3CC43

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cc4300
2QEX3 1VQO3 3CCL3 3I553 1VQK3 3CCS3 1YIJ3 1VQ53 3CCR3 3CCV3 3CCE3 1VQP3 3CC23 1Q824 3I563 3OW22 2OTJ3 1YIT3 1VQM3 1K9M4 1QVF2 1VQ93 1VQL3 1KD14 3CC43 1Q864 1N8R4 1M904 1M1K4 1YJW3 3CCQ3 1S723 3CCJ3 1VQ63 2OTL3 3CMA3 1Q7Y4 3CXC2 1YJN3 3G713 1W2B2 1VQ83 1Q814 1VQ73 1KQS2 3G6E3 2QA43 1YJ93 1JJ22 3CD63 1K734 3CPW2 3CCU3 3CC73 1YI23 3CCM3 1QVG2 3G4S3 1YHQ3 1KC84 1VQN3 1K8A4 3CME3 1VQ43 1NJI4
chains in the Genus database with same CATH superfamily
3CCL3 8CHOA 1BRSA 2GBXB 4R1KA 1WNHA 2I9WA 1RGEA 3ER7A 3E99A 1E3RA 1IVVA 1N9EA 1OHSA 1OPYA 1IQ8A 3KSED 1DMQA 1X1WA 4FMBA 1BAOA 1UI7A 1I3FA 7GSPA 1PFPA 2Z6BA 2CFKA 2CFWA 3EBYA 3JVCA 1UCJA 2LQVA 1LNHA 1JB4A 3NBBA 1RN7A 3OWYA 5KP3A 2WGOA 3SOYA 4ILFA 5A0OB 1Q864 1VQL3 4RNYA 1B20A 3WA2X 1S723 3EHCA 4HM7B 1STDA 3CCJ3 1RNBA 3HZPA 4KFDA 3CXC2 4CJNA 1FGRA 4XDVA 2W03A 1PY3A 2Y73A 5IG3A 2QA43 1TUHA 3B4OA 3BNCA 3DGMA 3B8LA 2WGQA 1FA3A 3U1WA 2W6JH 3ZFZA 1YJ93 2YX9A 2R41A 3VF1A 1G02A 3V92A 1NDOB 2KXGA 1GYBA 1DMNA 2O9UX 1IT7A 2MF7A 3X42A 5D83A 3EF8A 1UDII 2F4YA 2W56A 3X3ZA 2RCDA 3FG3A 3Q2PA 4EYCA 1AVKA 4OVMA 3UJMA 1I70A 3BNDA 1HYFA 3Q1CA 3JUMA 3T8UA 3AHWA 5IG4A 2C4BA 2IA7A 1A67A 1BSDA 1JKGB 1KSIA 1N9JA 2CWVA 2GXFA 3EX9A 5LC6A 4R9LA 3LZAA 3GWRA 1UUGB 3GZXB 1O7PB 4R80A 4CPKA 1O7GB 5BXQA 1KQS2 1TFKA 3S28A 1RGHA 2KF5A 4H61A 3WOEB 4JF8A 1FGMA 4ORLA 3F40A 2CX1A 4GL6A 4HJLB 4HYZA 7RNTA 2BMOB 2XGNA 2OOVA 4EXRA 2A15A 3KSPA 1ROAA 1UW1A 3EC9A 2LYXA 2D42A 3NQZA 4WHAA 1T3BA 1FZUA 3A5EA 1VQP3 1C54A 1IU7A 1B2ZA 4N6LA 4RNZA 2K3DA 4XBXA 3CNXA 1U8CB 3D9RA 3MG1A 4WYKB 2RSXA 4NHFA 5G2GA 1BU4A 4TX4A 4MMXB 1JB5A 3PZWA 5KP1A 1QALA 2OTL3 3FF2A 4FCMA 1Q814 2P05A 9RNTA 1LOXA 1OGZA 1YHQ3 2ML5A 3SXXA 1VQ43 3PGBA 3BU4A 1S5AA 3NHXA 1I8VA 1Q40A 1W2ZA 1O7MB 3TDGA 4BTWA 6STDA 1YGWA 3FG4A 1UGHI 1AR0A 3Q3FA 1SIHA 3SLUA 3UB1A 1JBRA 5IEOA 1GOYA 3KCHA 1VZZA 2IYJA 1R4YA 3STDA 1Q9EA 1C7HA 4FMCA 1BSEA 1FGTA 4HM8B 4HVNA 2L4VA 1OF5A 1W00A 1W02A 2KRTA 4J9AA 5ELJA 1JBTA 2FNQA 1RCLA 3FG1A 2HOHA 5RNTA 1GMPA 4J5KA 5AEWB 1YGEA 5G1KA 3NV0B 3FF0A 4IPBA 1VQN3 1V58A 3LXUX 3KE7A 1CYUA 4O2HA 1TFOA 2XRXB 1MNLA 1T2HA 2Y74A 3CCE3 4FCJA 1ZX2A 1NNVA 5HOHA 2XR8B 3NXJA 4BU4A 3UL5A 1ULJB 5KP4A 3CU3A 3F9SA 1ZS7A 2KF4A 2HMMB 4PEJA 1B3SA 3X40A 1GY5A 4GSPA 1TIJA 1RLSA 2SBLA 5FGOA 1BSBA 1RJOA 2P0MA 3V98A 3LT8A 3N54B 1O7NB 4XM4A 1PU4A 4MJDA 3CMA3 2WOHA 3BIRA 3ALAA 3M8CA 3NBJA 4O02B 2RFRA 1MGWA 3UL6A 3KZTA 5AIGA 1K8A4 5CLKA 4HM1B 3D79A 3DGYA 3GSPA 3LTCA 1GMRA 3G0KA 3EJVA 1VQ53 1TRQA 1IV7A 3EB8A 2KAAA 3SX1A 3DY5A 4EC6A 1FGQA 2W9QA 3VSYA 2F5WA 1N5HA 1AQZA 2WOFA 2YFJB 1QVF2 1VQM3 1SJWA 2O3OA 1BUJA 3IPTA 3PXMA 3RGRA 2P09A 4K1VA 1KD14 3LOYA 1YNVX 2W0QA 3SYUA 1YJW3 3VGNA 1O7WB 3SEDA 1AY7A 3F7XA 1W01A 1TP6A 1IVUA 3L0RA 3X41A 1HZ1A 3BLZA 3EQQB 1V57A 1W4NA 4N6MA 1IK3A 4FR9A 1K734 1EUIC 5IENA 1BRIA 4K1UA 4N6V0 3JUQA 1YI23 2XH9A 6RNTA 1RKYA 1FW7A 5CF1A 1IVXA 3LYGA 5JPUA 2H0IA 2MC8A 1FUWA 3FSDA 3S5CA 1RN4A 1B21A 1GY7A 2ZA4A 3MPHA 4XDWA 3SOAA 5D81A 2WO0A 1OCVA 2CIUA 3OW22 2CFGA 5CK6A 2UGIA 2BMQB 2M7OA 1LOWA 4EBGA 2D1WA 3RGAA 1JZOA 3D5IA 2CKFB 2IY2A 2XSHB 1IT8A 1ZGXA 1CQSA 1CYVA 4AKZA 3CD63 3EBTA 4KFEA 3GZRA 8RNTA 3F8XA 1OHPA 2HMOB 3MHEA 1JRQA 3DUKA 4N6TA 1MOLA 1VQQA 1UCKA 1I2FA 1IYYA 2BHMA 1OACA 1VQK3 3PYJA 2W56B 3KFQC 3QRDA 2OQEA 4X2HA 3AGOA 2CK3H 2ZDJA 2IUKA 1GD4A 3B4PA 3NX0A 3KKGA 1BRJA 5IG5A 1Q824 2ML6A 4MMZB 3S27A 3HX8A 2YFLB 4HM0B 4ZM8A 1NB5I 4CDLA 3FKAA 2UX0A 1M1K4 1HU9A 1GMQA 4AKYA 1VQ63 2F5MA 3EE1A 3G713 3MG2A 1W2B2 1VQ83 3IJEB 1FUSA 1BNFA 4HM6B 1CEWI 2GU1A 4LYLB 1ZO2A 1YVBI 5G1LA 3F14A 5I97A 1F8NA 4L7KA 1LQGC 1TJDA 3AMOA 4G1MB 5BVBA 1VQO3 4BL3A 4KFFA 4HZBB 2XFTA 3H3HA 2QIYA 3DH2A 2KF3A 3ECFA 1LRAA 3N8BA 6GSPA 5EVHA 4L8PA 4OUQA 3NM7A 3BNEA 1GOUA 3WHOA 4BTXA 1BNIA 1IDPA 2OOVC 3LT9A 3T8NA 1BNRA 1RCKA 3GZYB 1JV2B 1MWSA 2BMRB 3HK4A 1PYLA 2OQEC 2CG0A 3OX9A 4HZ9B 5IW9A 5AYSC 3CC43 4RNTA 1WMPA 1RNTA 3HIIA 4DKIA 2Q07A 2RBIA 1BIRA 4L8OA 1N8QA 2HMNB 1FYSA 1Q7HA 1UI8A 5EEOA 1GD3A 1VQ73 1JBSA 2E2TA 4JRFA 3K0ZA 3CPW2 3AGNA 1EA2A 2HMKB 1Q40B 3PCSA 2C10A 2KF6A 3NM2A 3AHSA 2Z77A 2XEPA 1QAFA 1W6YA 3WODG 1T2IA 1YIJ3 1TRPA 4IIAA 3URPA 4EV5A 3IMAB 1JB2A 1A2KA 4O8SA 3FLJA 3MSOA 1BVIA 1RDSA 3JUPA 1OF5B 2GEXA 2E2VA 1VQ93 2GBWB 3S67A 2F99A 3DGNA 4N3VA 1TTOA 1GSPA 1DVCA 1X1XA 2BO9B 1B2SA 3N9HA 4FCZA 2W9PA 3WDGB 1LNIA 1B27A 1BOXA 3DMCA 3B7CA 4K90B 3RNTA 4BL2A 3GRDA 4QWTA 3OXAA 2XGLA 3FZWA 1MWTA 1NJI4 1JNQA 1Y4KA 4KT3B 1B2XA 1LOYA 3QK9A 1SQWA 1RN1A 3ZG0A 3MG3A 1A2VA 2H0GA 2SARA 2AAEA 3O8YA 2IUJA 2F86B 2PZVA 4X2OA 4R9KA 1MWUA 1I0XA 2XFSA 2QGUA 1I2GA 3JUOA 3NBRA 1J2BA 4NPBA 3DGLA 3F7SA 4XBYA 5AIFA 2P38A 1BRKA 3F8HA 3MYTA 5AEUB 1YJN3 3FH1A 1ULIB 1O7HB 1RGFA 2CFLA 3LH4A 1AV4A 1JJ22 3K63A 1GOVA 1ROVA 1BRGA 1OUNA 1IV9A 3HIGA 2YFIB 1DYUA 3V99A 4HM4B 4Q53A 1LXEA 5IERA 4IT7A 5IG0A 3CNMA 2XF3A 3KIIA 4HM3B 2QEX3 2CWTA 3I553 2GSPA 2B1XB 4WFOA 1OH0A 4HBRA 1MWRA 1M9GA 2E2UA 2BNGA 5TGNA 1TU5A 1BANA 2HMLB 1K41A 2IMJA 1W5ZA 3JUNA 1QVG2 2CHCA 5FW5A 2CWUA 3A76A 1QMAA 2ZHXB 3EN8A 2CFDA 1B2UA 1D6YA 1RSNA 4HKVB 1IQYA 5LC7A 1W6GA 3BNBA 3D4AA 1RRLA 1FGOA 1RGCA 5DRVA 4EW5A 1UGIA 1Q7Y4 1X1YA 1JKGA 1X1UA 4STDA 3PCRA 3G6E3 4RZMA 1DVDA 5AI1A 3RDEA 5M18A 3FGYA 2Z76A 1NWWA 1NU3A 3HI7A 3K5TA 1BNGA 1BNSA 1LQMB 4O3VA 5M1AA 1GS3A 3G4S3 3G16A 2BIRA 1EEJA 3Q90A 3WR2A 1WMNA 1G96A 4RBNA 4I4KA 2RGQA 1LVNA 3GZBA 4HAAA 3CCV3 5EQLA 1RMSA 1IVWA 3I0YA 4LEHA 3CC23 1DETA 5BIRA 2JDIH 3WOFB 3ZG5A 2K54A 2OTJ3 1YIT3 1RGAA 3X3XA 4NREA 4N6NB 2Z7AA 4HM2B 2FXTA 2W04A 2B24B 4HOHA 5CXOA 5CF2A 1RHLA 2ZL8A 4WYKA 1K28A 1WQLB 4CCVA 3K9MC 3DZLA 2KCDA 2W2CA 3OWSA 1DE3A 1U5OA 3CPOA 3PS8A 1M1XB 4LGQA 4LZIA 5D82A 1HKXA 1E3VA 3ROBA 5M19A 2STDA 3LTBA 3LTAA 3J7Yd 1SPUA 3CME3 1W7CA 4KVHA 4K61A 3MKIA 3CCR3 3G8ZA 3KN4A 1MGRA 3LMLA 1BNEA 5AIHA 1BUQA 3FCSB 4GHOA 3BB9A 5JPPA 1W6CA 2XSOB 5STDA 4AEQA 2CH9A 2OWPA 1JZDA 4J8TA 4N6OB 1RGKA 1QAKA 2H0HA 2HMJB 2GEYA 2J8XB 3EN1B 4N6UA 3GAXA 2F98A 4GB5A 1EKMA 4MMYB 1LOVA 2JQ5A 2INXA 5AIIA 1WMOA 1V74A 3AMOB 3U97A 5IF6A 3S29A 3OV4A 3NUVA 1L5GB 3CCU3 1RGGA 3DGOA 4BIRA 1KC84 1A90A 1ISKA 2CC3A 3NQYA 1E97A 1I0VA 1UUVB 2BT3A 3NV0A 7STDA 3DM8A 2CW9A 3CCS3 1SIIA 3X3YA 4WWUC 1B2MA 4WP5A 1BSAA 2CX0A 2PNCA 3D3LA 3I563 1I2EA 4EV2A 2UUGC 1EQKA 1SARA 1R4CA 2L1SA 3D5GA 1UUWB 1M904 1BRHA 1GY6A 1KWIA 1D6ZA 3SVAA 1Q42A 5DREA 1RRHA 1BGSA 1WTHA 2AADA 1YVSA 4HM5B 1D6UA 1G0TA 2CG1A 1RGLA 4OK0A 1OGXA 3WMDA 1UCIA 1QJGA 2FGTA 5ELUA 3MWZA 4U13A 4J5GA 4BTYA 1NO3A 3UNLA 3WA3A 2C11A 2V1LA 4MEIA 1ASKA 1N5PA 5JBSA 4R4KA 1JN5A 3HOHA 5IEPA 2GU3A 1BSCA 1NB3I 3K7CA 3LTDA 1CH0A 4FMAA 4KZ1A 4LSOA 1EG9B 3T0UA 1IQXA 1K9M4 1BRNL 5HGRA 2K0MA 3DXOA 4I5QA 2F56A 4H3UA 4XB5A 1US1A 5GSPA 2P0XA 2OCTA 1N8R4 1DMMA 4FMDA 2BU4A 3H51A 4XBTA 5AYRB 3CCQ3 1BNJA 1RTUA 5BU4A 1STFI 1OHOA 1FUTA 2RNTA 1I3IA 1Z1SA 2R4IA 1UCLA 3CC73 1A2PA 1T5YA 3CCM3 1AVLA 3OWUA 4LMIA 1JN5B
chains in the Genus database with same CATH topology
3CCL3 8CHOA 2GBXB 4R1KA 1WNHA 2I9WA 3ER7A 3E99A 1E3RA 1IVVA 1N9EA 1OHSA 1OPYA 1IQ8A 3KSED 1DMQA 4FMBA 1UI7A 1PFPA 2Z6BA 2CFKA 2CFWA 3EBYA 3JVCA 3NBBA 2LQVA 1LNHA 1JB4A 3OWYA 1RN7A 5KP3A 3SOYA 2WGOA 5A0OB 1Q864 1VQL3 4RNYA 3WA2X 1S723 3EHCA 4HM7B 1STDA 3CCJ3 3HZPA 4KFDA 3CXC2 1FGRA 4XDVA 2W03A 5IG3A 2Y73A 2QA43 1TUHA 3B4OA 3BNCA 3DGMA 3B8LA 2WGQA 1FA3A 3U1WA 2W6JH 1YJ93 2YX9A 3VF1A 3V92A 1NDOB 2KXGA 1GYBA 1DMNA 2O9UX 1IT7A 2MF7A 3X42A 5D83A 3EF8A 2W56A 3X3ZA 2RCDA 3FG3A 3Q2PA 4EYCA 1AVKA 4OVMA 3UJMA 3BNDA 3Q1CA 3JUMA 3T8UA 5IG4A 2IA7A 1A67A 1KSIA 1JKGB 1N9JA 2CWVA 2GXFA 3EX9A 5LC6A 4R9LA 3LZAA 3GWRA 3GZXB 1O7PB 4R80A 1KQS2 1O7GB 5BXQA 1TFKA 3S28A 3WOEB 4H61A 4JF8A 1FGMA 4ORLA 3F40A 4GL6A 4HJLB 4HYZA 2BMOB 2XGNA 2OOVA 4EXRA 2A15A 3KSPA 1ROAA 1UW1A 3EC9A 2LYXA 2D42A 3NQZA 4WHAA 1VQP3 1IU7A 4N6LA 4RNZA 4XBXA 3CNXA 1U8CB 3D9RA 3MG1A 4WYKB 2RSXA 4NHFA 5G2GA 4TX4A 4MMXB 1JB5A 3PZWA 5KP1A 1QALA 2OTL3 3FF2A 4FCMA 1Q814 2P05A 1LOXA 1OGZA 1YHQ3 2ML5A 3SXXA 1VQ43 3PGBA 1S5AA 3NHXA 1Q40A 1W2ZA 1O7MB 3TDGA 4BTWA 6STDA 3FG4A 1AR0A 1SIHA 3SLUA 3UB1A 5IEOA 1VZZA 3STDA 4HVNA 1C7HA 4FMCA 1FGTA 4HM8B 2L4VA 1OF5A 1W00A 1W02A 2KRTA 4J9AA 5ELJA 2FNQA 3FG1A 5AEWB 1YGEA 3NV0B 3FF0A 4IPBA 1VQN3 3LXUX 3KE7A 4O2HA 1TFOA 2XRXB 1MNLA 2Y74A 3CCE3 4FCJA 1ZX2A 2XR8B 3NXJA 3UL5A 1ULJB 5KP4A 3CU3A 3F9SA 2HMMB 4PEJA 3X40A 1GY5A 1TIJA 2SBLA 5FGOA 1RJOA 2P0MA 3V98A 3LT8A 3N54B 1O7NB 4XM4A 1PU4A 4MJDA 3CMA3 2WOHA 3ALAA 3M8CA 3NBJA 4O02B 2RFRA 3UL6A 3KZTA 5AIGA 1K8A4 5CLKA 4HM1B 3LTCA 3G0KA 3EJVA 1VQ53 1IV7A 3EB8A 3SX1A 3DY5A 4EC6A 1FGQA 2W9QA 3VSYA 1N5HA 2WOFA 2YFJB 1QVF2 1VQM3 1SJWA 2O3OA 3IPTA 3PXMA 3RGRA 2P09A 4K1VA 1KD14 3LOYA 2W0QA 1YJW3 3VGNA 1O7WB 3SEDA 3F7XA 1W01A 1TP6A 1IVUA 3L0RA 3X41A 3BLZA 3EQQB 1IK3A 1W4NA 4N6MA 4FR9A 1K734 5IENA 4K1UA 4N6V0 3JUQA 1YI23 2XH9A 1RKYA 5CF1A 1IVXA 3LYGA 5JPUA 2MC8A 1FUWA 3FSDA 3S5CA 1GY7A 3MPHA 4XDWA 3SOAA 5D81A 2WO0A 1OCVA 2CIUA 3OW22 2CFGA 5CK6A 2BMQB 2M7OA 4EBGA 2D1WA 3RGAA 2CKFB 2XSHB 1IT8A 1CQSA 1CYVA 4AKZA 3CD63 3EBTA 4KFEA 3GZRA 3F8XA 1OHPA 2HMOB 3MHEA 1JRQA 3DUKA 4N6TA 1MOLA 2BHMA 1OACA 1VQK3 3PYJA 2W56B 3KFQC 3QRDA 2OQEA 4X2HA 2CK3H 2ZDJA 2IUKA 1GD4A 3B4PA 3NX0A 3KKGA 5IG5A 1Q824 2ML6A 4MMZB 3S27A 3HX8A 2YFLB 4HM0B 4ZM8A 1NB5I 4CDLA 3FKAA 2UX0A 1M1K4 1HU9A 4AKYA 1VQ63 3EE1A 3G713 3MG2A 1W2B2 1VQ83 3IJEB 4HM6B 1CEWI 2GU1A 1ZO2A 1YVBI 3F14A 5I97A 1F8NA 4L7KA 3AMOA 4G1MB 5BVBA 1VQO3 4KFFA 4HZBB 2XFTA 3H3HA 2QIYA 3ECFA 3N8BA 5EVHA 4L8PA 4OUQA 3NM7A 3BNEA 4BTXA 1IDPA 2OOVC 3LT9A 3T8NA 3GZYB 1JV2B 2BMRB 3HK4A 2OQEC 2CG0A 3OX9A 4HZ9B 5IW9A 5AYSC 3CC43 1WMPA 3HIIA 2Q07A 4L8OA 1N8QA 2HMNB 1UI8A 5EEOA 1GD3A 1VQ73 2E2TA 4JRFA 3K0ZA 3CPW2 1EA2A 2HMKB 1Q40B 3PCSA 2C10A 3NM2A 2Z77A 2XEPA 1QAFA 1W6YA 3WODG 1YIJ3 4IIAA 4EV5A 3IMAB 1JB2A 1A2KA 4O8SA 3FLJA 3MSOA 3JUPA 1OF5B 2GEXA 2E2VA 1VQ93 2GBWB 3S67A 2F99A 3DGNA 4N3VA 1DVCA 2BO9B 3N9HA 4FCZA 2W9PA 3WDGB 3DMCA 3B7CA 4K90B 3GRDA 4QWTA 3OXAA 2XGLA 3FZWA 1NJI4 1JNQA 1Y4KA 3QK9A 1SQWA 3MG3A 1A2VA 3O8YA 2IUJA 2F86B 2PZVA 4X2OA 4R9KA 2XFSA 2QGUA 3JUOA 1J2BA 3NBRA 3DGLA 3F7SA 4XBYA 5AIFA 2P38A 3F8HA 5AEUB 3MYTA 1YJN3 3FH1A 1ULIB 1O7HB 1JN5B 2CFLA 3LH4A 1AV4A 1JJ22 3K63A 1ROVA 3V99A 1OUNA 1IV9A 3HIGA 2YFIB 1DYUA 4HM4B 4Q53A 1LXEA 5IERA 4IT7A 5IG0A 3CNMA 2XF3A 3KIIA 4HM3B 2QEX3 2CWTA 3I553 2B1XB 4WFOA 1OH0A 4HBRA 1M9GA 2E2UA 2BNGA 5TGNA 1TU5A 2HMLB 1K41A 2IMJA 1W5ZA 3JUNA 2CHCA 5FW5A 2CWUA 3A76A 1QMAA 3EN8A 2CFDA 1D6YA 4HKVB 1IQYA 5LC7A 1W6GA 3BNBA 1RRLA 1FGOA 5DRVA 1Q7Y4 4STDA 1JKGA 3PCRA 3G6E3 4RZMA 1DVDA 5AI1A 3RDEA 3FGYA 2Z76A 1NWWA 1NU3A 3HI7A 3K5TA 4O3VA 3G4S3 1QVG2 1CYUA 1GS3A 3G16A 3Q90A 1WMNA 1G96A 4RBNA 4I4KA 2RGQA 1LVNA 3GZBA 3CCV3 5EQLA 1IVWA 3I0YA 4LEHA 3CC23 2JDIH 3WOFB 2K54A 2OTJ3 1YIT3 3X3XA 4NREA 4N6NB 2Z7AA 4HM2B 2FXTA 2W04A 2B24B 5CXOA 5CF2A 2ZL8A 4WYKA 1K28A 1WQLB 4CCVA 3K9MC 3DZLA 2KCDA 2W2CA 3OWSA 1U5OA 3CPOA 3PS8A 1M1XB 4LGQA 4LZIA 5D82A 1HKXA 1E3VA 3ROBA 2STDA 3LTBA 3LTAA 3J7Yd 1SPUA 3CME3 1W7CA 4KVHA 4K61A 3MKIA 3CCR3 3G8ZA 3KN4A 3LMLA 5AIHA 1BUQA 3FCSB 3BB9A 5JPPA 1W6CA 2XSOB 5STDA 4AEQA 2CH9A 2OWPA 4J8TA 4N6OB 1QAKA 2HMJB 2GEYA 3EN1B 4N6UA 3GAXA 2F98A 4GB5A 1EKMA 4MMYB 5AIIA 2INXA 1WMOA 1V74A 3AMOB 3U97A 5IF6A 3S29A 3OV4A 3NUVA 1L5GB 3CCU3 3DGOA 1KC84 1A90A 1ISKA 2CC3A 3NQYA 1E97A 1UUVB 3NV0A 2BT3A 7STDA 3DM8A 2CW9A 3CCS3 1SIIA 3X3YA 4WWUC 4WP5A 2PNCA 3D3LA 3I563 4EV2A 1EQKA 1R4CA 1UUWB 1M904 1GY6A 1KWIA 1D6ZA 3SVAA 1Q42A 5DREA 1RRHA 1WTHA 4HM5B 1D6UA 2CG1A 4OK0A 1OGXA 3WMDA 1QJGA 2FGTA 5ELUA 3MWZA 4U13A 4BTYA 1NO3A 3UNLA 3WA3A 2C11A 2V1LA 4MEIA 1ASKA 1N5PA 5JBSA 4R4KA 1JN5A 5IEPA 2GU3A 1NB3I 3K7CA 3LTDA 4FMAA 4KZ1A 4LSOA 3T0UA 1EG9B 1IQXA 1K9M4 5HGRA 2K0MA 3DXOA 4XB5A 4H3UA 1US1A 2P0XA 2OCTA 1N8R4 1DMMA 4FMDA 4XBTA 3H51A 5AYRB 3CCQ3 1STFI 1OHOA 1Z1SA 2R4IA 3CC73 3CCM3 1T5YA 1AVLA 3OWUA 4LMIA 2JQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX 3;  1VQO 3;  3CCL 3;  3I55 3;  1VQK 3;  3CCS 3;  1YIJ 3;  1VQ5 3;  3CCR 3;  3CCV 3;  3CCE 3;  1VQP 3;  3CC2 3;  1Q82 4;  3I56 3;  3OW2 2;  2OTJ 3;  1YIT 3;  1VQM 3;  1K9M 4;  1QVF 2;  1VQ9 3;  1VQL 3;  1KD1 4;  3CC4 3;  1Q86 4;  1N8R 4;  1M90 4;  1M1K 4;  1YJW 3;  3CCQ 3;  1S72 3;  3CCJ 3;  1VQ6 3;  2OTL 3;  3CMA 3;  1Q7Y 4;  3CXC 2;  1YJN 3;  3G71 3;  1W2B 2;  1VQ8 3;  1Q81 4;  1VQ7 3;  1KQS 2;  3G6E 3;  2QA4 3;  1YJ9 3;  1JJ2 2;  3CD6 3;  1K73 4;  3CPW 2;  3CCU 3;  3CC7 3;  1YI2 3;  3CCM 3;  1QVG 2;  3G4S 3;  1YHQ 3;  1KC8 4;  1VQN 3;  1K8A 4;  3CME 3;  1VQ4 3;  1NJI 4; 
#chains in the Genus database with same CATH topology
 3CCL 3;  8CHO A;  1BRS A;  2GBX B;  4R1K A;  1WNH A;  2I9W A;  1RGE A;  3ER7 A;  3E99 A;  1E3R A;  1IVV A;  1N9E A;  1OHS A;  1OPY A;  1IQ8 A;  3KSE D;  1DMQ A;  1X1W A;  4FMB A;  1BAO A;  1UI7 A;  1I3F A;  7GSP A;  1PFP A;  2Z6B A;  2CFK A;  2CFW A;  3EBY A;  3JVC A;  1UCJ A;  2LQV A;  1LNH A;  1JB4 A;  3NBB A;  1RN7 A;  3OWY A;  5KP3 A;  2WGO A;  3SOY A;  4ILF A;  5A0O B;  1Q86 4;  1VQL 3;  4RNY A;  1B20 A;  3WA2 X;  1S72 3;  3EHC A;  4HM7 B;  1STD A;  3CCJ 3;  1RNB A;  3HZP A;  4KFD A;  3CXC 2;  4CJN A;  1FGR A;  4XDV A;  2W03 A;  1PY3 A;  2Y73 A;  5IG3 A;  2QA4 3;  1TUH A;  3B4O A;  3BNC A;  3DGM A;  3B8L A;  2WGQ A;  1FA3 A;  3U1W A;  2W6J H;  3ZFZ A;  1YJ9 3;  2YX9 A;  2R41 A;  3VF1 A;  1G02 A;  3V92 A;  1NDO B;  2KXG A;  1GYB A;  1DMN A;  2O9U X;  1IT7 A;  2MF7 A;  3X42 A;  5D83 A;  3EF8 A;  1UDI I;  2F4Y A;  2W56 A;  3X3Z A;  2RCD A;  3FG3 A;  3Q2P A;  4EYC A;  1AVK A;  4OVM A;  3UJM A;  1I70 A;  3BND A;  1HYF A;  3Q1C A;  3JUM A;  3T8U A;  3AHW A;  5IG4 A;  2C4B A;  2IA7 A;  1A67 A;  1BSD A;  1JKG B;  1KSI A;  1N9J A;  2CWV A;  2GXF A;  3EX9 A;  5LC6 A;  4R9L A;  3LZA A;  3GWR A;  1UUG B;  3GZX B;  1O7P B;  4R80 A;  4CPK A;  1O7G B;  5BXQ A;  1KQS 2;  1TFK A;  3S28 A;  1RGH A;  2KF5 A;  4H61 A;  3WOE B;  4JF8 A;  1FGM A;  4ORL A;  3F40 A;  2CX1 A;  4GL6 A;  4HJL B;  4HYZ A;  7RNT A;  2BMO B;  2XGN A;  2OOV A;  4EXR A;  2A15 A;  3KSP A;  1ROA A;  1UW1 A;  3EC9 A;  2LYX A;  2D42 A;  3NQZ A;  4WHA A;  1T3B A;  1FZU A;  3A5E A;  1VQP 3;  1C54 A;  1IU7 A;  1B2Z A;  4N6L A;  4RNZ A;  2K3D A;  4XBX A;  3CNX A;  1U8C B;  3D9R A;  3MG1 A;  4WYK B;  2RSX A;  4NHF A;  5G2G A;  1BU4 A;  4TX4 A;  4MMX B;  1JB5 A;  3PZW A;  5KP1 A;  1QAL A;  2OTL 3;  3FF2 A;  4FCM A;  1Q81 4;  2P05 A;  9RNT A;  1LOX A;  1OGZ A;  1YHQ 3;  2ML5 A;  3SXX A;  1VQ4 3;  3PGB A;  3BU4 A;  1S5A A;  3NHX A;  1I8V A;  1Q40 A;  1W2Z A;  1O7M B;  3TDG A;  4BTW A;  6STD A;  1YGW A;  3FG4 A;  1UGH I;  1AR0 A;  3Q3F A;  1SIH A;  3SLU A;  3UB1 A;  1JBR A;  5IEO A;  1GOY A;  3KCH A;  1VZZ A;  2IYJ A;  1R4Y A;  3STD A;  1Q9E A;  1C7H A;  4FMC A;  1BSE A;  1FGT A;  4HM8 B;  4HVN A;  2L4V A;  1OF5 A;  1W00 A;  1W02 A;  2KRT A;  4J9A A;  5ELJ A;  1JBT A;  2FNQ A;  1RCL A;  3FG1 A;  2HOH A;  5RNT A;  1GMP A;  4J5K A;  5AEW B;  1YGE A;  5G1K A;  3NV0 B;  3FF0 A;  4IPB A;  1VQN 3;  1V58 A;  3LXU X;  3KE7 A;  1CYU A;  4O2H A;  1TFO A;  2XRX B;  1MNL A;  1T2H A;  2Y74 A;  3CCE 3;  4FCJ A;  1ZX2 A;  1NNV A;  5HOH A;  2XR8 B;  3NXJ A;  4BU4 A;  3UL5 A;  1ULJ B;  5KP4 A;  3CU3 A;  3F9S A;  1ZS7 A;  2KF4 A;  2HMM B;  4PEJ A;  1B3S A;  3X40 A;  1GY5 A;  4GSP A;  1TIJ A;  1RLS A;  2SBL A;  5FGO A;  1BSB A;  1RJO A;  2P0M A;  3V98 A;  3LT8 A;  3N54 B;  1O7N B;  4XM4 A;  1PU4 A;  4MJD A;  3CMA 3;  2WOH A;  3BIR A;  3ALA A;  3M8C A;  3NBJ A;  4O02 B;  2RFR A;  1MGW A;  3UL6 A;  3KZT A;  5AIG A;  1K8A 4;  5CLK A;  4HM1 B;  3D79 A;  3DGY A;  3GSP A;  3LTC A;  1GMR A;  3G0K A;  3EJV A;  1VQ5 3;  1TRQ A;  1IV7 A;  3EB8 A;  2KAA A;  3SX1 A;  3DY5 A;  4EC6 A;  1FGQ A;  2W9Q A;  3VSY A;  2F5W A;  1N5H A;  1AQZ A;  2WOF A;  2YFJ B;  1QVF 2;  1VQM 3;  1SJW A;  2O3O A;  1BUJ A;  3IPT A;  3PXM A;  3RGR A;  2P09 A;  4K1V A;  1KD1 4;  3LOY A;  1YNV X;  2W0Q A;  3SYU A;  1YJW 3;  3VGN A;  1O7W B;  3SED A;  1AY7 A;  3F7X A;  1W01 A;  1TP6 A;  1IVU A;  3L0R A;  3X41 A;  1HZ1 A;  3BLZ A;  3EQQ B;  1V57 A;  1W4N A;  4N6M A;  1IK3 A;  4FR9 A;  1K73 4;  1EUI C;  5IEN A;  1BRI A;  4K1U A;  4N6V 0;  3JUQ A;  1YI2 3;  2XH9 A;  6RNT A;  1RKY A;  1FW7 A;  5CF1 A;  1IVX A;  3LYG A;  5JPU A;  2H0I A;  2MC8 A;  1FUW A;  3FSD A;  3S5C A;  1RN4 A;  1B21 A;  1GY7 A;  2ZA4 A;  3MPH A;  4XDW A;  3SOA A;  5D81 A;  2WO0 A;  1OCV A;  2CIU A;  3OW2 2;  2CFG A;  5CK6 A;  2UGI A;  2BMQ B;  2M7O A;  1LOW A;  4EBG A;  2D1W A;  3RGA A;  1JZO A;  3D5I A;  2CKF B;  2IY2 A;  2XSH B;  1IT8 A;  1ZGX A;  1CQS A;  1CYV A;  4AKZ A;  3CD6 3;  3EBT A;  4KFE A;  3GZR A;  8RNT A;  3F8X A;  1OHP A;  2HMO B;  3MHE A;  1JRQ A;  3DUK A;  4N6T A;  1MOL A;  1VQQ A;  1UCK A;  1I2F A;  1IYY A;  2BHM A;  1OAC A;  1VQK 3;  3PYJ A;  2W56 B;  3KFQ C;  3QRD A;  2OQE A;  4X2H A;  3AGO A;  2CK3 H;  2ZDJ A;  2IUK A;  1GD4 A;  3B4P A;  3NX0 A;  3KKG A;  1BRJ A;  5IG5 A;  1Q82 4;  2ML6 A;  4MMZ B;  3S27 A;  3HX8 A;  2YFL B;  4HM0 B;  4ZM8 A;  1NB5 I;  4CDL A;  3FKA A;  2UX0 A;  1M1K 4;  1HU9 A;  1GMQ A;  4AKY A;  1VQ6 3;  2F5M A;  3EE1 A;  3G71 3;  3MG2 A;  1W2B 2;  1VQ8 3;  3IJE B;  1FUS A;  1BNF A;  4HM6 B;  1CEW I;  2GU1 A;  4LYL B;  1ZO2 A;  1YVB I;  5G1L A;  3F14 A;  5I97 A;  1F8N A;  4L7K A;  1LQG C;  1TJD A;  3AMO A;  4G1M B;  5BVB A;  1VQO 3;  4BL3 A;  4KFF A;  4HZB B;  2XFT A;  3H3H A;  2QIY A;  3DH2 A;  2KF3 A;  3ECF A;  1LRA A;  3N8B A;  6GSP A;  5EVH A;  4L8P A;  4OUQ A;  3NM7 A;  3BNE A;  1GOU A;  3WHO A;  4BTX A;  1BNI A;  1IDP A;  2OOV C;  3LT9 A;  3T8N A;  1BNR A;  1RCK A;  3GZY B;  1JV2 B;  1MWS A;  2BMR B;  3HK4 A;  1PYL A;  2OQE C;  2CG0 A;  3OX9 A;  4HZ9 B;  5IW9 A;  5AYS C;  3CC4 3;  4RNT A;  1WMP A;  1RNT A;  3HII A;  4DKI A;  2Q07 A;  2RBI A;  1BIR A;  4L8O A;  1N8Q A;  2HMN B;  1FYS A;  1Q7H A;  1UI8 A;  5EEO A;  1GD3 A;  1VQ7 3;  1JBS A;  2E2T A;  4JRF A;  3K0Z A;  3CPW 2;  3AGN A;  1EA2 A;  2HMK B;  1Q40 B;  3PCS A;  2C10 A;  2KF6 A;  3NM2 A;  3AHS A;  2Z77 A;  2XEP A;  1QAF A;  1W6Y A;  3WOD G;  1T2I A;  1YIJ 3;  1TRP A;  4IIA A;  3URP A;  4EV5 A;  3IMA B;  1JB2 A;  1A2K A;  4O8S A;  3FLJ A;  3MSO A;  1BVI A;  1RDS A;  3JUP A;  1OF5 B;  2GEX A;  2E2V A;  1VQ9 3;  2GBW B;  3S67 A;  2F99 A;  3DGN A;  4N3V A;  1TTO A;  1GSP A;  1DVC A;  1X1X A;  2BO9 B;  1B2S A;  3N9H A;  4FCZ A;  2W9P A;  3WDG B;  1LNI A;  1B27 A;  1BOX A;  3DMC A;  3B7C A;  4K90 B;  3RNT A;  4BL2 A;  3GRD A;  4QWT A;  3OXA A;  2XGL A;  3FZW A;  1MWT A;  1NJI 4;  1JNQ A;  1Y4K A;  4KT3 B;  1B2X A;  1LOY A;  3QK9 A;  1SQW A;  1RN1 A;  3ZG0 A;  3MG3 A;  1A2V A;  2H0G A;  2SAR A;  2AAE A;  3O8Y A;  2IUJ A;  2F86 B;  2PZV A;  4X2O A;  4R9K A;  1MWU A;  1I0X A;  2XFS A;  2QGU A;  1I2G A;  3JUO A;  3NBR A;  1J2B A;  4NPB A;  3DGL A;  3F7S A;  4XBY A;  5AIF A;  2P38 A;  1BRK A;  3F8H A;  3MYT A;  5AEU B;  1YJN 3;  3FH1 A;  1ULI B;  1O7H B;  1RGF A;  2CFL A;  3LH4 A;  1AV4 A;  1JJ2 2;  3K63 A;  1GOV A;  1ROV A;  1BRG A;  1OUN A;  1IV9 A;  3HIG A;  2YFI B;  1DYU A;  3V99 A;  4HM4 B;  4Q53 A;  1LXE A;  5IER A;  4IT7 A;  5IG0 A;  3CNM A;  2XF3 A;  3KII A;  4HM3 B;  2QEX 3;  2CWT A;  3I55 3;  2GSP A;  2B1X B;  4WFO A;  1OH0 A;  4HBR A;  1MWR A;  1M9G A;  2E2U A;  2BNG A;  5TGN A;  1TU5 A;  1BAN A;  2HML B;  1K41 A;  2IMJ A;  1W5Z A;  3JUN A;  1QVG 2;  2CHC A;  5FW5 A;  2CWU A;  3A76 A;  1QMA A;  2ZHX B;  3EN8 A;  2CFD A;  1B2U A;  1D6Y A;  1RSN A;  4HKV B;  1IQY A;  5LC7 A;  1W6G A;  3BNB A;  3D4A A;  1RRL A;  1FGO A;  1RGC A;  5DRV A;  4EW5 A;  1UGI A;  1Q7Y 4;  1X1Y A;  1JKG A;  1X1U A;  4STD A;  3PCR A;  3G6E 3;  4RZM A;  1DVD A;  5AI1 A;  3RDE A;  5M18 A;  3FGY A;  2Z76 A;  1NWW A;  1NU3 A;  3HI7 A;  3K5T A;  1BNG A;  1BNS A;  1LQM B;  4O3V A;  5M1A A;  1GS3 A;  3G4S 3;  3G16 A;  2BIR A;  1EEJ A;  3Q90 A;  3WR2 A;  1WMN A;  1G96 A;  4RBN A;  4I4K A;  2RGQ A;  1LVN A;  3GZB A;  4HAA A;  3CCV 3;  5EQL A;  1RMS A;  1IVW A;  3I0Y A;  4LEH A;  3CC2 3;  1DET A;  5BIR A;  2JDI H;  3WOF B;  3ZG5 A;  2K54 A;  2OTJ 3;  1YIT 3;  1RGA A;  3X3X A;  4NRE A;  4N6N B;  2Z7A A;  4HM2 B;  2FXT A;  2W04 A;  2B24 B;  4HOH A;  5CXO A;  5CF2 A;  1RHL A;  2ZL8 A;  4WYK A;  1K28 A;  1WQL B;  4CCV A;  3K9M C;  3DZL A;  2KCD A;  2W2C A;  3OWS A;  1DE3 A;  1U5O A;  3CPO A;  3PS8 A;  1M1X B;  4LGQ A;  4LZI A;  5D82 A;  1HKX A;  1E3V A;  3ROB A;  5M19 A;  2STD A;  3LTB A;  3LTA A;  3J7Y d;  1SPU A;  3CME 3;  1W7C A;  4KVH A;  4K61 A;  3MKI A;  3CCR 3;  3G8Z A;  3KN4 A;  1MGR A;  3LML A;  1BNE A;  5AIH A;  1BUQ A;  3FCS B;  4GHO A;  3BB9 A;  5JPP A;  1W6C A;  2XSO B;  5STD A;  4AEQ A;  2CH9 A;  2OWP A;  1JZD A;  4J8T A;  4N6O B;  1RGK A;  1QAK A;  2H0H A;  2HMJ B;  2GEY A;  2J8X B;  3EN1 B;  4N6U A;  3GAX A;  2F98 A;  4GB5 A;  1EKM A;  4MMY B;  1LOV A;  2JQ5 A;  2INX A;  5AII A;  1WMO A;  1V74 A;  3AMO B;  3U97 A;  5IF6 A;  3S29 A;  3OV4 A;  3NUV A;  1L5G B;  3CCU 3;  1RGG A;  3DGO A;  4BIR A;  1KC8 4;  1A90 A;  1ISK A;  2CC3 A;  3NQY A;  1E97 A;  1I0V A;  1UUV B;  2BT3 A;  3NV0 A;  7STD A;  3DM8 A;  2CW9 A;  3CCS 3;  1SII A;  3X3Y A;  4WWU C;  1B2M A;  4WP5 A;  1BSA A;  2CX0 A;  2PNC A;  3D3L A;  3I56 3;  1I2E A;  4EV2 A;  2UUG C;  1EQK A;  1SAR A;  1R4C A;  2L1S A;  3D5G A;  1UUW B;  1M90 4;  1BRH A;  1GY6 A;  1KWI A;  1D6Z A;  3SVA A;  1Q42 A;  5DRE A;  1RRH A;  1BGS A;  1WTH A;  2AAD A;  1YVS A;  4HM5 B;  1D6U A;  1G0T A;  2CG1 A;  1RGL A;  4OK0 A;  1OGX A;  3WMD A;  1UCI A;  1QJG A;  2FGT A;  5ELU A;  3MWZ A;  4U13 A;  4J5G A;  4BTY A;  1NO3 A;  3UNL A;  3WA3 A;  2C11 A;  2V1L A;  4MEI A;  1ASK A;  1N5P A;  5JBS A;  4R4K A;  1JN5 A;  3HOH A;  5IEP A;  2GU3 A;  1BSC A;  1NB3 I;  3K7C A;  3LTD A;  1CH0 A;  4FMA A;  4KZ1 A;  4LSO A;  1EG9 B;  3T0U A;  1IQX A;  1K9M 4;  1BRN L;  5HGR A;  2K0M A;  3DXO A;  4I5Q A;  2F56 A;  4H3U A;  4XB5 A;  1US1 A;  5GSP A;  2P0X A;  2OCT A;  1N8R 4;  1DMM A;  4FMD A;  2BU4 A;  3H51 A;  4XBT A;  5AYR B;  3CCQ 3;  1BNJ A;  1RTU A;  5BU4 A;  1STF I;  1OHO A;  1FUT A;  2RNT A;  1I3I A;  1Z1S A;  2R4I A;  1UCL A;  3CC7 3;  1A2P A;  1T5Y A;  3CCM 3;  1AVL A;  3OWU A;  4LMI A;  1JN5 B; 
#chains in the Genus database with same CATH homology
 3CCL 3;  8CHO A;  2GBX B;  4R1K A;  1WNH A;  2I9W A;  3ER7 A;  3E99 A;  1E3R A;  1IVV A;  1N9E A;  1OHS A;  1OPY A;  1IQ8 A;  3KSE D;  1DMQ A;  4FMB A;  1UI7 A;  1PFP A;  2Z6B A;  2CFK A;  2CFW A;  3EBY A;  3JVC A;  3NBB A;  2LQV A;  1LNH A;  1JB4 A;  3OWY A;  1RN7 A;  5KP3 A;  3SOY A;  2WGO A;  5A0O B;  1Q86 4;  1VQL 3;  4RNY A;  3WA2 X;  1S72 3;  3EHC A;  4HM7 B;  1STD A;  3CCJ 3;  3HZP A;  4KFD A;  3CXC 2;  1FGR A;  4XDV A;  2W03 A;  5IG3 A;  2Y73 A;  2QA4 3;  1TUH A;  3B4O A;  3BNC A;  3DGM A;  3B8L A;  2WGQ A;  1FA3 A;  3U1W A;  2W6J H;  1YJ9 3;  2YX9 A;  3VF1 A;  3V92 A;  1NDO B;  2KXG A;  1GYB A;  1DMN A;  2O9U X;  1IT7 A;  2MF7 A;  3X42 A;  5D83 A;  3EF8 A;  2W56 A;  3X3Z A;  2RCD A;  3FG3 A;  3Q2P A;  4EYC A;  1AVK A;  4OVM A;  3UJM A;  3BND A;  3Q1C A;  3JUM A;  3T8U A;  5IG4 A;  2IA7 A;  1A67 A;  1KSI A;  1JKG B;  1N9J A;  2CWV A;  2GXF A;  3EX9 A;  5LC6 A;  4R9L A;  3LZA A;  3GWR A;  3GZX B;  1O7P B;  4R80 A;  1KQS 2;  1O7G B;  5BXQ A;  1TFK A;  3S28 A;  3WOE B;  4H61 A;  4JF8 A;  1FGM A;  4ORL A;  3F40 A;  4GL6 A;  4HJL B;  4HYZ A;  2BMO B;  2XGN A;  2OOV A;  4EXR A;  2A15 A;  3KSP A;  1ROA A;  1UW1 A;  3EC9 A;  2LYX A;  2D42 A;  3NQZ A;  4WHA A;  1VQP 3;  1IU7 A;  4N6L A;  4RNZ A;  4XBX A;  3CNX A;  1U8C B;  3D9R A;  3MG1 A;  4WYK B;  2RSX A;  4NHF A;  5G2G A;  4TX4 A;  4MMX B;  1JB5 A;  3PZW A;  5KP1 A;  1QAL A;  2OTL 3;  3FF2 A;  4FCM A;  1Q81 4;  2P05 A;  1LOX A;  1OGZ A;  1YHQ 3;  2ML5 A;  3SXX A;  1VQ4 3;  3PGB A;  1S5A A;  3NHX A;  1Q40 A;  1W2Z A;  1O7M B;  3TDG A;  4BTW A;  6STD A;  3FG4 A;  1AR0 A;  1SIH A;  3SLU A;  3UB1 A;  5IEO A;  1VZZ A;  3STD A;  4HVN A;  1C7H A;  4FMC A;  1FGT A;  4HM8 B;  2L4V A;  1OF5 A;  1W00 A;  1W02 A;  2KRT A;  4J9A A;  5ELJ A;  2FNQ A;  3FG1 A;  5AEW B;  1YGE A;  3NV0 B;  3FF0 A;  4IPB A;  1VQN 3;  3LXU X;  3KE7 A;  4O2H A;  1TFO A;  2XRX B;  1MNL A;  2Y74 A;  3CCE 3;  4FCJ A;  1ZX2 A;  2XR8 B;  3NXJ A;  3UL5 A;  1ULJ B;  5KP4 A;  3CU3 A;  3F9S A;  2HMM B;  4PEJ A;  3X40 A;  1GY5 A;  1TIJ A;  2SBL A;  5FGO A;  1RJO A;  2P0M A;  3V98 A;  3LT8 A;  3N54 B;  1O7N B;  4XM4 A;  1PU4 A;  4MJD A;  3CMA 3;  2WOH A;  3ALA A;  3M8C A;  3NBJ A;  4O02 B;  2RFR A;  3UL6 A;  3KZT A;  5AIG A;  1K8A 4;  5CLK A;  4HM1 B;  3LTC A;  3G0K A;  3EJV A;  1VQ5 3;  1IV7 A;  3EB8 A;  3SX1 A;  3DY5 A;  4EC6 A;  1FGQ A;  2W9Q A;  3VSY A;  1N5H A;  2WOF A;  2YFJ B;  1QVF 2;  1VQM 3;  1SJW A;  2O3O A;  3IPT A;  3PXM A;  3RGR A;  2P09 A;  4K1V A;  1KD1 4;  3LOY A;  2W0Q A;  1YJW 3;  3VGN A;  1O7W B;  3SED A;  3F7X A;  1W01 A;  1TP6 A;  1IVU A;  3L0R A;  3X41 A;  3BLZ A;  3EQQ B;  1IK3 A;  1W4N A;  4N6M A;  4FR9 A;  1K73 4;  5IEN A;  4K1U A;  4N6V 0;  3JUQ A;  1YI2 3;  2XH9 A;  1RKY A;  5CF1 A;  1IVX A;  3LYG A;  5JPU A;  2MC8 A;  1FUW A;  3FSD A;  3S5C A;  1GY7 A;  3MPH A;  4XDW A;  3SOA A;  5D81 A;  2WO0 A;  1OCV A;  2CIU A;  3OW2 2;  2CFG A;  5CK6 A;  2BMQ B;  2M7O A;  4EBG A;  2D1W A;  3RGA A;  2CKF B;  2XSH B;  1IT8 A;  1CQS A;  1CYV A;  4AKZ A;  3CD6 3;  3EBT A;  4KFE A;  3GZR A;  3F8X A;  1OHP A;  2HMO B;  3MHE A;  1JRQ A;  3DUK A;  4N6T A;  1MOL A;  2BHM A;  1OAC A;  1VQK 3;  3PYJ A;  2W56 B;  3KFQ C;  3QRD A;  2OQE A;  4X2H A;  2CK3 H;  2ZDJ A;  2IUK A;  1GD4 A;  3B4P A;  3NX0 A;  3KKG A;  5IG5 A;  1Q82 4;  2ML6 A;  4MMZ B;  3S27 A;  3HX8 A;  2YFL B;  4HM0 B;  4ZM8 A;  1NB5 I;  4CDL A;  3FKA A;  2UX0 A;  1M1K 4;  1HU9 A;  4AKY A;  1VQ6 3;  3EE1 A;  3G71 3;  3MG2 A;  1W2B 2;  1VQ8 3;  3IJE B;  4HM6 B;  1CEW I;  2GU1 A;  1ZO2 A;  1YVB I;  3F14 A;  5I97 A;  1F8N A;  4L7K A;  3AMO A;  4G1M B;  5BVB A;  1VQO 3;  4KFF A;  4HZB B;  2XFT A;  3H3H A;  2QIY A;  3ECF A;  3N8B A;  5EVH A;  4L8P A;  4OUQ A;  3NM7 A;  3BNE A;  4BTX A;  1IDP A;  2OOV C;  3LT9 A;  3T8N A;  3GZY B;  1JV2 B;  2BMR B;  3HK4 A;  2OQE C;  2CG0 A;  3OX9 A;  4HZ9 B;  5IW9 A;  5AYS C;  3CC4 3;  1WMP A;  3HII A;  2Q07 A;  4L8O A;  1N8Q A;  2HMN B;  1UI8 A;  5EEO A;  1GD3 A;  1VQ7 3;  2E2T A;  4JRF A;  3K0Z A;  3CPW 2;  1EA2 A;  2HMK B;  1Q40 B;  3PCS A;  2C10 A;  3NM2 A;  2Z77 A;  2XEP A;  1QAF A;  1W6Y A;  3WOD G;  1YIJ 3;  4IIA A;  4EV5 A;  3IMA B;  1JB2 A;  1A2K A;  4O8S A;  3FLJ A;  3MSO A;  3JUP A;  1OF5 B;  2GEX A;  2E2V A;  1VQ9 3;  2GBW B;  3S67 A;  2F99 A;  3DGN A;  4N3V A;  1DVC A;  2BO9 B;  3N9H A;  4FCZ A;  2W9P A;  3WDG B;  3DMC A;  3B7C A;  4K90 B;  3GRD A;  4QWT A;  3OXA A;  2XGL A;  3FZW A;  1NJI 4;  1JNQ A;  1Y4K A;  3QK9 A;  1SQW A;  3MG3 A;  1A2V A;  3O8Y A;  2IUJ A;  2F86 B;  2PZV A;  4X2O A;  4R9K A;  2XFS A;  2QGU A;  3JUO A;  1J2B A;  3NBR A;  3DGL A;  3F7S A;  4XBY A;  5AIF A;  2P38 A;  3F8H A;  5AEU B;  3MYT A;  1YJN 3;  3FH1 A;  1ULI B;  1O7H B;  1JN5 B;  2CFL A;  3LH4 A;  1AV4 A;  1JJ2 2;  3K63 A;  1ROV A;  3V99 A;  1OUN A;  1IV9 A;  3HIG A;  2YFI B;  1DYU A;  4HM4 B;  4Q53 A;  1LXE A;  5IER A;  4IT7 A;  5IG0 A;  3CNM A;  2XF3 A;  3KII A;  4HM3 B;  2QEX 3;  2CWT A;  3I55 3;  2B1X B;  4WFO A;  1OH0 A;  4HBR A;  1M9G A;  2E2U A;  2BNG A;  5TGN A;  1TU5 A;  2HML B;  1K41 A;  2IMJ A;  1W5Z A;  3JUN A;  2CHC A;  5FW5 A;  2CWU A;  3A76 A;  1QMA A;  3EN8 A;  2CFD A;  1D6Y A;  4HKV B;  1IQY A;  5LC7 A;  1W6G A;  3BNB A;  1RRL A;  1FGO A;  5DRV A;  1Q7Y 4;  4STD A;  1JKG A;  3PCR A;  3G6E 3;  4RZM A;  1DVD A;  5AI1 A;  3RDE A;  3FGY A;  2Z76 A;  1NWW A;  1NU3 A;  3HI7 A;  3K5T A;  4O3V A;  3G4S 3;  1QVG 2;  1CYU A;  1GS3 A;  3G16 A;  3Q90 A;  1WMN A;  1G96 A;  4RBN A;  4I4K A;  2RGQ A;  1LVN A;  3GZB A;  3CCV 3;  5EQL A;  1IVW A;  3I0Y A;  4LEH A;  3CC2 3;  2JDI H;  3WOF B;  2K54 A;  2OTJ 3;  1YIT 3;  3X3X A;  4NRE A;  4N6N B;  2Z7A A;  4HM2 B;  2FXT A;  2W04 A;  2B24 B;  5CXO A;  5CF2 A;  2ZL8 A;  4WYK A;  1K28 A;  1WQL B;  4CCV A;  3K9M C;  3DZL A;  2KCD A;  2W2C A;  3OWS A;  1U5O A;  3CPO A;  3PS8 A;  1M1X B;  4LGQ A;  4LZI A;  5D82 A;  1HKX A;  1E3V A;  3ROB A;  2STD A;  3LTB A;  3LTA A;  3J7Y d;  1SPU A;  3CME 3;  1W7C A;  4KVH A;  4K61 A;  3MKI A;  3CCR 3;  3G8Z A;  3KN4 A;  3LML A;  5AIH A;  1BUQ A;  3FCS B;  3BB9 A;  5JPP A;  1W6C A;  2XSO B;  5STD A;  4AEQ A;  2CH9 A;  2OWP A;  4J8T A;  4N6O B;  1QAK A;  2HMJ B;  2GEY A;  3EN1 B;  4N6U A;  3GAX A;  2F98 A;  4GB5 A;  1EKM A;  4MMY B;  5AII A;  2INX A;  1WMO A;  1V74 A;  3AMO B;  3U97 A;  5IF6 A;  3S29 A;  3OV4 A;  3NUV A;  1L5G B;  3CCU 3;  3DGO A;  1KC8 4;  1A90 A;  1ISK A;  2CC3 A;  3NQY A;  1E97 A;  1UUV B;  3NV0 A;  2BT3 A;  7STD A;  3DM8 A;  2CW9 A;  3CCS 3;  1SII A;  3X3Y A;  4WWU C;  4WP5 A;  2PNC A;  3D3L A;  3I56 3;  4EV2 A;  1EQK A;  1R4C A;  1UUW B;  1M90 4;  1GY6 A;  1KWI A;  1D6Z A;  3SVA A;  1Q42 A;  5DRE A;  1RRH A;  1WTH A;  4HM5 B;  1D6U A;  2CG1 A;  4OK0 A;  1OGX A;  3WMD A;  1QJG A;  2FGT A;  5ELU A;  3MWZ A;  4U13 A;  4BTY A;  1NO3 A;  3UNL A;  3WA3 A;  2C11 A;  2V1L A;  4MEI A;  1ASK A;  1N5P A;  5JBS A;  4R4K A;  1JN5 A;  5IEP A;  2GU3 A;  1NB3 I;  3K7C A;  3LTD A;  4FMA A;  4KZ1 A;  4LSO A;  3T0U A;  1EG9 B;  1IQX A;  1K9M 4;  5HGR A;  2K0M A;  3DXO A;  4XB5 A;  4H3U A;  1US1 A;  2P0X A;  2OCT A;  1N8R 4;  1DMM A;  4FMD A;  4XBT A;  3H51 A;  5AYR B;  3CCQ 3;  1STF I;  1OHO A;  1Z1S A;  2R4I A;  3CC7 3;  3CCM 3;  1T5Y A;  1AVL A;  3OWU A;  4LMI A;  2JQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...