YVSA 2PZVA 1G02A 5BU4A 1M904 5RNTA 1N8R4 2MF7A 1NWWA 4XDVA 2KAAA 2WOHA 1AVKA 3FH1A 5IG3A 1JZDA 1OF5A 4HM0B 1BSBA 1L5GB 3V92A 1GMPA 3CPOA 1BSDA 3KE7A 5STDA 3F8XA 4U13A 2F98A 1VQ63 3MHEA 3BU4A 4TX4A 2HMLB 1IVUA 1QJGA 2JDIH 3WMDA 4FCMA 1BRGA 2W2CA 1VQ73 2W0QA 2V1LA 1Q40B 3T8UA 1NU3A 5BXQA 1OPYA 1BSCA 3FF2A 4AKYA 2CIUA 1MWSA 1G0TA 5BIRA 4STDA 3KFQC 1RHLA 1TRQA 1C7HA 4FMBA 1QVF2 3AMOB 4R80A 2CFWA 2P09A 3JUQA 1JB4A 6GSPA 2YFIB 3UNLA 2CFGA 4XM4A 3WR2A 5IEPA 2D42A 4FMDA 1DE3A 2W6JH 5M18A 1N8QA 1ULJB 3DGOA 2XGNA 2GU1A 2LYXA 3CME3 1FGTA 1MWRA 2W9QA 3LYGA 1VQ43 1W6YA 3NM2A 3Q90A 4HM4B 3OW22 1N5PA 3EJVA 1LQMB 2WGQA 5HGRA 2CWTA 1PYLA 3HIIA 3K0ZA 1ZS7A 2HMKB 3M8CA 4HAAA 4NREA 3EBTA 3G713 1A90A 1BUJA 1N9JA 2E2TA 3SYUA 1KQS2 1IQXA 1FGQA 1UCKA 3EHCA 1UGHI 5ELJA 1BU4A 1Q7HA 1S5AA 4HBRA 1VQP3 3WODG 1IT8A 1W01A 2YFJB 5LC7A 1FYSA 1ULIB 2A15A 2QGUA 4HJLB 4QWTA 4WHAA 2L4VA 4HKVB 4X2OA 2HMMB 1BSEA 1YVBI 2CWVA 2W56A 3PCSA 3GZBA 1NO3A 1WTHA 1V58A 4HM5B 2STDA 3KSPA 4H3UA 3JUPA 1SJWA 3AHSA 1D6YA 1Q7Y4 4N6NB 3BNDA 1BIRA 1OGXA 1LOVA 4N6LA 4XB5A 2D1WA 3ALAA 3G4S3 1T5YA 4MJDA 2YFLB 3HI7A 3ZG0A 5G1LA 3X3ZA 1IK3A 1UUWB 4AKZA 1GD3A 4J8TA 3WOFB 1JJ22 1RSNA 2BNGA 5CK6A 3WA3A 1Y4KA 3BNBA 1WQLB 1JV2B 4O8SA 5AI1A 4RNZA 4CPKA 1Q864 1RN4A 1A2KA 1GMRA 3DGLA 1F8NA 1YGWA 2XR8B 1T2HA 1RKYA 5IF6A 5EVHA 1KWIA 1U5OA 2J8XB 4BTWA 4RNTA 4IT7A 1K28A 3SX1A 2BMRB 3EBYA 3O8YA 1J2BA 1I2GA 2Y74A 3LT9A 1Z1SA 1U8CB 1X1WA 1AQZA 1FUSA 1I0VA 1LOWA 1WMOA 4KZ1A 2CHCA 2ZA4A 3NM7A 1WNHA 2AAEA 1YJW3 1YHQ3 3JUMA 1I0XA 1AV4A 4J5KA 4WWUC 4O02B 2RNTA 1RRHA 2GBWB 2IMJA 4K61A 1FUWA 1W02A 2B1XB 3UB1A 3LTDA 3JVCA 4I5QA 1EQKA 1UUVB 2B24B 3DUKA 1JNQA 1DETA 1I2EA 3Q1CA 2HMJB 3F9SA 1ZGXA 4HM8B 1MGWA 3S5CA 1YJN3 3CNMA 3FG3A 3CPW2 3WHOA 1DMQA 2OTL3 2GBXB 3FCSB 4R9KA 4MMYB 3L0RA 5AIFA 3NQYA 2CKFB 1RGKA 2BT3A 1PU4A 2CFLA 1SPUA 4BL3A 1TFOA 2IYJA 5EQLA 6STDA 1W2B2 1DMMA 1E97A 2UUGC 2BIRA 2XSHB 2XF3A 2GEYA 5FGOA 1OACA 5M1AA 1I70A 3CC43 1I3FA 1TRPA 3D4AA 2RGQA 1VQM3 1Q824 2O9UX 3MG3A 3D3LA 3LMLA 1CH0A 1A67A 3IPTA 3VF1A 3CCL3 1BNFA 1RGCA 1QVG2 4N6OB 2H0GA 3AMOA 4KFEA 3VGNA 1BNGA 1RN1A 1B21A 3MPHA 3BIRA 3U1WA 3IMAB 4EW5A 1AR0A 3AGOA 3SEDA 2Z77A 1EG9B 3OWYA 4FR9A 4RNYA 2BU4A 2P38A 3EQQB 2E2VA 2QIYA 1RGFA 2CC3A 5GSPA 1FA3A 1V74A 1JB2A 3IJEB 1CEWI 5AIHA 2GXFA 9RNTA 6RNTA 3WA2X 4BU4A 3DGMA 3F7XA 5KP1A 1T3BA 1GSPA 1QAKA 5KP4A 1Q42A 3FZWA 5CF2A 3PYJA 4BL2A 4L8PA 3Q3FA 3K7CA 1O7MB 5ELUA 1UI8A 2R41A 3D79A 1UCJA 4N6V0 1RRLA 1DMNA 3B4OA 4HVNA 3KN4A 1JRQA 1QAFA 1RJOA 1HZ1A 3HK4A 1R4CA 3KCHA 3GZYB 5EEOA 1K734 7STDA 1A2PA 1BNRA 1WMNA 3GRDA 4ZM8A 1YGEA 1M1K4 1IVWA 5IEOA 3U97A 4HM6B 2IUKA 1GY5A 7GSPA 3DGYA 2XGLA 5CXOA 3S28A 5FW5A 1KC84 1MWTA 1TUHA 1NDOB 1VQ53 2O3OA 2KF6A 2CWUA 2CW9A 1JZOA 3NBJA 3SVAA 5I97A 3CXC2 1DVCA 3FLJA 1S723 1NJI4 2H0IA 1WMPA 4AEQA 1RN7A 4I4KA 1TFKA 3SOYA 1SQWA 1W2ZA 2XSOB 3WOEB 2ZHXB 1BRSA 1I2FA 2Q07A 3LZAA 2XH9A 1RTUA 2KF4A 1V57A 2ZL8A 3QK9A 4EBGA 1JBSA 1AVLA 3N54B 1RCLA 1JN5B 1E3RA 2WO0A 4LZIA 1W00A 1IQYA 2P05A 2HOHA 1YIJ3 1MNLA 1UGIA 3F8HA 2CH9A 1QALA 3S29A 5D83A 4XDWA 1B3SA 4LMIA 4J9AA 1E3VA 2XRXB 5AYSC 1Q814 1GOYA 3MG2A 1N9EA 1K41A 1TU5A 3GZRA 1IT7A 1B2SA 4OUQA 3FKAA 1JBRA 2C4BA 4R9LA 1K9M4 1W5ZA 2OQEC 3H51A 2IY2A 4J5GA 5LC6A 5JBSA 2INXA 3HOHA 4ORLA 3GWRA 3BNCA 4GL6A 2F56A 1JKGA 1X1XA 2I9WA 3KKGA 4JRFA 4PEJA 2XFSA 2ZDJA 1B20A 2KF3A 3D5GA 4XBTA 2IA7A 1MGRA 2H0HA 4K1UA 4N6TA 2F99A 1RMSA 1CYUA 1EUIC 3DY5A 8CHOA 3CCQ3 1BRHA 5TGNA 2C10A 3OXAA 3NX0A 5DREA 4EV2A 4DKIA 1O7HB 1RGGA 3NHXA 1GS3A 2C11A 3PS8A 4FMAA 4WFOA 4WYKB 3KSED 2Z7AA 3K9MC 1O7PB 2F5MA 4L8OA 1IVVA 3RNTA 4XBYA 1BAOA 2W04A 3F40A 3X3YA 3X40A 1FGMA 3NV0B 4GHOA 3CU3A 1EA2A 4MEIA 1VQL3 2CFKA 2KXGA 3MWZA 3CCS3 3MSOA 3I553 2GEXA 4EV5A 4RZMA 5IERA 3FSDA 4HYZA 3DH2A 5IG5A 1BNSA 3AHWA 1QMAA 4L7KA 3J7Yd 1BRJA 4O2HA 3FG1A 2KCDA 1ASKA 4HZBB 3CCJ3 3HX8A 1GYBA 1OHPA 1Q40A 3EE1A 3F7SA 1N5HA 1GY6A 1ZO2A 1M9GA 1ZX2A 2K54A 2W56B 3UL6A 1B2UA 4OVMA 2K3DA 3URPA 3V98A 2YX9A 1RGEA 1YJ93 1US1A 2M7OA 4G1MB 2F4YA 5KP3A 1BRKA 4RBNA 1YNVX 1VQK3 3B7CA 4HM3B 3KZTA 5M19A 1HKXA 5AYRB 1B2ZA 2E2UA 2RBIA 1VZZA 3OWUA 1NNVA 3EB8A 2FNQA 4NPBA 5IW9A 3LTAA 2GSPA 2CFDA 3DMCA 1RNBA 1STFI 2JQ5A 1C54A 1VQ93 1B2XA 2BHMA 3CNXA 1X1UA 3X42A 3JUNA 4BTXA 1FGOA 3STDA 1OGZA 2K0MA 2FGTA 1X1YA 1JN5A 1W6GA 3LTBA 2AADA 3T0UA 1D6ZA 1UI7A 1UDII 1VQN3 4EYCA 5AIGA 2UX0A 4MMXB 1BGSA 4EXRA 1RNTA 3S27A 7RNTA 1GOUA 5D81A 4IPBA 1LNHA 3DGNA 2XEPA 4O3VA 1YIT3 1FGRA 1PY3A 4K1VA 1GMQA 2KF5A 4GB5A 1IU7A 1IDPA 5CF1A 2WOFA 1ROAA 1B2MA 4FMCA 3Q2PA 4BIRA 2R4IA 5IG4A 4FCZA 3NQZA 1CYVA 3LOYA 4MMZB 3X41A 2WGOA 1OUNA 3WDGB 5G1KA 1GY7A 1TP6A 1LNIA 3NBRA 4N3VA 2RSXA 3GZXB 3F14A
chains in the Genus database with same CATH topology
3BB9A 1UW1A 4CCVA 3G16A 4LGQA 3SOAA 5AEUB 5JPUA 3K63A 2OWPA 3CMA3 1VQ83 2QA43 1LOXA 3CD63 5D82A 2PNCA 3LTCA 3CCE3 3E99A 4H61A 2W03A 1JB5A 1OF5B 2ML6A 4WYKA 4EC6A 3LH4A 5IG0A 1STDA 4CDLA 3UJMA 2MC8A 2P0XA 1OHOA 3PZWA 2HMNB 3G8ZA 3OV4A 1IQ8A 1A2VA 2RFRA 3N9HA 2P0MA 3NV0A 2OOVC 3B4PA 3EF8A 3CC23 1K8A4 3MYTA 1OHSA 5AEWB 1ROVA 4WP5A 2Z76A 1PFPA 3EX9A 2FXTA 4HM2B 3EN8A 5AIIA 4BTYA 2XFTA 3BLZA 3LT8A 3OWSA 3FGYA 1HU9A 1OH0A 3PGBA 3PXMA 4FCJA 4KVHA 4R1KA 3MKIA 4IIAA 3RDEA 2W9PA 3RGAA 3ECFA 1SIIA 2OOVA 3T8NA 1IV9A 5DRVA 2OQEA 1EKMA 4XBXA 3X3XA 1BUQA 4R4KA 1NB5I 3UL5A 3CCV3 3VSYA 1D6UA 2F86B 2GU3A 4LEHA 2CG1A 4HZ9B 3FG4A 3DZLA 2CK3H 1NB3I 2Y73A 1OCVA 3NXJA 3ROBA 2CG0A 5CLKA 2BMOB 3K5TA 1LVNA 3BNEA 1W4NA 3LXUX 3OX9A 2Z6BA 2OCTA 3RGRA 1GD4A 2QEX3 4K90B 2IUJA 4JF8A 3MG1A 5JPPA 5A0OB 5G2GA 3CCM3 3NBBA 2KRTA 1O7WB 2RCDA 1IVXA 3NUVA 1MOLA 4X2HA 1CQSA 1ISKA 1LXEA 4OK0A 3S67A 2BO9B 2SBLA 3H3HA 3QRDA 3GAXA 3I563 3B8LA 3DM8A 1SIHA 3EN1B 1M1XB 3G0KA 4LSOA 4NHFA 2ML5A 3CCR3 1O7GB 3SXXA 3CCU3 4N6UA 3G6E3 3I0YA 4HM7B 3EC9A 1KSIA 1YI23 1JKGB 3N8BA 1KD14 3HZPA 2BMQB 3JUOA 1IV7A 1O7NB 1DYUA 3DXOA 3PCRA 1DVDA 3A76A 1VQO3 5BVBA 3V99A 1TIJA 2HMOB 1W7CA 4KFFA 4KFDA 3CC73 3SLUA 3HIGA 2LQVA 4Q53A 4N6MA 1W6CA 5IENA 1G96A 3D9RA 2OTJ3 3ER7A 3FF0A 4HM1B 3KIIA 2PZVA 1M904 1N8R4 2MF7A 1NWWA 4XDVA 2WOHA 1AVKA 3FH1A 5IG3A 1OF5A 4HM0B 1L5GB 3V92A 3CPOA 3KE7A 5STDA 3F8XA 4U13A 2F98A 1VQ63 3MHEA 3WMDA 4TX4A 2HMLB 1IVUA 1QJGA 2JDIH 4FCMA 2W2CA 1VQ73 2W0QA 2V1LA 1Q40B 3T8UA 1NU3A 5BXQA 1OPYA 3FF2A 4AKYA 2CIUA 4STDA 3KFQC 1C7HA 4FMBA 1QVF2 3AMOB 4R80A 2CFWA 2P09A 3JUQA 1JB4A 2YFIB 3UNLA 2CFGA 4XM4A 5IEPA 2D42A 4FMDA 2W6JH 1N8QA 1ULJB 3DGOA 2XGNA 2GU1A 2LYXA 3CME3 1FGTA 2W9QA 3LYGA 1VQ43 1W6YA 3NM2A 3Q90A 4HM4B 1N5PA 3EJVA 5HGRA 2WGQA 2CWTA 3HIIA 3K0ZA 2HMKB 3M8CA 4NREA 1A90A 3EBTA 3G713 1N9JA 2E2TA 1KQS2 1IQXA 1FGQA 3EHCA 5ELJA 1S5AA 4HBRA 1VQP3 3WODG 1IT8A 1W01A 2YFJB 5LC7A 1ULIB 2A15A 2QGUA 4HJLB 4QWTA 4WHAA 2L4VA 4HKVB 4X2OA 2HMMB 3PCSA 1YVBI 2CWVA 2W56A 3GZBA 1NO3A 1WTHA 4HM5B 2STDA 3KSPA 4H3UA 3JUPA 1SJWA 1Q7Y4 1D6YA 4N6NB 3BNDA 1OGXA 4N6LA 4XB5A 2D1WA 3ALAA 3G4S3 1T5YA 4MJDA 2YFLB 3HI7A 3X3ZA 1IK3A 1UUWB 4AKZA 1GD3A 4J8TA 3WOFB 1JJ22 2BNGA 5CK6A 3WA3A 1Y4KA 3BNBA 1WQLB 1JV2B 4O8SA 5AI1A 4RNZA 1Q864 1Q824 1A2KA 3DGLA 1F8NA 2XR8B 1RKYA 5IF6A 5EVHA 1KWIA 1U5OA 4BTWA 4IT7A 1K28A 3SX1A 2BMRB 3EBYA 3O8YA 1J2BA 2Y74A 3LT9A 1U8CB 1Z1SA 3TDGA 3OW22 1WMOA 4KZ1A 2CHCA 3NM7A 1YJW3 1WNHA 1YHQ3 3JUMA 1AV4A 4WWUC 4O02B 1RRHA 2GBWB 2IMJA 4K61A 1FUWA 1W02A 2B1XB 3UB1A 3LTDA 3JVCA 1EQKA 1UUVB 2B24B 3DUKA 1JNQA 4HM8B 3Q1CA 2HMJB 3F9SA 3S5CA 1YJN3 3CNMA 3FG3A 3CPW2 1DMQA 2OTL3 2GBXB 3FCSB 4R9KA 4MMYB 3L0RA 5AIFA 3NQYA 2CKFB 2BT3A 1PU4A 2CFLA 1SPUA 6STDA 1TFOA 5EQLA 1W2B2 1DMMA 1E97A 2XSHB 2XF3A 2GEYA 5FGOA 1OACA 3CC43 2RGQA 1VQM3 2O9UX 3MG3A 3D3LA 3LMLA 1A67A 3IPTA 3VF1A 3CCL3 1QVG2 4N6OB 3VGNA 3AMOA 4KFEA 3MPHA 3U1WA 3IMAB 1AR0A 3SEDA 2Z77A 1EG9B 3OWYA 4FR9A 4RNYA 2P38A 3EQQB 2E2VA 2QIYA 2CC3A 1FA3A 1V74A 1JB2A 3IJEB 1CEWI 5AIHA 2GXFA 3WA2X 3DGMA 3F7XA 5KP1A 1QAKA 5KP4A 1Q42A 3FZWA 5CF2A 3PYJA 4L8PA 3K7CA 1O7MB 5ELUA 1UI8A 4N6V0 1RRLA 1DMNA 3B4OA 4HVNA 3KN4A 1JRQA 1QAFA 1RJOA 3HK4A 1R4CA 3GZYB 5EEOA 1K734 7STDA 1WMNA 3GRDA 4ZM8A 1YGEA 1M1K4 1IVWA 5IEOA 3U97A 4HM6B 2IUKA 1GY5A 5CXOA 2XGLA 3S28A 5FW5A 1KC84 1TUHA 1NDOB 1VQ53 2O3OA 3NBJA 2CWUA 2CW9A 3SVAA 5I97A 3CXC2 1S723 1DVCA 3FLJA 1NJI4 1WMPA 4AEQA 1RN7A 4I4KA 1TFKA 3SOYA 1SQWA 1W2ZA 2XSOB 3WOEB 2Q07A 3LZAA 2XH9A 3QK9A 2ZL8A 4EBGA 1AVLA 3N54B 1JN5B 1E3RA 2WO0A 4LZIA 1IQYA 1W00A 2P05A 1YIJ3 1MNLA 3F8HA 2CH9A 1QALA 3S29A 5D83A 4XDWA 4LMIA 4J9AA 1E3VA 2XRXB 5AYSC 1Q814 3MG2A 1N9EA 1K41A 1TU5A 3GZRA 1IT7A 4OUQA 3FKAA 4R9LA 1K9M4 1W5ZA 2OQEC 3H51A 5LC6A 5JBSA 2INXA 4ORLA 3GWRA 3BNCA 4GL6A 3KKGA 1JKGA 2I9WA 4JRFA 4PEJA 2XFSA 2ZDJA 4XBTA 2IA7A 4K1UA 4N6TA 2F99A 1CYUA 3DY5A 8CHOA 3CCQ3 5TGNA 2C10A 3OXAA 3NX0A 5DREA 4EV2A 1O7HB 3NHXA 1GS3A 2C11A 3PS8A 4FMAA 4WFOA 4WYKB 3KSED 2Z7AA 3K9MC 1O7PB 4L8OA 1IVVA 4XBYA 2W04A 3F40A 3X3YA 3X40A 1FGMA 3NV0B 3CU3A 1EA2A 4MEIA 1VQL3 2CFKA 2KXGA 3MWZA 3CCS3 3MSOA 3I553 2GEXA 4EV5A 4RZMA 5IERA 3FSDA 4HYZA 5IG5A 1QMAA 4L7KA 3J7Yd 4O2HA 3FG1A 2KCDA 1ASKA 4HZBB 3CCJ3 3HX8A 1GYBA 1OHPA 1Q40A 3EE1A 3F7SA 1N5HA 1GY6A 1ZO2A 1M9GA 1ZX2A 2K54A 2W56B 3UL6A 4OVMA 3V98A 2YX9A 1YJ93 1US1A 2M7OA 4G1MB 5KP3A 4RBNA 1VQK3 3B7CA 4HM3B 3KZTA 1HKXA 5AYRB 2E2UA 3OWUA 1VZZA 3EB8A 2FNQA 5IW9A 3LTAA 2CFDA 3DMCA 1STFI 2JQ5A 1VQ93 2BHMA 3CNXA 3X42A 3JUNA 4BTXA 1FGOA 3STDA 1OGZA 2K0MA 2FGTA 1JN5A 1W6GA 3LTBA 3T0UA 1D6ZA 1UI7A 1VQN3 4EYCA 5AIGA 2UX0A 4MMXB 4EXRA 3S27A 5D81A 4IPBA 1LNHA 3DGNA 2XEPA 4O3VA 1YIT3 1FGRA 4K1VA 4GB5A 1IU7A 1IDPA 5CF1A 2WOFA 1ROAA 4FMCA 3Q2PA 2R4IA 5IG4A 4FCZA 3NQZA 1CYVA 3LOYA 4MMZB 3X41A 2WGOA 1OUNA 3WDGB 1GY7A 1TP6A 3NBRA 4N3VA 2RSXA 3GZXB 3F14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN 3;  1M90 4;  1N8R 4;  3G6E 3;  1VQK 3;  1JJ2 2;  1KQS 2;  1YJN 3;  1VQL 3;  1QVF 2;  1Q82 4;  3CCS 3;  3CPW 2;  1Q86 4;  3I55 3;  1YI2 3;  2OTL 3;  3CCR 3;  1KD1 4;  3CMA 3;  1K73 4;  1VQ8 3;  1VQP 3;  2QA4 3;  1YIT 3;  1YIJ 3;  3CD6 3;  3CCE 3;  3CCQ 3;  2QEX 3;  1VQO 3;  1M1K 4;  1W2B 2;  1VQ6 3;  3CCJ 3;  3OW2 2;  3CCM 3;  3CC7 3;  1Q81 4;  1KC8 4;  1YJW 3;  1VQ9 3;  3CME 3;  1VQ7 3;  1YHQ 3;  1VQ5 3;  3CXC 2;  3CCV 3;  1Q7Y 4;  1VQ4 3;  1S72 3;  3CC4 3;  1NJI 4;  1VQM 3;  1K9M 4;  3CC2 3;  3G4S 3;  1YJ9 3;  1K8A 4;  2OTJ 3;  3CCL 3;  3I56 3;  1QVG 2;  3CCU 3;  3G71 3; 
#chains in the Genus database with same CATH topology
 1RGH A;  2CX1 A;  1UW1 A;  3BB9 A;  5HOH A;  4CCV A;  3G16 A;  4LGQ A;  3SOA A;  5AEU B;  5JPU A;  1RCK A;  1UUG B;  3K63 A;  2OWP A;  3CMA 3;  1Q9E A;  1VQ8 3;  1BSA A;  2QA4 3;  1LOX A;  3CD6 3;  5D82 A;  2PNC A;  3LTC A;  4CJN A;  3CCE 3;  3E99 A;  1I3I A;  4H61 A;  2W03 A;  1JB5 A;  1OF5 B;  2ML6 A;  4WYK A;  4EC6 A;  3LH4 A;  5IG0 A;  1STD A;  1TJD A;  4CDL A;  3UJM A;  3GSP A;  2MC8 A;  1RGL A;  2P0X A;  1OHO A;  3PZW A;  2HMN B;  4ILF A;  3G8Z A;  3OV4 A;  1IQ8 A;  1A2V A;  2RFR A;  3N9H A;  2P0M A;  1VQQ A;  1HYF A;  2OOV C;  1FZU A;  3B4P A;  3EF8 A;  3NV0 A;  3CC2 3;  3MYT A;  1K8A 4;  3D5I A;  1OHS A;  5AEW B;  1ROV A;  4WP5 A;  2Z76 A;  1PFP A;  3EX9 A;  2FXT A;  4HM2 B;  1FUT A;  3EN8 A;  5AII A;  1RLS A;  4BTY A;  2XFT A;  3BLZ A;  2CX0 A;  3LT8 A;  3FGY A;  1HU9 A;  1OH0 A;  3OWS A;  3PGB A;  3PXM A;  4FCJ A;  4KVH A;  3MKI A;  4IIA A;  4R1K A;  2W9P A;  3RDE A;  3RGA A;  3ECF A;  1SII A;  2OOV A;  3AGN A;  3T8N A;  1IV9 A;  5DRV A;  2OQE A;  1EKM A;  4XBX A;  3X3X A;  1MWU A;  3I56 3;  1BUQ A;  4R4K A;  1R4Y A;  1NB5 I;  3UL5 A;  1LQG C;  1BRI A;  3CCV 3;  3VSY A;  1D6U A;  2F86 B;  2GU3 A;  4LEH A;  4LYL B;  2CG1 A;  4HZ9 B;  3FG4 A;  1BRN L;  1BNE A;  3DZL A;  2CK3 H;  1NB3 I;  2Y73 A;  4GSP A;  1OCV A;  3NXJ A;  1LRA A;  1UCI A;  3ROB A;  2CG0 A;  1AY7 A;  5CLK A;  1UCL A;  2BMO B;  3K5T A;  1LVN A;  3BNE A;  1W4N A;  3LXU X;  3OX9 A;  2Z6B A;  2OCT A;  3RGR A;  1GD4 A;  2QEX 3;  4K90 B;  2IUJ A;  4JF8 A;  3MG1 A;  5JPP A;  1BOX A;  5A0O B;  4KT3 B;  5G2G A;  3CCM 3;  3NBB A;  2KRT A;  1O7W B;  2RCD A;  1IVX A;  3NUV A;  1MOL A;  4X2H A;  1CQS A;  1GOV A;  1I8V A;  1LOY A;  1LXE A;  2BO9 B;  4OK0 A;  3S67 A;  3ZG5 A;  1ISK A;  2SBL A;  3H3H A;  3QRD A;  1SAR A;  1FW7 A;  1EEJ A;  3GAX A;  3B8L A;  3DM8 A;  1SIH A;  3EN1 B;  1M1X B;  3G0K A;  4LSO A;  4NHF A;  2ML5 A;  3CCR 3;  1O7G B;  3SXX A;  3CCU 3;  1JBT A;  4N6U A;  1IYY A;  1T2I A;  1BNJ A;  3G6E 3;  3I0Y A;  4HM7 B;  3EC9 A;  2L1S A;  1KSI A;  4HOH A;  1YI2 3;  1JKG B;  3A5E A;  1B27 A;  3N8B A;  1KD1 4;  3HZP A;  2BMQ B;  3JUO A;  1IV7 A;  1O7N B;  1BNI A;  1DYU A;  3DXO A;  3PCR A;  8RNT A;  1DVD A;  3A76 A;  3ZFZ A;  1VQO 3;  1BAN A;  5BVB A;  3TDG A;  3V99 A;  1TIJ A;  2HMO B;  1W7C A;  4KFF A;  4KFD A;  1RGA A;  3CC7 3;  3SLU A;  3HIG A;  2F5W A;  1TTO A;  2LQV A;  1BVI A;  2UGI A;  4Q53 A;  2SAR A;  4N6M A;  1RDS A;  1W6C A;  5IEN A;  1G96 A;  3D9R A;  2OTJ 3;  3ER7 A;  3FF0 A;  4HM1 B;  3KII A;  1YVS A;  2PZV A;  1G02 A;  5BU4 A;  1M90 4;  5RNT A;  1N8R 4;  2MF7 A;  1NWW A;  4XDV A;  2KAA A;  2WOH A;  1AVK A;  3FH1 A;  5IG3 A;  1JZD A;  1OF5 A;  4HM0 B;  1BSB A;  1L5G B;  3V92 A;  1GMP A;  3CPO A;  1BSD A;  3KE7 A;  5STD A;  3F8X A;  4U13 A;  2F98 A;  1VQ6 3;  3MHE A;  3BU4 A;  4TX4 A;  2HML B;  1IVU A;  1QJG A;  2JDI H;  3WMD A;  4FCM A;  1BRG A;  2W2C A;  1VQ7 3;  2W0Q A;  2V1L A;  1Q40 B;  3T8U A;  1NU3 A;  5BXQ A;  1OPY A;  1BSC A;  3FF2 A;  4AKY A;  2CIU A;  1MWS A;  1G0T A;  5BIR A;  4STD A;  3KFQ C;  1RHL A;  1TRQ A;  1C7H A;  4FMB A;  1QVF 2;  3AMO B;  4R80 A;  2CFW A;  2P09 A;  3JUQ A;  1JB4 A;  6GSP A;  2YFI B;  3UNL A;  2CFG A;  4XM4 A;  3WR2 A;  5IEP A;  2D42 A;  4FMD A;  1DE3 A;  2W6J H;  5M18 A;  1N8Q A;  1ULJ B;  3DGO A;  2XGN A;  2GU1 A;  2LYX A;  3CME 3;  1FGT A;  1MWR A;  2W9Q A;  3LYG A;  1VQ4 3;  1W6Y A;  3NM2 A;  3Q90 A;  4HM4 B;  3OW2 2;  1N5P A;  3EJV A;  1LQM B;  2WGQ A;  5HGR A;  2CWT A;  1PYL A;  3HII A;  3K0Z A;  1ZS7 A;  2HMK B;  3M8C A;  4HAA A;  4NRE A;  3EBT A;  3G71 3;  1A90 A;  1BUJ A;  1N9J A;  2E2T A;  3SYU A;  1KQS 2;  1IQX A;  1FGQ A;  1UCK A;  3EHC A;  1UGH I;  5ELJ A;  1BU4 A;  1Q7H A;  1S5A A;  4HBR A;  1VQP 3;  3WOD G;  1IT8 A;  1W01 A;  2YFJ B;  5LC7 A;  1FYS A;  1ULI B;  2A15 A;  2QGU A;  4HJL B;  4QWT A;  4WHA A;  2L4V A;  4HKV B;  4X2O A;  2HMM B;  1BSE A;  1YVB I;  2CWV A;  2W56 A;  3PCS A;  3GZB A;  1NO3 A;  1WTH A;  1V58 A;  4HM5 B;  2STD A;  3KSP A;  4H3U A;  3JUP A;  1SJW A;  3AHS A;  1D6Y A;  1Q7Y 4;  4N6N B;  3BND A;  1BIR A;  1OGX A;  1LOV A;  4N6L A;  4XB5 A;  2D1W A;  3ALA A;  3G4S 3;  1T5Y A;  4MJD A;  2YFL B;  3HI7 A;  3ZG0 A;  5G1L A;  3X3Z A;  1IK3 A;  1UUW B;  4AKZ A;  1GD3 A;  4J8T A;  3WOF B;  1JJ2 2;  1RSN A;  2BNG A;  5CK6 A;  3WA3 A;  1Y4K A;  3BNB A;  1WQL B;  1JV2 B;  4O8S A;  5AI1 A;  4RNZ A;  4CPK A;  1Q86 4;  1RN4 A;  1A2K A;  1GMR A;  3DGL A;  1F8N A;  1YGW A;  2XR8 B;  1T2H A;  1RKY A;  5IF6 A;  5EVH A;  1KWI A;  1U5O A;  2J8X B;  4BTW A;  4RNT A;  4IT7 A;  1K28 A;  3SX1 A;  2BMR B;  3EBY A;  3O8Y A;  1J2B A;  1I2G A;  2Y74 A;  3LT9 A;  1Z1S A;  1U8C B;  1X1W A;  1AQZ A;  1FUS A;  1I0V A;  1LOW A;  1WMO A;  4KZ1 A;  2CHC A;  2ZA4 A;  3NM7 A;  1WNH A;  2AAE A;  1YJW 3;  1YHQ 3;  3JUM A;  1I0X A;  1AV4 A;  4J5K A;  4WWU C;  4O02 B;  2RNT A;  1RRH A;  2GBW B;  2IMJ A;  4K61 A;  1FUW A;  1W02 A;  2B1X B;  3UB1 A;  3LTD A;  3JVC A;  4I5Q A;  1EQK A;  1UUV B;  2B24 B;  3DUK A;  1JNQ A;  1DET A;  1I2E A;  3Q1C A;  2HMJ B;  3F9S A;  1ZGX A;  4HM8 B;  1MGW A;  3S5C A;  1YJN 3;  3CNM A;  3FG3 A;  3CPW 2;  3WHO A;  1DMQ A;  2OTL 3;  2GBX B;  3FCS B;  4R9K A;  4MMY B;  3L0R A;  5AIF A;  3NQY A;  2CKF B;  1RGK A;  2BT3 A;  1PU4 A;  2CFL A;  1SPU A;  4BL3 A;  1TFO A;  2IYJ A;  5EQL A;  6STD A;  1W2B 2;  1DMM A;  1E97 A;  2UUG C;  2BIR A;  2XSH B;  2XF3 A;  2GEY A;  5FGO A;  1OAC A;  5M1A A;  1I70 A;  3CC4 3;  1I3F A;  1TRP A;  3D4A A;  2RGQ A;  1VQM 3;  1Q82 4;  2O9U X;  3MG3 A;  3D3L A;  3LML A;  1CH0 A;  1A67 A;  3IPT A;  3VF1 A;  3CCL 3;  1BNF A;  1RGC A;  1QVG 2;  4N6O B;  2H0G A;  3AMO A;  4KFE A;  3VGN A;  1BNG A;  1RN1 A;  1B21 A;  3MPH A;  3BIR A;  3U1W A;  3IMA B;  4EW5 A;  1AR0 A;  3AGO A;  3SED A;  2Z77 A;  1EG9 B;  3OWY A;  4FR9 A;  4RNY A;  2BU4 A;  2P38 A;  3EQQ B;  2E2V A;  2QIY A;  1RGF A;  2CC3 A;  5GSP A;  1FA3 A;  1V74 A;  1JB2 A;  3IJE B;  1CEW I;  5AIH A;  2GXF A;  9RNT A;  6RNT A;  3WA2 X;  4BU4 A;  3DGM A;  3F7X A;  5KP1 A;  1T3B A;  1GSP A;  1QAK A;  5KP4 A;  1Q42 A;  3FZW A;  5CF2 A;  3PYJ A;  4BL2 A;  4L8P A;  3Q3F A;  3K7C A;  1O7M B;  5ELU A;  1UI8 A;  2R41 A;  3D79 A;  1UCJ A;  4N6V 0;  1RRL A;  1DMN A;  3B4O A;  4HVN A;  3KN4 A;  1JRQ A;  1QAF A;  1RJO A;  1HZ1 A;  3HK4 A;  1R4C A;  3KCH A;  3GZY B;  5EEO A;  1K73 4;  7STD A;  1A2P A;  1BNR A;  1WMN A;  3GRD A;  4ZM8 A;  1YGE A;  1M1K 4;  1IVW A;  5IEO A;  3U97 A;  4HM6 B;  2IUK A;  1GY5 A;  7GSP A;  3DGY A;  2XGL A;  5CXO A;  3S28 A;  5FW5 A;  1KC8 4;  1MWT A;  1TUH A;  1NDO B;  1VQ5 3;  2O3O A;  2KF6 A;  2CWU A;  2CW9 A;  1JZO A;  3NBJ A;  3SVA A;  5I97 A;  3CXC 2;  1DVC A;  3FLJ A;  1S72 3;  1NJI 4;  2H0I A;  1WMP A;  4AEQ A;  1RN7 A;  4I4K A;  1TFK A;  3SOY A;  1SQW A;  1W2Z A;  2XSO B;  3WOE B;  2ZHX B;  1BRS A;  1I2F A;  2Q07 A;  3LZA A;  2XH9 A;  1RTU A;  2KF4 A;  1V57 A;  2ZL8 A;  3QK9 A;  4EBG A;  1JBS A;  1AVL A;  3N54 B;  1RCL A;  1JN5 B;  1E3R A;  2WO0 A;  4LZI A;  1W00 A;  1IQY A;  2P05 A;  2HOH A;  1YIJ 3;  1MNL A;  1UGI A;  3F8H A;  2CH9 A;  1QAL A;  3S29 A;  5D83 A;  4XDW A;  1B3S A;  4LMI A;  4J9A A;  1E3V A;  2XRX B;  5AYS C;  1Q81 4;  1GOY A;  3MG2 A;  1N9E A;  1K41 A;  1TU5 A;  3GZR A;  1IT7 A;  1B2S A;  4OUQ A;  3FKA A;  1JBR A;  2C4B A;  4R9L A;  1K9M 4;  1W5Z A;  2OQE C;  3H51 A;  2IY2 A;  4J5G A;  5LC6 A;  5JBS A;  2INX A;  3HOH A;  4ORL A;  3GWR A;  3BNC A;  4GL6 A;  2F56 A;  1JKG A;  1X1X A;  2I9W A;  3KKG A;  4JRF A;  4PEJ A;  2XFS A;  2ZDJ A;  1B20 A;  2KF3 A;  3D5G A;  4XBT A;  2IA7 A;  1MGR A;  2H0H A;  4K1U A;  4N6T A;  2F99 A;  1RMS A;  1CYU A;  1EUI C;  3DY5 A;  8CHO A;  3CCQ 3;  1BRH A;  5TGN A;  2C10 A;  3OXA A;  3NX0 A;  5DRE A;  4EV2 A;  4DKI A;  1O7H B;  1RGG A;  3NHX A;  1GS3 A;  2C11 A;  3PS8 A;  4FMA A;  4WFO A;  4WYK B;  3KSE D;  2Z7A A;  3K9M C;  1O7P B;  2F5M A;  4L8O A;  1IVV A;  3RNT A;  4XBY A;  1BAO A;  2W04 A;  3F40 A;  3X3Y A;  3X40 A;  1FGM A;  3NV0 B;  4GHO A;  3CU3 A;  1EA2 A;  4MEI A;  1VQL 3;  2CFK A;  2KXG A;  3MWZ A;  3CCS 3;  3MSO A;  3I55 3;  2GEX A;  4EV5 A;  4RZM A;  5IER A;  3FSD A;  4HYZ A;  3DH2 A;  5IG5 A;  1BNS A;  3AHW A;  1QMA A;  4L7K A;  3J7Y d;  1BRJ A;  4O2H A;  3FG1 A;  2KCD A;  1ASK A;  4HZB B;  3CCJ 3;  3HX8 A;  1GYB A;  1OHP A;  1Q40 A;  3EE1 A;  3F7S A;  1N5H A;  1GY6 A;  1ZO2 A;  1M9G A;  1ZX2 A;  2K54 A;  2W56 B;  3UL6 A;  1B2U A;  4OVM A;  2K3D A;  3URP A;  3V98 A;  2YX9 A;  1RGE A;  1YJ9 3;  1US1 A;  2M7O A;  4G1M B;  2F4Y A;  5KP3 A;  1BRK A;  4RBN A;  1YNV X;  1VQK 3;  3B7C A;  4HM3 B;  3KZT A;  5M19 A;  1HKX A;  5AYR B;  1B2Z A;  2E2U A;  2RBI A;  1VZZ A;  3OWU A;  1NNV A;  3EB8 A;  2FNQ A;  4NPB A;  5IW9 A;  3LTA A;  2GSP A;  2CFD A;  3DMC A;  1RNB A;  1STF I;  2JQ5 A;  1C54 A;  1VQ9 3;  1B2X A;  2BHM A;  3CNX A;  1X1U A;  3X42 A;  3JUN A;  4BTX A;  1FGO A;  3STD A;  1OGZ A;  2K0M A;  2FGT A;  1X1Y A;  1JN5 A;  1W6G A;  3LTB A;  2AAD A;  3T0U A;  1D6Z A;  1UI7 A;  1UDI I;  1VQN 3;  4EYC A;  5AIG A;  2UX0 A;  4MMX B;  1BGS A;  4EXR A;  1RNT A;  3S27 A;  7RNT A;  1GOU A;  5D81 A;  4IPB A;  1LNH A;  3DGN A;  2XEP A;  4O3V A;  1YIT 3;  1FGR A;  1PY3 A;  4K1V A;  1GMQ A;  2KF5 A;  4GB5 A;  1IU7 A;  1IDP A;  5CF1 A;  2WOF A;  1ROA A;  1B2M A;  4FMC A;  3Q2P A;  4BIR A;  2R4I A;  5IG4 A;  4FCZ A;  3NQZ A;  1CYV A;  3LOY A;  4MMZ B;  3X41 A;  2WGO A;  1OUN A;  3WDG B;  5G1K A;  1GY7 A;  1TP6 A;  1LNI A;  3NBR A;  4N3V A;  2RSX A;  3GZX B;  3F14 A; 
#chains in the Genus database with same CATH homology
 3BB9 A;  1UW1 A;  4CCV A;  3G16 A;  4LGQ A;  3SOA A;  5AEU B;  5JPU A;  3K63 A;  2OWP A;  3CMA 3;  1VQ8 3;  2QA4 3;  1LOX A;  3CD6 3;  5D82 A;  2PNC A;  3LTC A;  3CCE 3;  3E99 A;  4H61 A;  2W03 A;  1JB5 A;  1OF5 B;  2ML6 A;  4WYK A;  4EC6 A;  3LH4 A;  5IG0 A;  1STD A;  4CDL A;  3UJM A;  2MC8 A;  2P0X A;  1OHO A;  3PZW A;  2HMN B;  3G8Z A;  3OV4 A;  1IQ8 A;  1A2V A;  2RFR A;  3N9H A;  2P0M A;  3NV0 A;  2OOV C;  3B4P A;  3EF8 A;  3CC2 3;  1K8A 4;  3MYT A;  1OHS A;  5AEW B;  1ROV A;  4WP5 A;  2Z76 A;  1PFP A;  3EX9 A;  2FXT A;  4HM2 B;  3EN8 A;  5AII A;  4BTY A;  2XFT A;  3BLZ A;  3LT8 A;  3OWS A;  3FGY A;  1HU9 A;  1OH0 A;  3PGB A;  3PXM A;  4FCJ A;  4KVH A;  4R1K A;  3MKI A;  4IIA A;  3RDE A;  2W9P A;  3RGA A;  3ECF A;  1SII A;  2OOV A;  3T8N A;  1IV9 A;  5DRV A;  2OQE A;  1EKM A;  4XBX A;  3X3X A;  1BUQ A;  4R4K A;  1NB5 I;  3UL5 A;  3CCV 3;  3VSY A;  1D6U A;  2F86 B;  2GU3 A;  4LEH A;  2CG1 A;  4HZ9 B;  3FG4 A;  3DZL A;  2CK3 H;  1NB3 I;  2Y73 A;  1OCV A;  3NXJ A;  3ROB A;  2CG0 A;  5CLK A;  2BMO B;  3K5T A;  1LVN A;  3BNE A;  1W4N A;  3LXU X;  3OX9 A;  2Z6B A;  2OCT A;  3RGR A;  1GD4 A;  2QEX 3;  4K90 B;  2IUJ A;  4JF8 A;  3MG1 A;  5JPP A;  5A0O B;  5G2G A;  3CCM 3;  3NBB A;  2KRT A;  1O7W B;  2RCD A;  1IVX A;  3NUV A;  1MOL A;  4X2H A;  1CQS A;  1ISK A;  1LXE A;  4OK0 A;  3S67 A;  2BO9 B;  2SBL A;  3H3H A;  3QRD A;  3GAX A;  3I56 3;  3B8L A;  3DM8 A;  1SIH A;  3EN1 B;  1M1X B;  3G0K A;  4LSO A;  4NHF A;  2ML5 A;  3CCR 3;  1O7G B;  3SXX A;  3CCU 3;  4N6U A;  3G6E 3;  3I0Y A;  4HM7 B;  3EC9 A;  1KSI A;  1YI2 3;  1JKG B;  3N8B A;  1KD1 4;  3HZP A;  2BMQ B;  3JUO A;  1IV7 A;  1O7N B;  1DYU A;  3DXO A;  3PCR A;  1DVD A;  3A76 A;  1VQO 3;  5BVB A;  3V99 A;  1TIJ A;  2HMO B;  1W7C A;  4KFF A;  4KFD A;  3CC7 3;  3SLU A;  3HIG A;  2LQV A;  4Q53 A;  4N6M A;  1W6C A;  5IEN A;  1G96 A;  3D9R A;  2OTJ 3;  3ER7 A;  3FF0 A;  4HM1 B;  3KII A;  2PZV A;  1M90 4;  1N8R 4;  2MF7 A;  1NWW A;  4XDV A;  2WOH A;  1AVK A;  3FH1 A;  5IG3 A;  1OF5 A;  4HM0 B;  1L5G B;  3V92 A;  3CPO A;  3KE7 A;  5STD A;  3F8X A;  4U13 A;  2F98 A;  1VQ6 3;  3MHE A;  3WMD A;  4TX4 A;  2HML B;  1IVU A;  1QJG A;  2JDI H;  4FCM A;  2W2C A;  1VQ7 3;  2W0Q A;  2V1L A;  1Q40 B;  3T8U A;  1NU3 A;  5BXQ A;  1OPY A;  3FF2 A;  4AKY A;  2CIU A;  4STD A;  3KFQ C;  1C7H A;  4FMB A;  1QVF 2;  3AMO B;  4R80 A;  2CFW A;  2P09 A;  3JUQ A;  1JB4 A;  2YFI B;  3UNL A;  2CFG A;  4XM4 A;  5IEP A;  2D42 A;  4FMD A;  2W6J H;  1N8Q A;  1ULJ B;  3DGO A;  2XGN A;  2GU1 A;  2LYX A;  3CME 3;  1FGT A;  2W9Q A;  3LYG A;  1VQ4 3;  1W6Y A;  3NM2 A;  3Q90 A;  4HM4 B;  1N5P A;  3EJV A;  5HGR A;  2WGQ A;  2CWT A;  3HII A;  3K0Z A;  2HMK B;  3M8C A;  4NRE A;  1A90 A;  3EBT A;  3G71 3;  1N9J A;  2E2T A;  1KQS 2;  1IQX A;  1FGQ A;  3EHC A;  5ELJ A;  1S5A A;  4HBR A;  1VQP 3;  3WOD G;  1IT8 A;  1W01 A;  2YFJ B;  5LC7 A;  1ULI B;  2A15 A;  2QGU A;  4HJL B;  4QWT A;  4WHA A;  2L4V A;  4HKV B;  4X2O A;  2HMM B;  3PCS A;  1YVB I;  2CWV A;  2W56 A;  3GZB A;  1NO3 A;  1WTH A;  4HM5 B;  2STD A;  3KSP A;  4H3U A;  3JUP A;  1SJW A;  1Q7Y 4;  1D6Y A;  4N6N B;  3BND A;  1OGX A;  4N6L A;  4XB5 A;  2D1W A;  3ALA A;  3G4S 3;  1T5Y A;  4MJD A;  2YFL B;  3HI7 A;  3X3Z A;  1IK3 A;  1UUW B;  4AKZ A;  1GD3 A;  4J8T A;  3WOF B;  1JJ2 2;  2BNG A;  5CK6 A;  3WA3 A;  1Y4K A;  3BNB A;  1WQL B;  1JV2 B;  4O8S A;  5AI1 A;  4RNZ A;  1Q86 4;  1Q82 4;  1A2K A;  3DGL A;  1F8N A;  2XR8 B;  1RKY A;  5IF6 A;  5EVH A;  1KWI A;  1U5O A;  4BTW A;  4IT7 A;  1K28 A;  3SX1 A;  2BMR B;  3EBY A;  3O8Y A;  1J2B A;  2Y74 A;  3LT9 A;  1U8C B;  1Z1S A;  3TDG A;  3OW2 2;  1WMO A;  4KZ1 A;  2CHC A;  3NM7 A;  1YJW 3;  1WNH A;  1YHQ 3;  3JUM A;  1AV4 A;  4WWU C;  4O02 B;  1RRH A;  2GBW B;  2IMJ A;  4K61 A;  1FUW A;  1W02 A;  2B1X B;  3UB1 A;  3LTD A;  3JVC A;  1EQK A;  1UUV B;  2B24 B;  3DUK A;  1JNQ A;  4HM8 B;  3Q1C A;  2HMJ B;  3F9S A;  3S5C A;  1YJN 3;  3CNM A;  3FG3 A;  3CPW 2;  1DMQ A;  2OTL 3;  2GBX B;  3FCS B;  4R9K A;  4MMY B;  3L0R A;  5AIF A;  3NQY A;  2CKF B;  2BT3 A;  1PU4 A;  2CFL A;  1SPU A;  6STD A;  1TFO A;  5EQL A;  1W2B 2;  1DMM A;  1E97 A;  2XSH B;  2XF3 A;  2GEY A;  5FGO A;  1OAC A;  3CC4 3;  2RGQ A;  1VQM 3;  2O9U X;  3MG3 A;  3D3L A;  3LML A;  1A67 A;  3IPT A;  3VF1 A;  3CCL 3;  1QVG 2;  4N6O B;  3VGN A;  3AMO A;  4KFE A;  3MPH A;  3U1W A;  3IMA B;  1AR0 A;  3SED A;  2Z77 A;  1EG9 B;  3OWY A;  4FR9 A;  4RNY A;  2P38 A;  3EQQ B;  2E2V A;  2QIY A;  2CC3 A;  1FA3 A;  1V74 A;  1JB2 A;  3IJE B;  1CEW I;  5AIH A;  2GXF A;  3WA2 X;  3DGM A;  3F7X A;  5KP1 A;  1QAK A;  5KP4 A;  1Q42 A;  3FZW A;  5CF2 A;  3PYJ A;  4L8P A;  3K7C A;  1O7M B;  5ELU A;  1UI8 A;  4N6V 0;  1RRL A;  1DMN A;  3B4O A;  4HVN A;  3KN4 A;  1JRQ A;  1QAF A;  1RJO A;  3HK4 A;  1R4C A;  3GZY B;  5EEO A;  1K73 4;  7STD A;  1WMN A;  3GRD A;  4ZM8 A;  1YGE A;  1M1K 4;  1IVW A;  5IEO A;  3U97 A;  4HM6 B;  2IUK A;  1GY5 A;  5CXO A;  2XGL A;  3S28 A;  5FW5 A;  1KC8 4;  1TUH A;  1NDO B;  1VQ5 3;  2O3O A;  3NBJ A;  2CWU A;  2CW9 A;  3SVA A;  5I97 A;  3CXC 2;  1S72 3;  1DVC A;  3FLJ A;  1NJI 4;  1WMP A;  4AEQ A;  1RN7 A;  4I4K A;  1TFK A;  3SOY A;  1SQW A;  1W2Z A;  2XSO B;  3WOE B;  2Q07 A;  3LZA A;  2XH9 A;  3QK9 A;  2ZL8 A;  4EBG A;  1AVL A;  3N54 B;  1JN5 B;  1E3R A;  2WO0 A;  4LZI A;  1IQY A;  1W00 A;  2P05 A;  1YIJ 3;  1MNL A;  3F8H A;  2CH9 A;  1QAL A;  3S29 A;  5D83 A;  4XDW A;  4LMI A;  4J9A A;  1E3V A;  2XRX B;  5AYS C;  1Q81 4;  3MG2 A;  1N9E A;  1K41 A;  1TU5 A;  3GZR A;  1IT7 A;  4OUQ A;  3FKA A;  4R9L A;  1K9M 4;  1W5Z A;  2OQE C;  3H51 A;  5LC6 A;  5JBS A;  2INX A;  4ORL A;  3GWR A;  3BNC A;  4GL6 A;  3KKG A;  1JKG A;  2I9W A;  4JRF A;  4PEJ A;  2XFS A;  2ZDJ A;  4XBT A;  2IA7 A;  4K1U A;  4N6T A;  2F99 A;  1CYU A;  3DY5 A;  8CHO A;  3CCQ 3;  5TGN A;  2C10 A;  3OXA A;  3NX0 A;  5DRE A;  4EV2 A;  1O7H B;  3NHX A;  1GS3 A;  2C11 A;  3PS8 A;  4FMA A;  4WFO A;  4WYK B;  3KSE D;  2Z7A A;  3K9M C;  1O7P B;  4L8O A;  1IVV A;  4XBY A;  2W04 A;  3F40 A;  3X3Y A;  3X40 A;  1FGM A;  3NV0 B;  3CU3 A;  1EA2 A;  4MEI A;  1VQL 3;  2CFK A;  2KXG A;  3MWZ A;  3CCS 3;  3MSO A;  3I55 3;  2GEX A;  4EV5 A;  4RZM A;  5IER A;  3FSD A;  4HYZ A;  5IG5 A;  1QMA A;  4L7K A;  3J7Y d;  4O2H A;  3FG1 A;  2KCD A;  1ASK A;  4HZB B;  3CCJ 3;  3HX8 A;  1GYB A;  1OHP A;  1Q40 A;  3EE1 A;  3F7S A;  1N5H A;  1GY6 A;  1ZO2 A;  1M9G A;  1ZX2 A;  2K54 A;  2W56 B;  3UL6 A;  4OVM A;  3V98 A;  2YX9 A;  1YJ9 3;  1US1 A;  2M7O A;  4G1M B;  5KP3 A;  4RBN A;  1VQK 3;  3B7C A;  4HM3 B;  3KZT A;  1HKX A;  5AYR B;  2E2U A;  3OWU A;  1VZZ A;  3EB8 A;  2FNQ A;  5IW9 A;  3LTA A;  2CFD A;  3DMC A;  1STF I;  2JQ5 A;  1VQ9 3;  2BHM A;  3CNX A;  3X42 A;  3JUN A;  4BTX A;  1FGO A;  3STD A;  1OGZ A;  2K0M A;  2FGT A;  1JN5 A;  1W6G A;  3LTB A;  3T0U A;  1D6Z A;  1UI7 A;  1VQN 3;  4EYC A;  5AIG A;  2UX0 A;  4MMX B;  4EXR A;  3S27 A;  5D81 A;  4IPB A;  1LNH A;  3DGN A;  2XEP A;  4O3V A;  1YIT 3;  1FGR A;  4K1V A;  4GB5 A;  1IU7 A;  1IDP A;  5CF1 A;  2WOF A;  1ROA A;  4FMC A;  3Q2P A;  2R4I A;  5IG4 A;  4FCZ A;  3NQZ A;  1CYV A;  3LOY A;  4MMZ B;  3X41 A;  2WGO A;  1OUN A;  3WDG B;  1GY7 A;  1TP6 A;  3NBR A;  4N3V A;  2RSX A;  3GZX B;  3F14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...