4AEQA

Crystal structure of the dimeric immunity protein cmi solved by direct methods (arcimboldo)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
KGPACYQVSDEQARTFVKNDYLQRMKRWDNDVQLLGTEIPKITWEKIERSLTDVEDEKTLLVPFKAEGPDGKRMYYGMYHCEEGYVEYAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COLICIN-M IMMUNITY PROTEIN
publication title The Crystal Structure of the Dimeric Colicin M Immunity
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13995 YebF YebF-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.300 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4aeqA02
3.10.450.300 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4aeqA01
2XGLA 4AEQA 2LQVA
chains in the Genus database with same CATH superfamily
1WTHA 3RGAA 1IT7A 3D3LA 4EBGA 4HOHA 3DGLA 1WMOA 3OX9A 2HMKB 3MG2A 2WGQA 3KSPA 3EC9A 4G1MB 1I2EA 2W03A 4O02B 3WMDA 4HZ9B 1RNBA 4I5QA 1JB4A 3GSPA 2Z6BA 4KZ1A 1HU9A 5CF2A 2GSPA 1OGZA 2LYXA 1BRJA 1IVXA 4RNZA 1RN1A 2GEXA 3LXUX 3KIIA 4HM4B 3WODG 1VQP3 4AKYA 1YJ93 2WOFA 3PXMA 3BNDA 3HI7A 1EEJA 3S67A 3FG1A 2H0HA 2ML5A 2O3OA 3WDGB 3MKIA 5IF6A 2OTL3 3BIRA 1AVLA 3EN8A 1RMSA 3WA2X 3CXC2 1EUIC 3OWYA 1K734 1IYYA 1BSCA 4H61A 1BAOA 4J9AA 5ELJA 5BVBA 3AMOA 3CPOA 4N6UA 1VQM3 2A15A 1KSIA 2CX1A 3LTBA 3B4OA 1B2XA 3LOYA 3F8XA 2K0MA 3GZRA 3HOHA 1LXEA 4GSPA 3ROBA 3A5EA 1TFOA 3FF2A 3WA3A 2QA43 1FA3A 1T3BA 4K90B 5TGNA 1FW7A 4WYKA 2KAAA 4OK0A 5D82A 2WGOA 3PZWA 4N6LA 4HJLB 4XB5A 2B1XB 2BMQB 1NB3I 2B24B 2R4IA 3AMOB 4JF8A 3AGOA 4CJNA 1IU7A 1ASKA 1OHSA 3SXXA 2C11A 1DVCA 1LVNA 1VQK3 3MWZA 2KF3A 1Q42A 1STFI 2E2VA 3JVCA 4WYKB 3OWUA 4XDWA 1JBSA 3IPTA 2IYJA 3FG3A 1UDII 2O9UX 2W0QA 2CH9A 4KVHA 2WOHA 3G8ZA 4RBNA 1BNEA 4AEQA 4K1VA 1JB2A 1K28A 3CCE3 1MGRA 1Z1SA 2UUGC 3H51A 2QEX3 2WO0A 1BSAA 1TIJA 3DM8A 2HMLB 2BU4A 3K0ZA 4MJDA 2F98A 2W04A 1G02A 2HMOB 2CG0A 3ECFA 3CNXA 2OOVA 1IQYA 3MHEA 4XBXA 3WOFB 1LQMB 2IY2A 1GY5A 2XFTA 1D6ZA 3FZWA 2ML6A 1G96A 1TRPA 3PGBA 2CC3A 2Z7AA 3PYJA 4XBYA 2IUJA 1IQ8A 5DRVA 1AQZA 1OUNA 3K9MC 2OOVC 2CFKA 1DMMA 3QRDA 1MWRA 3X40A 3CCQ3 1B3SA 2XRXB 3EHCA 3KCHA 1U5OA 1JZDA 1A2PA 1BNFA 3WOEB 3BNCA 1BANA 5IG4A 3U1WA 1QVF2 1RCKA 1RGCA 2PNCA 3F14A 1US1A 5CF1A 1GD4A 1J2BA 2ZL8A 3E99A 4XM4A 2L1SA 3DGOA 2W9PA 1SARA 4LGQA 1K41A 3I563 3NUVA 3A76A 1GOUA 4WWUC 3SYUA 3OXAA 1KQS2 4OUQA 3UNLA 2OWPA 6STDA 3PS8A 3CCR3 1A2VA 1YGWA 1FGMA 4HYZA 5AI1A 1D6YA 3OV4A 4N6MA 4L8OA 3MSOA 1A90A 3S28A 1TTOA 1FUWA 1JNQA 5BIRA 1RN4A 1M9GA 1ROAA 2FGTA 3EB8A 3LYGA 3DGNA 4HVNA 5EVHA 1T5YA 2GU1A 3SOYA 3IMAB 5M18A 1UCJA 1ULIB 3LT8A 3SVAA 3LTDA 3G6E3 1VQ43 4WHAA 1JZOA 3URPA 1VQL3 4LZIA 1BNJA 5AIGA 2CWTA 3EJVA 1W6YA 1RGLA 4N3VA 5KP3A 3S5CA 2Q07A 5JBSA 1WNHA 1O7MB 1STDA 3JUQA 3LTAA 2XSOB 2BNGA 4RNTA 3N54B 5AEWB 3B8LA 1ZS7A 1KWIA 1QJGA 1UCKA 2CK3H 3JUPA 3K63A 3LH4A 2K3DA 4MEIA 1W02A 1E3RA 2H0IA 3N8BA 2W6JH 1PFPA 1JB5A 3JUMA 1GMQA 3OW22 1LRAA 1M904 1LQGC 1MWTA 5STDA 4HM2B 2XGNA 2BMRB 1LOWA 1Q7HA 1W2ZA 4N6V0 1BUQA 2UGIA 5EEOA 4LSOA 2P09A 1B2SA 1O7NB 1SPUA 3JUOA 1BNIA 1W01A 1BSDA 2F99A 4WP5A 1IT8A 1QAFA 1UI8A 3CCJ3 1QMAA 1BU4A 1DMQA 5CK6A 1C7HA 5CLKA 1LOXA 3EN1B 2P0MA 3O8YA 1RDSA 1GMPA 1RJOA 1JKGB 2RSXA 4FCJA 3CD63 1FGOA 3WR2A 1PU4A 1Q40A 1FGRA 1GSPA 1W00A 1W6CA 3FLJA 3Q2PA 5JPPA 4HM8B 1SIIA 1JJ22 1IQXA 3FKAA 2F5MA 1DETA 1IK3A 1W6GA 1S5AA 5LC7A 3CCS3 3LMLA 1E97A 1QALA 3CU3A 3LTCA 2GXFA 1N8R4 3GZXB 2GBXB 1N8QA 1Q40B 3S27A 3DGYA 3CNMA 1UUWB 3KKGA 3NQYA 1UGIA 1IDPA 1MWUA 1QAKA 2KCDA 1YJN3 3AHSA 3CC73 3NM7A 4CDLA 1FZUA 1RNTA 5EQLA 1TU5A 2BHMA 3KSED 3T8NA 3S29A 1X1UA 4KFFA 1I70A 2XFSA 1GS3A 1FYSA 5FGOA 3QK9A 1EA2A 3U97A 1WMPA 4EC6A 1LNIA 1GY7A 1ULJB 2UX0A 5BU4A 1JBRA 3X3YA 1E3VA 3NBJA 5CXOA 1Q7Y4 1BSBA 2YFLB 3HIGA 3X3XA 2CW9A 2F86B 4J5KA 5IG3A 4JRFA 3CPW2 2XH9A 3MPHA 4QWTA 5IENA 2CFLA 3MG3A 2QGUA 4EV5A 1BVIA 2CHCA 2YFIB 4J8TA 4O2HA 3ZFZA 1BRKA 1UGHI 3UL6A 1NDOB 3DZLA 3AHWA 3FSDA 5HGRA 3RGRA 2W2CA 1BRIA 1T2HA 1BRNL 1ZO2A 1BRSA 1RGFA 2F56A 3SOAA 2W9QA 1UI7A 3VSYA 1VQ83 1C54A 1W5ZA 3B7CA 2P0XA 3STDA 5D83A 4EXRA 4R80A 4HAAA 3UL5A 1B20A 3N9HA 4XBTA 5AIFA 5M19A 2P38A 1DMNA 1VQQA 3H3HA 1SIHA 3NM2A 5HOHA 3I553 1DVDA 3CME3 1O7GB 3K5TA 5AYRB 3L0RA 9RNTA 1RGHA 1RGEA 2H0GA 3NV0A 1NNVA 3PCRA 4IPBA 2E2UA 3CMA3 1O7WB 7GSPA 4HM1B 3OWSA 1TFKA 1YVSA 1B27A 1IVWA 1GOVA 2BT3A 3DMCA 4EW5A 1Q864 5IG5A 3D79A 3SEDA 3F40A 4STDA 4RZMA 4NPBA 1HZ1A 1O7HB 1WQLB 2J8XB 2R41A 3EE1A 3EX9A 3Q3FA 1B2ZA 2Z76A 3NV0B 3IJEB 4GL6A 3J7Yd 3AGNA 3NBBA 1RN7A 5FW5A 1VZZA 3KZTA 2INXA 3MYTA 1YIJ3 3F7SA 3HZPA 4MMZB 1NJI4 2CWUA 1AVKA 1PY3A 4ILFA 1RLSA 4N6OB 1AY7A 3GZYB 3GRDA 4K1UA 4WFOA 4HM7B 1UUVB 1TUHA 2CIUA 1I2GA 4BTXA 1FUTA 2L4VA 2GEYA 2HMNB 3SLUA 1JN5A 2CFDA 5KP4A 4R9KA 3HX8A 5BXQA 1OCVA 1MNLA 1CQSA 2IUKA 2KF5A 4HM0B 1YI23 4EV2A 2ZHXB 3B4PA 1RGGA 4DKIA 4FMBA 2OTJ3 1GY6A 1JKGA 1FGQA 1JN5B 1I3FA 2BMOB 5AYSC 2OQEA 3CCM3 1EG9B 1K9M4 4N6NB 4LMIA 3ER7A 4NREA 3VF1A 3GWRA 1U8CB 4FMAA 2C10A 1R4CA 1CH0A 1G0TA 4BU4A 1VQ73 2MF7A 3DY5A 4FMCA 7RNTA 5KP1A 3G16A 1RHLA 2QIYA 1OACA 5G2GA 3D5IA 1ZX2A 4O3VA 1BNRA 5IERA 1IVUA 5IW9A 1YIT3 4KFEA 3FG4A 1F8NA 1N9EA 4U13A 4BIRA 2I9WA 1IV7A 2AADA 2OQEC 1LOYA 4X2OA 4BTYA 2XSHB 1BRGA 1I0VA 4HM6B 1LNHA 3NX0A 1IV9A 1T2IA 1Y4KA 2IMJA 1OHOA 3HIIA 4HZBB 4ZM8A 4HKVB 3SX1A 2KXGA 3BNBA 4HM5B 4TX4A 3KN4A 3I0YA 4KFDA 1VQO3 1BRHA 4BTWA 3G0KA 1B2MA 1V57A 4HM3B 1BSEA 1SQWA 1BGSA 1NWWA 1NO3A 2RNTA 1W7CA 3DH2A 1GYBA 3M8CA 3DXOA 1TJDA 1I0XA 3BU4A 3KE7A 2KF6A 1BIRA 3GZBA 1YNVX 5LC6A 3F9SA 5M1AA 3CC23 1M1K4 1JBTA 2CFGA 1CYUA 2M7OA 2PZVA 3WHOA 1DE3A 2KRTA 1RRLA 3HK4A 3LZAA 2FNQA 1KD14 1RGAA 5IG0A 1BNSA 1KC84 6RNTA 2E2TA 3D9RA 1YVBI 1YJW3 2HMMB 2HOHA 3V98A 4LYLB 2OCTA 1B21A 3D4AA 2W56A 1EQKA 1M1XB 1GOYA 1B2UA 3V99A 1NB5I 2ZDJA 2CFWA 3GAXA 4H3UA 8CHOA 3FGYA 2C4BA 3NXJA 1CEWI 1I8VA 2D42A 1RCLA 4R1KA 5ELUA 2JQ5A 3ZG5A 4KT3B 3BLZA 3NQZA 5AIIA 1Q9EA 1ROVA 1TRQA 3NBRA 4GHOA 5AEUB 1S723 2W56B 1VQN3 1CYVA 3G713 1OHPA 3F7XA 1HKXA 2SARA 3FF0A 3FH1A 3G4S3 7STDA 1W2B2 1OH0A 1BUJA 1VQ93 2F5WA 4R9LA 1O7PB 1X1WA 5RNTA 2P05A 1W4NA 3CCL3 1Q814 1GMRA 2F4YA 2YFJB 4LEHA 2GU3A 1MOLA 2KF4A 1I3IA 3BB9A 3RNTA 5AIHA 3ZG0A 1HYFA 3KFQC 3V92A 4FCZA 5GSPA 3FCSB 4ORLA 1UW1A 4PEJA 2SBLA 5A0OB 4MMXB 1RSNA 4I4KA 2FXTA 2XR8B 1BNGA 1X1YA 3Q1CA 1X1XA 4CCVA 1OGXA 5I97A 1UCIA 4L7KA 2BO9B 6GSPA 1A67A 2BIRA 1JV2B 2RBIA 2XGLA 2AAEA 2Z77A 4O8SA 1YGEA 4HBRA 2ZA4A 5JPUA 1A2KA 1SJWA 1LOVA 2MC8A 1YHQ3 1Q824 2XEPA 3JUNA 5DREA 3PCSA 1GD3A 1D6UA 3MG1A 4FCMA 1N5HA 3X41A 2V1LA 1VQ53 1I2FA 5G1KA 1RTUA 3EBTA 3UB1A 1PYLA 1TP6A 3UJMA 2D1WA 3EBYA 4J5GA 1AR0A 1L5GB 1JRQA 1FGTA 3F8HA 4N6TA 5IEPA 3CC43 1AV4A 4R4KA 4MMYB 1QVG2 1BOXA 3T0UA 4FMDA 2XF3A 2HMJB 1ISKA 1OF5A 1DYUA 1ZGXA 2RCDA 2CG1A 1N9JA 2GBWB 2YX9A 3X3ZA 3ALAA 4AKZA 1VQ63 2JDIH 4OVMA 1EKMA 1UCLA 4FR9A 3CCU3 4GB5A 3TDGA 1N5PA 4NHFA 2CX0A 3T8UA 1V74A 1R4YA 3EQQB 4K61A 3NHXA 3K7CA 4L8PA 4XDVA 4IIAA 1OF5B 4BL3A 1NU3A 3X42A 3CCV3 1UUGB 3DUKA 1WMNA 2K54A 4X2HA 3VGNA 4BL2A 8RNTA 2RFRA 1K8A4 5IEOA 3BNEA 4Q53A 2Y74A 3LT9A 3EF8A 4IT7A 1OPYA 1RGKA 1MWSA 3Q90A 2CWVA 1IVVA 2LQVA 5D81A 1FUSA 2STDA 2Y73A 4EYCA 2IA7A 5G1LA 2RGQA 3RDEA 4CPKA 1RRHA 3DGMA 4RNYA 1RKYA 3D5GA 1MGWA 1V58A 2CKFB
chains in the Genus database with same CATH topology
1WTHA 3RGAA 1IT7A 3D3LA 4EBGA 3DGLA 1WMOA 3OX9A 2HMKB 3MG2A 2WGQA 3KSPA 3EC9A 4G1MB 2W03A 4O02B 3WMDA 4HZ9B 1JB4A 4KZ1A 2Z6BA 1HU9A 5CF2A 1OGZA 2LYXA 1IVXA 4RNZA 2GEXA 3LXUX 3KIIA 4HM4B 3WODG 1VQP3 4AKYA 1YJ93 2WOFA 3PXMA 3BNDA 3HI7A 3S67A 3FG1A 2ML5A 2O3OA 3WDGB 3MKIA 5IF6A 2OTL3 1AVLA 3EN8A 3WA2X 3CXC2 3OWYA 1K734 4H61A 4J9AA 5ELJA 5BVBA 3AMOA 3CPOA 4N6UA 2A15A 1KSIA 3LTBA 3LOYA 3B4OA 1YI23 3F8XA 2K0MA 3GZRA 3ROBA 1LXEA 1TFOA 3FF2A 3WA3A 2QA43 1FA3A 4K90B 5TGNA 4WYKA 4OK0A 5D82A 2WGOA 3PZWA 4N6LA 4HJLB 4XB5A 2B1XB 2BMQB 1NB3I 2B24B 2R4IA 3AMOB 4JF8A 1IU7A 1ASKA 1OHSA 3SXXA 2C11A 1DVCA 1LVNA 1VQK3 3MWZA 1Q42A 1STFI 2E2VA 3JVCA 4WYKB 3OWUA 4XDWA 3IPTA 3FG3A 2O9UX 2W0QA 2CH9A 4KVHA 2WOHA 3G8ZA 4RBNA 4AEQA 4K1VA 1JB2A 1K28A 3CCE3 1Z1SA 3H51A 2QEX3 2WO0A 1TIJA 3DM8A 2HMLB 3K0ZA 4MJDA 2F98A 2W04A 2HMOB 2OOVA 2CG0A 3ECFA 3CNXA 1IQYA 3MHEA 4XBXA 3WOFB 2XFTA 1GY5A 1D6ZA 3FZWA 2ML6A 1G96A 3PGBA 3PYJA 2CC3A 2Z7AA 4XBYA 2IUJA 1IQ8A 5DRVA 1OUNA 3K9MC 2OOVC 2CFKA 1DMMA 3QRDA 3X40A 3CCQ3 2XRXB 3EHCA 1U5OA 3WOEB 3BNCA 5IG4A 1QVF2 3U1WA 2PNCA 3F14A 1US1A 5CF1A 1GD4A 1J2BA 2ZL8A 3E99A 4XM4A 3DGOA 2W9PA 4LGQA 1K41A 3I563 3NUVA 3A76A 4WWUC 3OXAA 1KQS2 4OUQA 3UNLA 2OWPA 6STDA 3PS8A 3CCR3 1A2VA 1FGMA 4HYZA 5AI1A 1D6YA 3OV4A 4N6MA 4L8OA 3MSOA 1A90A 3S28A 1FUWA 1JNQA 1M9GA 1ROAA 2FGTA 3EB8A 3LYGA 3DGNA 4HVNA 5EVHA 1T5YA 2GU1A 3SOYA 3IMAB 1ULIB 3LT8A 3SVAA 3LTDA 3G6E3 1VQ43 4WHAA 1VQL3 4LZIA 5AIGA 2CWTA 3EJVA 1W6YA 4N3VA 5KP3A 3S5CA 2Q07A 5JBSA 1WNHA 1O7MB 1STDA 3JUQA 3LTAA 2XSOB 2BNGA 5AEWB 3N54B 3B8LA 5CK6A 1KWIA 1QJGA 2CK3H 3JUPA 3K63A 3CCU3 3LH4A 4MEIA 1W02A 1E3RA 3N8BA 2W6JH 1PFPA 1JB5A 3JUMA 3OW22 1M904 5STDA 4HM2B 2XGNA 2BMRB 1W2ZA 4N6V0 1BUQA 5EEOA 4LSOA 2P09A 1SPUA 1O7NB 3JUOA 1W01A 2F99A 4WP5A 1IT8A 1QAFA 1UI8A 3CCJ3 1QMAA 1DMQA 1C7HA 5CLKA 1LOXA 3EN1B 2P0MA 3O8YA 1RJOA 1JKGB 2RSXA 4FCJA 3CD63 1FGOA 1PU4A 1Q40A 1FGRA 1W00A 1W6CA 3FLJA 3Q2PA 5JPPA 4HM8B 1SIIA 1JJ22 1IQXA 3FKAA 1IK3A 1W6GA 1S5AA 5LC7A 3CCS3 3LMLA 1E97A 1QALA 3CU3A 3LTCA 2GXFA 1N8R4 3GZXB 2GBXB 1N8QA 1Q40B 3S27A 3CNMA 1UUWB 3KKGA 3NQYA 1IDPA 1QAKA 2KCDA 1YJN3 3CC73 3NM7A 4CDLA 5EQLA 1TU5A 2BHMA 3KSED 3T8NA 3S29A 4KFFA 2XFSA 1GS3A 5FGOA 3QK9A 1EA2A 3U97A 1WMPA 4EC6A 1ULJB 1GY7A 2UX0A 3X3YA 1E3VA 3NBJA 5CXOA 1Q7Y4 2YFLB 3HIGA 3X3XA 2CW9A 2F86B 5IG3A 3CPW2 4JRFA 2XH9A 3MPHA 4QWTA 5IENA 2CFLA 3MG3A 2QGUA 4EV5A 2CHCA 2YFIB 4J8TA 4O2HA 3UL6A 1NDOB 3DZLA 3FSDA 5HGRA 3RGRA 2W2CA 1ZO2A 3SOAA 2W9QA 1UI7A 3VSYA 1VQ83 1W5ZA 3B7CA 2P0XA 3STDA 5D83A 4EXRA 4R80A 3UL5A 3N9HA 4XBTA 5AIFA 2P38A 1DMNA 3H3HA 1SIHA 3NM2A 3I553 1DVDA 3CME3 1O7GB 3K5TA 5AYRB 3L0RA 3NV0A 3PCRA 4IPBA 2E2UA 3CMA3 1O7WB 4HM1B 3OWSA 1TFKA 1IVWA 2BT3A 1Q864 3DMCA 5IG5A 3SEDA 3F40A 4STDA 4RZMA 1O7HB 1WQLB 3EE1A 3EX9A 2Z76A 3NV0B 3IJEB 4GL6A 3J7Yd 5FW5A 3NBBA 1RN7A 1VZZA 3KZTA 2INXA 3MYTA 1YIJ3 3F7SA 3HZPA 4MMZB 1NJI4 2CWUA 1AVKA 4N6OB 3GZYB 3GRDA 4K1UA 4WFOA 4HM7B 1UUVB 1TUHA 2CIUA 4BTXA 2L4VA 2GEYA 2HMNB 3SLUA 1JN5A 2CFDA 5KP4A 4R9KA 3HX8A 5BXQA 1OCVA 1MNLA 1CQSA 2IUKA 4HM0B 4EV2A 3B4PA 4FMBA 1GY6A 1JKGA 1FGQA 1JN5B 2BMOB 5AYSC 2OQEA 3CCM3 1K9M4 1EG9B 4N6NB 4LMIA 3ER7A 4NREA 3VF1A 3GWRA 1U8CB 4FMAA 2C10A 1R4CA 1VQ73 2OTJ3 2MF7A 3DY5A 4FMCA 5KP1A 3G16A 2QIYA 5G2GA 1OACA 1ZX2A 4O3VA 5IERA 1IVUA 5IW9A 1YIT3 4KFEA 3FG4A 1F8NA 1N9EA 4U13A 4BTYA 2I9WA 1IV7A 2OQEC 4X2OA 2XSHB 4HM6B 1LNHA 3NX0A 1IV9A 1Y4KA 3HIIA 2IMJA 1OHOA 4HZBB 4ZM8A 4HKVB 3SX1A 2KXGA 3BNBA 4HM5B 4TX4A 3KN4A 3I0YA 4KFDA 1VQO3 4BTWA 3G0KA 4HM3B 1SQWA 1NWWA 1NO3A 1W7CA 1GYBA 3M8CA 3DXOA 3KE7A 3GZBA 5LC6A 3F9SA 3CC23 1M1K4 1CYUA 2CFGA 2M7OA 2PZVA 2KRTA 1RRLA 3HK4A 3LZAA 2FNQA 1KD14 5IG0A 1KC84 2E2TA 3D9RA 1YVBI 1YJW3 2HMMB 3V98A 2OCTA 2W56A 1EQKA 1M1XB 3V99A 1NB5I 2ZDJA 2CFWA 3GAXA 4H3UA 8CHOA 3FGYA 3NXJA 1CEWI 4R1KA 2D42A 5ELUA 2JQ5A 5AIIA 3BLZA 3NQZA 1S723 5AEUB 1ROVA 3NBRA 2W56B 1VQN3 1CYVA 3G713 1OHPA 3F7XA 1HKXA 3FF0A 3FH1A 3G4S3 7STDA 1W2B2 1OH0A 1VQ93 4R9LA 1O7PB 3CCL3 2P05A 1W4NA 1Q814 2YFJB 4LEHA 2GU3A 1MOLA 3BB9A 5AIHA 3KFQC 3V92A 4FCZA 3FCSB 4ORLA 1UW1A 4PEJA 2SBLA 5A0OB 4MMXB 4I4KA 2FXTA 2XR8B 3Q1CA 4CCVA 5I97A 1OGXA 4L7KA 2BO9B 1A67A 1JV2B 2XGLA 2Z77A 4O8SA 1YGEA 4HBRA 5JPUA 1A2KA 1SJWA 2MC8A 1YHQ3 1Q824 2XEPA 3JUNA 5DREA 3PCSA 1GD3A 1D6UA 3MG1A 4FCMA 1N5HA 3X41A 2V1LA 1VQ53 3EBTA 3UB1A 1TP6A 3UJMA 2D1WA 3EBYA 1AR0A 1L5GB 1JRQA 1FGTA 3F8HA 4N6TA 5IEPA 3CC43 1AV4A 4R4KA 4MMYB 1QVG2 3T0UA 4FMDA 2XF3A 2HMJB 1ISKA 1OF5A 1DYUA 2CG1A 2RCDA 1N9JA 2GBWB 2YX9A 3X3ZA 3ALAA 4AKZA 1VQ63 2JDIH 4OVMA 1EKMA 4FR9A 4GB5A 3TDGA 1N5PA 4NHFA 3T8UA 1V74A 3EQQB 4K61A 3NHXA 3K7CA 4L8PA 4XDVA 4IIAA 1OF5B 1NU3A 3X42A 3CCV3 3DUKA 1WMNA 2K54A 4X2HA 3VGNA 2RFRA 1K8A4 5IEOA 3BNEA 4Q53A 2Y74A 3LT9A 3EF8A 4IT7A 1OPYA 3Q90A 2CWVA 1IVVA 2LQVA 5D81A 2STDA 2Y73A 4EYCA 2IA7A 3RDEA 2RGQA 1RRHA 3DGMA 4RNYA 1RKYA 1VQM3 2CKFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGL A;  4AEQ A;  2LQV A; 
#chains in the Genus database with same CATH topology
 1WTH A;  3RGA A;  1IT7 A;  3D3L A;  4EBG A;  4HOH A;  3DGL A;  1WMO A;  3OX9 A;  2HMK B;  3MG2 A;  2WGQ A;  3KSP A;  3EC9 A;  4G1M B;  1I2E A;  2W03 A;  4O02 B;  3WMD A;  4HZ9 B;  1RNB A;  4I5Q A;  1JB4 A;  3GSP A;  2Z6B A;  4KZ1 A;  1HU9 A;  5CF2 A;  2GSP A;  1OGZ A;  2LYX A;  1BRJ A;  1IVX A;  4RNZ A;  1RN1 A;  2GEX A;  3LXU X;  3KII A;  4HM4 B;  3WOD G;  1VQP 3;  4AKY A;  1YJ9 3;  2WOF A;  3PXM A;  3BND A;  3HI7 A;  1EEJ A;  3S67 A;  3FG1 A;  2H0H A;  2ML5 A;  2O3O A;  3WDG B;  3MKI A;  5IF6 A;  2OTL 3;  3BIR A;  1AVL A;  3EN8 A;  1RMS A;  3WA2 X;  3CXC 2;  1EUI C;  3OWY A;  1K73 4;  1IYY A;  1BSC A;  4H61 A;  1BAO A;  4J9A A;  5ELJ A;  5BVB A;  3AMO A;  3CPO A;  4N6U A;  1VQM 3;  2A15 A;  1KSI A;  2CX1 A;  3LTB A;  3B4O A;  1B2X A;  3LOY A;  3F8X A;  2K0M A;  3GZR A;  3HOH A;  1LXE A;  4GSP A;  3ROB A;  3A5E A;  1TFO A;  3FF2 A;  3WA3 A;  2QA4 3;  1FA3 A;  1T3B A;  4K90 B;  5TGN A;  1FW7 A;  4WYK A;  2KAA A;  4OK0 A;  5D82 A;  2WGO A;  3PZW A;  4N6L A;  4HJL B;  4XB5 A;  2B1X B;  2BMQ B;  1NB3 I;  2B24 B;  2R4I A;  3AMO B;  4JF8 A;  3AGO A;  4CJN A;  1IU7 A;  1ASK A;  1OHS A;  3SXX A;  2C11 A;  1DVC A;  1LVN A;  1VQK 3;  3MWZ A;  2KF3 A;  1Q42 A;  1STF I;  2E2V A;  3JVC A;  4WYK B;  3OWU A;  4XDW A;  1JBS A;  3IPT A;  2IYJ A;  3FG3 A;  1UDI I;  2O9U X;  2W0Q A;  2CH9 A;  4KVH A;  2WOH A;  3G8Z A;  4RBN A;  1BNE A;  4AEQ A;  4K1V A;  1JB2 A;  1K28 A;  3CCE 3;  1MGR A;  1Z1S A;  2UUG C;  3H51 A;  2QEX 3;  2WO0 A;  1BSA A;  1TIJ A;  3DM8 A;  2HML B;  2BU4 A;  3K0Z A;  4MJD A;  2F98 A;  2W04 A;  1G02 A;  2HMO B;  2CG0 A;  3ECF A;  3CNX A;  2OOV A;  1IQY A;  3MHE A;  4XBX A;  3WOF B;  1LQM B;  2IY2 A;  1GY5 A;  2XFT A;  1D6Z A;  3FZW A;  2ML6 A;  1G96 A;  1TRP A;  3PGB A;  2CC3 A;  2Z7A A;  3PYJ A;  4XBY A;  2IUJ A;  1IQ8 A;  5DRV A;  1AQZ A;  1OUN A;  3K9M C;  2OOV C;  2CFK A;  1DMM A;  3QRD A;  1MWR A;  3X40 A;  3CCQ 3;  1B3S A;  2XRX B;  3EHC A;  3KCH A;  1U5O A;  1JZD A;  1A2P A;  1BNF A;  3WOE B;  3BNC A;  1BAN A;  5IG4 A;  3U1W A;  1QVF 2;  1RCK A;  1RGC A;  2PNC A;  3F14 A;  1US1 A;  5CF1 A;  1GD4 A;  1J2B A;  2ZL8 A;  3E99 A;  4XM4 A;  2L1S A;  3DGO A;  2W9P A;  1SAR A;  4LGQ A;  1K41 A;  3I56 3;  3NUV A;  3A76 A;  1GOU A;  4WWU C;  3SYU A;  3OXA A;  1KQS 2;  4OUQ A;  3UNL A;  2OWP A;  6STD A;  3PS8 A;  3CCR 3;  1A2V A;  1YGW A;  1FGM A;  4HYZ A;  5AI1 A;  1D6Y A;  3OV4 A;  4N6M A;  4L8O A;  3MSO A;  1A90 A;  3S28 A;  1TTO A;  1FUW A;  1JNQ A;  5BIR A;  1RN4 A;  1M9G A;  1ROA A;  2FGT A;  3EB8 A;  3LYG A;  3DGN A;  4HVN A;  5EVH A;  1T5Y A;  2GU1 A;  3SOY A;  3IMA B;  5M18 A;  1UCJ A;  1ULI B;  3LT8 A;  3SVA A;  3LTD A;  3G6E 3;  1VQ4 3;  4WHA A;  1JZO A;  3URP A;  1VQL 3;  4LZI A;  1BNJ A;  5AIG A;  2CWT A;  3EJV A;  1W6Y A;  1RGL A;  4N3V A;  5KP3 A;  3S5C A;  2Q07 A;  5JBS A;  1WNH A;  1O7M B;  1STD A;  3JUQ A;  3LTA A;  2XSO B;  2BNG A;  4RNT A;  3N54 B;  5AEW B;  3B8L A;  1ZS7 A;  1KWI A;  1QJG A;  1UCK A;  2CK3 H;  3JUP A;  3K63 A;  3LH4 A;  2K3D A;  4MEI A;  1W02 A;  1E3R A;  2H0I A;  3N8B A;  2W6J H;  1PFP A;  1JB5 A;  3JUM A;  1GMQ A;  3OW2 2;  1LRA A;  1M90 4;  1LQG C;  1MWT A;  5STD A;  4HM2 B;  2XGN A;  2BMR B;  1LOW A;  1Q7H A;  1W2Z A;  4N6V 0;  1BUQ A;  2UGI A;  5EEO A;  4LSO A;  2P09 A;  1B2S A;  1O7N B;  1SPU A;  3JUO A;  1BNI A;  1W01 A;  1BSD A;  2F99 A;  4WP5 A;  1IT8 A;  1QAF A;  1UI8 A;  3CCJ 3;  1QMA A;  1BU4 A;  1DMQ A;  5CK6 A;  1C7H A;  5CLK A;  1LOX A;  3EN1 B;  2P0M A;  3O8Y A;  1RDS A;  1GMP A;  1RJO A;  1JKG B;  2RSX A;  4FCJ A;  3CD6 3;  1FGO A;  3WR2 A;  1PU4 A;  1Q40 A;  1FGR A;  1GSP A;  1W00 A;  1W6C A;  3FLJ A;  3Q2P A;  5JPP A;  4HM8 B;  1SII A;  1JJ2 2;  1IQX A;  3FKA A;  2F5M A;  1DET A;  1IK3 A;  1W6G A;  1S5A A;  5LC7 A;  3CCS 3;  3LML A;  1E97 A;  1QAL A;  3CU3 A;  3LTC A;  2GXF A;  1N8R 4;  3GZX B;  2GBX B;  1N8Q A;  1Q40 B;  3S27 A;  3DGY A;  3CNM A;  1UUW B;  3KKG A;  3NQY A;  1UGI A;  1IDP A;  1MWU A;  1QAK A;  2KCD A;  1YJN 3;  3AHS A;  3CC7 3;  3NM7 A;  4CDL A;  1FZU A;  1RNT A;  5EQL A;  1TU5 A;  2BHM A;  3KSE D;  3T8N A;  3S29 A;  1X1U A;  4KFF A;  1I70 A;  2XFS A;  1GS3 A;  1FYS A;  5FGO A;  3QK9 A;  1EA2 A;  3U97 A;  1WMP A;  4EC6 A;  1LNI A;  1GY7 A;  1ULJ B;  2UX0 A;  5BU4 A;  1JBR A;  3X3Y A;  1E3V A;  3NBJ A;  5CXO A;  1Q7Y 4;  1BSB A;  2YFL B;  3HIG A;  3X3X A;  2CW9 A;  2F86 B;  4J5K A;  5IG3 A;  4JRF A;  3CPW 2;  2XH9 A;  3MPH A;  4QWT A;  5IEN A;  2CFL A;  3MG3 A;  2QGU A;  4EV5 A;  1BVI A;  2CHC A;  2YFI B;  4J8T A;  4O2H A;  3ZFZ A;  1BRK A;  1UGH I;  3UL6 A;  1NDO B;  3DZL A;  3AHW A;  3FSD A;  5HGR A;  3RGR A;  2W2C A;  1BRI A;  1T2H A;  1BRN L;  1ZO2 A;  1BRS A;  1RGF A;  2F56 A;  3SOA A;  2W9Q A;  1UI7 A;  3VSY A;  1VQ8 3;  1C54 A;  1W5Z A;  3B7C A;  2P0X A;  3STD A;  5D83 A;  4EXR A;  4R80 A;  4HAA A;  3UL5 A;  1B20 A;  3N9H A;  4XBT A;  5AIF A;  5M19 A;  2P38 A;  1DMN A;  1VQQ A;  3H3H A;  1SIH A;  3NM2 A;  5HOH A;  3I55 3;  1DVD A;  3CME 3;  1O7G B;  3K5T A;  5AYR B;  3L0R A;  9RNT A;  1RGH A;  1RGE A;  2H0G A;  3NV0 A;  1NNV A;  3PCR A;  4IPB A;  2E2U A;  3CMA 3;  1O7W B;  7GSP A;  4HM1 B;  3OWS A;  1TFK A;  1YVS A;  1B27 A;  1IVW A;  1GOV A;  2BT3 A;  3DMC A;  4EW5 A;  1Q86 4;  5IG5 A;  3D79 A;  3SED A;  3F40 A;  4STD A;  4RZM A;  4NPB A;  1HZ1 A;  1O7H B;  1WQL B;  2J8X B;  2R41 A;  3EE1 A;  3EX9 A;  3Q3F A;  1B2Z A;  2Z76 A;  3NV0 B;  3IJE B;  4GL6 A;  3J7Y d;  3AGN A;  3NBB A;  1RN7 A;  5FW5 A;  1VZZ A;  3KZT A;  2INX A;  3MYT A;  1YIJ 3;  3F7S A;  3HZP A;  4MMZ B;  1NJI 4;  2CWU A;  1AVK A;  1PY3 A;  4ILF A;  1RLS A;  4N6O B;  1AY7 A;  3GZY B;  3GRD A;  4K1U A;  4WFO A;  4HM7 B;  1UUV B;  1TUH A;  2CIU A;  1I2G A;  4BTX A;  1FUT A;  2L4V A;  2GEY A;  2HMN B;  3SLU A;  1JN5 A;  2CFD A;  5KP4 A;  4R9K A;  3HX8 A;  5BXQ A;  1OCV A;  1MNL A;  1CQS A;  2IUK A;  2KF5 A;  4HM0 B;  1YI2 3;  4EV2 A;  2ZHX B;  3B4P A;  1RGG A;  4DKI A;  4FMB A;  2OTJ 3;  1GY6 A;  1JKG A;  1FGQ A;  1JN5 B;  1I3F A;  2BMO B;  5AYS C;  2OQE A;  3CCM 3;  1EG9 B;  1K9M 4;  4N6N B;  4LMI A;  3ER7 A;  4NRE A;  3VF1 A;  3GWR A;  1U8C B;  4FMA A;  2C10 A;  1R4C A;  1CH0 A;  1G0T A;  4BU4 A;  1VQ7 3;  2MF7 A;  3DY5 A;  4FMC A;  7RNT A;  5KP1 A;  3G16 A;  1RHL A;  2QIY A;  1OAC A;  5G2G A;  3D5I A;  1ZX2 A;  4O3V A;  1BNR A;  5IER A;  1IVU A;  5IW9 A;  1YIT 3;  4KFE A;  3FG4 A;  1F8N A;  1N9E A;  4U13 A;  4BIR A;  2I9W A;  1IV7 A;  2AAD A;  2OQE C;  1LOY A;  4X2O A;  4BTY A;  2XSH B;  1BRG A;  1I0V A;  4HM6 B;  1LNH A;  3NX0 A;  1IV9 A;  1T2I A;  1Y4K A;  2IMJ A;  1OHO A;  3HII A;  4HZB B;  4ZM8 A;  4HKV B;  3SX1 A;  2KXG A;  3BNB A;  4HM5 B;  4TX4 A;  3KN4 A;  3I0Y A;  4KFD A;  1VQO 3;  1BRH A;  4BTW A;  3G0K A;  1B2M A;  1V57 A;  4HM3 B;  1BSE A;  1SQW A;  1BGS A;  1NWW A;  1NO3 A;  2RNT A;  1W7C A;  3DH2 A;  1GYB A;  3M8C A;  3DXO A;  1TJD A;  1I0X A;  3BU4 A;  3KE7 A;  2KF6 A;  1BIR A;  3GZB A;  1YNV X;  5LC6 A;  3F9S A;  5M1A A;  3CC2 3;  1M1K 4;  1JBT A;  2CFG A;  1CYU A;  2M7O A;  2PZV A;  3WHO A;  1DE3 A;  2KRT A;  1RRL A;  3HK4 A;  3LZA A;  2FNQ A;  1KD1 4;  1RGA A;  5IG0 A;  1BNS A;  1KC8 4;  6RNT A;  2E2T A;  3D9R A;  1YVB I;  1YJW 3;  2HMM B;  2HOH A;  3V98 A;  4LYL B;  2OCT A;  1B21 A;  3D4A A;  2W56 A;  1EQK A;  1M1X B;  1GOY A;  1B2U A;  3V99 A;  1NB5 I;  2ZDJ A;  2CFW A;  3GAX A;  4H3U A;  8CHO A;  3FGY A;  2C4B A;  3NXJ A;  1CEW I;  1I8V A;  2D42 A;  1RCL A;  4R1K A;  5ELU A;  2JQ5 A;  3ZG5 A;  4KT3 B;  3BLZ A;  3NQZ A;  5AII A;  1Q9E A;  1ROV A;  1TRQ A;  3NBR A;  4GHO A;  5AEU B;  1S72 3;  2W56 B;  1VQN 3;  1CYV A;  3G71 3;  1OHP A;  3F7X A;  1HKX A;  2SAR A;  3FF0 A;  3FH1 A;  3G4S 3;  7STD A;  1W2B 2;  1OH0 A;  1BUJ A;  1VQ9 3;  2F5W A;  4R9L A;  1O7P B;  1X1W A;  5RNT A;  2P05 A;  1W4N A;  3CCL 3;  1Q81 4;  1GMR A;  2F4Y A;  2YFJ B;  4LEH A;  2GU3 A;  1MOL A;  2KF4 A;  1I3I A;  3BB9 A;  3RNT A;  5AIH A;  3ZG0 A;  1HYF A;  3KFQ C;  3V92 A;  4FCZ A;  5GSP A;  3FCS B;  4ORL A;  1UW1 A;  4PEJ A;  2SBL A;  5A0O B;  4MMX B;  1RSN A;  4I4K A;  2FXT A;  2XR8 B;  1BNG A;  1X1Y A;  3Q1C A;  1X1X A;  4CCV A;  1OGX A;  5I97 A;  1UCI A;  4L7K A;  2BO9 B;  6GSP A;  1A67 A;  2BIR A;  1JV2 B;  2RBI A;  2XGL A;  2AAE A;  2Z77 A;  4O8S A;  1YGE A;  4HBR A;  2ZA4 A;  5JPU A;  1A2K A;  1SJW A;  1LOV A;  2MC8 A;  1YHQ 3;  1Q82 4;  2XEP A;  3JUN A;  5DRE A;  3PCS A;  1GD3 A;  1D6U A;  3MG1 A;  4FCM A;  1N5H A;  3X41 A;  2V1L A;  1VQ5 3;  1I2F A;  5G1K A;  1RTU A;  3EBT A;  3UB1 A;  1PYL A;  1TP6 A;  3UJM A;  2D1W A;  3EBY A;  4J5G A;  1AR0 A;  1L5G B;  1JRQ A;  1FGT A;  3F8H A;  4N6T A;  5IEP A;  3CC4 3;  1AV4 A;  4R4K A;  4MMY B;  1QVG 2;  1BOX A;  3T0U A;  4FMD A;  2XF3 A;  2HMJ B;  1ISK A;  1OF5 A;  1DYU A;  1ZGX A;  2RCD A;  2CG1 A;  1N9J A;  2GBW B;  2YX9 A;  3X3Z A;  3ALA A;  4AKZ A;  1VQ6 3;  2JDI H;  4OVM A;  1EKM A;  1UCL A;  4FR9 A;  3CCU 3;  4GB5 A;  3TDG A;  1N5P A;  4NHF A;  2CX0 A;  3T8U A;  1V74 A;  1R4Y A;  3EQQ B;  4K61 A;  3NHX A;  3K7C A;  4L8P A;  4XDV A;  4IIA A;  1OF5 B;  4BL3 A;  1NU3 A;  3X42 A;  3CCV 3;  1UUG B;  3DUK A;  1WMN A;  2K54 A;  4X2H A;  3VGN A;  4BL2 A;  8RNT A;  2RFR A;  1K8A 4;  5IEO A;  3BNE A;  4Q53 A;  2Y74 A;  3LT9 A;  3EF8 A;  4IT7 A;  1OPY A;  1RGK A;  1MWS A;  3Q90 A;  2CWV A;  1IVV A;  2LQV A;  5D81 A;  1FUS A;  2STD A;  2Y73 A;  4EYC A;  2IA7 A;  5G1L A;  2RGQ A;  3RDE A;  4CPK A;  1RRH A;  3DGM A;  4RNY A;  1RKY A;  3D5G A;  1MGW A;  1V58 A;  2CKF B; 
#chains in the Genus database with same CATH homology
 1WTH A;  3RGA A;  1IT7 A;  3D3L A;  4EBG A;  3DGL A;  1WMO A;  3OX9 A;  2HMK B;  3MG2 A;  2WGQ A;  3KSP A;  3EC9 A;  4G1M B;  2W03 A;  4O02 B;  3WMD A;  4HZ9 B;  1JB4 A;  4KZ1 A;  2Z6B A;  1HU9 A;  5CF2 A;  1OGZ A;  2LYX A;  1IVX A;  4RNZ A;  2GEX A;  3LXU X;  3KII A;  4HM4 B;  3WOD G;  1VQP 3;  4AKY A;  1YJ9 3;  2WOF A;  3PXM A;  3BND A;  3HI7 A;  3S67 A;  3FG1 A;  2ML5 A;  2O3O A;  3WDG B;  3MKI A;  5IF6 A;  2OTL 3;  1AVL A;  3EN8 A;  3WA2 X;  3CXC 2;  3OWY A;  1K73 4;  4H61 A;  4J9A A;  5ELJ A;  5BVB A;  3AMO A;  3CPO A;  4N6U A;  2A15 A;  1KSI A;  3LTB A;  3LOY A;  3B4O A;  1YI2 3;  3F8X A;  2K0M A;  3GZR A;  3ROB A;  1LXE A;  1TFO A;  3FF2 A;  3WA3 A;  2QA4 3;  1FA3 A;  4K90 B;  5TGN A;  4WYK A;  4OK0 A;  5D82 A;  2WGO A;  3PZW A;  4N6L A;  4HJL B;  4XB5 A;  2B1X B;  2BMQ B;  1NB3 I;  2B24 B;  2R4I A;  3AMO B;  4JF8 A;  1IU7 A;  1ASK A;  1OHS A;  3SXX A;  2C11 A;  1DVC A;  1LVN A;  1VQK 3;  3MWZ A;  1Q42 A;  1STF I;  2E2V A;  3JVC A;  4WYK B;  3OWU A;  4XDW A;  3IPT A;  3FG3 A;  2O9U X;  2W0Q A;  2CH9 A;  4KVH A;  2WOH A;  3G8Z A;  4RBN A;  4AEQ A;  4K1V A;  1JB2 A;  1K28 A;  3CCE 3;  1Z1S A;  3H51 A;  2QEX 3;  2WO0 A;  1TIJ A;  3DM8 A;  2HML B;  3K0Z A;  4MJD A;  2F98 A;  2W04 A;  2HMO B;  2OOV A;  2CG0 A;  3ECF A;  3CNX A;  1IQY A;  3MHE A;  4XBX A;  3WOF B;  2XFT A;  1GY5 A;  1D6Z A;  3FZW A;  2ML6 A;  1G96 A;  3PGB A;  3PYJ A;  2CC3 A;  2Z7A A;  4XBY A;  2IUJ A;  1IQ8 A;  5DRV A;  1OUN A;  3K9M C;  2OOV C;  2CFK A;  1DMM A;  3QRD A;  3X40 A;  3CCQ 3;  2XRX B;  3EHC A;  1U5O A;  3WOE B;  3BNC A;  5IG4 A;  1QVF 2;  3U1W A;  2PNC A;  3F14 A;  1US1 A;  5CF1 A;  1GD4 A;  1J2B A;  2ZL8 A;  3E99 A;  4XM4 A;  3DGO A;  2W9P A;  4LGQ A;  1K41 A;  3I56 3;  3NUV A;  3A76 A;  4WWU C;  3OXA A;  1KQS 2;  4OUQ A;  3UNL A;  2OWP A;  6STD A;  3PS8 A;  3CCR 3;  1A2V A;  1FGM A;  4HYZ A;  5AI1 A;  1D6Y A;  3OV4 A;  4N6M A;  4L8O A;  3MSO A;  1A90 A;  3S28 A;  1FUW A;  1JNQ A;  1M9G A;  1ROA A;  2FGT A;  3EB8 A;  3LYG A;  3DGN A;  4HVN A;  5EVH A;  1T5Y A;  2GU1 A;  3SOY A;  3IMA B;  1ULI B;  3LT8 A;  3SVA A;  3LTD A;  3G6E 3;  1VQ4 3;  4WHA A;  1VQL 3;  4LZI A;  5AIG A;  2CWT A;  3EJV A;  1W6Y A;  4N3V A;  5KP3 A;  3S5C A;  2Q07 A;  5JBS A;  1WNH A;  1O7M B;  1STD A;  3JUQ A;  3LTA A;  2XSO B;  2BNG A;  5AEW B;  3N54 B;  3B8L A;  5CK6 A;  1KWI A;  1QJG A;  2CK3 H;  3JUP A;  3K63 A;  3CCU 3;  3LH4 A;  4MEI A;  1W02 A;  1E3R A;  3N8B A;  2W6J H;  1PFP A;  1JB5 A;  3JUM A;  3OW2 2;  1M90 4;  5STD A;  4HM2 B;  2XGN A;  2BMR B;  1W2Z A;  4N6V 0;  1BUQ A;  5EEO A;  4LSO A;  2P09 A;  1SPU A;  1O7N B;  3JUO A;  1W01 A;  2F99 A;  4WP5 A;  1IT8 A;  1QAF A;  1UI8 A;  3CCJ 3;  1QMA A;  1DMQ A;  1C7H A;  5CLK A;  1LOX A;  3EN1 B;  2P0M A;  3O8Y A;  1RJO A;  1JKG B;  2RSX A;  4FCJ A;  3CD6 3;  1FGO A;  1PU4 A;  1Q40 A;  1FGR A;  1W00 A;  1W6C A;  3FLJ A;  3Q2P A;  5JPP A;  4HM8 B;  1SII A;  1JJ2 2;  1IQX A;  3FKA A;  1IK3 A;  1W6G A;  1S5A A;  5LC7 A;  3CCS 3;  3LML A;  1E97 A;  1QAL A;  3CU3 A;  3LTC A;  2GXF A;  1N8R 4;  3GZX B;  2GBX B;  1N8Q A;  1Q40 B;  3S27 A;  3CNM A;  1UUW B;  3KKG A;  3NQY A;  1IDP A;  1QAK A;  2KCD A;  1YJN 3;  3CC7 3;  3NM7 A;  4CDL A;  5EQL A;  1TU5 A;  2BHM A;  3KSE D;  3T8N A;  3S29 A;  4KFF A;  2XFS A;  1GS3 A;  5FGO A;  3QK9 A;  1EA2 A;  3U97 A;  1WMP A;  4EC6 A;  1ULJ B;  1GY7 A;  2UX0 A;  3X3Y A;  1E3V A;  3NBJ A;  5CXO A;  1Q7Y 4;  2YFL B;  3HIG A;  3X3X A;  2CW9 A;  2F86 B;  5IG3 A;  3CPW 2;  4JRF A;  2XH9 A;  3MPH A;  4QWT A;  5IEN A;  2CFL A;  3MG3 A;  2QGU A;  4EV5 A;  2CHC A;  2YFI B;  4J8T A;  4O2H A;  3UL6 A;  1NDO B;  3DZL A;  3FSD A;  5HGR A;  3RGR A;  2W2C A;  1ZO2 A;  3SOA A;  2W9Q A;  1UI7 A;  3VSY A;  1VQ8 3;  1W5Z A;  3B7C A;  2P0X A;  3STD A;  5D83 A;  4EXR A;  4R80 A;  3UL5 A;  3N9H A;  4XBT A;  5AIF A;  2P38 A;  1DMN A;  3H3H A;  1SIH A;  3NM2 A;  3I55 3;  1DVD A;  3CME 3;  1O7G B;  3K5T A;  5AYR B;  3L0R A;  3NV0 A;  3PCR A;  4IPB A;  2E2U A;  3CMA 3;  1O7W B;  4HM1 B;  3OWS A;  1TFK A;  1IVW A;  2BT3 A;  1Q86 4;  3DMC A;  5IG5 A;  3SED A;  3F40 A;  4STD A;  4RZM A;  1O7H B;  1WQL B;  3EE1 A;  3EX9 A;  2Z76 A;  3NV0 B;  3IJE B;  4GL6 A;  3J7Y d;  5FW5 A;  3NBB A;  1RN7 A;  1VZZ A;  3KZT A;  2INX A;  3MYT A;  1YIJ 3;  3F7S A;  3HZP A;  4MMZ B;  1NJI 4;  2CWU A;  1AVK A;  4N6O B;  3GZY B;  3GRD A;  4K1U A;  4WFO A;  4HM7 B;  1UUV B;  1TUH A;  2CIU A;  4BTX A;  2L4V A;  2GEY A;  2HMN B;  3SLU A;  1JN5 A;  2CFD A;  5KP4 A;  4R9K A;  3HX8 A;  5BXQ A;  1OCV A;  1MNL A;  1CQS A;  2IUK A;  4HM0 B;  4EV2 A;  3B4P A;  4FMB A;  1GY6 A;  1JKG A;  1FGQ A;  1JN5 B;  2BMO B;  5AYS C;  2OQE A;  3CCM 3;  1K9M 4;  1EG9 B;  4N6N B;  4LMI A;  3ER7 A;  4NRE A;  3VF1 A;  3GWR A;  1U8C B;  4FMA A;  2C10 A;  1R4C A;  1VQ7 3;  2OTJ 3;  2MF7 A;  3DY5 A;  4FMC A;  5KP1 A;  3G16 A;  2QIY A;  5G2G A;  1OAC A;  1ZX2 A;  4O3V A;  5IER A;  1IVU A;  5IW9 A;  1YIT 3;  4KFE A;  3FG4 A;  1F8N A;  1N9E A;  4U13 A;  4BTY A;  2I9W A;  1IV7 A;  2OQE C;  4X2O A;  2XSH B;  4HM6 B;  1LNH A;  3NX0 A;  1IV9 A;  1Y4K A;  3HII A;  2IMJ A;  1OHO A;  4HZB B;  4ZM8 A;  4HKV B;  3SX1 A;  2KXG A;  3BNB A;  4HM5 B;  4TX4 A;  3KN4 A;  3I0Y A;  4KFD A;  1VQO 3;  4BTW A;  3G0K A;  4HM3 B;  1SQW A;  1NWW A;  1NO3 A;  1W7C A;  1GYB A;  3M8C A;  3DXO A;  3KE7 A;  3GZB A;  5LC6 A;  3F9S A;  3CC2 3;  1M1K 4;  1CYU A;  2CFG A;  2M7O A;  2PZV A;  2KRT A;  1RRL A;  3HK4 A;  3LZA A;  2FNQ A;  1KD1 4;  5IG0 A;  1KC8 4;  2E2T A;  3D9R A;  1YVB I;  1YJW 3;  2HMM B;  3V98 A;  2OCT A;  2W56 A;  1EQK A;  1M1X B;  3V99 A;  1NB5 I;  2ZDJ A;  2CFW A;  3GAX A;  4H3U A;  8CHO A;  3FGY A;  3NXJ A;  1CEW I;  4R1K A;  2D42 A;  5ELU A;  2JQ5 A;  5AII A;  3BLZ A;  3NQZ A;  1S72 3;  5AEU B;  1ROV A;  3NBR A;  2W56 B;  1VQN 3;  1CYV A;  3G71 3;  1OHP A;  3F7X A;  1HKX A;  3FF0 A;  3FH1 A;  3G4S 3;  7STD A;  1W2B 2;  1OH0 A;  1VQ9 3;  4R9L A;  1O7P B;  3CCL 3;  2P05 A;  1W4N A;  1Q81 4;  2YFJ B;  4LEH A;  2GU3 A;  1MOL A;  3BB9 A;  5AIH A;  3KFQ C;  3V92 A;  4FCZ A;  3FCS B;  4ORL A;  1UW1 A;  4PEJ A;  2SBL A;  5A0O B;  4MMX B;  4I4K A;  2FXT A;  2XR8 B;  3Q1C A;  4CCV A;  5I97 A;  1OGX A;  4L7K A;  2BO9 B;  1A67 A;  1JV2 B;  2XGL A;  2Z77 A;  4O8S A;  1YGE A;  4HBR A;  5JPU A;  1A2K A;  1SJW A;  2MC8 A;  1YHQ 3;  1Q82 4;  2XEP A;  3JUN A;  5DRE A;  3PCS A;  1GD3 A;  1D6U A;  3MG1 A;  4FCM A;  1N5H A;  3X41 A;  2V1L A;  1VQ5 3;  3EBT A;  3UB1 A;  1TP6 A;  3UJM A;  2D1W A;  3EBY A;  1AR0 A;  1L5G B;  1JRQ A;  1FGT A;  3F8H A;  4N6T A;  5IEP A;  3CC4 3;  1AV4 A;  4R4K A;  4MMY B;  1QVG 2;  3T0U A;  4FMD A;  2XF3 A;  2HMJ B;  1ISK A;  1OF5 A;  1DYU A;  2CG1 A;  2RCD A;  1N9J A;  2GBW B;  2YX9 A;  3X3Z A;  3ALA A;  4AKZ A;  1VQ6 3;  2JDI H;  4OVM A;  1EKM A;  4FR9 A;  4GB5 A;  3TDG A;  1N5P A;  4NHF A;  3T8U A;  1V74 A;  3EQQ B;  4K61 A;  3NHX A;  3K7C A;  4L8P A;  4XDV A;  4IIA A;  1OF5 B;  1NU3 A;  3X42 A;  3CCV 3;  3DUK A;  1WMN A;  2K54 A;  4X2H A;  3VGN A;  2RFR A;  1K8A 4;  5IEO A;  3BNE A;  4Q53 A;  2Y74 A;  3LT9 A;  3EF8 A;  4IT7 A;  1OPY A;  3Q90 A;  2CWV A;  1IVV A;  2LQV A;  5D81 A;  2STD A;  2Y73 A;  4EYC A;  2IA7 A;  3RDE A;  2RGQ A;  1RRH A;  3DGM A;  4RNY A;  1RKY A;  1VQM 3;  2CKF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...