3MHEA

Crystal structure of ketosteroid isomerase p39a from pseudomonas testosteroni (tksi)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
120
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-Isomerase
publication title Crystal Structure of Ketosteroid Isomerase P39A from Pseudomonas Testosteroni (tKSI)
rcsb
source organism Comamonas testosteroni
total genus 31
structure length 120
sequence length 124
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3mheA00
5IEPA 1BUQA 3EBTA 5AIHA 5AEUB 3OWYA 2XR8B 5CLKA 1ISKA 4MJDA 3MG2A 3M8CA 5BVBA 5KP1A 4HM7B 1UUWB 1JN5B 1STDA 3VSYA 5DREA 2I9WA 3FF0A 3ECFA 2XSHB 5IERA 3G8ZA 2INXA 3KE7A 1WQLB 3T8UA 5IF6A 3NHXA 4ORLA 5CF2A 3DUKA 1QJGA 4HM0B 5CXOA 3FGYA 5AI1A 1E3VA 2CHCA 4HM3B 4LEHA 4K1VA 1E3RA 2CKFB 4K1UA 2YFLB 3RGRA 4OUQA 2K54A 3NV0B 3EHCA 4Q53A 1O7HB 2F98A 3CU3A 4X2HA 5AIFA 3EBYA 3FLJA 6STDA 1OUNA 2BMOB 2F99A 3HZPA 3CNXA 4XBXA 3GZYB 1OHOA 4HJLB 1W6YA 3MG3A 4R9LA 3UNLA 2Z76A 1OHPA 5IEOA 5KP4A 3DZLA 2BMQB 3BB9A 3JUMA 4H3UA 1NWWA 2GBXB 3MHEA 1O7MB 4HM5B 1DMQA 1HKXA 3KZTA 3S5CA 1JKGA 3Q90A 4LMIA 4HZ9B 3EN8A 3F9SA 1OCVA 3DM8A 3EC9A 3MYTA 3NBRA 4HM1B 1OF5B 1QMAA 3K0ZA 3OXAA 3EJVA 2GBWB 1NU3A 1CQSA 7STDA 1SJWA 1ZX2A 4L8OA 1U5OA 4RZMA 5IG5A 1JN5A 4XB5A 2HMLB 3B4OA 5CK6A 3F40A 3SOAA 1IDPA 4WYKB 1TUHA 3MKIA 3OV4A 1OGXA 1GY5A 2UX0A 4KVHA 2B1XB 4HM2B 1S5AA 4FCMA 2HMOB 3CPOA 3H3HA 1OHSA 3CNMA 3OWSA 3GZBA 5D82A 2W2CA 4L8PA 1O7NB 2Z77A 1EG9B 3OX9A 5KP3A 3FF2A 4I4KA 5DRVA 4LGQA 3FZWA 4J8TA 5AIIA 2F86B 3GWRA 5EVHA 4L7KA 3IPTA 4XBTA 3VGNA 3MG1A 4U13A 1O7PB 2STDA 3FSDA 2BNGA 5D81A 2HMJB 3NUVA 4HM8B 3JUNA 4IIAA 1W01A 2RFRA 3KKGA 3HX8A 2BMRB 2GEXA 1ZO2A 1C7HA 1JB4A 1Q40B 4N3VA 5JPPA 3MSOA 3JUOA 4STDA 2YFIB 2GXFA 4XBYA 2XSOB 1JB2A 3K7CA 5TGNA 1DMMA 3E99A 3ER7A 5JPUA 3DXOA 1OH0A 3UJMA 1VZZA 3NM2A 3SOYA 4FCJA 1OF5A 1O7WB 2JQ5A 5HGRA 4XDWA 1DMNA 3DMCA 3SEDA 4HVNA 2R4IA 2HMKB 3GRDA 1ULJB 1NDOB 5IG4A 3JUQA 4R9KA 3G16A 4WWUC 1A2KA 4HM6B 1OPYA 3T8NA 1GS3A 3LZAA 1GYBA 3OWUA 4X2OA 2QIYA 3FH1A 2PZVA 2GEYA 3JUPA 4WYKA 1EA2A 3NXJA 4HM4B 1ULIB 2B24B 3G0KA 1E97A 3F7SA 2QGUA 1UUVB 3B4PA 5AIGA 3BLZA 4CDLA 3F8XA 3F8HA 2XRXB 2IMJA 1Z1SA 3I0YA 4J9AA 1JB5A 5D83A 3GZXB 8CHOA 3B7CA 1O7GB 2RCDA 1W02A 4PEJA 3NV0A 1OGZA 3F7XA 5IENA 1AR0A 5G2GA 3WMDA 3B8LA 3HK4A 4XDVA 4HZBB 4GB5A 2YFJB 3D9RA 4HKVB 3GZRA 1GY7A 1K41A 3H51A 4OVMA 3STDA 1Q42A 2HMMB 5STDA 5BXQA 4R1KA 3F14A 3RGAA 1TP6A 1ASKA 1Q40A 3LYGA 5IG3A 5IG0A 2OWPA 3KSPA 2Z7AA 3EF8A 1GY6A 2RGQA 3EQQB 3EN1B 3EX9A 5AEWB 3A76A 5CF1A 1W00A 1JKGB 4WP5A 4XM4A 5FW5A 2HMNB 2A15A 3FKAA 3ROBA
chains in the Genus database with same CATH superfamily
1ZS7A 1V74A 4N6UA 3ZFZA 5IEPA 1BUQA 1B2ZA 1KWIA 1BRKA 3EBTA 4HBRA 1UDII 1UI8A 1B2UA 2ZDJA 5AIHA 5AEUB 1Q814 2LQVA 1NB5I 3LXUX 3AGNA 4BTWA 2D1WA 3OWYA 1UGHI 1LXEA 1MOLA 3CC73 2WO0A 3DGOA 2XR8B 3K9MC 1VQ73 2O9UX 5CLKA 3BNDA 1N5HA 1ISKA 3N9HA 4I5QA 3PGBA 3A5EA 3RDEA 2HOHA 2CG1A 4MJDA 5M18A 5G1LA 1RCKA 3D5IA 2KF5A 3MG2A 3M8CA 3AMOA 5BVBA 5KP1A 4EXRA 4HM7B 1FW7A 1UUWB 1JN5B 1BRGA 1MGRA 1WNHA 1G02A 1STDA 2F5MA 3NQYA 1M1K4 1FUSA 2CK3H 3PCSA 2ZHXB 3FG1A 3VSYA 1HYFA 5DREA 2I9WA 3FF0A 1RLSA 3CD63 1CYUA 4GSPA 2QA43 3ECFA 1BNJA 1ROAA 3KN4A 2KF4A 3BNBA 3EE1A 1GD4A 1I2FA 2Y74A 1IK3A 1UW1A 3DY5A 2XSHB 1VQ93 4HOHA 1RRLA 3AHWA 5IERA 3G8ZA 1VQM3 2INXA 1CYVA 1MNLA 3DH2A 3G713 2ML6A 3N54B 2WGOA 3BU4A 1T2HA 1IVXA 3KE7A 1BSBA 1WQLB 5G1KA 3I563 1W6GA 3T8UA 3D3LA 4TX4A 2FGTA 3X3ZA 1QAKA 5IF6A 3NHXA 3CCU3 1VQ43 2M7OA 1RNBA 1Q864 3QRDA 2XFTA 1UI7A 4ORLA 5CF2A 3DUKA 1FYSA 1QJGA 4HM0B 3FGYA 5CXOA 3U1WA 5AI1A 2BHMA 3V98A 1IV9A 2PNCA 1E3VA 3K63A 1B21A 2CHCA 2KF3A 4HM3B 4LEHA 4K1VA 2CC3A 1DVDA 1E3RA 3AGOA 2CKFB 4K1UA 3K5TA 1K734 3NM7A 5A0OB 2CX1A 1GOVA 2YFLB 3SX1A 1BGSA 4CJNA 1GD3A 2CWVA 2OQEC 3DGMA 4IPBA 3RGRA 1V57A 3MWZA 1RGKA 4KFFA 3KIIA 1K8A4 4OUQA 2K54A 3HIGA 3EHCA 3NV0B 4R80A 1BRJA 4Q53A 1LQGC 3WR2A 2K3DA 2W03A 1O7HB 1BOXA 4BTYA 2CFDA 2F98A 3CU3A 4X2HA 1ROVA 1YIT3 1BU4A 1QVF2 5ELUA 5AIFA 3EBYA 3FLJA 1IT7A 1YGEA 6STDA 1A2VA 1OUNA 2BMOB 1N8R4 2H0HA 4N6V0 2OTL3 2CIUA 1JRQA 2F99A 3PZWA 1X1XA 3HZPA 1A2PA 3CNXA 4XBXA 1FGTA 1RGCA 1CH0A 3CPW2 1VQ63 1DETA 1Y4KA 3GAXA 3WODG 3GZYB 1OHOA 4HJLB 1W6YA 1N5PA 2CFWA 5EEOA 1UCIA 1TFOA 3SLUA 3MG3A 4R9LA 3UNLA 2Z76A 2ZA4A 4HAAA 1J2BA 1OHPA 2P05A 5IEOA 1VQ83 1IQYA 1RHLA 1BNRA 1BNSA 5KP4A 3DZLA 3CCV3 3FCSB 1D6ZA 2BMQB 1BSCA 1EEJA 4NREA 1I70A 1VQP3 2AADA 3BB9A 2W6JH 3JUMA 4H3UA 4WHAA 2RNTA 1RN1A 1NWWA 2GBXB 3MHEA 1O7MB 1RN4A 3U97A 4HM5B 1US1A 3HIIA 1DMQA 1HKXA 3KZTA 1I3FA 8RNTA 3ZG0A 2CWUA 3S67A 1WMPA 3S5CA 1JKGA 5FGOA 3Q90A 4LMIA 4HZ9B 1UGIA 2BO9B 1FGMA 3EN8A 3F9SA 1JZOA 1RGLA 4OK0A 1FZUA 1I3IA 1OCVA 3DM8A 2R41A 1LNHA 1GOYA 3CCL3 3BNCA 3EC9A 3MYTA 3NBRA 4HM1B 5HOHA 1OF5B 1GMRA 1QMAA 1RNTA 3PS8A 3CCR3 3K0ZA 1B3SA 1VQK3 1IVVA 1BRIA 3OXAA 1KC84 1C54A 4KT3B 1BAOA 1UCKA 3EJVA 3T0UA 2GBWB 1NU3A 2FXTA 1Q824 2OOVC 4BL2A 2W56B 1CQSA 3BIRA 3KCHA 7STDA 2FNQA 2W9PA 1SJWA 2IYJA 1ZX2A 4DKIA 4AKYA 1WTHA 4L8OA 2CW9A 1TIJA 5IW9A 2CFGA 1YI23 1U5OA 4FMDA 4GL6A 2IY2A 2F5WA 4RZMA 4FMCA 5IG5A 1SARA 3WA2X 4JF8A 3CXC2 1BRSA 2V1LA 1JN5A 2KCDA 4XB5A 1GMQA 3L0RA 2HMLB 3SVAA 2MF7A 1RGHA 2OQEA 4AKZA 3CCM3 1VQL3 3B4OA 1G96A 5CK6A 1UUGB 1IU7A 1BSEA 1RCLA 1IDPA 2KAAA 3AMOB 3F40A 4WYKB 3SOAA 1TUHA 3MKIA 1JBRA 7GSPA 4ZM8A 3V92A 3OV4A 4O8SA 1OGXA 4WFOA 3UL5A 1LOXA 1FGOA 1GY5A 2GU3A 3IMAB 2UX0A 2GU1A 1G0TA 4KVHA 4BU4A 4LZIA 4BTXA 1BIRA 2B1XB 5I97A 3GSPA 2OCTA 4EV2A 4HM2B 1RGFA 1S5AA 1DYUA 1JNQA 1W2B2 4K90B 1IVUA 1D6YA 4KFEA 2C4BA 4FCMA 1KSIA 2HMOB 3PYJA 4EW5A 1YJW3 1SIIA 2C10A 3D4AA 1EKMA 3CPOA 3H3HA 1OHSA 2KRTA 3CNMA 1YGWA 3OWSA 3LOYA 3GZBA 3DGLA 1M9GA 1VQ53 2CX0A 5D82A 4KFDA 3G4S3 1R4YA 2IA7A 2RSXA 2W0QA 1TFKA 2W2CA 4L8PA 1O7NB 2Z77A 1EG9B 4EBGA 3OX9A 5KP3A 3FF2A 1I0VA 4K61A 3X3YA 2GSPA 1CEWI 3Q3FA 1STFI 4I4KA 1TTOA 4R4KA 5DRVA 2H0GA 1FUTA 2Q07A 4LGQA 1IQ8A 1IVWA 3SYUA 3FZWA 3LTDA 4J8TA 5AIIA 2F86B 2P38A 1B2XA 4QWTA 5M1AA 3GWRA 4N6LA 1T2IA 1BSDA 1RRHA 1GMPA 2XH9A 3JVCA 4L7KA 4RNYA 5EVHA 1LOYA 3IPTA 4O3VA 2BU4A 1BRHA 4XBTA 1ZGXA 2CFLA 1B2MA 2IUKA 3VGNA 1NJI4 1HU9A 3MG1A 4U13A 2CFKA 3RNTA 5LC6A 1RSNA 1O7PB 1B27A 1SQWA 2L4VA 3ALAA 1LQMB 2STDA 3FSDA 4EYCA 3ZG5A 3Q1CA 2BNGA 1I2EA 5D81A 2E2TA 1BNFA 2HMJB 3G6E3 3NUVA 4HM8B 3UB1A 3JUNA 4IIAA 3CMA3 3NQZA 1W01A 2RFRA 3KKGA 4EC6A 3HX8A 1SIHA 4O2HA 1RKYA 2BMRB 2GEXA 1MWUA 1UCJA 1YVSA 2O3OA 4JRFA 2OOVA 1ZO2A 1EUIC 1QALA 4J5KA 1C7HA 1JB4A 1Q40B 4N3VA 1U8CB 3LT9A 5BU4A 5JPPA 3LT8A 2P09A 3JUOA 3MSOA 3CC43 4STDA 1TRQA 2GXFA 2YFIB 4XBYA 4O02B 1T3BA 1PFPA 2XSOB 3EB8A 1JB2A 3D5GA 3K7CA 1L5GB 1M904 4N6MA 1RGAA 5TGNA 4J5GA 5EQLA 1BANA 1DMMA 1D6UA 3IJEB 1BUJA 3E99A 3S28A 1PYLA 3ER7A 1VQN3 2WOFA 5JPUA 3DXOA 1OH0A 3WA3A 3UJMA 4LYLB 3PXMA 1VZZA 3NBJA 1N9EA 3NM2A 1AVLA 3CME3 3SOYA 2E2UA 4FCJA 1OF5A 9RNTA 5M19A 1O7WB 1AVKA 5AYSC 1A67A 2JQ5A 5HGRA 2K0MA 4XDWA 5ELJA 1DMNA 3DMCA 1IV7A 3N8BA 5BIRA 1VQO3 1W7CA 3SEDA 1DVCA 1GOUA 3MPHA 4HVNA 1BVIA 2R4IA 2HMKB 3GRDA 3KSED 2Z6BA 1JBSA 3WOFB 2W56A 1ULJB 1NDOB 5IG4A 2CG0A 2C11A 3JUQA 3LTBA 4R9KA 3G16A 4WWUC 3WDGB 1A2KA 2SARA 2J8XB 1V58A 3FG4A 4HM6B 1OPYA 1LVNA 3T8NA 1GS3A 1BNIA 3LZAA 1RN7A 3PCRA 1YIJ3 2KF6A 3HI7A 1GYBA 2D42A 1SPUA 4FR9A 5RNTA 2AAEA 3BNEA 1OACA 3V99A 2IUJA 3VF1A 3OWUA 2H0IA 6RNTA 3HOHA 1BSAA 4X2OA 2P0XA 1LNIA 2XGLA 3Q2PA 2QIYA 4AEQA 3LMLA 1K28A 2PZVA 2GEYA 1RMSA 1NB3I 3FH1A 3JUPA 4GHOA 4WYKA 4FMAA 1NO3A 1AQZA 2WOHA 4KZ1A 4MMZB 3UL6A 1EA2A 2UUGC 3AHSA 1RTUA 3SXXA 1JJ22 3NXJA 2QEX3 1F8NA 2CWTA 2ML5A 1ULIB 4HM4B 4CPKA 2B24B 3G0KA 3OW22 1B20A 1E97A 1PY3A 1W4NA 3F7SA 2QGUA 1UUVB 3B4PA 5AIGA 1AY7A 2XF3A 3BLZA 1BNEA 1YNVX 4MMXB 1EQKA 4FMBA 4CDLA 3F8XA 3X41A 3D79A 4RNZA 2XGNA 7RNTA 1DE3A 1X1YA 3F8HA 2XFSA 3WOEB 1FGRA 1X1UA 1K9M4 2XRXB 1MGWA 4LSOA 1I0XA 1LRAA 2IMJA 1Z1SA 3I0YA 4J9AA 1IQXA 1IYYA 1JB5A 5D83A 1LOWA 3GZXB 8CHOA 3B7CA 1Q7Y4 1O7GB 2RCDA 1W02A 2BT3A 4N6NB 4PEJA 6GSPA 1VQQA 1QAFA 3WHOA 3NV0A 1KQS2 1OGZA 2YX9A 3F7XA 1QVG2 1B2SA 5IENA 4H61A 1RDSA 2WGQA 2Y73A 1AR0A 2L1SA 1YHQ3 3X40A 5G2GA 2JDIH 3S27A 5GSPA 4MMYB 1MWRA 4RBNA 3TDGA 1HZ1A 2SBLA 3DGYA 1LOVA 1RJOA 3WMDA 3B8LA 4IT7A 1GSPA 1W6CA 3X42A 3HK4A 3X3XA 1JV2B 1I2GA 4GB5A 4HZBB 4XDVA 1YJ93 2RBIA 2P0MA 2YFJB 3D9RA 4HKVB 1PU4A 2BIRA 1TU5A 1YJN3 3GZRA 3LTCA 1YVBI 1GY7A 1WMOA 1MWTA 1Q7HA 1K41A 1FGQA 1W2ZA 4G1MB 1S723 2XEPA 4N6OB 3H51A 4OVMA 3STDA 1Q42A 1M1XB 5JBSA 2HMMB 1T5YA 2OTJ3 3LTAA 5STDA 5BXQA 3J7Yd 3CCJ3 3CCE3 2E2VA 2F4YA 3NX0A 4R1KA 4BIRA 1X1WA 3KFQC 3LH4A 4HYZA 1WMNA 4MEIA 1FUWA 3F14A 3RGAA 1JZDA 1TP6A 3NBBA 1N8QA 1KD14 1ASKA 2W9QA 1TJDA 1I8VA 2MC8A 2F56A 1Q40A 2KXGA 3LYGA 1W5ZA 3CC23 5IG3A 1A90A 1IT8A 5IG0A 2OWPA 1JBTA 1R4CA 3KSPA 3FG3A 2Z7AA 3EF8A 1GY6A 1Q9EA 1RGEA 2RGQA 3EQQB 3DGNA 3EN1B 2LYXA 3EX9A 4BL3A 5AEWB 5AYRB 1BRNL 5LC7A 1MWSA 4FCZA 1NNVA 3QK9A 4NPBA 3A76A 4ILFA 3O8YA 1AV4A 5CF1A 3I553 2UGIA 1W00A 2W04A 3URPA 1RGGA 1JKGB 2ZL8A 4WP5A 1UCLA 1BNGA 4EV5A 4RNTA 4N6TA 4XM4A 5FW5A 2HMNB 2A15A 4CCVA 1FA3A 3FKAA 1TRPA 4NHFA 3ROBA 3S29A 1N9JA 3CCQ3 3CCS3 2CH9A
chains in the Genus database with same CATH topology
1V74A 4N6UA 5IEPA 1BUQA 1KWIA 3EBTA 4HBRA 1Q814 1NB5I 1UI8A 2ZDJA 5AIHA 5AEUB 2LQVA 3LXUX 4BTWA 2D1WA 3OWYA 1LXEA 1MOLA 3CC73 2WO0A 3DGOA 2XR8B 3K9MC 1VQ73 2O9UX 5CLKA 3BNDA 1N5HA 1ISKA 3N9HA 3PGBA 3RDEA 2CG1A 4MJDA 3MG2A 3M8CA 3AMOA 5BVBA 5KP1A 4EXRA 4HM7B 1UUWB 1JN5B 1WNHA 1M1K4 1STDA 3NQYA 2CK3H 3PCSA 3FG1A 3VSYA 5DREA 2I9WA 3FF0A 3CD63 1CYUA 2QA43 3ECFA 1ROAA 3KN4A 3EE1A 3BNBA 1GD4A 2Y74A 1IK3A 1UW1A 3DY5A 2XSHB 1VQ93 1RRLA 5IERA 3G8ZA 1VQM3 2INXA 1CYVA 1MNLA 3G713 2ML6A 3N54B 2WGOA 1IVXA 3KE7A 1WQLB 3I563 1W6GA 3T8UA 3D3LA 4TX4A 2FGTA 3X3ZA 1QAKA 5IF6A 3NHXA 3CCU3 1VQ43 2M7OA 1Q864 3QRDA 2XFTA 1UI7A 4ORLA 5CF2A 3DUKA 1QJGA 4HM0B 5CXOA 3FGYA 3U1WA 5AI1A 2BHMA 3V98A 1IV9A 2PNCA 1E3VA 3K63A 2CHCA 4HM3B 4LEHA 4K1VA 2CC3A 1DVDA 1E3RA 1K734 2CKFB 4K1UA 3K5TA 3NM7A 5A0OB 2YFLB 3SX1A 1GD3A 2CWVA 2OQEC 3DGMA 4IPBA 3RGRA 3MWZA 4KFFA 3KIIA 1K8A4 4OUQA 2K54A 3HIGA 3EHCA 3NV0B 4R80A 4Q53A 2W03A 1O7HB 4BTYA 2CFDA 2F98A 3CU3A 4X2HA 1ROVA 1YIT3 1QVF2 5ELUA 5AIFA 3EBYA 3FLJA 1IT7A 1YGEA 6STDA 1A2VA 1OUNA 2BMOB 1N8R4 4N6V0 2OTL3 2CIUA 1JRQA 2F99A 3PZWA 3HZPA 3CNXA 4XBXA 3CPW2 1FGTA 1VQ63 1Y4KA 3GAXA 3WODG 3GZYB 1OHOA 4HJLB 1W6YA 1N5PA 2CFWA 5EEOA 1TFOA 3SLUA 3MG3A 4R9LA 3UNLA 2Z76A 1J2BA 2P05A 1OHPA 5IEOA 1VQ83 1IQYA 5KP4A 3DZLA 3CCV3 3FCSB 1D6ZA 2BMQB 4NREA 1VQP3 3BB9A 2W6JH 3JUMA 4H3UA 4WHAA 1NWWA 2GBXB 3MHEA 1O7MB 3U97A 4HM5B 1US1A 3HIIA 1DMQA 1HKXA 3KZTA 2CWUA 3S67A 1WMPA 3S5CA 1JKGA 5FGOA 3Q90A 4LMIA 4HZ9B 2BO9B 1FGMA 3EN8A 3F9SA 4OK0A 1OCVA 3DM8A 1LNHA 3CCL3 3BNCA 3EC9A 3MYTA 3NBRA 4HM1B 1OF5B 1QMAA 3PS8A 3CCR3 3K0ZA 1VQK3 1IVVA 3OXAA 1KC84 3EJVA 3T0UA 2GBWB 1NU3A 2FXTA 1Q824 2OOVC 2W56B 1CQSA 7STDA 2FNQA 2W9PA 1SJWA 1ZX2A 4AKYA 1WTHA 4L8OA 2CW9A 1TIJA 5IW9A 2CFGA 1YI23 1U5OA 4FMDA 4GL6A 4RZMA 4FMCA 5IG5A 3WA2X 4JF8A 3CXC2 2V1LA 1JN5A 2KCDA 4XB5A 3L0RA 3SVAA 2HMLB 2MF7A 2OQEA 4AKZA 3CCM3 1VQL3 3B4OA 1G96A 5CK6A 3AMOB 1IU7A 3F40A 3SOAA 1IDPA 4WYKB 1TUHA 3MKIA 4ZM8A 3V92A 3OV4A 4O8SA 1OGXA 4WFOA 3UL5A 1LOXA 1FGOA 1GY5A 2GU3A 3IMAB 2UX0A 2GU1A 4KVHA 4LZIA 4BTXA 5I97A 2B1XB 2OCTA 4EV2A 4HM2B 1S5AA 1DYUA 1JNQA 1W2B2 4K90B 1IVUA 1D6YA 4KFEA 4FCMA 1KSIA 2HMOB 3PYJA 1YJW3 1SIIA 2C10A 1EKMA 3CPOA 3H3HA 1OHSA 2KRTA 3CNMA 3OWSA 3LOYA 3GZBA 3DGLA 1M9GA 1VQ53 5D82A 4KFDA 3G4S3 2IA7A 2RSXA 2W0QA 1TFKA 2W2CA 4L8PA 1O7NB 2Z77A 1EG9B 4EBGA 3OX9A 5KP3A 3FF2A 4K61A 3X3YA 1CEWI 1STFI 4I4KA 4R4KA 5DRVA 2Q07A 4LGQA 1IQ8A 1IVWA 3FZWA 3LTDA 4J8TA 5AIIA 2F86B 2P38A 4QWTA 3GWRA 4N6LA 4RNYA 1RRHA 3JVCA 2XH9A 4L7KA 5EVHA 3IPTA 4O3VA 4XBTA 2CFLA 2IUKA 3VGNA 1NJI4 1HU9A 3MG1A 4U13A 2CFKA 5LC6A 1SQWA 1O7PB 2L4VA 3ALAA 2STDA 3FSDA 4EYCA 3Q1CA 2BNGA 5D81A 2E2TA 2HMJB 3G6E3 3NUVA 4HM8B 3UB1A 3JUNA 4IIAA 3CMA3 3NQZA 1W01A 2RFRA 3KKGA 4EC6A 3HX8A 1SIHA 4O2HA 1RKYA 2BMRB 2GEXA 2O3OA 4JRFA 2OOVA 1ZO2A 1QALA 1C7HA 1JB4A 1Q40B 4N3VA 1U8CB 3LT9A 5JPPA 3LT8A 2P09A 3JUOA 3MSOA 3CC43 4STDA 2YFIB 2GXFA 4XBYA 4O02B 1PFPA 2XSOB 3EB8A 1JB2A 3K7CA 1L5GB 1M904 4N6MA 5TGNA 5EQLA 1DMMA 1D6UA 3IJEB 3E99A 3S28A 3ER7A 1VQN3 2WOFA 5JPUA 3DXOA 1OH0A 3WA3A 3UJMA 3PXMA 1VZZA 3NBJA 1N9EA 3NM2A 1AVLA 3CME3 3SOYA 2E2UA 4FCJA 1OF5A 1O7WB 1AVKA 5AYSC 1A67A 2JQ5A 5HGRA 2K0MA 4XDWA 5ELJA 1DMNA 3DMCA 1IV7A 3N8BA 1VQO3 1W7CA 3SEDA 1DVCA 3MPHA 4HVNA 2R4IA 2HMKB 3GRDA 3KSED 2Z6BA 3WOFB 2W56A 1ULJB 1NDOB 5IG4A 2CG0A 2C11A 3JUQA 3LTBA 4R9KA 3G16A 4WWUC 3WDGB 1A2KA 3FG4A 4HM6B 1OPYA 1LVNA 3T8NA 1GS3A 3LZAA 1YIJ3 1RN7A 3PCRA 3HI7A 1GYBA 2D42A 1SPUA 4FR9A 3BNEA 3V99A 1OACA 2IUJA 3VF1A 3OWUA 4X2OA 2P0XA 2XGLA 3Q2PA 2QIYA 4AEQA 3LMLA 1K28A 2PZVA 2GEYA 3FH1A 1NB3I 3JUPA 4WYKA 4FMAA 1NO3A 2WOHA 4KZ1A 4MMZB 3UL6A 1EA2A 3SXXA 1JJ22 3NXJA 2QEX3 1F8NA 2CWTA 2ML5A 1ULIB 4HM4B 3OW22 2B24B 3G0KA 1E97A 1W4NA 3F7SA 2QGUA 1UUVB 3B4PA 5AIGA 2XF3A 3BLZA 4MMXB 1EQKA 4FMBA 4CDLA 3F8XA 3X41A 4RNZA 2XGNA 3F8HA 2XFSA 3WOEB 1FGRA 1K9M4 2XRXB 4LSOA 2IMJA 1Z1SA 3I0YA 4J9AA 1IQXA 1JB5A 5D83A 3GZXB 8CHOA 3B7CA 1Q7Y4 1O7GB 2RCDA 1W02A 2BT3A 4N6NB 4PEJA 1QAFA 1KQS2 3NV0A 1OGZA 2YX9A 3F7XA 1QVG2 5IENA 4H61A 2WGQA 2Y73A 1AR0A 1YHQ3 3X40A 5G2GA 2JDIH 3S27A 4MMYB 4RBNA 3TDGA 2SBLA 1RJOA 3WMDA 3B8LA 4IT7A 1W6CA 3X42A 3HK4A 3X3XA 1JV2B 4HZBB 4GB5A 4XDVA 1YJ93 2P0MA 2YFJB 3D9RA 4HKVB 1PU4A 1TU5A 1YJN3 3GZRA 3LTCA 1YVBI 1GY7A 1WMOA 1K41A 1FGQA 1W2ZA 4G1MB 1S723 2XEPA 4N6OB 3H51A 4OVMA 3STDA 1Q42A 1M1XB 5JBSA 2HMMB 1T5YA 2OTJ3 3LTAA 5STDA 5BXQA 3J7Yd 3CCJ3 3CCE3 2E2VA 3NX0A 4R1KA 3KFQC 3LH4A 4HYZA 1WMNA 4MEIA 1FUWA 3F14A 3RGAA 1TP6A 3NBBA 1N8QA 1KD14 1ASKA 2W9QA 2MC8A 1Q40A 2KXGA 3LYGA 1W5ZA 3CC23 5IG3A 1A90A 1IT8A 5IG0A 2OWPA 1R4CA 3KSPA 3FG3A 2Z7AA 3EF8A 1GY6A 2RGQA 3EQQB 3DGNA 3EN1B 2LYXA 3EX9A 5AEWB 5AYRB 5LC7A 4FCZA 3QK9A 3A76A 3O8YA 1AV4A 5CF1A 3I553 1W00A 2W04A 1JKGB 2ZL8A 4WP5A 4EV5A 4N6TA 4XM4A 5FW5A 2HMNB 2A15A 4CCVA 1FA3A 3FKAA 3S29A 4NHFA 3ROBA 1N9JA 3CCQ3 3CCS3 2CH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IEP A;  1BUQ A;  3EBT A;  5AIH A;  5AEU B;  3OWY A;  2XR8 B;  5CLK A;  1ISK A;  4MJD A;  3MG2 A;  3M8C A;  5BVB A;  5KP1 A;  4HM7 B;  1UUW B;  1JN5 B;  1STD A;  3VSY A;  5DRE A;  2I9W A;  3FF0 A;  3ECF A;  2XSH B;  5IER A;  3G8Z A;  2INX A;  3KE7 A;  1WQL B;  3T8U A;  5IF6 A;  3NHX A;  4ORL A;  5CF2 A;  3DUK A;  1QJG A;  4HM0 B;  5CXO A;  3FGY A;  5AI1 A;  1E3V A;  2CHC A;  4HM3 B;  4LEH A;  4K1V A;  1E3R A;  2CKF B;  4K1U A;  2YFL B;  3RGR A;  4OUQ A;  2K54 A;  3NV0 B;  3EHC A;  4Q53 A;  1O7H B;  2F98 A;  3CU3 A;  4X2H A;  5AIF A;  3EBY A;  3FLJ A;  6STD A;  1OUN A;  2BMO B;  2F99 A;  3HZP A;  3CNX A;  4XBX A;  3GZY B;  1OHO A;  4HJL B;  1W6Y A;  3MG3 A;  4R9L A;  3UNL A;  2Z76 A;  1OHP A;  5IEO A;  5KP4 A;  3DZL A;  2BMQ B;  3BB9 A;  3JUM A;  4H3U A;  1NWW A;  2GBX B;  3MHE A;  1O7M B;  4HM5 B;  1DMQ A;  1HKX A;  3KZT A;  3S5C A;  1JKG A;  3Q90 A;  4LMI A;  4HZ9 B;  3EN8 A;  3F9S A;  1OCV A;  3DM8 A;  3EC9 A;  3MYT A;  3NBR A;  4HM1 B;  1OF5 B;  1QMA A;  3K0Z A;  3OXA A;  3EJV A;  2GBW B;  1NU3 A;  1CQS A;  7STD A;  1SJW A;  1ZX2 A;  4L8O A;  1U5O A;  4RZM A;  5IG5 A;  1JN5 A;  4XB5 A;  2HML B;  3B4O A;  5CK6 A;  3F40 A;  3SOA A;  1IDP A;  4WYK B;  1TUH A;  3MKI A;  3OV4 A;  1OGX A;  1GY5 A;  2UX0 A;  4KVH A;  2B1X B;  4HM2 B;  1S5A A;  4FCM A;  2HMO B;  3CPO A;  3H3H A;  1OHS A;  3CNM A;  3OWS A;  3GZB A;  5D82 A;  2W2C A;  4L8P A;  1O7N B;  2Z77 A;  1EG9 B;  3OX9 A;  5KP3 A;  3FF2 A;  4I4K A;  5DRV A;  4LGQ A;  3FZW A;  4J8T A;  5AII A;  2F86 B;  3GWR A;  5EVH A;  4L7K A;  3IPT A;  4XBT A;  3VGN A;  3MG1 A;  4U13 A;  1O7P B;  2STD A;  3FSD A;  2BNG A;  5D81 A;  2HMJ B;  3NUV A;  4HM8 B;  3JUN A;  4IIA A;  1W01 A;  2RFR A;  3KKG A;  3HX8 A;  2BMR B;  2GEX A;  1ZO2 A;  1C7H A;  1JB4 A;  1Q40 B;  4N3V A;  5JPP A;  3MSO A;  3JUO A;  4STD A;  2YFI B;  2GXF A;  4XBY A;  2XSO B;  1JB2 A;  3K7C A;  5TGN A;  1DMM A;  3E99 A;  3ER7 A;  5JPU A;  3DXO A;  1OH0 A;  3UJM A;  1VZZ A;  3NM2 A;  3SOY A;  4FCJ A;  1OF5 A;  1O7W B;  2JQ5 A;  5HGR A;  4XDW A;  1DMN A;  3DMC A;  3SED A;  4HVN A;  2R4I A;  2HMK B;  3GRD A;  1ULJ B;  1NDO B;  5IG4 A;  3JUQ A;  4R9K A;  3G16 A;  4WWU C;  1A2K A;  4HM6 B;  1OPY A;  3T8N A;  1GS3 A;  3LZA A;  1GYB A;  3OWU A;  4X2O A;  2QIY A;  3FH1 A;  2PZV A;  2GEY A;  3JUP A;  4WYK A;  1EA2 A;  3NXJ A;  4HM4 B;  1ULI B;  2B24 B;  3G0K A;  1E97 A;  3F7S A;  2QGU A;  1UUV B;  3B4P A;  5AIG A;  3BLZ A;  4CDL A;  3F8X A;  3F8H A;  2XRX B;  2IMJ A;  1Z1S A;  3I0Y A;  4J9A A;  1JB5 A;  5D83 A;  3GZX B;  8CHO A;  3B7C A;  1O7G B;  2RCD A;  1W02 A;  4PEJ A;  3NV0 A;  1OGZ A;  3F7X A;  5IEN A;  1AR0 A;  5G2G A;  3WMD A;  3B8L A;  3HK4 A;  4XDV A;  4HZB B;  4GB5 A;  2YFJ B;  3D9R A;  4HKV B;  3GZR A;  1GY7 A;  1K41 A;  3H51 A;  4OVM A;  3STD A;  1Q42 A;  2HMM B;  5STD A;  5BXQ A;  4R1K A;  3F14 A;  3RGA A;  1TP6 A;  1ASK A;  1Q40 A;  3LYG A;  5IG3 A;  5IG0 A;  2OWP A;  3KSP A;  2Z7A A;  3EF8 A;  1GY6 A;  2RGQ A;  3EQQ B;  3EN1 B;  3EX9 A;  5AEW B;  3A76 A;  5CF1 A;  1W00 A;  1JKG B;  4WP5 A;  4XM4 A;  5FW5 A;  2HMN B;  2A15 A;  3FKA A;  3ROB A; 
#chains in the Genus database with same CATH topology
 1ZS7 A;  1V74 A;  4N6U A;  3ZFZ A;  5IEP A;  1BUQ A;  1B2Z A;  1KWI A;  1BRK A;  3EBT A;  4HBR A;  1UDI I;  1UI8 A;  1B2U A;  2ZDJ A;  5AIH A;  5AEU B;  1Q81 4;  2LQV A;  1NB5 I;  3LXU X;  3AGN A;  4BTW A;  2D1W A;  3OWY A;  1UGH I;  1LXE A;  1MOL A;  3CC7 3;  2WO0 A;  3DGO A;  2XR8 B;  3K9M C;  1VQ7 3;  2O9U X;  5CLK A;  3BND A;  1N5H A;  1ISK A;  3N9H A;  4I5Q A;  3PGB A;  3A5E A;  3RDE A;  2HOH A;  2CG1 A;  4MJD A;  5M18 A;  5G1L A;  1RCK A;  3D5I A;  2KF5 A;  3MG2 A;  3M8C A;  3AMO A;  5BVB A;  5KP1 A;  4EXR A;  4HM7 B;  1FW7 A;  1UUW B;  1JN5 B;  1BRG A;  1MGR A;  1WNH A;  1G02 A;  1STD A;  2F5M A;  3NQY A;  1M1K 4;  1FUS A;  2CK3 H;  3PCS A;  2ZHX B;  3FG1 A;  3VSY A;  1HYF A;  5DRE A;  2I9W A;  3FF0 A;  1RLS A;  3CD6 3;  1CYU A;  4GSP A;  2QA4 3;  3ECF A;  1BNJ A;  1ROA A;  3KN4 A;  2KF4 A;  3BNB A;  3EE1 A;  1GD4 A;  1I2F A;  2Y74 A;  1IK3 A;  1UW1 A;  3DY5 A;  2XSH B;  1VQ9 3;  4HOH A;  1RRL A;  3AHW A;  5IER A;  3G8Z A;  1VQM 3;  2INX A;  1CYV A;  1MNL A;  3DH2 A;  3G71 3;  2ML6 A;  3N54 B;  2WGO A;  3BU4 A;  1T2H A;  1IVX A;  3KE7 A;  1BSB A;  1WQL B;  5G1K A;  3I56 3;  1W6G A;  3T8U A;  3D3L A;  4TX4 A;  2FGT A;  3X3Z A;  1QAK A;  5IF6 A;  3NHX A;  3CCU 3;  1VQ4 3;  2M7O A;  1RNB A;  1Q86 4;  3QRD A;  2XFT A;  1UI7 A;  4ORL A;  5CF2 A;  3DUK A;  1FYS A;  1QJG A;  4HM0 B;  3FGY A;  5CXO A;  3U1W A;  5AI1 A;  2BHM A;  3V98 A;  1IV9 A;  2PNC A;  1E3V A;  3K63 A;  1B21 A;  2CHC A;  2KF3 A;  4HM3 B;  4LEH A;  4K1V A;  2CC3 A;  1DVD A;  1E3R A;  3AGO A;  2CKF B;  4K1U A;  3K5T A;  1K73 4;  3NM7 A;  5A0O B;  2CX1 A;  1GOV A;  2YFL B;  3SX1 A;  1BGS A;  4CJN A;  1GD3 A;  2CWV A;  2OQE C;  3DGM A;  4IPB A;  3RGR A;  1V57 A;  3MWZ A;  1RGK A;  4KFF A;  3KII A;  1K8A 4;  4OUQ A;  2K54 A;  3HIG A;  3EHC A;  3NV0 B;  4R80 A;  1BRJ A;  4Q53 A;  1LQG C;  3WR2 A;  2K3D A;  2W03 A;  1O7H B;  1BOX A;  4BTY A;  2CFD A;  2F98 A;  3CU3 A;  4X2H A;  1ROV A;  1YIT 3;  1BU4 A;  1QVF 2;  5ELU A;  5AIF A;  3EBY A;  3FLJ A;  1IT7 A;  1YGE A;  6STD A;  1A2V A;  1OUN A;  2BMO B;  1N8R 4;  2H0H A;  4N6V 0;  2OTL 3;  2CIU A;  1JRQ A;  2F99 A;  3PZW A;  1X1X A;  3HZP A;  1A2P A;  3CNX A;  4XBX A;  1FGT A;  1RGC A;  1CH0 A;  3CPW 2;  1VQ6 3;  1DET A;  1Y4K A;  3GAX A;  3WOD G;  3GZY B;  1OHO A;  4HJL B;  1W6Y A;  1N5P A;  2CFW A;  5EEO A;  1UCI A;  1TFO A;  3SLU A;  3MG3 A;  4R9L A;  3UNL A;  2Z76 A;  2ZA4 A;  4HAA A;  1J2B A;  1OHP A;  2P05 A;  5IEO A;  1VQ8 3;  1IQY A;  1RHL A;  1BNR A;  1BNS A;  5KP4 A;  3DZL A;  3CCV 3;  3FCS B;  1D6Z A;  2BMQ B;  1BSC A;  1EEJ A;  4NRE A;  1I70 A;  1VQP 3;  2AAD A;  3BB9 A;  2W6J H;  3JUM A;  4H3U A;  4WHA A;  2RNT A;  1RN1 A;  1NWW A;  2GBX B;  3MHE A;  1O7M B;  1RN4 A;  3U97 A;  4HM5 B;  1US1 A;  3HII A;  1DMQ A;  1HKX A;  3KZT A;  1I3F A;  8RNT A;  3ZG0 A;  2CWU A;  3S67 A;  1WMP A;  3S5C A;  1JKG A;  5FGO A;  3Q90 A;  4LMI A;  4HZ9 B;  1UGI A;  2BO9 B;  1FGM A;  3EN8 A;  3F9S A;  1JZO A;  1RGL A;  4OK0 A;  1FZU A;  1I3I A;  1OCV A;  3DM8 A;  2R41 A;  1LNH A;  1GOY A;  3CCL 3;  3BNC A;  3EC9 A;  3MYT A;  3NBR A;  4HM1 B;  5HOH A;  1OF5 B;  1GMR A;  1QMA A;  1RNT A;  3PS8 A;  3CCR 3;  3K0Z A;  1B3S A;  1VQK 3;  1IVV A;  1BRI A;  3OXA A;  1KC8 4;  1C54 A;  4KT3 B;  1BAO A;  1UCK A;  3EJV A;  3T0U A;  2GBW B;  1NU3 A;  2FXT A;  1Q82 4;  2OOV C;  4BL2 A;  2W56 B;  1CQS A;  3BIR A;  3KCH A;  7STD A;  2FNQ A;  2W9P A;  1SJW A;  2IYJ A;  1ZX2 A;  4DKI A;  4AKY A;  1WTH A;  4L8O A;  2CW9 A;  1TIJ A;  5IW9 A;  2CFG A;  1YI2 3;  1U5O A;  4FMD A;  4GL6 A;  2IY2 A;  2F5W A;  4RZM A;  4FMC A;  5IG5 A;  1SAR A;  3WA2 X;  4JF8 A;  3CXC 2;  1BRS A;  2V1L A;  1JN5 A;  2KCD A;  4XB5 A;  1GMQ A;  3L0R A;  2HML B;  3SVA A;  2MF7 A;  1RGH A;  2OQE A;  4AKZ A;  3CCM 3;  1VQL 3;  3B4O A;  1G96 A;  5CK6 A;  1UUG B;  1IU7 A;  1BSE A;  1RCL A;  1IDP A;  2KAA A;  3AMO B;  3F40 A;  4WYK B;  3SOA A;  1TUH A;  3MKI A;  1JBR A;  7GSP A;  4ZM8 A;  3V92 A;  3OV4 A;  4O8S A;  1OGX A;  4WFO A;  3UL5 A;  1LOX A;  1FGO A;  1GY5 A;  2GU3 A;  3IMA B;  2UX0 A;  2GU1 A;  1G0T A;  4KVH A;  4BU4 A;  4LZI A;  4BTX A;  1BIR A;  2B1X B;  5I97 A;  3GSP A;  2OCT A;  4EV2 A;  4HM2 B;  1RGF A;  1S5A A;  1DYU A;  1JNQ A;  1W2B 2;  4K90 B;  1IVU A;  1D6Y A;  4KFE A;  2C4B A;  4FCM A;  1KSI A;  2HMO B;  3PYJ A;  4EW5 A;  1YJW 3;  1SII A;  2C10 A;  3D4A A;  1EKM A;  3CPO A;  3H3H A;  1OHS A;  2KRT A;  3CNM A;  1YGW A;  3OWS A;  3LOY A;  3GZB A;  3DGL A;  1M9G A;  1VQ5 3;  2CX0 A;  5D82 A;  4KFD A;  3G4S 3;  1R4Y A;  2IA7 A;  2RSX A;  2W0Q A;  1TFK A;  2W2C A;  4L8P A;  1O7N B;  2Z77 A;  1EG9 B;  4EBG A;  3OX9 A;  5KP3 A;  3FF2 A;  1I0V A;  4K61 A;  3X3Y A;  2GSP A;  1CEW I;  3Q3F A;  1STF I;  4I4K A;  1TTO A;  4R4K A;  5DRV A;  2H0G A;  1FUT A;  2Q07 A;  4LGQ A;  1IQ8 A;  1IVW A;  3SYU A;  3FZW A;  3LTD A;  4J8T A;  5AII A;  2F86 B;  2P38 A;  1B2X A;  4QWT A;  5M1A A;  3GWR A;  4N6L A;  1T2I A;  1BSD A;  1RRH A;  1GMP A;  2XH9 A;  3JVC A;  4L7K A;  4RNY A;  5EVH A;  1LOY A;  3IPT A;  4O3V A;  2BU4 A;  1BRH A;  4XBT A;  1ZGX A;  2CFL A;  1B2M A;  2IUK A;  3VGN A;  1NJI 4;  1HU9 A;  3MG1 A;  4U13 A;  2CFK A;  3RNT A;  5LC6 A;  1RSN A;  1O7P B;  1B27 A;  1SQW A;  2L4V A;  3ALA A;  1LQM B;  2STD A;  3FSD A;  4EYC A;  3ZG5 A;  3Q1C A;  2BNG A;  1I2E A;  5D81 A;  2E2T A;  1BNF A;  2HMJ B;  3G6E 3;  3NUV A;  4HM8 B;  3UB1 A;  3JUN A;  4IIA A;  3CMA 3;  3NQZ A;  1W01 A;  2RFR A;  3KKG A;  4EC6 A;  3HX8 A;  1SIH A;  4O2H A;  1RKY A;  2BMR B;  2GEX A;  1MWU A;  1UCJ A;  1YVS A;  2O3O A;  4JRF A;  2OOV A;  1ZO2 A;  1EUI C;  1QAL A;  4J5K A;  1C7H A;  1JB4 A;  1Q40 B;  4N3V A;  1U8C B;  3LT9 A;  5BU4 A;  5JPP A;  3LT8 A;  2P09 A;  3JUO A;  3MSO A;  3CC4 3;  4STD A;  1TRQ A;  2GXF A;  2YFI B;  4XBY A;  4O02 B;  1T3B A;  1PFP A;  2XSO B;  3EB8 A;  1JB2 A;  3D5G A;  3K7C A;  1L5G B;  1M90 4;  4N6M A;  1RGA A;  5TGN A;  4J5G A;  5EQL A;  1BAN A;  1DMM A;  1D6U A;  3IJE B;  1BUJ A;  3E99 A;  3S28 A;  1PYL A;  3ER7 A;  1VQN 3;  2WOF A;  5JPU A;  3DXO A;  1OH0 A;  3WA3 A;  3UJM A;  4LYL B;  3PXM A;  1VZZ A;  3NBJ A;  1N9E A;  3NM2 A;  1AVL A;  3CME 3;  3SOY A;  2E2U A;  4FCJ A;  1OF5 A;  9RNT A;  5M19 A;  1O7W B;  1AVK A;  5AYS C;  1A67 A;  2JQ5 A;  5HGR A;  2K0M A;  4XDW A;  5ELJ A;  1DMN A;  3DMC A;  1IV7 A;  3N8B A;  5BIR A;  1VQO 3;  1W7C A;  3SED A;  1DVC A;  1GOU A;  3MPH A;  4HVN A;  1BVI A;  2R4I A;  2HMK B;  3GRD A;  3KSE D;  2Z6B A;  1JBS A;  3WOF B;  2W56 A;  1ULJ B;  1NDO B;  5IG4 A;  2CG0 A;  2C11 A;  3JUQ A;  3LTB A;  4R9K A;  3G16 A;  4WWU C;  3WDG B;  1A2K A;  2SAR A;  2J8X B;  1V58 A;  3FG4 A;  4HM6 B;  1OPY A;  1LVN A;  3T8N A;  1GS3 A;  1BNI A;  3LZA A;  1RN7 A;  3PCR A;  1YIJ 3;  2KF6 A;  3HI7 A;  1GYB A;  2D42 A;  1SPU A;  4FR9 A;  5RNT A;  2AAE A;  3BNE A;  1OAC A;  3V99 A;  2IUJ A;  3VF1 A;  3OWU A;  2H0I A;  6RNT A;  3HOH A;  1BSA A;  4X2O A;  2P0X A;  1LNI A;  2XGL A;  3Q2P A;  2QIY A;  4AEQ A;  3LML A;  1K28 A;  2PZV A;  2GEY A;  1RMS A;  1NB3 I;  3FH1 A;  3JUP A;  4GHO A;  4WYK A;  4FMA A;  1NO3 A;  1AQZ A;  2WOH A;  4KZ1 A;  4MMZ B;  3UL6 A;  1EA2 A;  2UUG C;  3AHS A;  1RTU A;  3SXX A;  1JJ2 2;  3NXJ A;  2QEX 3;  1F8N A;  2CWT A;  2ML5 A;  1ULI B;  4HM4 B;  4CPK A;  2B24 B;  3G0K A;  3OW2 2;  1B20 A;  1E97 A;  1PY3 A;  1W4N A;  3F7S A;  2QGU A;  1UUV B;  3B4P A;  5AIG A;  1AY7 A;  2XF3 A;  3BLZ A;  1BNE A;  1YNV X;  4MMX B;  1EQK A;  4FMB A;  4CDL A;  3F8X A;  3X41 A;  3D79 A;  4RNZ A;  2XGN A;  7RNT A;  1DE3 A;  1X1Y A;  3F8H A;  2XFS A;  3WOE B;  1FGR A;  1X1U A;  1K9M 4;  2XRX B;  1MGW A;  4LSO A;  1I0X A;  1LRA A;  2IMJ A;  1Z1S A;  3I0Y A;  4J9A A;  1IQX A;  1IYY A;  1JB5 A;  5D83 A;  1LOW A;  3GZX B;  8CHO A;  3B7C A;  1Q7Y 4;  1O7G B;  2RCD A;  1W02 A;  2BT3 A;  4N6N B;  4PEJ A;  6GSP A;  1VQQ A;  1QAF A;  3WHO A;  3NV0 A;  1KQS 2;  1OGZ A;  2YX9 A;  3F7X A;  1QVG 2;  1B2S A;  5IEN A;  4H61 A;  1RDS A;  2WGQ A;  2Y73 A;  1AR0 A;  2L1S A;  1YHQ 3;  3X40 A;  5G2G A;  2JDI H;  3S27 A;  5GSP A;  4MMY B;  1MWR A;  4RBN A;  3TDG A;  1HZ1 A;  2SBL A;  3DGY A;  1LOV A;  1RJO A;  3WMD A;  3B8L A;  4IT7 A;  1GSP A;  1W6C A;  3X42 A;  3HK4 A;  3X3X A;  1JV2 B;  1I2G A;  4GB5 A;  4HZB B;  4XDV A;  1YJ9 3;  2RBI A;  2P0M A;  2YFJ B;  3D9R A;  4HKV B;  1PU4 A;  2BIR A;  1TU5 A;  1YJN 3;  3GZR A;  3LTC A;  1YVB I;  1GY7 A;  1WMO A;  1MWT A;  1Q7H A;  1K41 A;  1FGQ A;  1W2Z A;  4G1M B;  1S72 3;  2XEP A;  4N6O B;  3H51 A;  4OVM A;  3STD A;  1Q42 A;  1M1X B;  5JBS A;  2HMM B;  1T5Y A;  2OTJ 3;  3LTA A;  5STD A;  5BXQ A;  3J7Y d;  3CCJ 3;  3CCE 3;  2E2V A;  2F4Y A;  3NX0 A;  4R1K A;  4BIR A;  1X1W A;  3KFQ C;  3LH4 A;  4HYZ A;  1WMN A;  4MEI A;  1FUW A;  3F14 A;  3RGA A;  1JZD A;  1TP6 A;  3NBB A;  1N8Q A;  1KD1 4;  1ASK A;  2W9Q A;  1TJD A;  1I8V A;  2MC8 A;  2F56 A;  1Q40 A;  2KXG A;  3LYG A;  1W5Z A;  3CC2 3;  5IG3 A;  1A90 A;  1IT8 A;  5IG0 A;  2OWP A;  1JBT A;  1R4C A;  3KSP A;  3FG3 A;  2Z7A A;  3EF8 A;  1GY6 A;  1Q9E A;  1RGE A;  2RGQ A;  3EQQ B;  3DGN A;  3EN1 B;  2LYX A;  3EX9 A;  4BL3 A;  5AEW B;  5AYR B;  1BRN L;  5LC7 A;  1MWS A;  4FCZ A;  1NNV A;  3QK9 A;  4NPB A;  3A76 A;  4ILF A;  3O8Y A;  1AV4 A;  5CF1 A;  3I55 3;  2UGI A;  1W00 A;  2W04 A;  3URP A;  1RGG A;  1JKG B;  2ZL8 A;  4WP5 A;  1UCL A;  1BNG A;  4EV5 A;  4RNT A;  4N6T A;  4XM4 A;  5FW5 A;  2HMN B;  2A15 A;  4CCV A;  1FA3 A;  3FKA A;  1TRP A;  4NHF A;  3ROB A;  3S29 A;  1N9J A;  3CCQ 3;  3CCS 3;  2CH9 A; 
#chains in the Genus database with same CATH homology
 1V74 A;  4N6U A;  5IEP A;  1BUQ A;  1KWI A;  3EBT A;  4HBR A;  1Q81 4;  1NB5 I;  1UI8 A;  2ZDJ A;  5AIH A;  5AEU B;  2LQV A;  3LXU X;  4BTW A;  2D1W A;  3OWY A;  1LXE A;  1MOL A;  3CC7 3;  2WO0 A;  3DGO A;  2XR8 B;  3K9M C;  1VQ7 3;  2O9U X;  5CLK A;  3BND A;  1N5H A;  1ISK A;  3N9H A;  3PGB A;  3RDE A;  2CG1 A;  4MJD A;  3MG2 A;  3M8C A;  3AMO A;  5BVB A;  5KP1 A;  4EXR A;  4HM7 B;  1UUW B;  1JN5 B;  1WNH A;  1M1K 4;  1STD A;  3NQY A;  2CK3 H;  3PCS A;  3FG1 A;  3VSY A;  5DRE A;  2I9W A;  3FF0 A;  3CD6 3;  1CYU A;  2QA4 3;  3ECF A;  1ROA A;  3KN4 A;  3EE1 A;  3BNB A;  1GD4 A;  2Y74 A;  1IK3 A;  1UW1 A;  3DY5 A;  2XSH B;  1VQ9 3;  1RRL A;  5IER A;  3G8Z A;  1VQM 3;  2INX A;  1CYV A;  1MNL A;  3G71 3;  2ML6 A;  3N54 B;  2WGO A;  1IVX A;  3KE7 A;  1WQL B;  3I56 3;  1W6G A;  3T8U A;  3D3L A;  4TX4 A;  2FGT A;  3X3Z A;  1QAK A;  5IF6 A;  3NHX A;  3CCU 3;  1VQ4 3;  2M7O A;  1Q86 4;  3QRD A;  2XFT A;  1UI7 A;  4ORL A;  5CF2 A;  3DUK A;  1QJG A;  4HM0 B;  5CXO A;  3FGY A;  3U1W A;  5AI1 A;  2BHM A;  3V98 A;  1IV9 A;  2PNC A;  1E3V A;  3K63 A;  2CHC A;  4HM3 B;  4LEH A;  4K1V A;  2CC3 A;  1DVD A;  1E3R A;  1K73 4;  2CKF B;  4K1U A;  3K5T A;  3NM7 A;  5A0O B;  2YFL B;  3SX1 A;  1GD3 A;  2CWV A;  2OQE C;  3DGM A;  4IPB A;  3RGR A;  3MWZ A;  4KFF A;  3KII A;  1K8A 4;  4OUQ A;  2K54 A;  3HIG A;  3EHC A;  3NV0 B;  4R80 A;  4Q53 A;  2W03 A;  1O7H B;  4BTY A;  2CFD A;  2F98 A;  3CU3 A;  4X2H A;  1ROV A;  1YIT 3;  1QVF 2;  5ELU A;  5AIF A;  3EBY A;  3FLJ A;  1IT7 A;  1YGE A;  6STD A;  1A2V A;  1OUN A;  2BMO B;  1N8R 4;  4N6V 0;  2OTL 3;  2CIU A;  1JRQ A;  2F99 A;  3PZW A;  3HZP A;  3CNX A;  4XBX A;  3CPW 2;  1FGT A;  1VQ6 3;  1Y4K A;  3GAX A;  3WOD G;  3GZY B;  1OHO A;  4HJL B;  1W6Y A;  1N5P A;  2CFW A;  5EEO A;  1TFO A;  3SLU A;  3MG3 A;  4R9L A;  3UNL A;  2Z76 A;  1J2B A;  2P05 A;  1OHP A;  5IEO A;  1VQ8 3;  1IQY A;  5KP4 A;  3DZL A;  3CCV 3;  3FCS B;  1D6Z A;  2BMQ B;  4NRE A;  1VQP 3;  3BB9 A;  2W6J H;  3JUM A;  4H3U A;  4WHA A;  1NWW A;  2GBX B;  3MHE A;  1O7M B;  3U97 A;  4HM5 B;  1US1 A;  3HII A;  1DMQ A;  1HKX A;  3KZT A;  2CWU A;  3S67 A;  1WMP A;  3S5C A;  1JKG A;  5FGO A;  3Q90 A;  4LMI A;  4HZ9 B;  2BO9 B;  1FGM A;  3EN8 A;  3F9S A;  4OK0 A;  1OCV A;  3DM8 A;  1LNH A;  3CCL 3;  3BNC A;  3EC9 A;  3MYT A;  3NBR A;  4HM1 B;  1OF5 B;  1QMA A;  3PS8 A;  3CCR 3;  3K0Z A;  1VQK 3;  1IVV A;  3OXA A;  1KC8 4;  3EJV A;  3T0U A;  2GBW B;  1NU3 A;  2FXT A;  1Q82 4;  2OOV C;  2W56 B;  1CQS A;  7STD A;  2FNQ A;  2W9P A;  1SJW A;  1ZX2 A;  4AKY A;  1WTH A;  4L8O A;  2CW9 A;  1TIJ A;  5IW9 A;  2CFG A;  1YI2 3;  1U5O A;  4FMD A;  4GL6 A;  4RZM A;  4FMC A;  5IG5 A;  3WA2 X;  4JF8 A;  3CXC 2;  2V1L A;  1JN5 A;  2KCD A;  4XB5 A;  3L0R A;  3SVA A;  2HML B;  2MF7 A;  2OQE A;  4AKZ A;  3CCM 3;  1VQL 3;  3B4O A;  1G96 A;  5CK6 A;  3AMO B;  1IU7 A;  3F40 A;  3SOA A;  1IDP A;  4WYK B;  1TUH A;  3MKI A;  4ZM8 A;  3V92 A;  3OV4 A;  4O8S A;  1OGX A;  4WFO A;  3UL5 A;  1LOX A;  1FGO A;  1GY5 A;  2GU3 A;  3IMA B;  2UX0 A;  2GU1 A;  4KVH A;  4LZI A;  4BTX A;  5I97 A;  2B1X B;  2OCT A;  4EV2 A;  4HM2 B;  1S5A A;  1DYU A;  1JNQ A;  1W2B 2;  4K90 B;  1IVU A;  1D6Y A;  4KFE A;  4FCM A;  1KSI A;  2HMO B;  3PYJ A;  1YJW 3;  1SII A;  2C10 A;  1EKM A;  3CPO A;  3H3H A;  1OHS A;  2KRT A;  3CNM A;  3OWS A;  3LOY A;  3GZB A;  3DGL A;  1M9G A;  1VQ5 3;  5D82 A;  4KFD A;  3G4S 3;  2IA7 A;  2RSX A;  2W0Q A;  1TFK A;  2W2C A;  4L8P A;  1O7N B;  2Z77 A;  1EG9 B;  4EBG A;  3OX9 A;  5KP3 A;  3FF2 A;  4K61 A;  3X3Y A;  1CEW I;  1STF I;  4I4K A;  4R4K A;  5DRV A;  2Q07 A;  4LGQ A;  1IQ8 A;  1IVW A;  3FZW A;  3LTD A;  4J8T A;  5AII A;  2F86 B;  2P38 A;  4QWT A;  3GWR A;  4N6L A;  4RNY A;  1RRH A;  3JVC A;  2XH9 A;  4L7K A;  5EVH A;  3IPT A;  4O3V A;  4XBT A;  2CFL A;  2IUK A;  3VGN A;  1NJI 4;  1HU9 A;  3MG1 A;  4U13 A;  2CFK A;  5LC6 A;  1SQW A;  1O7P B;  2L4V A;  3ALA A;  2STD A;  3FSD A;  4EYC A;  3Q1C A;  2BNG A;  5D81 A;  2E2T A;  2HMJ B;  3G6E 3;  3NUV A;  4HM8 B;  3UB1 A;  3JUN A;  4IIA A;  3CMA 3;  3NQZ A;  1W01 A;  2RFR A;  3KKG A;  4EC6 A;  3HX8 A;  1SIH A;  4O2H A;  1RKY A;  2BMR B;  2GEX A;  2O3O A;  4JRF A;  2OOV A;  1ZO2 A;  1QAL A;  1C7H A;  1JB4 A;  1Q40 B;  4N3V A;  1U8C B;  3LT9 A;  5JPP A;  3LT8 A;  2P09 A;  3JUO A;  3MSO A;  3CC4 3;  4STD A;  2YFI B;  2GXF A;  4XBY A;  4O02 B;  1PFP A;  2XSO B;  3EB8 A;  1JB2 A;  3K7C A;  1L5G B;  1M90 4;  4N6M A;  5TGN A;  5EQL A;  1DMM A;  1D6U A;  3IJE B;  3E99 A;  3S28 A;  3ER7 A;  1VQN 3;  2WOF A;  5JPU A;  3DXO A;  1OH0 A;  3WA3 A;  3UJM A;  3PXM A;  1VZZ A;  3NBJ A;  1N9E A;  3NM2 A;  1AVL A;  3CME 3;  3SOY A;  2E2U A;  4FCJ A;  1OF5 A;  1O7W B;  1AVK A;  5AYS C;  1A67 A;  2JQ5 A;  5HGR A;  2K0M A;  4XDW A;  5ELJ A;  1DMN A;  3DMC A;  1IV7 A;  3N8B A;  1VQO 3;  1W7C A;  3SED A;  1DVC A;  3MPH A;  4HVN A;  2R4I A;  2HMK B;  3GRD A;  3KSE D;  2Z6B A;  3WOF B;  2W56 A;  1ULJ B;  1NDO B;  5IG4 A;  2CG0 A;  2C11 A;  3JUQ A;  3LTB A;  4R9K A;  3G16 A;  4WWU C;  3WDG B;  1A2K A;  3FG4 A;  4HM6 B;  1OPY A;  1LVN A;  3T8N A;  1GS3 A;  3LZA A;  1YIJ 3;  1RN7 A;  3PCR A;  3HI7 A;  1GYB A;  2D42 A;  1SPU A;  4FR9 A;  3BNE A;  3V99 A;  1OAC A;  2IUJ A;  3VF1 A;  3OWU A;  4X2O A;  2P0X A;  2XGL A;  3Q2P A;  2QIY A;  4AEQ A;  3LML A;  1K28 A;  2PZV A;  2GEY A;  3FH1 A;  1NB3 I;  3JUP A;  4WYK A;  4FMA A;  1NO3 A;  2WOH A;  4KZ1 A;  4MMZ B;  3UL6 A;  1EA2 A;  3SXX A;  1JJ2 2;  3NXJ A;  2QEX 3;  1F8N A;  2CWT A;  2ML5 A;  1ULI B;  4HM4 B;  3OW2 2;  2B24 B;  3G0K A;  1E97 A;  1W4N A;  3F7S A;  2QGU A;  1UUV B;  3B4P A;  5AIG A;  2XF3 A;  3BLZ A;  4MMX B;  1EQK A;  4FMB A;  4CDL A;  3F8X A;  3X41 A;  4RNZ A;  2XGN A;  3F8H A;  2XFS A;  3WOE B;  1FGR A;  1K9M 4;  2XRX B;  4LSO A;  2IMJ A;  1Z1S A;  3I0Y A;  4J9A A;  1IQX A;  1JB5 A;  5D83 A;  3GZX B;  8CHO A;  3B7C A;  1Q7Y 4;  1O7G B;  2RCD A;  1W02 A;  2BT3 A;  4N6N B;  4PEJ A;  1QAF A;  1KQS 2;  3NV0 A;  1OGZ A;  2YX9 A;  3F7X A;  1QVG 2;  5IEN A;  4H61 A;  2WGQ A;  2Y73 A;  1AR0 A;  1YHQ 3;  3X40 A;  5G2G A;  2JDI H;  3S27 A;  4MMY B;  4RBN A;  3TDG A;  2SBL A;  1RJO A;  3WMD A;  3B8L A;  4IT7 A;  1W6C A;  3X42 A;  3HK4 A;  3X3X A;  1JV2 B;  4HZB B;  4GB5 A;  4XDV A;  1YJ9 3;  2P0M A;  2YFJ B;  3D9R A;  4HKV B;  1PU4 A;  1TU5 A;  1YJN 3;  3GZR A;  3LTC A;  1YVB I;  1GY7 A;  1WMO A;  1K41 A;  1FGQ A;  1W2Z A;  4G1M B;  1S72 3;  2XEP A;  4N6O B;  3H51 A;  4OVM A;  3STD A;  1Q42 A;  1M1X B;  5JBS A;  2HMM B;  1T5Y A;  2OTJ 3;  3LTA A;  5STD A;  5BXQ A;  3J7Y d;  3CCJ 3;  3CCE 3;  2E2V A;  3NX0 A;  4R1K A;  3KFQ C;  3LH4 A;  4HYZ A;  1WMN A;  4MEI A;  1FUW A;  3F14 A;  3RGA A;  1TP6 A;  3NBB A;  1N8Q A;  1KD1 4;  1ASK A;  2W9Q A;  2MC8 A;  1Q40 A;  2KXG A;  3LYG A;  1W5Z A;  3CC2 3;  5IG3 A;  1A90 A;  1IT8 A;  5IG0 A;  2OWP A;  1R4C A;  3KSP A;  3FG3 A;  2Z7A A;  3EF8 A;  1GY6 A;  2RGQ A;  3EQQ B;  3DGN A;  3EN1 B;  2LYX A;  3EX9 A;  5AEW B;  5AYR B;  5LC7 A;  4FCZ A;  3QK9 A;  3A76 A;  3O8Y A;  1AV4 A;  5CF1 A;  3I55 3;  1W00 A;  2W04 A;  1JKG B;  2ZL8 A;  4WP5 A;  4EV5 A;  4N6T A;  4XM4 A;  5FW5 A;  2HMN B;  2A15 A;  4CCV A;  1FA3 A;  3FKA A;  3S29 A;  4NHF A;  3ROB A;  1N9J A;  3CCQ 3;  3CCS 3;  2CH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...