3MHEA

Crystal structure of ketosteroid isomerase p39a from pseudomonas testosteroni (tksi)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
120
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-Isomerase
publication title Crystal Structure of Ketosteroid Isomerase P39A from Pseudomonas Testosteroni (tKSI)
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 31
structure length 120
sequence length 124
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3mheA00
1ULIB 3EBTA 1Q40B 2HMKB 3NXJA 1OHSA 5KP1A 5EVHA 5CLKA 2Z77A 5BXQA 4XBXA 3F8HA 3UNLA 2BMRB 5AI1A 3KSPA 3B8LA 3EQQB 3EN8A 1OUNA 3DUKA 2GEXA 3DMCA 3OV4A 5JPUA 3KZTA 5JPPA 3F9SA 5AEUB 3NV0A 1NWWA 1U5OA 1NDOB 5TGNA 3MSOA 1OHPA 4XM4A 5BVBA 1ZO2A 1K41A 5CXOA 3FKAA 2INXA 2GBXB 1VZZA 2F86B 1ZX2A 3SEDA 1OHOA 1NU3A 1OCVA 2CKFB 1DMQA 2BMQB 1OF5B 2YFLB 3LYGA 5IG0A 3T8UA 3CPOA 3GZXB 4L8PA 2BMOB 1DMNA 3NBRA 5KP3A 4IIAA 1E3VA 4MJDA 4FCJA 1JN5A 2K54A 3VGNA 1OH0A 3JUNA 3MG1A 3NM2A 4Q53A 3Q90A 4HM3B 4X2OA 3F7SA 5G2GA 5HGRA 1W6YA 1UUVB 3STDA 3OXAA 3DM8A 4HM2B 3GZBA 3SOYA 1BUQA 1EG9B 3FGYA 1W02A 4HM0B 3UJMA 3WMDA 2XRXB 2HMLB 4HVNA 2GBWB 1ASKA 3OWSA 3EHCA 1O7MB 2B1XB 1JKGB 3FLJA 3GZYB 2RFRA 3EX9A 4OVMA 3EN1B 3FZWA 4LGQA 1JB4A 3MG2A 3I0YA 2UX0A 3VSYA 4HM4B 3OWUA 4WWUC 2F98A 4I4KA 1W01A 1GY7A 3G0KA 1A2KA 2XSOB 5IF6A 2F99A 1HKXA 3MYTA 4ORLA 1OPYA 2R4IA 5DREA 3FF0A 3B4PA 2OWPA 4WP5A 3EC9A 3EF8A 1GY6A 4R9KA 3ROBA 5IENA 3F14A 2YFIB 3K7CA 3LZAA 3CU3A 3K0ZA 4WYKA 3GWRA 4STDA 1Q40A 2RCDA 1ISKA 3HX8A 4N3VA 4J9AA 2HMOB 4HM8B 4U13A 1O7GB 5IG5A 2HMMB 3NUVA 1E3RA 3DXOA 3F7XA 4R9LA 1UUWB 1O7HB 4L8OA 1GS3A 4L7KA 3A76A 1QMAA 3JUPA 3G16A 3OWYA 4J8TA 5D82A 4XB5A 3FSDA 4XDVA 4PEJA 4HZ9B 3H3HA 2RGQA 4HM1B 4HM7B 3S5CA 3BB9A 1IDPA 5CK6A 5D81A 2IMJA 3E99A 1DMMA 3T8NA 3KKGA 1TUHA 4OUQA 3B7CA 2B24B 3FH1A 3NV0B 3D9RA 2Z7AA 3ECFA 3JUQA 1OF5A 3FF2A 2PZVA 3CNMA 2JQ5A 5IEPA 4CDLA 4LMIA 1SJWA 4HKVB 5IEOA 4K1VA 3EBYA 2XSHB 6STDA 5STDA 3KE7A 1OGZA 3HZPA 1WQLB 3MKIA 5AIGA 2W2CA 1GYBA 4FCMA 3MG3A 3EJVA 1GY5A 4R1KA 5AIFA 4HJLB 5AEWB 1QJGA 3SOAA 3RGRA 4RZMA 4HM5B 2CHCA 1O7PB 5AIHA 1JN5B 3F40A 3JUMA 4GB5A 5IG4A 1O7WB 4HZBB 2QGUA 5FW5A 1EA2A 3GRDA 5CF2A 2Z76A 2YFJB 1JKGA 1C7HA 2HMNB 1AR0A 1O7NB 4XBTA 1Q42A 1S5AA 5DRVA 5D83A 1W00A 7STDA 1OGXA 5AIIA 3OX9A 1CQSA 1JB5A 4X2HA 3NHXA 3DZLA 3RGAA 5IG3A 4K1UA 3F8XA 2I9WA 3G8ZA 3H51A 5IERA 4LEHA 3IPTA 4HM6B 3CNXA 2A15A 3JUOA 2BNGA 1E97A 1Z1SA 4XBYA 1JB2A 2GEYA 1STDA 5KP4A 4KVHA 3MHEA 3GZRA 4H3UA 8CHOA 2STDA 3ER7A 2HMJB 2QIYA 3BLZA 3B4OA 3HK4A 5CF1A 1TP6A 2GXFA 1ULJB 2XR8B 3M8CA 4WYKB 4XDWA
chains in the Genus database with same CATH superfamily
1I3IA 1STFI 1ULIB 2J8XB 3EBTA 1Q40B 3NQZA 5ELUA 2HMKB 1AVKA 1RN7A 1TFKA 2OQEC 3NXJA 3G713 1RN4A 4KT3B 1OHSA 2KF5A 1IVVA 1IQXA 3BNBA 3QRDA 5KP1A 1VQ93 5EVHA 5CLKA 2Z77A 3EB8A 1RGLA 5BXQA 5GSPA 2CK3H 3AMOB 3DGMA 2CW9A 4XBXA 1BIRA 3F8HA 1EQKA 3UNLA 2BMRB 1RMSA 1CEWI 1LOVA 2O3OA 1FA3A 5AI1A 3KSPA 1JNQA 1RTUA 3SYUA 4OK0A 3CD63 3CCR3 1UW1A 4N6UA 4CCVA 1RKYA 3B8LA 3D3LA 3EQQB 3EN8A 1OUNA 1SARA 3DGOA 3DUKA 2GEXA 4N6NB 5LC6A 3J7Yd 1SIHA 1U8CB 2KF3A 3DMCA 3OV4A 3AHSA 3CME3 4O8SA 5JPUA 1KSIA 4DKIA 4O2HA 1RGKA 4AEQA 3KZTA 3S29A 3WOFB 3F9SA 3ZG5A 5JPPA 1JJ22 5AEUB 1VQP3 7GSPA 1BNIA 4N6V0 1L5GB 1D6YA 1V58A 1FGTA 1QALA 3CCU3 2E2TA 3S67A 2ZDJA 3LTBA 3NV0A 1NWWA 2Y73A 1JBSA 1YGWA 1OACA 2OQEA 1JRQA 1IK3A 2OCTA 6RNTA 1R4YA 1U5OA 4GSPA 2CFKA 5JBSA 1GOVA 1NDOB 1IQ8A 3CCV3 1TU5A 1YGEA 3N9HA 1RJOA 1FUWA 2UUGC 3UL6A 5TGNA 1RCLA 1W4NA 2C10A 2P05A 3RDEA 3MSOA 2CG1A 1OHPA 4XM4A 5EQLA 3WR2A 3BIRA 1ZO2A 5BVBA 4HOHA 2WGQA 1K41A 2CFGA 5CXOA 6GSPA 3FKAA 1G02A 2INXA 3K5TA 2GBXB 4MEIA 1US1A 3HOHA 1S723 1VZZA 2CG0A 4LYLB 2F86B 1I0XA 3PXMA 1ZX2A 2D1WA 1T2HA 1IVWA 1Y4KA 2H0IA 1OHOA 1NU3A 2CFDA 3SEDA 1OCVA 2CKFB 1DMQA 3D5IA 3KSED 4EXRA 3S27A 2BMQB 2CWTA 1D6UA 1FGRA 1HYFA 1OF5B 4J5GA 1W5ZA 2YFLB 3LYGA 3HI7A 5IG0A 3T8UA 4EV2A 1PU4A 3CPOA 3DGYA 3GZXB 5G1LA 4L8PA 1BUJA 1JZDA 2BMOB 1T3BA 3BNCA 1MNLA 1DMNA 3NBRA 1BAOA 3NQYA 2AADA 5KP3A 1GD3A 2W6JH 4IIAA 1E3VA 4MJDA 2Z6BA 2CFLA 3CC23 1UCIA 1YJW3 1BSDA 2BT3A 1JBRA 5I97A 3V98A 4FCJA 1RGEA 1JN5A 2YX9A 4ILFA 4R4KA 2K54A 2ZL8A 1EUIC 2KRTA 3VGNA 1OH0A 3N8BA 4EV5A 5HOHA 1UUGB 2XGNA 1NO3A 4O3VA 3DGNA 3JUNA 1UDII 1RDSA 1Q9EA 3MG1A 1JBTA 5M18A 1Q864 3NM2A 4Q53A 2R41A 3Q90A 2KCDA 3JVCA 3KN4A 4FMBA 4HM3B 4X2OA 1TRQA 3F7SA 5G2GA 1W6YA 5HGRA 3VF1A 3WOEB 2F5MA 4MMYB 2IY2A 1T2IA 1IT8A 1B3SA 1UUVB 3STDA 3CCM3 1X1YA 3OXAA 2P0MA 3DM8A 3FG1A 4HM2B 3GZBA 3NX0A 1LOWA 3SOYA 2FGTA 3ZG0A 1BUQA 1I2EA 1EG9B 1FGMA 3FGYA 1IVUA 1W02A 4HM0B 3UJMA 3WMDA 2IUKA 3LOYA 1BRNL 2XRXB 2HMLB 4HVNA 2GBWB 2L4VA 4NHFA 1ASKA 3OWSA 3X41A 3EHCA 4NREA 1LOXA 3N54B 4RBNA 1M1K4 4FCZA 1O7MB 3KFQC 2B1XB 1ZGXA 1N8R4 3HIGA 1EEJA 1JKGB 1N8QA 1ROVA 3FLJA 3D5GA 1YIT3 1QVG2 2W9PA 3GZYB 4FMAA 3SXXA 3WDGB 1MWTA 1SPUA 2RFRA 3UB1A 2OOVC 4HAAA 3EX9A 4O02B 4FR9A 4OVMA 1MOLA 2MF7A 3EN1B 1M1XB 1BU4A 3FZWA 4LGQA 1JB4A 1FUSA 1RNBA 3MG2A 1LOYA 1NB3I 3I0YA 5ELJA 3U1WA 2GU1A 2UX0A 4MMXB 3VSYA 4HM4B 2CWUA 1W2ZA 1BANA 3NBJA 1KC84 1JV2B 4GL6A 3SLUA 4K90B 1YI23 1KWIA 3OWUA 2GU3A 1WMPA 2F4YA 4WWUC 1BRHA 2F98A 4I4KA 2W56B 1AVLA 1W01A 1GY7A 1K734 3MWZA 3G0KA 1CH0A 1VQ43 1W6GA 1A2KA 2P0XA 2XSOB 4MMZB 5IF6A 2F99A 1HKXA 3MYTA 4ORLA 3ALAA 3WA2X 4EYCA 1TRPA 3SVAA 1OPYA 2R4IA 5DREA 9RNTA 1UGHI 2LQVA 3FF0A 2KF6A 3K9MC 5EEOA 3B4PA 2OWPA 2MC8A 1VQL3 4WP5A 3EC9A 1CYUA 3EF8A 2F56A 2WGOA 1GY6A 1B2XA 4R9KA 2Y74A 2RSXA 2CX1A 1GD4A 1WMOA 4JF8A 1FYSA 3ROBA 3WA3A 2W9QA 2OOVA 1LNIA 5IENA 1M9GA 1VQK3 1UCKA 3F14A 2CH9A 2CIUA 2ML6A 3OW22 2YFIB 3K7CA 3UL5A 3LZAA 1GMRA 3CU3A 3K0ZA 1BGSA 2RBIA 4WYKA 4EC6A 3GWRA 2E2VA 1G0TA 4STDA 3O8YA 1TFOA 1RNTA 1Q40A 2RCDA 1I70A 1UI7A 2K0MA 1G96A 2KAAA 1ISKA 1BSEA 3HX8A 4KZ1A 4J9AA 1LQGC 2AAEA 1EKMA 1SQWA 2HOHA 4N3VA 2HMOB 1LVNA 1GMPA 3NBBA 4HM8B 4U13A 3AMOA 1O7GB 4BTYA 2XF3A 5IG5A 1GOUA 3Q3FA 2Q07A 4H61A 2HMMB 1MGRA 1E3RA 1IVXA 3NUVA 2BU4A 2XGLA 1YJN3 1TJDA 1TTOA 2QA43 3DXOA 3LT8A 5BIRA 3CCL3 3F7XA 2C11A 1BOXA 1N5PA 4WFOA 2CFWA 4R80A 4R9LA 1UUWB 1O7HB 4L8OA 3ZFZA 4CPKA 5M19A 1PFPA 2WOFA 5IW9A 1GS3A 1DVCA 4L7KA 3A76A 1Q824 1QMAA 1FZUA 2P38A 3GAXA 3JUPA 1B21A 1B2UA 1W6CA 1B20A 3Q2PA 3G16A 5M1AA 1Q7Y4 3QK9A 5G1KA 3BNDA 3OWYA 1T5YA 4J8TA 5D82A 1DE3A 4KFDA 4XB5A 3FSDA 5BU4A 2W04A 4XDVA 3CCJ3 3LXUX 1R4CA 4PEJA 4HZ9B 3H3HA 3X40A 2RGQA 4HM1B 4HM7B 3S5CA 4JRFA 1BRKA 3BB9A 1IDPA 3HIIA 1LQMB 2KXGA 3X3XA 1IV9A 5CK6A 5D81A 2IMJA 1RGHA 1IQYA 2IUJA 5AYSC 3E99A 3V92A 1IYYA 1BNGA 1BRGA 1DMMA 2F5WA 3KKGA 1TUHA 3T8NA 4HBRA 1V57A 4G1MB 4OUQA 2QEX3 1IV7A 3LMLA 3B7CA 1B27A 2B24B 3LT9A 3CCQ3 5FGOA 3CCE3 3FH1A 4TX4A 1ROAA 3NV0B 3FCSB 1B2SA 2FNQA 2BHMA 3BU4A 3D9RA 2Z7AA 1W7CA 3AHWA 2O9UX 1RRHA 3BNEA 3V99A 3CC73 2H0GA 1MWUA 1RGFA 3ECFA 4N6TA 1J2BA 3JUQA 4RNZA 1IU7A 1OF5A 3FF2A 3X3YA 3D79A 1BNFA 1FUTA 1UCJA 2PZVA 3CNMA 3PCRA 3RNTA 2JQ5A 5IEPA 1YVBI 1ZS7A 4CDLA 1B2MA 4LMIA 1MWRA 1SJWA 1I2FA 4LZIA 3I563 1V74A 2OTL3 3U97A 1VQ53 4HKVB 5A0OB 2IYJA 1RRLA 5IEOA 4IPBA 4K1VA 4EBGA 1RN1A 3EBYA 4N6LA 2XSHB 3G6E3 6STDA 1X1WA 5STDA 1Q814 3LTCA 3KE7A 1AV4A 1OGZA 1RGGA 3HZPA 1WQLB 3MKIA 5AIGA 2W2CA 3LTAA 2ML5A 4I5QA 1GYBA 4FCMA 4GHOA 4KFFA 4KFEA 1VQ63 3MG3A 3EJVA 1GY5A 1MGWA 4R1KA 1GSPA 5AIFA 3KCHA 4HJLB 2BIRA 4AKZA 2XEPA 5AEWB 2M7OA 1SIIA 1QJGA 1DYUA 1M904 1BNRA 2SBLA 1A67A 3FG3A 3X3ZA 3RGRA 4RZMA 3SOAA 1BSCA 1BRJA 1BNSA 5AYRB 4HM5B 2CHCA 3PCSA 3I553 1MWSA 1UI8A 1VQN3 4BIRA 1O7PB 2UGIA 5AIHA 4CJNA 3DGLA 1JN5B 2CX0A 2XH9A 3PZWA 1YJ93 4BU4A 1N9EA 3F40A 3JUMA 4N6MA 4GB5A 5IG4A 1K9M4 4EW5A 4BL2A 1GOYA 2BO9B 1BVIA 3AGNA 1HZ1A 1B2ZA 1O7WB 1GMQA 1IT7A 1JZOA 1UCLA 2QGUA 4HZBB 5FW5A 1I3FA 1EA2A 1LNHA 5RNTA 1C54A 1FGQA 3WHOA 4QWTA 1I2GA 2H0HA 2P09A 1BSAA 1PYLA 3GRDA 1X1XA 5CF2A 3FG4A 2Z76A 2YFJB 1JKGA 2XFTA 2JDIH 3DY5A 1C7HA 2WO0A 2CWVA 1A2PA 2GSPA 3PS8A 1W2B2 2PNCA 2HMNB 1KD14 1AR0A 1O7NB 1WMNA 3EE1A 2FXTA 1NNVA 2IA7A 1VQ83 7RNTA 3K63A 4XBTA 1Q42A 1WTHA 4J5KA 3LH4A 1X1UA 3NM7A 2SARA 3MPHA 4HYZA 2WOHA 1S5AA 5DRVA 3CMA3 5D83A 1W00A 3URPA 8RNTA 3CPW2 1VQO3 2K3DA 7STDA 1OGXA 1UGIA 2D42A 1RLSA 2L1SA 3IMAB 3KIIA 4WHAA 2W56A 5AIIA 4IT7A 2KF4A 1RSNA 1QVF2 3CCS3 3OX9A 1CQSA 1FGOA 1AY7A 1CYVA 3TDGA 1BNJA 1JB5A 3T0UA 1NJI4 1VQ73 1Q7HA 4X2HA 3NHXA 1YNVX 2V1LA 1LXEA 3DH2A 3DZLA 4RNTA 3RGAA 5IG3A 1RHLA 3F8XA 2I9WA 4K1UA 1FW7A 1QAFA 4XDWA 1DETA 2C4BA 3G8ZA 1DVDA 3H51A 5IERA 1VQM3 4LEHA 3PYJA 2W0QA 1RGAA 2CC3A 3CXC2 3IPTA 1AQZA 5LC7A 3S28A 1K28A 4HM6B 1N5HA 2XFSA 3X42A 1WNHA 3CNXA 3WODG 3G4S3 1A2VA 1K8A4 2OTJ3 2A15A 2W03A 4FMCA 3JUOA 1BRIA 1HU9A 2E2UA 2BNGA 1I8VA 1YIJ3 1E97A 1QAKA 3Q1CA 1BRSA 2ZA4A 2LYXA 3AGOA 4XBYA 1JB2A 2RNTA 3A5EA 1D6ZA 1N9JA 1NB5I 2GEYA 1STDA 4RNYA 3L0RA 5KP4A 1VQQA 4KVHA 3MHEA 3D4AA 3PGBA 3GZRA 4BTWA 4H3UA 4ZM8A 3IJEB 8CHOA 1RGCA 2STDA 3SX1A 3ER7A 1YVSA 1F8NA 1LRAA 2HMJB 2QIYA 1TIJA 3BLZA 4LSOA 1YHQ3 4AKYA 3B4OA 3HK4A 5CF1A 1TP6A 4BTXA 1BSBA 2GXFA 3GSPA 4BL3A 1PY3A 4N6OB 1KQS2 1ULJB 2XR8B 3LTDA 4NPBA 1I0VA 4FMDA 3CC43 3M8CA 1RCKA 1BNEA 4WYKB 1A90A 1Z1SA 4K61A 2ZHXB
chains in the Genus database with same CATH topology
1STFI 1ULIB 3EBTA 1Q40B 3NQZA 5ELUA 2HMKB 1AVKA 1RN7A 1TFKA 2OQEC 3NXJA 3G713 1OHSA 1IVVA 1IQXA 3BNBA 3QRDA 5KP1A 1VQ93 5EVHA 5CLKA 2Z77A 3EB8A 5BXQA 2CK3H 3AMOB 3DGMA 2CW9A 4XBXA 3F8HA 1EQKA 3UNLA 2BMRB 1CEWI 2O3OA 1FA3A 5AI1A 3KSPA 1JNQA 4OK0A 3CD63 3CCR3 1UW1A 4N6UA 4CCVA 1RKYA 3B8LA 3D3LA 3EQQB 3EN8A 1OUNA 3DGOA 3DUKA 3J7Yd 2GEXA 4N6NB 5LC6A 1SIHA 1U8CB 3DMCA 3OV4A 3CME3 4O8SA 5JPUA 1KSIA 4O2HA 1VQL3 4AEQA 3KZTA 3S29A 3WOFB 3F9SA 5JPPA 5AEUB 1VQP3 4N6V0 1L5GB 1D6YA 1FGTA 1QALA 3CCU3 2E2TA 3S67A 2ZDJA 3LTBA 3NV0A 1NWWA 2Y73A 1OACA 2OQEA 1JRQA 1IK3A 2OCTA 1U5OA 2CFKA 5JBSA 1NDOB 1IQ8A 3CCV3 1TU5A 1YGEA 3N9HA 1RJOA 1FUWA 3UL6A 5TGNA 1W4NA 2C10A 2P05A 3RDEA 3MSOA 2CG1A 1OHPA 4XM4A 5EQLA 5BVBA 1ZO2A 2WGQA 1K41A 2CFGA 5CXOA 3FKAA 2INXA 3K5TA 2GBXB 4MEIA 1US1A 1S723 1VZZA 2CG0A 2F86B 3PXMA 1ZX2A 2D1WA 1JJ22 1IVWA 1Y4KA 3SEDA 1OHOA 1NU3A 2CFDA 1OCVA 2CKFB 1DMQA 3KSED 4EXRA 3S27A 2BMQB 2CWTA 1D6UA 1FGRA 1OF5B 1W5ZA 2YFLB 3LYGA 3HI7A 5IG0A 3T8UA 4EV2A 1PU4A 3CPOA 3GZXB 4L8PA 2BMOB 3BNCA 1MNLA 1DMNA 3NBRA 3NQYA 5KP3A 1GD3A 2W6JH 4IIAA 1E3VA 4MJDA 2Z6BA 2CFLA 3CC23 1YJW3 2BT3A 5I97A 3V98A 4FCJA 1JN5A 2YX9A 4R4KA 2K54A 2ZL8A 2KRTA 3VGNA 1OH0A 3N8BA 4EV5A 2XGNA 1NO3A 4O3VA 3DGNA 3JUNA 3MG1A 1Q864 3NM2A 4Q53A 3Q90A 2KCDA 3JVCA 3KN4A 4FMBA 4HM3B 4X2OA 3F7SA 5G2GA 5HGRA 1W6YA 3VF1A 3WOEB 4MMYB 1IT8A 1UUVB 3STDA 3CCM3 3OXAA 2P0MA 3DM8A 3FG1A 4HM2B 3GZBA 3NX0A 3SOYA 1BUQA 2FGTA 1EG9B 1FGMA 3FGYA 1IVUA 1W02A 4HM0B 3UJMA 3WMDA 2IUKA 3LOYA 2XRXB 2HMLB 4HVNA 2GBWB 2L4VA 4NHFA 1ASKA 3OWSA 3X41A 3EHCA 4NREA 1LOXA 3N54B 4RBNA 1M1K4 4FCZA 1O7MB 3KFQC 2B1XB 1N8R4 3HIGA 1JKGB 1N8QA 1ROVA 3FLJA 1YIT3 1QVG2 2W9PA 3GZYB 4FMAA 3SXXA 3WDGB 1SPUA 2RFRA 3UB1A 2OOVC 3EX9A 4O02B 4FR9A 4OVMA 1MOLA 2MF7A 3EN1B 1M1XB 3FZWA 4LGQA 1JB4A 3MG2A 1NB3I 3I0YA 5ELJA 3U1WA 2GU1A 2UX0A 4MMXB 3VSYA 4HM4B 2CWUA 1W2ZA 3NBJA 1KC84 1JV2B 4GL6A 3SLUA 4K90B 1YI23 1KWIA 3OWUA 2GU3A 1WMPA 4WWUC 2F98A 4I4KA 2W56B 1AVLA 1W01A 1GY7A 1K734 3MWZA 3G0KA 1VQ43 1W6GA 1A2KA 2P0XA 2XSOB 4MMZB 5IF6A 2F99A 1HKXA 3MYTA 4ORLA 3ALAA 3WA2X 4EYCA 3SVAA 1OPYA 2R4IA 5DREA 3FF0A 2LQVA 3K9MC 2MC8A 5EEOA 3B4PA 2OWPA 4WP5A 3EC9A 1CYUA 3EF8A 2WGOA 1GY6A 4R9KA 2Y74A 2RSXA 1GD4A 1WMOA 4JF8A 3ROBA 3WA3A 2W9QA 2OOVA 1VQK3 5IENA 1M9GA 3F14A 2CH9A 2CIUA 2ML6A 3OW22 2YFIB 3K7CA 3UL5A 3LZAA 3CU3A 3K0ZA 4WYKA 4EC6A 3GWRA 2E2VA 4STDA 3O8YA 1TFOA 1Q40A 2RCDA 1UI7A 2K0MA 1G96A 1ISKA 3HX8A 4N3VA 4KZ1A 4J9AA 1VQN3 1EKMA 1SQWA 2HMOB 1LVNA 3NBBA 4HM8B 4U13A 3AMOA 1O7GB 4BTYA 2XF3A 5IG5A 2Q07A 4H61A 2HMMB 3NUVA 1E3RA 1IVXA 2XGLA 1YJN3 2QA43 3DXOA 3LT8A 3CCL3 3F7XA 2C11A 1N5PA 4WFOA 2CFWA 4R80A 4R9LA 1UUWB 1O7HB 4L8OA 1PFPA 2WOFA 5IW9A 1GS3A 1DVCA 4L7KA 3A76A 1Q824 1QMAA 2P38A 3GAXA 3JUPA 1W6CA 3Q2PA 3G16A 1Q7Y4 3QK9A 3BNDA 3OWYA 1T5YA 4J8TA 5D82A 4KFDA 4XB5A 3FSDA 2W04A 4XDVA 3CCJ3 3LXUX 1R4CA 4PEJA 4HZ9B 3H3HA 3X40A 2RGQA 4HM1B 4HM7B 3S5CA 4JRFA 3BB9A 1IDPA 3HIIA 2KXGA 3X3XA 1IV9A 5CK6A 5D81A 2IMJA 1IQYA 2IUJA 5AYSC 3E99A 3V92A 1DMMA 3T8NA 3KKGA 1TUHA 4HBRA 4G1MB 4OUQA 2QEX3 1IV7A 3LMLA 3B7CA 2B24B 3LT9A 3CCQ3 5FGOA 3CCE3 3FH1A 4TX4A 1ROAA 3NV0B 3FCSB 2FNQA 2BHMA 3D9RA 2Z7AA 1W7CA 3CC73 2O9UX 1RRHA 3BNEA 3V99A 3ECFA 4N6TA 1J2BA 3JUQA 4RNZA 1IU7A 1OF5A 3FF2A 3X3YA 2PZVA 3CNMA 3PCRA 2JQ5A 5IEPA 1YVBI 4CDLA 4LMIA 1SJWA 4LZIA 3I563 1V74A 2OTL3 3U97A 1VQ53 4HKVB 5A0OB 1RRLA 5IEOA 4IPBA 4K1VA 4EBGA 3EBYA 4N6LA 2XSHB 3G6E3 6STDA 5STDA 1Q814 3LTCA 3KE7A 1AV4A 1OGZA 3HZPA 1WQLB 3MKIA 5AIGA 2W2CA 3LTAA 2ML5A 1GYBA 4FCMA 4KFFA 4KFEA 1VQ63 3MG3A 3EJVA 1GY5A 4R1KA 5AIFA 4HJLB 4AKZA 2XEPA 5AEWB 2M7OA 1SIIA 1QJGA 1DYUA 1M904 2SBLA 1A67A 3FG3A 3X3ZA 3RGRA 4RZMA 3SOAA 5AYRB 4HM5B 2CHCA 3PCSA 3I553 1UI8A 1O7PB 5AIHA 3DGLA 1JN5B 2XH9A 3PZWA 1YJ93 1N9EA 3F40A 3JUMA 4N6MA 4GB5A 5IG4A 1K9M4 2BO9B 3L0RA 1O7WB 4HZBB 1IT7A 2QGUA 5FW5A 1LNHA 1EA2A 1FGQA 4QWTA 2P09A 3GRDA 5CF2A 3FG4A 2Z76A 2YFJB 1JKGA 2XFTA 2JDIH 3DY5A 1C7HA 2WO0A 2CWVA 3PS8A 1W2B2 2PNCA 2HMNB 1KD14 1AR0A 1O7NB 1WMNA 3EE1A 2FXTA 2IA7A 1VQ83 3K63A 4XBTA 1Q42A 1WTHA 3LH4A 3NM7A 3MPHA 4HYZA 2WOHA 1S5AA 5DRVA 3CMA3 5D83A 1W00A 3CPW2 1VQO3 7STDA 1OGXA 2D42A 3IMAB 3KIIA 4WHAA 2W56A 5AIIA 4IT7A 1QVF2 3CCS3 3OX9A 1CQSA 1FGOA 1CYVA 3TDGA 1JB5A 3T0UA 1NJI4 1VQ73 4X2HA 3NHXA 2V1LA 1LXEA 3DZLA 3RGAA 5IG3A 4K1UA 3F8XA 2I9WA 1QAFA 4XDWA 3G8ZA 1DVDA 3H51A 5IERA 1VQM3 4LEHA 3PYJA 2W0QA 2CC3A 3CXC2 3IPTA 3S28A 5LC7A 1K28A 4HM6B 1N5HA 2XFSA 3X42A 1WNHA 3CNXA 3WODG 3G4S3 1A2VA 1K8A4 2OTJ3 2A15A 2W03A 4FMCA 3JUOA 1HU9A 2E2UA 1YIJ3 2BNGA 1E97A 1QAKA 3Q1CA 4XBYA 2LYXA 1JB2A 1D6ZA 1N9JA 1NB5I 2GEYA 1STDA 4RNYA 5KP4A 4KVHA 3MHEA 3PGBA 3GZRA 4H3UA 4ZM8A 3IJEB 8CHOA 2STDA 3SX1A 3ER7A 1F8NA 2HMJB 2QIYA 1TIJA 3BLZA 4LSOA 1YHQ3 4AKYA 3B4OA 3HK4A 5CF1A 1TP6A 4BTXA 2GXFA 4N6OB 1KQS2 1ULJB 2XR8B 3LTDA 4FMDA 3CC43 3M8CA 4WYKB 4BTWA 1Z1SA 4K61A 1A90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULI B;  3EBT A;  1Q40 B;  2HMK B;  3NXJ A;  1OHS A;  5KP1 A;  5EVH A;  5CLK A;  2Z77 A;  5BXQ A;  4XBX A;  3F8H A;  3UNL A;  2BMR B;  5AI1 A;  3KSP A;  3B8L A;  3EQQ B;  3EN8 A;  1OUN A;  3DUK A;  2GEX A;  3DMC A;  3OV4 A;  5JPU A;  3KZT A;  5JPP A;  3F9S A;  5AEU B;  3NV0 A;  1NWW A;  1U5O A;  1NDO B;  5TGN A;  3MSO A;  1OHP A;  4XM4 A;  5BVB A;  1ZO2 A;  1K41 A;  5CXO A;  3FKA A;  2INX A;  2GBX B;  1VZZ A;  2F86 B;  1ZX2 A;  3SED A;  1OHO A;  1NU3 A;  1OCV A;  2CKF B;  1DMQ A;  2BMQ B;  1OF5 B;  2YFL B;  3LYG A;  5IG0 A;  3T8U A;  3CPO A;  3GZX B;  4L8P A;  2BMO B;  1DMN A;  3NBR A;  5KP3 A;  4IIA A;  1E3V A;  4MJD A;  4FCJ A;  1JN5 A;  2K54 A;  3VGN A;  1OH0 A;  3JUN A;  3MG1 A;  3NM2 A;  4Q53 A;  3Q90 A;  4HM3 B;  4X2O A;  3F7S A;  5G2G A;  5HGR A;  1W6Y A;  1UUV B;  3STD A;  3OXA A;  3DM8 A;  4HM2 B;  3GZB A;  3SOY A;  1BUQ A;  1EG9 B;  3FGY A;  1W02 A;  4HM0 B;  3UJM A;  3WMD A;  2XRX B;  2HML B;  4HVN A;  2GBW B;  1ASK A;  3OWS A;  3EHC A;  1O7M B;  2B1X B;  1JKG B;  3FLJ A;  3GZY B;  2RFR A;  3EX9 A;  4OVM A;  3EN1 B;  3FZW A;  4LGQ A;  1JB4 A;  3MG2 A;  3I0Y A;  2UX0 A;  3VSY A;  4HM4 B;  3OWU A;  4WWU C;  2F98 A;  4I4K A;  1W01 A;  1GY7 A;  3G0K A;  1A2K A;  2XSO B;  5IF6 A;  2F99 A;  1HKX A;  3MYT A;  4ORL A;  1OPY A;  2R4I A;  5DRE A;  3FF0 A;  3B4P A;  2OWP A;  4WP5 A;  3EC9 A;  3EF8 A;  1GY6 A;  4R9K A;  3ROB A;  5IEN A;  3F14 A;  2YFI B;  3K7C A;  3LZA A;  3CU3 A;  3K0Z A;  4WYK A;  3GWR A;  4STD A;  1Q40 A;  2RCD A;  1ISK A;  3HX8 A;  4N3V A;  4J9A A;  2HMO B;  4HM8 B;  4U13 A;  1O7G B;  5IG5 A;  2HMM B;  3NUV A;  1E3R A;  3DXO A;  3F7X A;  4R9L A;  1UUW B;  1O7H B;  4L8O A;  1GS3 A;  4L7K A;  3A76 A;  1QMA A;  3JUP A;  3G16 A;  3OWY A;  4J8T A;  5D82 A;  4XB5 A;  3FSD A;  4XDV A;  4PEJ A;  4HZ9 B;  3H3H A;  2RGQ A;  4HM1 B;  4HM7 B;  3S5C A;  3BB9 A;  1IDP A;  5CK6 A;  5D81 A;  2IMJ A;  3E99 A;  1DMM A;  3T8N A;  3KKG A;  1TUH A;  4OUQ A;  3B7C A;  2B24 B;  3FH1 A;  3NV0 B;  3D9R A;  2Z7A A;  3ECF A;  3JUQ A;  1OF5 A;  3FF2 A;  2PZV A;  3CNM A;  2JQ5 A;  5IEP A;  4CDL A;  4LMI A;  1SJW A;  4HKV B;  5IEO A;  4K1V A;  3EBY A;  2XSH B;  6STD A;  5STD A;  3KE7 A;  1OGZ A;  3HZP A;  1WQL B;  3MKI A;  5AIG A;  2W2C A;  1GYB A;  4FCM A;  3MG3 A;  3EJV A;  1GY5 A;  4R1K A;  5AIF A;  4HJL B;  5AEW B;  1QJG A;  3SOA A;  3RGR A;  4RZM A;  4HM5 B;  2CHC A;  1O7P B;  5AIH A;  1JN5 B;  3F40 A;  3JUM A;  4GB5 A;  5IG4 A;  1O7W B;  4HZB B;  2QGU A;  5FW5 A;  1EA2 A;  3GRD A;  5CF2 A;  2Z76 A;  2YFJ B;  1JKG A;  1C7H A;  2HMN B;  1AR0 A;  1O7N B;  4XBT A;  1Q42 A;  1S5A A;  5DRV A;  5D83 A;  1W00 A;  7STD A;  1OGX A;  5AII A;  3OX9 A;  1CQS A;  1JB5 A;  4X2H A;  3NHX A;  3DZL A;  3RGA A;  5IG3 A;  4K1U A;  3F8X A;  2I9W A;  3G8Z A;  3H51 A;  5IER A;  4LEH A;  3IPT A;  4HM6 B;  3CNX A;  2A15 A;  3JUO A;  2BNG A;  1E97 A;  1Z1S A;  4XBY A;  1JB2 A;  2GEY A;  1STD A;  5KP4 A;  4KVH A;  3MHE A;  3GZR A;  4H3U A;  8CHO A;  2STD A;  3ER7 A;  2HMJ B;  2QIY A;  3BLZ A;  3B4O A;  3HK4 A;  5CF1 A;  1TP6 A;  2GXF A;  1ULJ B;  2XR8 B;  3M8C A;  4WYK B;  4XDW A; 
#chains in the Genus database with same CATH topology
 1I3I A;  1STF I;  1ULI B;  2J8X B;  3EBT A;  1Q40 B;  3NQZ A;  5ELU A;  2HMK B;  1AVK A;  1RN7 A;  1TFK A;  2OQE C;  3NXJ A;  3G71 3;  1RN4 A;  4KT3 B;  1OHS A;  2KF5 A;  1IVV A;  1IQX A;  3BNB A;  3QRD A;  5KP1 A;  1VQ9 3;  5EVH A;  5CLK A;  2Z77 A;  3EB8 A;  1RGL A;  5BXQ A;  5GSP A;  2CK3 H;  3AMO B;  3DGM A;  2CW9 A;  4XBX A;  1BIR A;  3F8H A;  1EQK A;  3UNL A;  2BMR B;  1RMS A;  1CEW I;  1LOV A;  2O3O A;  1FA3 A;  5AI1 A;  3KSP A;  1JNQ A;  1RTU A;  3SYU A;  4OK0 A;  3CD6 3;  3CCR 3;  1UW1 A;  4N6U A;  4CCV A;  1RKY A;  3B8L A;  3D3L A;  3EQQ B;  3EN8 A;  1OUN A;  1SAR A;  3DGO A;  3DUK A;  2GEX A;  4N6N B;  5LC6 A;  3J7Y d;  1SIH A;  1U8C B;  2KF3 A;  3DMC A;  3OV4 A;  3AHS A;  3CME 3;  4O8S A;  5JPU A;  1KSI A;  4DKI A;  4O2H A;  1RGK A;  4AEQ A;  3KZT A;  3S29 A;  3WOF B;  3F9S A;  3ZG5 A;  5JPP A;  1JJ2 2;  5AEU B;  1VQP 3;  7GSP A;  1BNI A;  4N6V 0;  1L5G B;  1D6Y A;  1V58 A;  1FGT A;  1QAL A;  3CCU 3;  2E2T A;  3S67 A;  2ZDJ A;  3LTB A;  3NV0 A;  1NWW A;  2Y73 A;  1JBS A;  1YGW A;  1OAC A;  2OQE A;  1JRQ A;  1IK3 A;  2OCT A;  6RNT A;  1R4Y A;  1U5O A;  4GSP A;  2CFK A;  5JBS A;  1GOV A;  1NDO B;  1IQ8 A;  3CCV 3;  1TU5 A;  1YGE A;  3N9H A;  1RJO A;  1FUW A;  2UUG C;  3UL6 A;  5TGN A;  1RCL A;  1W4N A;  2C10 A;  2P05 A;  3RDE A;  3MSO A;  2CG1 A;  1OHP A;  4XM4 A;  5EQL A;  3WR2 A;  3BIR A;  1ZO2 A;  5BVB A;  4HOH A;  2WGQ A;  1K41 A;  2CFG A;  5CXO A;  6GSP A;  3FKA A;  1G02 A;  2INX A;  3K5T A;  2GBX B;  4MEI A;  1US1 A;  3HOH A;  1S72 3;  1VZZ A;  2CG0 A;  4LYL B;  2F86 B;  1I0X A;  3PXM A;  1ZX2 A;  2D1W A;  1T2H A;  1IVW A;  1Y4K A;  2H0I A;  1OHO A;  1NU3 A;  2CFD A;  3SED A;  1OCV A;  2CKF B;  1DMQ A;  3D5I A;  3KSE D;  4EXR A;  3S27 A;  2BMQ B;  2CWT A;  1D6U A;  1FGR A;  1HYF A;  1OF5 B;  4J5G A;  1W5Z A;  2YFL B;  3LYG A;  3HI7 A;  5IG0 A;  3T8U A;  4EV2 A;  1PU4 A;  3CPO A;  3DGY A;  3GZX B;  5G1L A;  4L8P A;  1BUJ A;  1JZD A;  2BMO B;  1T3B A;  3BNC A;  1MNL A;  1DMN A;  3NBR A;  1BAO A;  3NQY A;  2AAD A;  5KP3 A;  1GD3 A;  2W6J H;  4IIA A;  1E3V A;  4MJD A;  2Z6B A;  2CFL A;  3CC2 3;  1UCI A;  1YJW 3;  1BSD A;  2BT3 A;  1JBR A;  5I97 A;  3V98 A;  4FCJ A;  1RGE A;  1JN5 A;  2YX9 A;  4ILF A;  4R4K A;  2K54 A;  2ZL8 A;  1EUI C;  2KRT A;  3VGN A;  1OH0 A;  3N8B A;  4EV5 A;  5HOH A;  1UUG B;  2XGN A;  1NO3 A;  4O3V A;  3DGN A;  3JUN A;  1UDI I;  1RDS A;  1Q9E A;  3MG1 A;  1JBT A;  5M18 A;  1Q86 4;  3NM2 A;  4Q53 A;  2R41 A;  3Q90 A;  2KCD A;  3JVC A;  3KN4 A;  4FMB A;  4HM3 B;  4X2O A;  1TRQ A;  3F7S A;  5G2G A;  1W6Y A;  5HGR A;  3VF1 A;  3WOE B;  2F5M A;  4MMY B;  2IY2 A;  1T2I A;  1IT8 A;  1B3S A;  1UUV B;  3STD A;  3CCM 3;  1X1Y A;  3OXA A;  2P0M A;  3DM8 A;  3FG1 A;  4HM2 B;  3GZB A;  3NX0 A;  1LOW A;  3SOY A;  2FGT A;  3ZG0 A;  1BUQ A;  1I2E A;  1EG9 B;  1FGM A;  3FGY A;  1IVU A;  1W02 A;  4HM0 B;  3UJM A;  3WMD A;  2IUK A;  3LOY A;  1BRN L;  2XRX B;  2HML B;  4HVN A;  2GBW B;  2L4V A;  4NHF A;  1ASK A;  3OWS A;  3X41 A;  3EHC A;  4NRE A;  1LOX A;  3N54 B;  4RBN A;  1M1K 4;  4FCZ A;  1O7M B;  3KFQ C;  2B1X B;  1ZGX A;  1N8R 4;  3HIG A;  1EEJ A;  1JKG B;  1N8Q A;  1ROV A;  3FLJ A;  3D5G A;  1YIT 3;  1QVG 2;  2W9P A;  3GZY B;  4FMA A;  3SXX A;  3WDG B;  1MWT A;  1SPU A;  2RFR A;  3UB1 A;  2OOV C;  4HAA A;  3EX9 A;  4O02 B;  4FR9 A;  4OVM A;  1MOL A;  2MF7 A;  3EN1 B;  1M1X B;  1BU4 A;  3FZW A;  4LGQ A;  1JB4 A;  1FUS A;  1RNB A;  3MG2 A;  1LOY A;  1NB3 I;  3I0Y A;  5ELJ A;  3U1W A;  2GU1 A;  2UX0 A;  4MMX B;  3VSY A;  4HM4 B;  2CWU A;  1W2Z A;  1BAN A;  3NBJ A;  1KC8 4;  1JV2 B;  4GL6 A;  3SLU A;  4K90 B;  1YI2 3;  1KWI A;  3OWU A;  2GU3 A;  1WMP A;  2F4Y A;  4WWU C;  1BRH A;  2F98 A;  4I4K A;  2W56 B;  1AVL A;  1W01 A;  1GY7 A;  1K73 4;  3MWZ A;  3G0K A;  1CH0 A;  1VQ4 3;  1W6G A;  1A2K A;  2P0X A;  2XSO B;  4MMZ B;  5IF6 A;  2F99 A;  1HKX A;  3MYT A;  4ORL A;  3ALA A;  3WA2 X;  4EYC A;  1TRP A;  3SVA A;  1OPY A;  2R4I A;  5DRE A;  9RNT A;  1UGH I;  2LQV A;  3FF0 A;  2KF6 A;  3K9M C;  5EEO A;  3B4P A;  2OWP A;  2MC8 A;  1VQL 3;  4WP5 A;  3EC9 A;  1CYU A;  3EF8 A;  2F56 A;  2WGO A;  1GY6 A;  1B2X A;  4R9K A;  2Y74 A;  2RSX A;  2CX1 A;  1GD4 A;  1WMO A;  4JF8 A;  1FYS A;  3ROB A;  3WA3 A;  2W9Q A;  2OOV A;  1LNI A;  5IEN A;  1M9G A;  1VQK 3;  1UCK A;  3F14 A;  2CH9 A;  2CIU A;  2ML6 A;  3OW2 2;  2YFI B;  3K7C A;  3UL5 A;  3LZA A;  1GMR A;  3CU3 A;  3K0Z A;  1BGS A;  2RBI A;  4WYK A;  4EC6 A;  3GWR A;  2E2V A;  1G0T A;  4STD A;  3O8Y A;  1TFO A;  1RNT A;  1Q40 A;  2RCD A;  1I70 A;  1UI7 A;  2K0M A;  1G96 A;  2KAA A;  1ISK A;  1BSE A;  3HX8 A;  4KZ1 A;  4J9A A;  1LQG C;  2AAE A;  1EKM A;  1SQW A;  2HOH A;  4N3V A;  2HMO B;  1LVN A;  1GMP A;  3NBB A;  4HM8 B;  4U13 A;  3AMO A;  1O7G B;  4BTY A;  2XF3 A;  5IG5 A;  1GOU A;  3Q3F A;  2Q07 A;  4H61 A;  2HMM B;  1MGR A;  1E3R A;  1IVX A;  3NUV A;  2BU4 A;  2XGL A;  1YJN 3;  1TJD A;  1TTO A;  2QA4 3;  3DXO A;  3LT8 A;  5BIR A;  3CCL 3;  3F7X A;  2C11 A;  1BOX A;  1N5P A;  4WFO A;  2CFW A;  4R80 A;  4R9L A;  1UUW B;  1O7H B;  4L8O A;  3ZFZ A;  4CPK A;  5M19 A;  1PFP A;  2WOF A;  5IW9 A;  1GS3 A;  1DVC A;  4L7K A;  3A76 A;  1Q82 4;  1QMA A;  1FZU A;  2P38 A;  3GAX A;  3JUP A;  1B21 A;  1B2U A;  1W6C A;  1B20 A;  3Q2P A;  3G16 A;  5M1A A;  1Q7Y 4;  3QK9 A;  5G1K A;  3BND A;  3OWY A;  1T5Y A;  4J8T A;  5D82 A;  1DE3 A;  4KFD A;  4XB5 A;  3FSD A;  5BU4 A;  2W04 A;  4XDV A;  3CCJ 3;  3LXU X;  1R4C A;  4PEJ A;  4HZ9 B;  3H3H A;  3X40 A;  2RGQ A;  4HM1 B;  4HM7 B;  3S5C A;  4JRF A;  1BRK A;  3BB9 A;  1IDP A;  3HII A;  1LQM B;  2KXG A;  3X3X A;  1IV9 A;  5CK6 A;  5D81 A;  2IMJ A;  1RGH A;  1IQY A;  2IUJ A;  5AYS C;  3E99 A;  3V92 A;  1IYY A;  1BNG A;  1BRG A;  1DMM A;  2F5W A;  3KKG A;  1TUH A;  3T8N A;  4HBR A;  1V57 A;  4G1M B;  4OUQ A;  2QEX 3;  1IV7 A;  3LML A;  3B7C A;  1B27 A;  2B24 B;  3LT9 A;  3CCQ 3;  5FGO A;  3CCE 3;  3FH1 A;  4TX4 A;  1ROA A;  3NV0 B;  3FCS B;  1B2S A;  2FNQ A;  2BHM A;  3BU4 A;  3D9R A;  2Z7A A;  1W7C A;  3AHW A;  2O9U X;  1RRH A;  3BNE A;  3V99 A;  3CC7 3;  2H0G A;  1MWU A;  1RGF A;  3ECF A;  4N6T A;  1J2B A;  3JUQ A;  4RNZ A;  1IU7 A;  1OF5 A;  3FF2 A;  3X3Y A;  3D79 A;  1BNF A;  1FUT A;  1UCJ A;  2PZV A;  3CNM A;  3PCR A;  3RNT A;  2JQ5 A;  5IEP A;  1YVB I;  1ZS7 A;  4CDL A;  1B2M A;  4LMI A;  1MWR A;  1SJW A;  1I2F A;  4LZI A;  3I56 3;  1V74 A;  2OTL 3;  3U97 A;  1VQ5 3;  4HKV B;  5A0O B;  2IYJ A;  1RRL A;  5IEO A;  4IPB A;  4K1V A;  4EBG A;  1RN1 A;  3EBY A;  4N6L A;  2XSH B;  3G6E 3;  6STD A;  1X1W A;  5STD A;  1Q81 4;  3LTC A;  3KE7 A;  1AV4 A;  1OGZ A;  1RGG A;  3HZP A;  1WQL B;  3MKI A;  5AIG A;  2W2C A;  3LTA A;  2ML5 A;  4I5Q A;  1GYB A;  4FCM A;  4GHO A;  4KFF A;  4KFE A;  1VQ6 3;  3MG3 A;  3EJV A;  1GY5 A;  1MGW A;  4R1K A;  1GSP A;  5AIF A;  3KCH A;  4HJL B;  2BIR A;  4AKZ A;  2XEP A;  5AEW B;  2M7O A;  1SII A;  1QJG A;  1DYU A;  1M90 4;  1BNR A;  2SBL A;  1A67 A;  3FG3 A;  3X3Z A;  3RGR A;  4RZM A;  3SOA A;  1BSC A;  1BRJ A;  1BNS A;  5AYR B;  4HM5 B;  2CHC A;  3PCS A;  3I55 3;  1MWS A;  1UI8 A;  1VQN 3;  4BIR A;  1O7P B;  2UGI A;  5AIH A;  4CJN A;  3DGL A;  1JN5 B;  2CX0 A;  2XH9 A;  3PZW A;  1YJ9 3;  4BU4 A;  1N9E A;  3F40 A;  3JUM A;  4N6M A;  4GB5 A;  5IG4 A;  1K9M 4;  4EW5 A;  4BL2 A;  1GOY A;  2BO9 B;  1BVI A;  3AGN A;  1HZ1 A;  1B2Z A;  1O7W B;  1GMQ A;  1IT7 A;  1JZO A;  1UCL A;  2QGU A;  4HZB B;  5FW5 A;  1I3F A;  1EA2 A;  1LNH A;  5RNT A;  1C54 A;  1FGQ A;  3WHO A;  4QWT A;  1I2G A;  2H0H A;  2P09 A;  1BSA A;  1PYL A;  3GRD A;  1X1X A;  5CF2 A;  3FG4 A;  2Z76 A;  2YFJ B;  1JKG A;  2XFT A;  2JDI H;  3DY5 A;  1C7H A;  2WO0 A;  2CWV A;  1A2P A;  2GSP A;  3PS8 A;  1W2B 2;  2PNC A;  2HMN B;  1KD1 4;  1AR0 A;  1O7N B;  1WMN A;  3EE1 A;  2FXT A;  1NNV A;  2IA7 A;  1VQ8 3;  7RNT A;  3K63 A;  4XBT A;  1Q42 A;  1WTH A;  4J5K A;  3LH4 A;  1X1U A;  3NM7 A;  2SAR A;  3MPH A;  4HYZ A;  2WOH A;  1S5A A;  5DRV A;  3CMA 3;  5D83 A;  1W00 A;  3URP A;  8RNT A;  3CPW 2;  1VQO 3;  2K3D A;  7STD A;  1OGX A;  1UGI A;  2D42 A;  1RLS A;  2L1S A;  3IMA B;  3KII A;  4WHA A;  2W56 A;  5AII A;  4IT7 A;  2KF4 A;  1RSN A;  1QVF 2;  3CCS 3;  3OX9 A;  1CQS A;  1FGO A;  1AY7 A;  1CYV A;  3TDG A;  1BNJ A;  1JB5 A;  3T0U A;  1NJI 4;  1VQ7 3;  1Q7H A;  4X2H A;  3NHX A;  1YNV X;  2V1L A;  1LXE A;  3DH2 A;  3DZL A;  4RNT A;  3RGA A;  5IG3 A;  1RHL A;  3F8X A;  2I9W A;  4K1U A;  1FW7 A;  1QAF A;  4XDW A;  1DET A;  2C4B A;  3G8Z A;  1DVD A;  3H51 A;  5IER A;  1VQM 3;  4LEH A;  3PYJ A;  2W0Q A;  1RGA A;  2CC3 A;  3CXC 2;  3IPT A;  1AQZ A;  5LC7 A;  3S28 A;  1K28 A;  4HM6 B;  1N5H A;  2XFS A;  3X42 A;  1WNH A;  3CNX A;  3WOD G;  3G4S 3;  1A2V A;  1K8A 4;  2OTJ 3;  2A15 A;  2W03 A;  4FMC A;  3JUO A;  1BRI A;  1HU9 A;  2E2U A;  2BNG A;  1I8V A;  1YIJ 3;  1E97 A;  1QAK A;  3Q1C A;  1BRS A;  2ZA4 A;  2LYX A;  3AGO A;  4XBY A;  1JB2 A;  2RNT A;  3A5E A;  1D6Z A;  1N9J A;  1NB5 I;  2GEY A;  1STD A;  4RNY A;  3L0R A;  5KP4 A;  1VQQ A;  4KVH A;  3MHE A;  3D4A A;  3PGB A;  3GZR A;  4BTW A;  4H3U A;  4ZM8 A;  3IJE B;  8CHO A;  1RGC A;  2STD A;  3SX1 A;  3ER7 A;  1YVS A;  1F8N A;  1LRA A;  2HMJ B;  2QIY A;  1TIJ A;  3BLZ A;  4LSO A;  1YHQ 3;  4AKY A;  3B4O A;  3HK4 A;  5CF1 A;  1TP6 A;  4BTX A;  1BSB A;  2GXF A;  3GSP A;  4BL3 A;  1PY3 A;  4N6O B;  1KQS 2;  1ULJ B;  2XR8 B;  3LTD A;  4NPB A;  1I0V A;  4FMD A;  3CC4 3;  3M8C A;  1RCK A;  1BNE A;  4WYK B;  1A90 A;  1Z1S A;  4K61 A;  2ZHX B; 
#chains in the Genus database with same CATH homology
 1STF I;  1ULI B;  3EBT A;  1Q40 B;  3NQZ A;  5ELU A;  2HMK B;  1AVK A;  1RN7 A;  1TFK A;  2OQE C;  3NXJ A;  3G71 3;  1OHS A;  1IVV A;  1IQX A;  3BNB A;  3QRD A;  5KP1 A;  1VQ9 3;  5EVH A;  5CLK A;  2Z77 A;  3EB8 A;  5BXQ A;  2CK3 H;  3AMO B;  3DGM A;  2CW9 A;  4XBX A;  3F8H A;  1EQK A;  3UNL A;  2BMR B;  1CEW I;  2O3O A;  1FA3 A;  5AI1 A;  3KSP A;  1JNQ A;  4OK0 A;  3CD6 3;  3CCR 3;  1UW1 A;  4N6U A;  4CCV A;  1RKY A;  3B8L A;  3D3L A;  3EQQ B;  3EN8 A;  1OUN A;  3DGO A;  3DUK A;  3J7Y d;  2GEX A;  4N6N B;  5LC6 A;  1SIH A;  1U8C B;  3DMC A;  3OV4 A;  3CME 3;  4O8S A;  5JPU A;  1KSI A;  4O2H A;  1VQL 3;  4AEQ A;  3KZT A;  3S29 A;  3WOF B;  3F9S A;  5JPP A;  5AEU B;  1VQP 3;  4N6V 0;  1L5G B;  1D6Y A;  1FGT A;  1QAL A;  3CCU 3;  2E2T A;  3S67 A;  2ZDJ A;  3LTB A;  3NV0 A;  1NWW A;  2Y73 A;  1OAC A;  2OQE A;  1JRQ A;  1IK3 A;  2OCT A;  1U5O A;  2CFK A;  5JBS A;  1NDO B;  1IQ8 A;  3CCV 3;  1TU5 A;  1YGE A;  3N9H A;  1RJO A;  1FUW A;  3UL6 A;  5TGN A;  1W4N A;  2C10 A;  2P05 A;  3RDE A;  3MSO A;  2CG1 A;  1OHP A;  4XM4 A;  5EQL A;  5BVB A;  1ZO2 A;  2WGQ A;  1K41 A;  2CFG A;  5CXO A;  3FKA A;  2INX A;  3K5T A;  2GBX B;  4MEI A;  1US1 A;  1S72 3;  1VZZ A;  2CG0 A;  2F86 B;  3PXM A;  1ZX2 A;  2D1W A;  1JJ2 2;  1IVW A;  1Y4K A;  3SED A;  1OHO A;  1NU3 A;  2CFD A;  1OCV A;  2CKF B;  1DMQ A;  3KSE D;  4EXR A;  3S27 A;  2BMQ B;  2CWT A;  1D6U A;  1FGR A;  1OF5 B;  1W5Z A;  2YFL B;  3LYG A;  3HI7 A;  5IG0 A;  3T8U A;  4EV2 A;  1PU4 A;  3CPO A;  3GZX B;  4L8P A;  2BMO B;  3BNC A;  1MNL A;  1DMN A;  3NBR A;  3NQY A;  5KP3 A;  1GD3 A;  2W6J H;  4IIA A;  1E3V A;  4MJD A;  2Z6B A;  2CFL A;  3CC2 3;  1YJW 3;  2BT3 A;  5I97 A;  3V98 A;  4FCJ A;  1JN5 A;  2YX9 A;  4R4K A;  2K54 A;  2ZL8 A;  2KRT A;  3VGN A;  1OH0 A;  3N8B A;  4EV5 A;  2XGN A;  1NO3 A;  4O3V A;  3DGN A;  3JUN A;  3MG1 A;  1Q86 4;  3NM2 A;  4Q53 A;  3Q90 A;  2KCD A;  3JVC A;  3KN4 A;  4FMB A;  4HM3 B;  4X2O A;  3F7S A;  5G2G A;  5HGR A;  1W6Y A;  3VF1 A;  3WOE B;  4MMY B;  1IT8 A;  1UUV B;  3STD A;  3CCM 3;  3OXA A;  2P0M A;  3DM8 A;  3FG1 A;  4HM2 B;  3GZB A;  3NX0 A;  3SOY A;  1BUQ A;  2FGT A;  1EG9 B;  1FGM A;  3FGY A;  1IVU A;  1W02 A;  4HM0 B;  3UJM A;  3WMD A;  2IUK A;  3LOY A;  2XRX B;  2HML B;  4HVN A;  2GBW B;  2L4V A;  4NHF A;  1ASK A;  3OWS A;  3X41 A;  3EHC A;  4NRE A;  1LOX A;  3N54 B;  4RBN A;  1M1K 4;  4FCZ A;  1O7M B;  3KFQ C;  2B1X B;  1N8R 4;  3HIG A;  1JKG B;  1N8Q A;  1ROV A;  3FLJ A;  1YIT 3;  1QVG 2;  2W9P A;  3GZY B;  4FMA A;  3SXX A;  3WDG B;  1SPU A;  2RFR A;  3UB1 A;  2OOV C;  3EX9 A;  4O02 B;  4FR9 A;  4OVM A;  1MOL A;  2MF7 A;  3EN1 B;  1M1X B;  3FZW A;  4LGQ A;  1JB4 A;  3MG2 A;  1NB3 I;  3I0Y A;  5ELJ A;  3U1W A;  2GU1 A;  2UX0 A;  4MMX B;  3VSY A;  4HM4 B;  2CWU A;  1W2Z A;  3NBJ A;  1KC8 4;  1JV2 B;  4GL6 A;  3SLU A;  4K90 B;  1YI2 3;  1KWI A;  3OWU A;  2GU3 A;  1WMP A;  4WWU C;  2F98 A;  4I4K A;  2W56 B;  1AVL A;  1W01 A;  1GY7 A;  1K73 4;  3MWZ A;  3G0K A;  1VQ4 3;  1W6G A;  1A2K A;  2P0X A;  2XSO B;  4MMZ B;  5IF6 A;  2F99 A;  1HKX A;  3MYT A;  4ORL A;  3ALA A;  3WA2 X;  4EYC A;  3SVA A;  1OPY A;  2R4I A;  5DRE A;  3FF0 A;  2LQV A;  3K9M C;  2MC8 A;  5EEO A;  3B4P A;  2OWP A;  4WP5 A;  3EC9 A;  1CYU A;  3EF8 A;  2WGO A;  1GY6 A;  4R9K A;  2Y74 A;  2RSX A;  1GD4 A;  1WMO A;  4JF8 A;  3ROB A;  3WA3 A;  2W9Q A;  2OOV A;  1VQK 3;  5IEN A;  1M9G A;  3F14 A;  2CH9 A;  2CIU A;  2ML6 A;  3OW2 2;  2YFI B;  3K7C A;  3UL5 A;  3LZA A;  3CU3 A;  3K0Z A;  4WYK A;  4EC6 A;  3GWR A;  2E2V A;  4STD A;  3O8Y A;  1TFO A;  1Q40 A;  2RCD A;  1UI7 A;  2K0M A;  1G96 A;  1ISK A;  3HX8 A;  4N3V A;  4KZ1 A;  4J9A A;  1VQN 3;  1EKM A;  1SQW A;  2HMO B;  1LVN A;  3NBB A;  4HM8 B;  4U13 A;  3AMO A;  1O7G B;  4BTY A;  2XF3 A;  5IG5 A;  2Q07 A;  4H61 A;  2HMM B;  3NUV A;  1E3R A;  1IVX A;  2XGL A;  1YJN 3;  2QA4 3;  3DXO A;  3LT8 A;  3CCL 3;  3F7X A;  2C11 A;  1N5P A;  4WFO A;  2CFW A;  4R80 A;  4R9L A;  1UUW B;  1O7H B;  4L8O A;  1PFP A;  2WOF A;  5IW9 A;  1GS3 A;  1DVC A;  4L7K A;  3A76 A;  1Q82 4;  1QMA A;  2P38 A;  3GAX A;  3JUP A;  1W6C A;  3Q2P A;  3G16 A;  1Q7Y 4;  3QK9 A;  3BND A;  3OWY A;  1T5Y A;  4J8T A;  5D82 A;  4KFD A;  4XB5 A;  3FSD A;  2W04 A;  4XDV A;  3CCJ 3;  3LXU X;  1R4C A;  4PEJ A;  4HZ9 B;  3H3H A;  3X40 A;  2RGQ A;  4HM1 B;  4HM7 B;  3S5C A;  4JRF A;  3BB9 A;  1IDP A;  3HII A;  2KXG A;  3X3X A;  1IV9 A;  5CK6 A;  5D81 A;  2IMJ A;  1IQY A;  2IUJ A;  5AYS C;  3E99 A;  3V92 A;  1DMM A;  3T8N A;  3KKG A;  1TUH A;  4HBR A;  4G1M B;  4OUQ A;  2QEX 3;  1IV7 A;  3LML A;  3B7C A;  2B24 B;  3LT9 A;  3CCQ 3;  5FGO A;  3CCE 3;  3FH1 A;  4TX4 A;  1ROA A;  3NV0 B;  3FCS B;  2FNQ A;  2BHM A;  3D9R A;  2Z7A A;  1W7C A;  3CC7 3;  2O9U X;  1RRH A;  3BNE A;  3V99 A;  3ECF A;  4N6T A;  1J2B A;  3JUQ A;  4RNZ A;  1IU7 A;  1OF5 A;  3FF2 A;  3X3Y A;  2PZV A;  3CNM A;  3PCR A;  2JQ5 A;  5IEP A;  1YVB I;  4CDL A;  4LMI A;  1SJW A;  4LZI A;  3I56 3;  1V74 A;  2OTL 3;  3U97 A;  1VQ5 3;  4HKV B;  5A0O B;  1RRL A;  5IEO A;  4IPB A;  4K1V A;  4EBG A;  3EBY A;  4N6L A;  2XSH B;  3G6E 3;  6STD A;  5STD A;  1Q81 4;  3LTC A;  3KE7 A;  1AV4 A;  1OGZ A;  3HZP A;  1WQL B;  3MKI A;  5AIG A;  2W2C A;  3LTA A;  2ML5 A;  1GYB A;  4FCM A;  4KFF A;  4KFE A;  1VQ6 3;  3MG3 A;  3EJV A;  1GY5 A;  4R1K A;  5AIF A;  4HJL B;  4AKZ A;  2XEP A;  5AEW B;  2M7O A;  1SII A;  1QJG A;  1DYU A;  1M90 4;  2SBL A;  1A67 A;  3FG3 A;  3X3Z A;  3RGR A;  4RZM A;  3SOA A;  5AYR B;  4HM5 B;  2CHC A;  3PCS A;  3I55 3;  1UI8 A;  1O7P B;  5AIH A;  3DGL A;  1JN5 B;  2XH9 A;  3PZW A;  1YJ9 3;  1N9E A;  3F40 A;  3JUM A;  4N6M A;  4GB5 A;  5IG4 A;  1K9M 4;  2BO9 B;  3L0R A;  1O7W B;  4HZB B;  1IT7 A;  2QGU A;  5FW5 A;  1LNH A;  1EA2 A;  1FGQ A;  4QWT A;  2P09 A;  3GRD A;  5CF2 A;  3FG4 A;  2Z76 A;  2YFJ B;  1JKG A;  2XFT A;  2JDI H;  3DY5 A;  1C7H A;  2WO0 A;  2CWV A;  3PS8 A;  1W2B 2;  2PNC A;  2HMN B;  1KD1 4;  1AR0 A;  1O7N B;  1WMN A;  3EE1 A;  2FXT A;  2IA7 A;  1VQ8 3;  3K63 A;  4XBT A;  1Q42 A;  1WTH A;  3LH4 A;  3NM7 A;  3MPH A;  4HYZ A;  2WOH A;  1S5A A;  5DRV A;  3CMA 3;  5D83 A;  1W00 A;  3CPW 2;  1VQO 3;  7STD A;  1OGX A;  2D42 A;  3IMA B;  3KII A;  4WHA A;  2W56 A;  5AII A;  4IT7 A;  1QVF 2;  3CCS 3;  3OX9 A;  1CQS A;  1FGO A;  1CYV A;  3TDG A;  1JB5 A;  3T0U A;  1NJI 4;  1VQ7 3;  4X2H A;  3NHX A;  2V1L A;  1LXE A;  3DZL A;  3RGA A;  5IG3 A;  4K1U A;  3F8X A;  2I9W A;  1QAF A;  4XDW A;  3G8Z A;  1DVD A;  3H51 A;  5IER A;  1VQM 3;  4LEH A;  3PYJ A;  2W0Q A;  2CC3 A;  3CXC 2;  3IPT A;  3S28 A;  5LC7 A;  1K28 A;  4HM6 B;  1N5H A;  2XFS A;  3X42 A;  1WNH A;  3CNX A;  3WOD G;  3G4S 3;  1A2V A;  1K8A 4;  2OTJ 3;  2A15 A;  2W03 A;  4FMC A;  3JUO A;  1HU9 A;  2E2U A;  1YIJ 3;  2BNG A;  1E97 A;  1QAK A;  3Q1C A;  4XBY A;  2LYX A;  1JB2 A;  1D6Z A;  1N9J A;  1NB5 I;  2GEY A;  1STD A;  4RNY A;  5KP4 A;  4KVH A;  3MHE A;  3PGB A;  3GZR A;  4H3U A;  4ZM8 A;  3IJE B;  8CHO A;  2STD A;  3SX1 A;  3ER7 A;  1F8N A;  2HMJ B;  2QIY A;  1TIJ A;  3BLZ A;  4LSO A;  1YHQ 3;  4AKY A;  3B4O A;  3HK4 A;  5CF1 A;  1TP6 A;  4BTX A;  2GXF A;  4N6O B;  1KQS 2;  1ULJ B;  2XR8 B;  3LTD A;  4FMD A;  3CC4 3;  3M8C A;  4WYK B;  4BTW A;  1Z1S A;  4K61 A;  1A90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...