1PFPA

Cathelin-like motif of protegrin-3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
87
Chain Sequence
ALSYREAVLRAVDRLNEQSSEANLYRLLELDQDPGTPKPVSFTVKETVUPRPTRQPPELUDFKENGRVKQUVGTVTLDLDITUNEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Protegrin 3
publication title Selenomethionine and Selenocysteine Double Labeling Strategy for Crystallographic Phasing
pubmed doi rcsb
source organism Sus scrofa
total genus 21
structure length 87
sequence length 98
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1pfpA00
3QRDA 3S67A 4N6MA 1DVDA 1DVCA 1GD3A 3KFQC 3KSED 4N6V0 5ELUA 3L0RA 2OCTA 4LZIA 4ZM8A 1FA3A 3UL6A 1N9JA 4N6UA 2BO9B 2KXGA 1NB3I 3NX0A 1A67A 3LH4A 3PXMA 1MNLA 1A90A 1G96A 4IT7A 3Q2PA 1CEWI 4N6TA 5LC6A 1NB5I 3MWZA 1TIJA 3K9MC 1ROAA 1WNHA 3SVAA 1R4CA 1LXEA 1MOLA 5ELJA 1N5PA 4N6OB 4EYCA 1STFI 3IMAB 4N6NB 4CCVA 1EQKA 1RN7A 1PFPA 3UL5A 5EQLA 2W9QA 1M9GA 1GD4A 4TX4A 2CH9A 1IV9A 5A0OB 1YVBI 1CYUA 5LC7A 1CYVA 1IV7A 1FUWA 2W9PA 1KWIA 3GAXA 3PYJA 1N5HA 3PS8A 2O9UX 4N6LA
chains in the Genus database with same CATH superfamily
2OTJ3 2D1WA 3HIGA 3S67A 1VQO3 4HAAA 1I2EA 3I0YA 3JUNA 2HOHA 1DVDA 1Q814 2UX0A 2A15A 2YFIB 5KP3A 5IG3A 2P0XA 3EN1B 4HM0B 4HZBB 1AY7A 2CWTA 3RNTA 1IYYA 1R4YA 4X2HA 4JF8A 4AKYA 1OHSA 2RNTA 1BGSA 1RGAA 3MG2A 4N6V0 1YNVX 1SPUA 3LMLA 1VQM3 2W56B 1FUTA 1GOVA 5EEOA 3SOYA 1AVLA 1SIHA 1UI8A 3CME3 1UUWB 2CX1A 4LZIA 3KIIA 2FNQA 1BNJA 1RJOA 3OX9A 1S5AA 3AGNA 1N9JA 2ZHXB 1YGEA 3K0ZA 3Q90A 1OH0A 3N8BA 4N6UA 2JDIH 2QA43 1OHOA 1B2XA 1OGZA 4GL6A 4O2HA 3DGYA 2PZVA 1V57A 1EKMA 2XSOB 2E2VA 2XGLA 2GSPA 1B20A 1RSNA 2GEXA 4R1KA 3OWUA 2GU1A 4R4KA 3U1WA 1N8R4 1BU4A 5AYRB 5IG5A 2F99A 3BB9A 1V74A 1W6YA 3E99A 1UUGB 3GZRA 4EV2A 1UCIA 3D79A 1UUVB 4NREA 3KZTA 5HOHA 1RGHA 1WMNA 1ROAA 2YFLB 3EF8A 2ML5A 2HMJB 3CCS3 3CCR3 3CCM3 4HYZA 2D42A 4BTWA 1U8CB 1YGWA 1IVWA 3H3HA 3O8YA 4FMBA 1LXEA 5ELJA 1W6GA 1W2ZA 4WYKA 3D5IA 1BANA 1X1XA 3D3LA 1O7HB 1VQ63 4H61A 1E3RA 1LOWA 1I3FA 1FZUA 1DMMA 3X40A 2P38A 2LYXA 4XDWA 1M1XB 4BL3A 1Q40B 3GZXB 1GMPA 3GZBA 4CCVA 3RDEA 3TDGA 2BU4A 3NM7A 1IK3A 1JZOA 5D83A 1W01A 1CQSA 3DXOA 1O7MB 1I2GA 2GU3A 3B4PA 3BNEA 2K54A 5M19A 3NBJA 1UCJA 5EQLA 2W9QA 5G2GA 2OOVC 2XR8B 1IU7A 1IVVA 1BNIA 5DRVA 1RN1A 3AHWA 1RCKA 5IENA 1GY7A 3OWYA 3FF0A 5JPUA 3WA3A 1LNIA 1IV9A 1CYUA 1YVBI 2J8XB 3F8HA 5LC7A 3AHSA 1OACA 2HMNB 1CYVA 1IV7A 1U5OA 3BIRA 1FUWA 1VZZA 2W9PA 4AKZA 1UGIA 5M1AA 1I3IA 1JN5A 5AIHA 3KN4A 1Y4KA 3PYJA 1SIIA 3CXC2 1RHLA 4I4KA 2RCDA 4R9KA 1JV2B 1ZX2A 2V1LA 1TU5A 3NM2A 2B24B 1BNSA 3BLZA 3PS8A 1LOYA 1B21A 1I0VA 3B8LA 1JKGA 1YIJ3 1GSPA 2H0IA 1ISKA 3NXJA 4N6LA 1TP6A 2CX0A 2ZDJA 2HMMB 3BNDA 3QRDA 5AEWB 1M1K4 1B2SA 1QMAA 2RBIA 1AVKA 3RGRA 4EXRA 4KZ1A 1IQYA 3K63A 3VSYA 2CW9A 1W02A 4HM7B 3DM8A 1DVCA 1GD3A 5BU4A 4OK0A 4AEQA 4GSPA 5BVBA 1BRNL 2Z77A 3S29A 3MKIA 2FXTA 3KCHA 2MC8A 4NHFA 5IG0A 3F14A 1O7NB 3N54B 3D4AA 1LOXA 4XBTA 3K5TA 1VQK3 1N8QA 1YJN3 1LOVA 2L1SA 5TGNA 4ORLA 2C10A 1GOYA 2CWVA 1BUQA 5I97A 1GMRA 5HGRA 5D82A 1OPYA 1BVIA 4MEIA 1FA3A 1GS3A 2ZA4A 2STDA 2XH9A 4KVHA 3FLJA 3T8NA 2H0HA 1KD14 2CC3A 1BSDA 3KSPA 1QVG2 1RGKA 1RLSA 2Z76A 1YVSA 2K0MA 2CHCA 1NB3I 1IT7A 2Q07A 3FH1A 3FG1A 5AIFA 3LTAA 2KF5A 3WHOA 1A67A 1GY6A 3F7SA 3LH4A 3OXAA 2W0QA 4K90B 2IY2A 5AIIA 1BAOA 2LQVA 4BTYA 3CD63 1E97A 3CNMA 1WMPA 1B2ZA 4JRFA 4MMZB 4IT7A 1LNHA 3WDGB 3MG3A 3Q2PA 4J5KA 5BXQA 1CEWI 2GEYA 3JUQA 1LQMB 1HKXA 4KFDA 3NQYA 1VQ93 1MWTA 4BL2A 1TIJA 3FG3A 3HIIA 1BSBA 2W56A 1B3SA 3DY5A 2OQEA 3S27A 1A2KA 3BU4A 3LT9A 3MHEA 3CCL3 3BNBA 3HI7A 4IIAA 1N9EA 3ROBA 3SVAA 1JBSA 3DH2A 1BUJA 3SEDA 1OF5B 5D81A 2SARA 3B7CA 2HMLB 1B27A 3JVCA 4OUQA 5IEPA 2CFDA 2W2CA 4LEHA 3IMAB 3UNLA 1DETA 1T2IA 2HMOB 1RN4A 2E2TA 4HJLB 2IUJA 2CK3H 9RNTA 4U13A 3LTBA 1QJGA 2W03A 1QALA 3NQZA 2CFWA 3GWRA 3V99A 1VQ73 1FUSA 2CFKA 3UL5A 1Q864 2SBLA 2FGTA 3D5GA 3T0UA 2E2UA 2CG1A 1GD4A 4G1MB 4R9LA 1W4NA 3T8UA 1O7PB 1I2FA 2JQ5A 4LGQA 1J2BA 3X41A 1GOUA 1OGXA 1JBTA 1K734 4J8TA 1FGQA 1LRAA 1W5ZA 5AIGA 4LSOA 1KWIA 2YFJB 3EX9A 1RGGA 7RNTA 2L4VA 1BSAA 3FCSB 3SYUA 5JPPA 4IPBA 2BT3A 3G4S3 3IPTA 1FGMA 2HMKB 5IG4A 3CC43 3D9RA 3NV0A 2Y73A 3OWSA 1O7GB 4PEJA 3WOFB 1NJI4 4MMYB 1WTHA 2WGQA 4WYKB 3LZAA 3EJVA 1UI7A 4FMDA 1L5GB 3LYGA 1YIT3 4NPBA 4EV5A 1D6UA 2QEX3 4K61A 1DMQA 4HKVB 3K7CA 1QAKA 4EC6A 1JB4A 3G713 3CMA3 2C4BA 1AQZA 1GYBA 1QVF2 1ROVA 3HZPA 4HM1B 2OWPA 1F8NA 1K28A 1HYFA 3CU3A 3B4OA 3ECFA 2XRXB 2F5WA 5ELUA 3L0RA 1RDSA 3DGMA 1TRPA 3FKAA 1VQN3 4HM3B 1JB2A 2KCDA 2OCTA 8CHOA 4FCZA 5IERA 2Y74A 2AAEA 1Q42A 1RRLA 4Q53A 4STDA 4XB5A 3EHCA 6RNTA 1NDOB 2XFSA 1C7HA 2KXGA 4BU4A 5BIRA 3NX0A 3LOYA 1JN5B 3LTCA 1RGCA 3N9HA 3G16A 1Q7Y4 1D6ZA 1MNLA 3KKGA 1G96A 3OW22 4RNYA 4KT3B 4O3VA 1YJ93 2BHMA 4N6TA 1RTUA 2XGNA 1NB5I 3VGNA 1ASKA 1K41A 1WMOA 3G6E3 1VQ43 1JKGB 2PNCA 3A76A 1ZS7A 3Q3FA 4J5GA 1SJWA 4KFEA 3FG4A 3WMDA 3CCV3 3EB8A 1WNHA 2Z7AA 1ZO2A 4HM4B 1IDPA 3EN8A 5AYSC 3J7Yd 4EBGA 1BRSA 2BMQB 3AGOA 3GRDA 7GSPA 2WGOA 3SOAA 2C11A 1R4CA 2OQEC 1WQLB 2RFRA 3EBYA 3F9SA 3X3ZA 5IF6A 4L8PA 4RBNA 2H0GA 3CCU3 1IQ8A 1S723 1BNGA 2XEPA 2F86B 4K1VA 1MWUA 1STDA 8RNTA 3UB1A 3EE1A 1X1WA 3URPA 5M18A 2RGQA 5AI1A 4WP5A 2K3DA 3ALAA 4GB5A 4WHAA 4RNZA 1VQL3 2RSXA 4CPKA 1BSEA 4HM6B 3PZWA 3EQQB 1Z1SA 3JUMA 3A5EA 4L8OA 3UJMA 4GHOA 1MWRA 3CPW2 1PFPA 2O3OA 2W04A 3M8CA 3AMOB 3WODG 1W6CA 3EC9A 2KF6A 3LXUX 2IYJA 4WWUC 1G02A 1BRGA 3DMCA 2CIUA 1M9GA 2Z6BA 4KFFA 1Q9EA 4HVNA 1BRIA 1TRQA 5RNTA 5FW5A 5A0OB 1DMNA 1OF5A 2BNGA 5IW9A 1AV4A 3CNXA 3DGLA 2M7OA 1RGEA 1NWWA 1D6YA 3DZLA 3QK9A 5CF2A 6GSPA 3CC73 1IT8A 1BSCA 1HZ1A 4MMXB 4LYLB 1NU3A 2CFGA 1NO3A 1SQWA 3GAXA 4FMCA 4N3VA 5CXOA 1VQ53 1KSIA 3G0KA 3NBRA 3CPOA 1UCLA 1RGFA 5STDA 1FGRA 3LT8A 1MGRA 4FCMA 1QAFA 5G1LA 6STDA 1VQP3 1YI23 1JJ22 2XF3A 1K9M4 3HOHA 2ML6A 1EEJA 1RKYA 1KQS2 1T3BA 1JNQA 1M904 3BNCA 3NUVA 4LMIA 3PCRA 3SX1A 1C54A 3DGOA 3H51A 2IA7A 4ILFA 5AEUB 3MYTA 1YHQ3 2CG0A 3DUKA 4N6MA 2MF7A 3NHXA 2AADA 3RGAA 1NNVA 4R80A 3WOEB 4X2OA 1Q824 1E3VA 1HU9A 3F7XA 4FR9A 3ZFZA 2GBXB 1B2MA 3KFQC 4H3UA 1OCVA 1UGHI 2QIYA 3OV4A 1I8VA 3GSPA 3STDA 1W2B2 1O7WB 2KAAA 3HX8A 1ULIB 3V98A 3FF2A 3VF1A 2GXFA 1B2UA 3KSED 3X42A 1GY5A 4CDLA 1OHPA 3V92A 3MG1A 3CC23 1SARA 1Q40A 3SXXA 2CKFB 3CCE3 3LTDA 5CF1A 4XM4A 1UDII 4ZM8A 2WOFA 1UW1A 4XBYA 3UL6A 2CFLA 1V58A 4QWTA 3KE7A 5CK6A 1BRKA 2IUKA 2BIRA 1KC84 2BO9B 4HOHA 3X3XA 2XSHB 1TFKA 3JUOA 3WR2A 1BIRA 5KP4A 2UUGC 2P0MA 3F40A 2F4YA 1TFOA 2F56A 3PXMA 2ZL8A 3CCQ3 4O8SA 1AR0A 1A90A 1OUNA 3NBBA 1BNRA 1RNTA 1W7CA 1BOXA 3I563 4WFOA 5LC6A 1UCKA 1LQGC 2WOHA 3PGBA 4RZMA 3MWZA 1US1A 1CH0A 2GBWB 2R4IA 1RRHA 1ULJB 3NV0B 1PU4A 4XBXA 3K9MC 1JZDA 1I70A 1T5YA 1RCLA 2YX9A 1X1YA 1MWSA 3Q1CA 1T2HA 4BTXA 1TUHA 1FYSA 3ZG0A 3SLUA 4HM2B 1DE3A 2BMRB 5CLKA 4CJNA 2KF3A 1MOLA 1EA2A 2P09A 1RNBA 1EUIC 4J9AA 1A2VA 1BNEA 5FGOA 3WA2X 3GZYB 1IVXA 1N5PA 4N6OB 2W6JH 3HK4A 4EYCA 4HBRA 1STFI 5JBSA 3JUPA 3X3YA 4HM5B 1LVNA 3MPHA 1GMQA 1FGOA 2BMOB 4FMAA 4N6NB 1DYUA 1EQKA 2OOVA 2F5MA 2CWUA 1BNFA 1G0TA 1Q7HA 1RN7A 2KF4A 1JRQA 2KRTA 2WO0A 1W00A 1ZGXA 3G8ZA 4FCJA 1I0XA 4RNTA 4O02B 1YJW3 3ER7A 4L7KA 1JB5A 4TX4A 1JBRA 4OVMA 3IJEB 3S28A 2QGUA 2CH9A 4I5QA 3ZG5A 1TJDA 1IVUA 1RGLA 7STDA 3I553 2IMJA 1BRJA 1BRHA 5KP1A 3FGYA 4HM8B 4K1UA 5IEOA 1TTOA 2UGIA 5EVHA 1PY3A 2P05A 2INXA 3S5CA 3U97A 2I9WA 3DGNA 3MSOA 2XFTA 4XDVA 2OTL3 4HZ9B 5DREA 4EW5A 1IQXA 5GSPA 4MJDA 3PCSA 4BIRA 1N5HA 1A2PA 2R41A 3FSDA 5G1KA 1RMSA 1X1UA 4DKIA 1PYLA 3EBTA 3CCJ3 1VQ83 1EG9B 1VQQA 1MGWA 3AMOA 1K8A4 2B1XB 3F8XA 2O9UX 3FZWA 2F98A 1FW7A 1FGTA
chains in the Genus database with same CATH topology
2OTJ3 2D1WA 3HIGA 3S67A 1VQO3 3I0YA 3JUNA 1DVDA 1Q814 2UX0A 2A15A 2YFIB 5KP3A 5IG3A 2P0XA 3EN1B 4HM0B 4HZBB 2CWTA 4X2HA 4JF8A 4AKYA 1OHSA 3MG2A 4N6V0 1SPUA 3LMLA 1VQM3 2W56B 5EEOA 3SOYA 1AVLA 1SIHA 1UI8A 3CME3 1UUWB 4LZIA 3KIIA 2FNQA 1RJOA 3OX9A 1S5AA 1N9JA 3K0ZA 1YGEA 3Q90A 1OH0A 3N8BA 4N6UA 2JDIH 2QA43 1OHOA 1OGZA 4GL6A 4O2HA 2PZVA 1EKMA 2XSOB 2E2VA 2XGLA 2GEXA 4R1KA 3OWUA 2GU1A 4R4KA 3U1WA 1N8R4 5AYRB 5IG5A 2F99A 3BB9A 1V74A 1W6YA 3E99A 3GZRA 4EV2A 1UUVB 4NREA 3KZTA 1WMNA 1ROAA 2YFLB 3EF8A 2ML5A 2HMJB 3CCS3 3CCR3 3CCM3 4HYZA 2D42A 4BTWA 1U8CB 1IVWA 3H3HA 3O8YA 4FMBA 1LXEA 5ELJA 1W6GA 1W2ZA 4WYKA 3D3LA 1O7HB 1VQ63 4H61A 1E3RA 1DMMA 3X40A 2P38A 2LYXA 4XDWA 1M1XB 1Q40B 3GZXB 3GZBA 4CCVA 3RDEA 3TDGA 3NM7A 1IK3A 5D83A 1W01A 1CQSA 3DXOA 1O7MB 2GU3A 3B4PA 3BNEA 2K54A 3NBJA 5EQLA 5G2GA 2W9QA 2OOVC 2XR8B 1IU7A 1IVVA 5DRVA 5IENA 1GY7A 3OWYA 3FF0A 5JPUA 3WA3A 1IV9A 1CYUA 1YVBI 3F8HA 5LC7A 1OACA 2HMNB 1CYVA 1IV7A 1U5OA 1FUWA 1VZZA 2W9PA 4AKZA 1JN5A 5AIHA 3KN4A 1Y4KA 3PYJA 1SIIA 3CXC2 4I4KA 2RCDA 4R9KA 1JV2B 1ZX2A 2V1LA 1TU5A 3NM2A 2B24B 3BLZA 3PS8A 3B8LA 1JKGA 1YIJ3 1ISKA 3NXJA 4N6LA 1TP6A 2ZDJA 2HMMB 3BNDA 3QRDA 5AEWB 1M1K4 1QMAA 1AVKA 3RGRA 4EXRA 4KZ1A 1IQYA 3K63A 3VSYA 2CW9A 1W02A 4HM7B 3DM8A 1DVCA 1GD3A 4OK0A 4AEQA 5BVBA 2Z77A 3S29A 3MKIA 2FXTA 2MC8A 4NHFA 5IG0A 3F14A 1O7NB 3N54B 1LOXA 4XBTA 3K5TA 1VQK3 1N8QA 1YJN3 5TGNA 4ORLA 2C10A 2CWVA 1BUQA 5I97A 5HGRA 5D82A 1OPYA 4MEIA 1FA3A 1GS3A 4KVHA 2STDA 2XH9A 3T8NA 3FLJA 1KD14 2CC3A 1QVG2 3KSPA 2Z76A 2K0MA 2CHCA 1NB3I 1IT7A 2Q07A 3FH1A 3FG1A 5AIFA 3LTAA 1A67A 1GY6A 3F7SA 3LH4A 3OXAA 2W0QA 4K90B 4BTYA 5AIIA 3CD63 2LQVA 1E97A 3CNMA 1WMPA 4JRFA 4MMZB 4IT7A 1LNHA 3WDGB 3MG3A 3Q2PA 5BXQA 1CEWI 2GEYA 3JUQA 1HKXA 4KFDA 3NQYA 1VQ93 1TIJA 3FG3A 3HIIA 2W56A 3DY5A 2OQEA 3S27A 1A2KA 3LT9A 3MHEA 3CCL3 3BNBA 3HI7A 4IIAA 1N9EA 3ROBA 3SVAA 3SEDA 1OF5B 5D81A 3B7CA 2HMLB 3JVCA 4OUQA 5IEPA 2CFDA 2W2CA 4LEHA 3IMAB 3UNLA 2HMOB 2E2TA 4HJLB 2IUJA 2CK3H 4U13A 3LTBA 1QJGA 2W03A 1QALA 3NQZA 2CFWA 3GWRA 3V99A 1VQ73 2CFKA 3UL5A 1Q864 2SBLA 2FGTA 3T0UA 2E2UA 2CG1A 1GD4A 4G1MB 4R9LA 1W4NA 3T8UA 1O7PB 2JQ5A 4LGQA 1J2BA 3X41A 1OGXA 1K734 4J8TA 1FGQA 1W5ZA 5AIGA 4LSOA 1KWIA 2YFJB 3EX9A 2L4VA 3FCSB 5JPPA 4IPBA 2BT3A 3G4S3 3IPTA 1FGMA 2HMKB 5IG4A 3CC43 3D9RA 3NV0A 2Y73A 3OWSA 1O7GB 4PEJA 3WOFB 1NJI4 4MMYB 1WTHA 2WGQA 4WYKB 3LZAA 3EJVA 1UI7A 4FMDA 1L5GB 3LYGA 1YIT3 4EV5A 1D6UA 2QEX3 4K61A 1DMQA 4HKVB 3K7CA 1QAKA 4EC6A 1JB4A 3G713 3CMA3 1GYBA 1QVF2 1ROVA 3HZPA 4HM1B 2OWPA 1F8NA 1K28A 3CU3A 3B4OA 3ECFA 2XRXB 5ELUA 3L0RA 3DGMA 3FKAA 1VQN3 4HM3B 1JB2A 2KCDA 2OCTA 8CHOA 4FCZA 5IERA 2Y74A 1Q42A 1RRLA 4Q53A 4STDA 4XB5A 3EHCA 1NDOB 2XFSA 1C7HA 2KXGA 3NX0A 3LOYA 1JN5B 3LTCA 3N9HA 1Q7Y4 3G16A 1D6ZA 1MNLA 3KKGA 1G96A 3OW22 4RNYA 4O3VA 1YJ93 2BHMA 4N6TA 2XGNA 1NB5I 3VGNA 1ASKA 1K41A 1WMOA 3G6E3 1VQ43 1JKGB 2PNCA 3A76A 3WMDA 4KFEA 3CCV3 1SJWA 3FG4A 3EB8A 1WNHA 2Z7AA 1ZO2A 4HM4B 1IDPA 3EN8A 5AYSC 3J7Yd 4EBGA 2BMQB 3GRDA 2WGOA 3SOAA 2C11A 1R4CA 2OQEC 1WQLB 2RFRA 3EBYA 3F9SA 3X3ZA 5IF6A 4L8PA 4RBNA 3CCU3 1IQ8A 1S723 2XEPA 2F86B 4K1VA 1STDA 3UB1A 3EE1A 2RGQA 5AI1A 4WP5A 3ALAA 4GB5A 4WHAA 4RNZA 1VQL3 2RSXA 4HM6B 3PZWA 3EQQB 1Z1SA 3JUMA 3UJMA 4L8OA 3CPW2 1PFPA 2O3OA 2W04A 3M8CA 3AMOB 3WODG 1W6CA 3EC9A 3LXUX 4WWUC 3DMCA 2CIUA 1M9GA 2Z6BA 4KFFA 4HVNA 5FW5A 5A0OB 1DMNA 1OF5A 2BNGA 5IW9A 1AV4A 3CNXA 3DGLA 2M7OA 1NWWA 1D6YA 3DZLA 3QK9A 5CF2A 3CC73 1IT8A 4MMXB 1NU3A 2CFGA 1NO3A 1SQWA 3GAXA 4FMCA 4N3VA 5CXOA 1VQ53 1KSIA 3G0KA 3NBRA 3CPOA 5STDA 1FGRA 3LT8A 6STDA 4FCMA 1QAFA 1VQP3 1YI23 1JJ22 2XF3A 1K9M4 1RKYA 2ML6A 1KQS2 1JNQA 1M904 3BNCA 3NUVA 4LMIA 3PCRA 3SX1A 3DGOA 3H51A 2IA7A 5AEUB 3MYTA 1YHQ3 2CG0A 3DUKA 4N6MA 2MF7A 3NHXA 3RGAA 3WOEB 4R80A 4X2OA 1Q824 1E3VA 1HU9A 3F7XA 4FR9A 2GBXB 3KFQC 4H3UA 1OCVA 2QIYA 3STDA 3OV4A 1W2B2 1O7WB 3HX8A 3V98A 1ULIB 3VF1A 3FF2A 2GXFA 3KSED 3X42A 1GY5A 4CDLA 1OHPA 3V92A 3MG1A 3CC23 1Q40A 3SXXA 2CKFB 3CCE3 3LTDA 5CF1A 4XM4A 4ZM8A 2WOFA 1UW1A 4XBYA 3UL6A 2CFLA 4QWTA 3KE7A 5CK6A 2IUKA 1KC84 2BO9B 3X3XA 2XSHB 1TFKA 3JUOA 5KP4A 2P0MA 3F40A 1TFOA 3PXMA 2ZL8A 3CCQ3 4O8SA 1AR0A 1A90A 1OUNA 3NBBA 1W7CA 3I563 4WFOA 5LC6A 2WOHA 3PGBA 4RZMA 3MWZA 1US1A 2GBWB 2R4IA 3NV0B 1RRHA 1ULJB 1PU4A 4XBXA 3K9MC 1T5YA 2YX9A 3Q1CA 4BTXA 1TUHA 3SLUA 4HM2B 2BMRB 5CLKA 1MOLA 1EA2A 2P09A 4J9AA 1A2VA 5FGOA 3WA2X 3GZYB 1IVXA 1N5PA 4N6OB 2W6JH 3HK4A 4EYCA 4HBRA 1STFI 5JBSA 3JUPA 3X3YA 4HM5B 1LVNA 3MPHA 4FMAA 1FGOA 2BMOB 4N6NB 1DYUA 1EQKA 2OOVA 2CWUA 1RN7A 1JRQA 2KRTA 2WO0A 1W00A 3G8ZA 4FCJA 4O02B 1YJW3 3ER7A 4L7KA 1JB5A 4TX4A 4OVMA 3IJEB 3S28A 2QGUA 2CH9A 1IVUA 7STDA 3I553 2IMJA 5KP1A 3FGYA 4HM8B 4K1UA 5IEOA 5EVHA 2P05A 2INXA 3S5CA 3U97A 2I9WA 3DGNA 3MSOA 2XFTA 4XDVA 2OTL3 4HZ9B 5DREA 1IQXA 4MJDA 3PCSA 1N5HA 3FSDA 3EBTA 3CCJ3 1VQ83 1EG9B 1K8A4 3AMOA 2B1XB 3F8XA 2O9UX 3FZWA 2F98A 1FGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRD A;  3S67 A;  4N6M A;  1DVD A;  1DVC A;  1GD3 A;  3KFQ C;  3KSE D;  4N6V 0;  5ELU A;  3L0R A;  2OCT A;  4LZI A;  4ZM8 A;  1FA3 A;  3UL6 A;  1N9J A;  4N6U A;  2BO9 B;  2KXG A;  1NB3 I;  3NX0 A;  1A67 A;  3LH4 A;  3PXM A;  1MNL A;  1A90 A;  1G96 A;  4IT7 A;  3Q2P A;  1CEW I;  4N6T A;  5LC6 A;  1NB5 I;  3MWZ A;  1TIJ A;  3K9M C;  1ROA A;  1WNH A;  3SVA A;  1R4C A;  1LXE A;  1MOL A;  5ELJ A;  1N5P A;  4N6O B;  4EYC A;  1STF I;  3IMA B;  4N6N B;  4CCV A;  1EQK A;  1RN7 A;  1PFP A;  3UL5 A;  5EQL A;  2W9Q A;  1M9G A;  1GD4 A;  4TX4 A;  2CH9 A;  1IV9 A;  5A0O B;  1YVB I;  1CYU A;  5LC7 A;  1CYV A;  1IV7 A;  1FUW A;  2W9P A;  1KWI A;  3GAX A;  3PYJ A;  1N5H A;  3PS8 A;  2O9U X;  4N6L A; 
#chains in the Genus database with same CATH topology
 2OTJ 3;  2D1W A;  3HIG A;  3S67 A;  1VQO 3;  4HAA A;  1I2E A;  3I0Y A;  3JUN A;  2HOH A;  1DVD A;  1Q81 4;  2UX0 A;  2A15 A;  2YFI B;  5KP3 A;  5IG3 A;  2P0X A;  3EN1 B;  4HM0 B;  4HZB B;  1AY7 A;  2CWT A;  3RNT A;  1IYY A;  1R4Y A;  4X2H A;  4JF8 A;  4AKY A;  1OHS A;  2RNT A;  1BGS A;  1RGA A;  3MG2 A;  4N6V 0;  1YNV X;  1SPU A;  3LML A;  1VQM 3;  2W56 B;  1FUT A;  1GOV A;  5EEO A;  3SOY A;  1AVL A;  1SIH A;  1UI8 A;  3CME 3;  1UUW B;  2CX1 A;  4LZI A;  3KII A;  2FNQ A;  1BNJ A;  1RJO A;  3OX9 A;  1S5A A;  3AGN A;  1N9J A;  2ZHX B;  1YGE A;  3K0Z A;  3Q90 A;  1OH0 A;  3N8B A;  4N6U A;  2JDI H;  2QA4 3;  1OHO A;  1B2X A;  1OGZ A;  4GL6 A;  4O2H A;  3DGY A;  2PZV A;  1V57 A;  1EKM A;  2XSO B;  2E2V A;  2XGL A;  2GSP A;  1B20 A;  1RSN A;  2GEX A;  4R1K A;  3OWU A;  2GU1 A;  4R4K A;  3U1W A;  1N8R 4;  1BU4 A;  5AYR B;  5IG5 A;  2F99 A;  3BB9 A;  1V74 A;  1W6Y A;  3E99 A;  1UUG B;  3GZR A;  4EV2 A;  1UCI A;  3D79 A;  1UUV B;  4NRE A;  3KZT A;  5HOH A;  1RGH A;  1WMN A;  1ROA A;  2YFL B;  3EF8 A;  2ML5 A;  2HMJ B;  3CCS 3;  3CCR 3;  3CCM 3;  4HYZ A;  2D42 A;  4BTW A;  1U8C B;  1YGW A;  1IVW A;  3H3H A;  3O8Y A;  4FMB A;  1LXE A;  5ELJ A;  1W6G A;  1W2Z A;  4WYK A;  3D5I A;  1BAN A;  1X1X A;  3D3L A;  1O7H B;  1VQ6 3;  4H61 A;  1E3R A;  1LOW A;  1I3F A;  1FZU A;  1DMM A;  3X40 A;  2P38 A;  2LYX A;  4XDW A;  1M1X B;  4BL3 A;  1Q40 B;  3GZX B;  1GMP A;  3GZB A;  4CCV A;  3RDE A;  3TDG A;  2BU4 A;  3NM7 A;  1IK3 A;  1JZO A;  5D83 A;  1W01 A;  1CQS A;  3DXO A;  1O7M B;  1I2G A;  2GU3 A;  3B4P A;  3BNE A;  2K54 A;  5M19 A;  3NBJ A;  1UCJ A;  5EQL A;  2W9Q A;  5G2G A;  2OOV C;  2XR8 B;  1IU7 A;  1IVV A;  1BNI A;  5DRV A;  1RN1 A;  3AHW A;  1RCK A;  5IEN A;  1GY7 A;  3OWY A;  3FF0 A;  5JPU A;  3WA3 A;  1LNI A;  1IV9 A;  1CYU A;  1YVB I;  2J8X B;  3F8H A;  5LC7 A;  3AHS A;  1OAC A;  2HMN B;  1CYV A;  1IV7 A;  1U5O A;  3BIR A;  1FUW A;  1VZZ A;  2W9P A;  4AKZ A;  1UGI A;  5M1A A;  1I3I A;  1JN5 A;  5AIH A;  3KN4 A;  1Y4K A;  3PYJ A;  1SII A;  3CXC 2;  1RHL A;  4I4K A;  2RCD A;  4R9K A;  1JV2 B;  1ZX2 A;  2V1L A;  1TU5 A;  3NM2 A;  2B24 B;  1BNS A;  3BLZ A;  3PS8 A;  1LOY A;  1B21 A;  1I0V A;  3B8L A;  1JKG A;  1YIJ 3;  1GSP A;  2H0I A;  1ISK A;  3NXJ A;  4N6L A;  1TP6 A;  2CX0 A;  2ZDJ A;  2HMM B;  3BND A;  3QRD A;  5AEW B;  1M1K 4;  1B2S A;  1QMA A;  2RBI A;  1AVK A;  3RGR A;  4EXR A;  4KZ1 A;  1IQY A;  3K63 A;  3VSY A;  2CW9 A;  1W02 A;  4HM7 B;  3DM8 A;  1DVC A;  1GD3 A;  5BU4 A;  4OK0 A;  4AEQ A;  4GSP A;  5BVB A;  1BRN L;  2Z77 A;  3S29 A;  3MKI A;  2FXT A;  3KCH A;  2MC8 A;  4NHF A;  5IG0 A;  3F14 A;  1O7N B;  3N54 B;  3D4A A;  1LOX A;  4XBT A;  3K5T A;  1VQK 3;  1N8Q A;  1YJN 3;  1LOV A;  2L1S A;  5TGN A;  4ORL A;  2C10 A;  1GOY A;  2CWV A;  1BUQ A;  5I97 A;  1GMR A;  5HGR A;  5D82 A;  1OPY A;  1BVI A;  4MEI A;  1FA3 A;  1GS3 A;  2ZA4 A;  2STD A;  2XH9 A;  4KVH A;  3FLJ A;  3T8N A;  2H0H A;  1KD1 4;  2CC3 A;  1BSD A;  3KSP A;  1QVG 2;  1RGK A;  1RLS A;  2Z76 A;  1YVS A;  2K0M A;  2CHC A;  1NB3 I;  1IT7 A;  2Q07 A;  3FH1 A;  3FG1 A;  5AIF A;  3LTA A;  2KF5 A;  3WHO A;  1A67 A;  1GY6 A;  3F7S A;  3LH4 A;  3OXA A;  2W0Q A;  4K90 B;  2IY2 A;  5AII A;  1BAO A;  2LQV A;  4BTY A;  3CD6 3;  1E97 A;  3CNM A;  1WMP A;  1B2Z A;  4JRF A;  4MMZ B;  4IT7 A;  1LNH A;  3WDG B;  3MG3 A;  3Q2P A;  4J5K A;  5BXQ A;  1CEW I;  2GEY A;  3JUQ A;  1LQM B;  1HKX A;  4KFD A;  3NQY A;  1VQ9 3;  1MWT A;  4BL2 A;  1TIJ A;  3FG3 A;  3HII A;  1BSB A;  2W56 A;  1B3S A;  3DY5 A;  2OQE A;  3S27 A;  1A2K A;  3BU4 A;  3LT9 A;  3MHE A;  3CCL 3;  3BNB A;  3HI7 A;  4IIA A;  1N9E A;  3ROB A;  3SVA A;  1JBS A;  3DH2 A;  1BUJ A;  3SED A;  1OF5 B;  5D81 A;  2SAR A;  3B7C A;  2HML B;  1B27 A;  3JVC A;  4OUQ A;  5IEP A;  2CFD A;  2W2C A;  4LEH A;  3IMA B;  3UNL A;  1DET A;  1T2I A;  2HMO B;  1RN4 A;  2E2T A;  4HJL B;  2IUJ A;  2CK3 H;  9RNT A;  4U13 A;  3LTB A;  1QJG A;  2W03 A;  1QAL A;  3NQZ A;  2CFW A;  3GWR A;  3V99 A;  1VQ7 3;  1FUS A;  2CFK A;  3UL5 A;  1Q86 4;  2SBL A;  2FGT A;  3D5G A;  3T0U A;  2E2U A;  2CG1 A;  1GD4 A;  4G1M B;  4R9L A;  1W4N A;  3T8U A;  1O7P B;  1I2F A;  2JQ5 A;  4LGQ A;  1J2B A;  3X41 A;  1GOU A;  1OGX A;  1JBT A;  1K73 4;  4J8T A;  1FGQ A;  1LRA A;  1W5Z A;  5AIG A;  4LSO A;  1KWI A;  2YFJ B;  3EX9 A;  1RGG A;  7RNT A;  2L4V A;  1BSA A;  3FCS B;  3SYU A;  5JPP A;  4IPB A;  2BT3 A;  3G4S 3;  3IPT A;  1FGM A;  2HMK B;  5IG4 A;  3CC4 3;  3D9R A;  3NV0 A;  2Y73 A;  3OWS A;  1O7G B;  4PEJ A;  3WOF B;  1NJI 4;  4MMY B;  1WTH A;  2WGQ A;  4WYK B;  3LZA A;  3EJV A;  1UI7 A;  4FMD A;  1L5G B;  3LYG A;  1YIT 3;  4NPB A;  4EV5 A;  1D6U A;  2QEX 3;  4K61 A;  1DMQ A;  4HKV B;  3K7C A;  1QAK A;  4EC6 A;  1JB4 A;  3G71 3;  3CMA 3;  2C4B A;  1AQZ A;  1GYB A;  1QVF 2;  1ROV A;  3HZP A;  4HM1 B;  2OWP A;  1F8N A;  1K28 A;  1HYF A;  3CU3 A;  3B4O A;  3ECF A;  2XRX B;  2F5W A;  5ELU A;  3L0R A;  1RDS A;  3DGM A;  1TRP A;  3FKA A;  1VQN 3;  4HM3 B;  1JB2 A;  2KCD A;  2OCT A;  8CHO A;  4FCZ A;  5IER A;  2Y74 A;  2AAE A;  1Q42 A;  1RRL A;  4Q53 A;  4STD A;  4XB5 A;  3EHC A;  6RNT A;  1NDO B;  2XFS A;  1C7H A;  2KXG A;  4BU4 A;  5BIR A;  3NX0 A;  3LOY A;  1JN5 B;  3LTC A;  1RGC A;  3N9H A;  3G16 A;  1Q7Y 4;  1D6Z A;  1MNL A;  3KKG A;  1G96 A;  3OW2 2;  4RNY A;  4KT3 B;  4O3V A;  1YJ9 3;  2BHM A;  4N6T A;  1RTU A;  2XGN A;  1NB5 I;  3VGN A;  1ASK A;  1K41 A;  1WMO A;  3G6E 3;  1VQ4 3;  1JKG B;  2PNC A;  3A76 A;  1ZS7 A;  3Q3F A;  4J5G A;  1SJW A;  4KFE A;  3FG4 A;  3WMD A;  3CCV 3;  3EB8 A;  1WNH A;  2Z7A A;  1ZO2 A;  4HM4 B;  1IDP A;  3EN8 A;  5AYS C;  3J7Y d;  4EBG A;  1BRS A;  2BMQ B;  3AGO A;  3GRD A;  7GSP A;  2WGO A;  3SOA A;  2C11 A;  1R4C A;  2OQE C;  1WQL B;  2RFR A;  3EBY A;  3F9S A;  3X3Z A;  5IF6 A;  4L8P A;  4RBN A;  2H0G A;  3CCU 3;  1IQ8 A;  1S72 3;  1BNG A;  2XEP A;  2F86 B;  4K1V A;  1MWU A;  1STD A;  8RNT A;  3UB1 A;  3EE1 A;  1X1W A;  3URP A;  5M18 A;  2RGQ A;  5AI1 A;  4WP5 A;  2K3D A;  3ALA A;  4GB5 A;  4WHA A;  4RNZ A;  1VQL 3;  2RSX A;  4CPK A;  1BSE A;  4HM6 B;  3PZW A;  3EQQ B;  1Z1S A;  3JUM A;  3A5E A;  4L8O A;  3UJM A;  4GHO A;  1MWR A;  3CPW 2;  1PFP A;  2O3O A;  2W04 A;  3M8C A;  3AMO B;  3WOD G;  1W6C A;  3EC9 A;  2KF6 A;  3LXU X;  2IYJ A;  4WWU C;  1G02 A;  1BRG A;  3DMC A;  2CIU A;  1M9G A;  2Z6B A;  4KFF A;  1Q9E A;  4HVN A;  1BRI A;  1TRQ A;  5RNT A;  5FW5 A;  5A0O B;  1DMN A;  1OF5 A;  2BNG A;  5IW9 A;  1AV4 A;  3CNX A;  3DGL A;  2M7O A;  1RGE A;  1NWW A;  1D6Y A;  3DZL A;  3QK9 A;  5CF2 A;  6GSP A;  3CC7 3;  1IT8 A;  1BSC A;  1HZ1 A;  4MMX B;  4LYL B;  1NU3 A;  2CFG A;  1NO3 A;  1SQW A;  3GAX A;  4FMC A;  4N3V A;  5CXO A;  1VQ5 3;  1KSI A;  3G0K A;  3NBR A;  3CPO A;  1UCL A;  1RGF A;  5STD A;  1FGR A;  3LT8 A;  1MGR A;  4FCM A;  1QAF A;  5G1L A;  6STD A;  1VQP 3;  1YI2 3;  1JJ2 2;  2XF3 A;  1K9M 4;  3HOH A;  2ML6 A;  1EEJ A;  1RKY A;  1KQS 2;  1T3B A;  1JNQ A;  1M90 4;  3BNC A;  3NUV A;  4LMI A;  3PCR A;  3SX1 A;  1C54 A;  3DGO A;  3H51 A;  2IA7 A;  4ILF A;  5AEU B;  3MYT A;  1YHQ 3;  2CG0 A;  3DUK A;  4N6M A;  2MF7 A;  3NHX A;  2AAD A;  3RGA A;  1NNV A;  4R80 A;  3WOE B;  4X2O A;  1Q82 4;  1E3V A;  1HU9 A;  3F7X A;  4FR9 A;  3ZFZ A;  2GBX B;  1B2M A;  3KFQ C;  4H3U A;  1OCV A;  1UGH I;  2QIY A;  3OV4 A;  1I8V A;  3GSP A;  3STD A;  1W2B 2;  1O7W B;  2KAA A;  3HX8 A;  1ULI B;  3V98 A;  3FF2 A;  3VF1 A;  2GXF A;  1B2U A;  3KSE D;  3X42 A;  1GY5 A;  4CDL A;  1OHP A;  3V92 A;  3MG1 A;  3CC2 3;  1SAR A;  1Q40 A;  3SXX A;  2CKF B;  3CCE 3;  3LTD A;  5CF1 A;  4XM4 A;  1UDI I;  4ZM8 A;  2WOF A;  1UW1 A;  4XBY A;  3UL6 A;  2CFL A;  1V58 A;  4QWT A;  3KE7 A;  5CK6 A;  1BRK A;  2IUK A;  2BIR A;  1KC8 4;  2BO9 B;  4HOH A;  3X3X A;  2XSH B;  1TFK A;  3JUO A;  3WR2 A;  1BIR A;  5KP4 A;  2UUG C;  2P0M A;  3F40 A;  2F4Y A;  1TFO A;  2F56 A;  3PXM A;  2ZL8 A;  3CCQ 3;  4O8S A;  1AR0 A;  1A90 A;  1OUN A;  3NBB A;  1BNR A;  1RNT A;  1W7C A;  1BOX A;  3I56 3;  4WFO A;  5LC6 A;  1UCK A;  1LQG C;  2WOH A;  3PGB A;  4RZM A;  3MWZ A;  1US1 A;  1CH0 A;  2GBW B;  2R4I A;  1RRH A;  1ULJ B;  3NV0 B;  1PU4 A;  4XBX A;  3K9M C;  1JZD A;  1I70 A;  1T5Y A;  1RCL A;  2YX9 A;  1X1Y A;  1MWS A;  3Q1C A;  1T2H A;  4BTX A;  1TUH A;  1FYS A;  3ZG0 A;  3SLU A;  4HM2 B;  1DE3 A;  2BMR B;  5CLK A;  4CJN A;  2KF3 A;  1MOL A;  1EA2 A;  2P09 A;  1RNB A;  1EUI C;  4J9A A;  1A2V A;  1BNE A;  5FGO A;  3WA2 X;  3GZY B;  1IVX A;  1N5P A;  4N6O B;  2W6J H;  3HK4 A;  4EYC A;  4HBR A;  1STF I;  5JBS A;  3JUP A;  3X3Y A;  4HM5 B;  1LVN A;  3MPH A;  1GMQ A;  1FGO A;  2BMO B;  4FMA A;  4N6N B;  1DYU A;  1EQK A;  2OOV A;  2F5M A;  2CWU A;  1BNF A;  1G0T A;  1Q7H A;  1RN7 A;  2KF4 A;  1JRQ A;  2KRT A;  2WO0 A;  1W00 A;  1ZGX A;  3G8Z A;  4FCJ A;  1I0X A;  4RNT A;  4O02 B;  1YJW 3;  3ER7 A;  4L7K A;  1JB5 A;  4TX4 A;  1JBR A;  4OVM A;  3IJE B;  3S28 A;  2QGU A;  2CH9 A;  4I5Q A;  3ZG5 A;  1TJD A;  1IVU A;  1RGL A;  7STD A;  3I55 3;  2IMJ A;  1BRJ A;  1BRH A;  5KP1 A;  3FGY A;  4HM8 B;  4K1U A;  5IEO A;  1TTO A;  2UGI A;  5EVH A;  1PY3 A;  2P05 A;  2INX A;  3S5C A;  3U97 A;  2I9W A;  3DGN A;  3MSO A;  2XFT A;  4XDV A;  2OTL 3;  4HZ9 B;  5DRE A;  4EW5 A;  1IQX A;  5GSP A;  4MJD A;  3PCS A;  4BIR A;  1N5H A;  1A2P A;  2R41 A;  3FSD A;  5G1K A;  1RMS A;  1X1U A;  4DKI A;  1PYL A;  3EBT A;  3CCJ 3;  1VQ8 3;  1EG9 B;  1VQQ A;  1MGW A;  3AMO A;  1K8A 4;  2B1X B;  3F8X A;  2O9U X;  3FZW A;  2F98 A;  1FW7 A;  1FGT A; 
#chains in the Genus database with same CATH homology
 2OTJ 3;  2D1W A;  3HIG A;  3S67 A;  1VQO 3;  3I0Y A;  3JUN A;  1DVD A;  1Q81 4;  2UX0 A;  2A15 A;  2YFI B;  5KP3 A;  5IG3 A;  2P0X A;  3EN1 B;  4HM0 B;  4HZB B;  2CWT A;  4X2H A;  4JF8 A;  4AKY A;  1OHS A;  3MG2 A;  4N6V 0;  1SPU A;  3LML A;  1VQM 3;  2W56 B;  5EEO A;  3SOY A;  1AVL A;  1SIH A;  1UI8 A;  3CME 3;  1UUW B;  4LZI A;  3KII A;  2FNQ A;  1RJO A;  3OX9 A;  1S5A A;  1N9J A;  3K0Z A;  1YGE A;  3Q90 A;  1OH0 A;  3N8B A;  4N6U A;  2JDI H;  2QA4 3;  1OHO A;  1OGZ A;  4GL6 A;  4O2H A;  2PZV A;  1EKM A;  2XSO B;  2E2V A;  2XGL A;  2GEX A;  4R1K A;  3OWU A;  2GU1 A;  4R4K A;  3U1W A;  1N8R 4;  5AYR B;  5IG5 A;  2F99 A;  3BB9 A;  1V74 A;  1W6Y A;  3E99 A;  3GZR A;  4EV2 A;  1UUV B;  4NRE A;  3KZT A;  1WMN A;  1ROA A;  2YFL B;  3EF8 A;  2ML5 A;  2HMJ B;  3CCS 3;  3CCR 3;  3CCM 3;  4HYZ A;  2D42 A;  4BTW A;  1U8C B;  1IVW A;  3H3H A;  3O8Y A;  4FMB A;  1LXE A;  5ELJ A;  1W6G A;  1W2Z A;  4WYK A;  3D3L A;  1O7H B;  1VQ6 3;  4H61 A;  1E3R A;  1DMM A;  3X40 A;  2P38 A;  2LYX A;  4XDW A;  1M1X B;  1Q40 B;  3GZX B;  3GZB A;  4CCV A;  3RDE A;  3TDG A;  3NM7 A;  1IK3 A;  5D83 A;  1W01 A;  1CQS A;  3DXO A;  1O7M B;  2GU3 A;  3B4P A;  3BNE A;  2K54 A;  3NBJ A;  5EQL A;  5G2G A;  2W9Q A;  2OOV C;  2XR8 B;  1IU7 A;  1IVV A;  5DRV A;  5IEN A;  1GY7 A;  3OWY A;  3FF0 A;  5JPU A;  3WA3 A;  1IV9 A;  1CYU A;  1YVB I;  3F8H A;  5LC7 A;  1OAC A;  2HMN B;  1CYV A;  1IV7 A;  1U5O A;  1FUW A;  1VZZ A;  2W9P A;  4AKZ A;  1JN5 A;  5AIH A;  3KN4 A;  1Y4K A;  3PYJ A;  1SII A;  3CXC 2;  4I4K A;  2RCD A;  4R9K A;  1JV2 B;  1ZX2 A;  2V1L A;  1TU5 A;  3NM2 A;  2B24 B;  3BLZ A;  3PS8 A;  3B8L A;  1JKG A;  1YIJ 3;  1ISK A;  3NXJ A;  4N6L A;  1TP6 A;  2ZDJ A;  2HMM B;  3BND A;  3QRD A;  5AEW B;  1M1K 4;  1QMA A;  1AVK A;  3RGR A;  4EXR A;  4KZ1 A;  1IQY A;  3K63 A;  3VSY A;  2CW9 A;  1W02 A;  4HM7 B;  3DM8 A;  1DVC A;  1GD3 A;  4OK0 A;  4AEQ A;  5BVB A;  2Z77 A;  3S29 A;  3MKI A;  2FXT A;  2MC8 A;  4NHF A;  5IG0 A;  3F14 A;  1O7N B;  3N54 B;  1LOX A;  4XBT A;  3K5T A;  1VQK 3;  1N8Q A;  1YJN 3;  5TGN A;  4ORL A;  2C10 A;  2CWV A;  1BUQ A;  5I97 A;  5HGR A;  5D82 A;  1OPY A;  4MEI A;  1FA3 A;  1GS3 A;  4KVH A;  2STD A;  2XH9 A;  3T8N A;  3FLJ A;  1KD1 4;  2CC3 A;  1QVG 2;  3KSP A;  2Z76 A;  2K0M A;  2CHC A;  1NB3 I;  1IT7 A;  2Q07 A;  3FH1 A;  3FG1 A;  5AIF A;  3LTA A;  1A67 A;  1GY6 A;  3F7S A;  3LH4 A;  3OXA A;  2W0Q A;  4K90 B;  4BTY A;  5AII A;  3CD6 3;  2LQV A;  1E97 A;  3CNM A;  1WMP A;  4JRF A;  4MMZ B;  4IT7 A;  1LNH A;  3WDG B;  3MG3 A;  3Q2P A;  5BXQ A;  1CEW I;  2GEY A;  3JUQ A;  1HKX A;  4KFD A;  3NQY A;  1VQ9 3;  1TIJ A;  3FG3 A;  3HII A;  2W56 A;  3DY5 A;  2OQE A;  3S27 A;  1A2K A;  3LT9 A;  3MHE A;  3CCL 3;  3BNB A;  3HI7 A;  4IIA A;  1N9E A;  3ROB A;  3SVA A;  3SED A;  1OF5 B;  5D81 A;  3B7C A;  2HML B;  3JVC A;  4OUQ A;  5IEP A;  2CFD A;  2W2C A;  4LEH A;  3IMA B;  3UNL A;  2HMO B;  2E2T A;  4HJL B;  2IUJ A;  2CK3 H;  4U13 A;  3LTB A;  1QJG A;  2W03 A;  1QAL A;  3NQZ A;  2CFW A;  3GWR A;  3V99 A;  1VQ7 3;  2CFK A;  3UL5 A;  1Q86 4;  2SBL A;  2FGT A;  3T0U A;  2E2U A;  2CG1 A;  1GD4 A;  4G1M B;  4R9L A;  1W4N A;  3T8U A;  1O7P B;  2JQ5 A;  4LGQ A;  1J2B A;  3X41 A;  1OGX A;  1K73 4;  4J8T A;  1FGQ A;  1W5Z A;  5AIG A;  4LSO A;  1KWI A;  2YFJ B;  3EX9 A;  2L4V A;  3FCS B;  5JPP A;  4IPB A;  2BT3 A;  3G4S 3;  3IPT A;  1FGM A;  2HMK B;  5IG4 A;  3CC4 3;  3D9R A;  3NV0 A;  2Y73 A;  3OWS A;  1O7G B;  4PEJ A;  3WOF B;  1NJI 4;  4MMY B;  1WTH A;  2WGQ A;  4WYK B;  3LZA A;  3EJV A;  1UI7 A;  4FMD A;  1L5G B;  3LYG A;  1YIT 3;  4EV5 A;  1D6U A;  2QEX 3;  4K61 A;  1DMQ A;  4HKV B;  3K7C A;  1QAK A;  4EC6 A;  1JB4 A;  3G71 3;  3CMA 3;  1GYB A;  1QVF 2;  1ROV A;  3HZP A;  4HM1 B;  2OWP A;  1F8N A;  1K28 A;  3CU3 A;  3B4O A;  3ECF A;  2XRX B;  5ELU A;  3L0R A;  3DGM A;  3FKA A;  1VQN 3;  4HM3 B;  1JB2 A;  2KCD A;  2OCT A;  8CHO A;  4FCZ A;  5IER A;  2Y74 A;  1Q42 A;  1RRL A;  4Q53 A;  4STD A;  4XB5 A;  3EHC A;  1NDO B;  2XFS A;  1C7H A;  2KXG A;  3NX0 A;  3LOY A;  1JN5 B;  3LTC A;  3N9H A;  1Q7Y 4;  3G16 A;  1D6Z A;  1MNL A;  3KKG A;  1G96 A;  3OW2 2;  4RNY A;  4O3V A;  1YJ9 3;  2BHM A;  4N6T A;  2XGN A;  1NB5 I;  3VGN A;  1ASK A;  1K41 A;  1WMO A;  3G6E 3;  1VQ4 3;  1JKG B;  2PNC A;  3A76 A;  3WMD A;  4KFE A;  3CCV 3;  1SJW A;  3FG4 A;  3EB8 A;  1WNH A;  2Z7A A;  1ZO2 A;  4HM4 B;  1IDP A;  3EN8 A;  5AYS C;  3J7Y d;  4EBG A;  2BMQ B;  3GRD A;  2WGO A;  3SOA A;  2C11 A;  1R4C A;  2OQE C;  1WQL B;  2RFR A;  3EBY A;  3F9S A;  3X3Z A;  5IF6 A;  4L8P A;  4RBN A;  3CCU 3;  1IQ8 A;  1S72 3;  2XEP A;  2F86 B;  4K1V A;  1STD A;  3UB1 A;  3EE1 A;  2RGQ A;  5AI1 A;  4WP5 A;  3ALA A;  4GB5 A;  4WHA A;  4RNZ A;  1VQL 3;  2RSX A;  4HM6 B;  3PZW A;  3EQQ B;  1Z1S A;  3JUM A;  3UJM A;  4L8O A;  3CPW 2;  1PFP A;  2O3O A;  2W04 A;  3M8C A;  3AMO B;  3WOD G;  1W6C A;  3EC9 A;  3LXU X;  4WWU C;  3DMC A;  2CIU A;  1M9G A;  2Z6B A;  4KFF A;  4HVN A;  5FW5 A;  5A0O B;  1DMN A;  1OF5 A;  2BNG A;  5IW9 A;  1AV4 A;  3CNX A;  3DGL A;  2M7O A;  1NWW A;  1D6Y A;  3DZL A;  3QK9 A;  5CF2 A;  3CC7 3;  1IT8 A;  4MMX B;  1NU3 A;  2CFG A;  1NO3 A;  1SQW A;  3GAX A;  4FMC A;  4N3V A;  5CXO A;  1VQ5 3;  1KSI A;  3G0K A;  3NBR A;  3CPO A;  5STD A;  1FGR A;  3LT8 A;  6STD A;  4FCM A;  1QAF A;  1VQP 3;  1YI2 3;  1JJ2 2;  2XF3 A;  1K9M 4;  1RKY A;  2ML6 A;  1KQS 2;  1JNQ A;  1M90 4;  3BNC A;  3NUV A;  4LMI A;  3PCR A;  3SX1 A;  3DGO A;  3H51 A;  2IA7 A;  5AEU B;  3MYT A;  1YHQ 3;  2CG0 A;  3DUK A;  4N6M A;  2MF7 A;  3NHX A;  3RGA A;  3WOE B;  4R80 A;  4X2O A;  1Q82 4;  1E3V A;  1HU9 A;  3F7X A;  4FR9 A;  2GBX B;  3KFQ C;  4H3U A;  1OCV A;  2QIY A;  3STD A;  3OV4 A;  1W2B 2;  1O7W B;  3HX8 A;  3V98 A;  1ULI B;  3VF1 A;  3FF2 A;  2GXF A;  3KSE D;  3X42 A;  1GY5 A;  4CDL A;  1OHP A;  3V92 A;  3MG1 A;  3CC2 3;  1Q40 A;  3SXX A;  2CKF B;  3CCE 3;  3LTD A;  5CF1 A;  4XM4 A;  4ZM8 A;  2WOF A;  1UW1 A;  4XBY A;  3UL6 A;  2CFL A;  4QWT A;  3KE7 A;  5CK6 A;  2IUK A;  1KC8 4;  2BO9 B;  3X3X A;  2XSH B;  1TFK A;  3JUO A;  5KP4 A;  2P0M A;  3F40 A;  1TFO A;  3PXM A;  2ZL8 A;  3CCQ 3;  4O8S A;  1AR0 A;  1A90 A;  1OUN A;  3NBB A;  1W7C A;  3I56 3;  4WFO A;  5LC6 A;  2WOH A;  3PGB A;  4RZM A;  3MWZ A;  1US1 A;  2GBW B;  2R4I A;  3NV0 B;  1RRH A;  1ULJ B;  1PU4 A;  4XBX A;  3K9M C;  1T5Y A;  2YX9 A;  3Q1C A;  4BTX A;  1TUH A;  3SLU A;  4HM2 B;  2BMR B;  5CLK A;  1MOL A;  1EA2 A;  2P09 A;  4J9A A;  1A2V A;  5FGO A;  3WA2 X;  3GZY B;  1IVX A;  1N5P A;  4N6O B;  2W6J H;  3HK4 A;  4EYC A;  4HBR A;  1STF I;  5JBS A;  3JUP A;  3X3Y A;  4HM5 B;  1LVN A;  3MPH A;  4FMA A;  1FGO A;  2BMO B;  4N6N B;  1DYU A;  1EQK A;  2OOV A;  2CWU A;  1RN7 A;  1JRQ A;  2KRT A;  2WO0 A;  1W00 A;  3G8Z A;  4FCJ A;  4O02 B;  1YJW 3;  3ER7 A;  4L7K A;  1JB5 A;  4TX4 A;  4OVM A;  3IJE B;  3S28 A;  2QGU A;  2CH9 A;  1IVU A;  7STD A;  3I55 3;  2IMJ A;  5KP1 A;  3FGY A;  4HM8 B;  4K1U A;  5IEO A;  5EVH A;  2P05 A;  2INX A;  3S5C A;  3U97 A;  2I9W A;  3DGN A;  3MSO A;  2XFT A;  4XDV A;  2OTL 3;  4HZ9 B;  5DRE A;  1IQX A;  4MJD A;  3PCS A;  1N5H A;  3FSD A;  3EBT A;  3CCJ 3;  1VQ8 3;  1EG9 B;  1K8A 4;  3AMO A;  2B1X B;  3F8X A;  2O9U X;  3FZW A;  2F98 A;  1FGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...