1I3IA

Ribonuclease t1 v78t mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRTVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i3iA00
3Q3FA 1BVIA 1UCKA 1RGFA 1TRPA 2RBIA 2F56A 1I70A 3WHOA 1B27A 1I3FA 1BRNL 1AY7A 3D4AA 1BSAA 2GSPA 3A5EA 2F5WA 1BOXA 4RNTA 1BRJA 1RNBA 1X1YA 4BU4A 3AGNA 1RDSA 1RHLA 1RTUA 5RNTA 1BSDA 1I8VA 1I2EA 1RNTA 1DETA 1IYYA 1BNGA 3AHSA 6GSPA 1BNIA 1BNFA 4GHOA 5GSPA 1RGGA 1RLSA 4J5GA 5BU4A 2KF6A 1HYFA 1X1UA 3URPA 1B2SA 1RGCA 3AGOA 1YGWA 1T2HA 2KAAA 1RSNA 1RGEA 1BSBA 1RGHA 1C54A 1GOYA 1FW7A 1B2UA 1CH0A 1UCIA 3BU4A 3D5IA 1LOYA 1RGKA 7RNTA 1G02A 1A2PA 1BRHA 1RMSA 1RCLA 1BRSA 3HOHA 1FZUA 1I0VA 2KF4A 2F5MA 3SYUA 2C4BA 2SARA 4J5KA 1YVSA 4BIRA 1B2ZA 1SARA 3GSPA 3RNTA 3KCHA 1GMRA 1FUSA 1BSEA 2ZA4A 1FYSA 3DGYA 1BNRA 1JBSA 1AQZA 1BSCA 1RGLA 2BU4A 1Q9EA 1DE3A 1LNIA 3BIRA 1I0XA 1R4YA 7GSPA 1GOUA 1RN1A 1TRQA 1MGWA 2RNTA 1RCKA 1MGRA 1BRGA 1YNVX 1UCLA 1BNSA 1B21A 4HOHA 1BU4A 1B3SA 2KF5A 8RNTA 1B2MA 3WR2A 3D5GA 1RGAA 1GOVA 1RN4A 4HAAA 1LOVA 2KF3A 9RNTA 1LRAA 1BANA 1I3IA 1BAOA 1BRKA 1LOWA 1GMQA 2AADA 1X1WA 1HZ1A 1JBRA 1BNEA 6RNTA 1B2XA 1BNJA 1TTOA 1ZGXA 1B20A 1UCJA 1BIRA 1I2FA 2F4YA 2HOHA 3DH2A 1PY3A 1JBTA 1FUTA 1BGSA 1PYLA 3AHWA 1I2GA 5BIRA 1T2IA 5HOHA 4GSPA 1GMPA 2BIRA 2AAEA 1BUJA 1X1XA 1GSPA 1BRIA
chains in the Genus database with same CATH superfamily
1UGIA 3VSYA 2W9PA 2WO0A 2R41A 1VZZA 1RGFA 3FG1A 5ELJA 1GD3A 5ELUA 2Z76A 1OGZA 4R4KA 1J2BA 2B1XB 3WHOA 1GS3A 3DMCA 3K7CA 3LZAA 1BRNL 3D4AA 2CH9A 4N6MA 4BL3A 1JB4A 1V57A 2IYJA 3KZTA 2WGOA 6STDA 1T5YA 4MMYB 2F5WA 2XGLA 1FGOA 3EN8A 4BL2A 4KFEA 2FXTA 2RGQA 3EC9A 4BU4A 3AGNA 2Z77A 2HMMB 1BSDA 4XM4A 5G1LA 1BNGA 2IA7A 6GSPA 1BNIA 1BNFA 1O7NB 3WMDA 2GXFA 4FCJA 2YFIB 3LH4A 4J5GA 4N6V0 1O7PB 1QAKA 3NXJA 5BU4A 3CD63 1UUGB 2GEYA 3B4OA 3Q2PA 1IDPA 3F40A 1IU7A 3URPA 3DGNA 1IVVA 3PXMA 3K63A 4GB5A 4O8SA 1YJ93 1T2HA 2K3DA 2KAAA 1RRLA 2R4IA 2CFDA 1RGEA 3H51A 3BNBA 4HM0B 2BHMA 4U13A 4AEQA 1Q824 3JUNA 1C54A 1FW7A 3D5IA 3BU4A 2XGNA 1AVKA 2Q07A 1G02A 1QJGA 4OUQA 3PCSA 5JPPA 3S29A 1BRSA 4GL6A 2BMOB 4XDWA 1LNHA 1VQ43 3CCE3 5AEWB 3D9RA 3KFQC 3CU3A 3I0YA 1V58A 3BB9A 2MC8A 3KE7A 1B2ZA 3WOFB 1Q7Y4 1A67A 1WTHA 1GMRA 3SLUA 1FYSA 4HM5B 3GWRA 3I553 3DGYA 3RGRA 3B4PA 1BNRA 2OQEA 1CQSA 2W56B 1GD4A 3CCR3 4NHFA 4WWUC 3DZLA 3PZWA 2OTL3 4KFFA 2F86B 3Q90A 4L8PA 5G2GA 2I9WA 7GSPA 1MGWA 1RCKA 2ZHXB 1BRGA 1EA2A 1UCLA 3DY5A 3F8XA 3MPHA 4HOHA 3HX8A 2KF5A 1AR0A 2CHCA 3OXAA 3D5GA 1RN4A 2F99A 2GEXA 2P09A 2P38A 3DGLA 4LZIA 4RNZA 2GBWB 4TX4A 3UNLA 1A2KA 3M8CA 1JB5A 3EF8A 3F7XA 1BAOA 1ZS7A 1VQK3 1VQ63 5IG5A 2FGTA 1JBRA 1BNEA 1Q40A 1N8R4 2P0XA 1RN7A 1DVDA 3G8ZA 1KD14 1Y4KA 1VQL3 3FCSB 3PYJA 5FGOA 2WGQA 3LTCA 2P0MA 3DH2A 1FGQA 4BTYA 3CCU3 1CYVA 1VQ73 1FA3A 1OH0A 1BGSA 1E97A 2XH9A 1G96A 4KVHA 1T2IA 1DVCA 1STFI 3OX9A 1WMNA 3E99A 1FGRA 5AI1A 4EC6A 3OWYA 2ML5A 4QWTA 1GYBA 1NWWA 3AMOA 2OCTA 5IEOA 1BUJA 2ZDJA 4EW5A 1OHOA 1O7WB 4XBXA 4G1MB 5AIHA 2CX0A 2E2TA 1EKMA 1BVIA 2UUGC 5EVHA 3NV0A 3EBYA 1TRPA 1CYUA 4WYKB 2F56A 1DYUA 1VQQA 5KP1A 1VQN3 2W2CA 3LTBA 3L0RA 4STDA 1AY7A 1BSAA 1Z1SA 2GSPA 2XF3A 2YFJB 5IW9A 4FCMA 4HM2B 1N9EA 1BOXA 2CKFB 3OV4A 2LYXA 1BRJA 3ER7A 3OWSA 4EXRA 4AKYA 5IG4A 1M9GA 1RDSA 4MMXB 5RNTA 1F8NA 2A15A 1YIT3 3EN1B 1S5AA 2CFGA 3F7SA 3GZXB 3N54B 3RGAA 5EEOA 3AHSA 4WFOA 7STDA 4HM8B 3SOYA 1IT7A 3PGBA 1ASKA 1IVUA 4GHOA 4AKZA 3CPW2 1RLSA 1N9JA 5STDA 1M904 1Q42A 1UW1A 3SXXA 3F8HA 2Y73A 5D82A 4Q53A 2OOVC 2J8XB 1RGCA 1TFOA 1VQO3 5D83A 3PCRA 4WHAA 1W7CA 3LOYA 4OK0A 1BSBA 1O7HB 1RGHA 1GOYA 3CMA3 1QVF2 1ROAA 3HI7A 4HYZA 3MG2A 2XFSA 1RGKA 4RBNA 2CWVA 1K8A4 1A2PA 4JRFA 1RCLA 1JZOA 1JKGA 3S67A 1FZUA 1W2ZA 5M18A 5IG3A 2F5MA 2INXA 1NNVA 2D1WA 3FZWA 1SQWA 4O3VA 4BIRA 3JUQA 4K90B 3RNTA 3KCHA 1VQ83 1IV9A 4LGQA 3ZG5A 1PU4A 1D6YA 1LQGC 3WDGB 1TIJA 4FMCA 3G713 1AQZA 2Y74A 3CC43 4N6NB 1RGLA 2JQ5A 1TJDA 1FUWA 2D42A 2W9QA 1GOUA 1RN1A 1TRQA 3N9HA 3GZBA 1MGRA 4K61A 4R80A 4WP5A 1B21A 1ISKA 1BU4A 1B3SA 3DM8A 8RNTA 2BT3A 5IEPA 1YIJ3 1LXEA 1GOVA 3LYGA 1LQMB 2V1LA 4PEJA 5EQLA 3NM7A 1K28A 1NDOB 2FNQA 3FKAA 3OW22 1JZDA 1YHQ3 3S28A 3EQQB 3I563 1LRAA 1K41A 1N5PA 1I3IA 1JJ22 1LOWA 3MG3A 1STDA 3FSDA 2L1SA 1AV4A 1PFPA 1LOXA 1KC84 4HM3B 1UUVB 1YGEA 1OGXA 2BMRB 1TP6A 1BNJA 1OHSA 2CFWA 1ZGXA 3DXOA 3EB8A 4H61A 1BIRA 3V99A 3HK4A 3BNDA 3KSPA 4HVNA 5M19A 1DMMA 1JBTA 3AHWA 5BIRA 1KSIA 5TGNA 3NQZA 2IUJA 5HOHA 3STDA 2HMJB 3NBRA 1K9M4 1D6ZA 4DKIA 4ZM8A 1NB3I 3G16A 4N6OB 3U97A 1YI23 1LVNA 4FMDA 4BTWA 5D81A 1JNQA 1BRIA 4EYCA 2E2UA 2HMKB 4R9LA 2WOFA 1IV7A 3Q3FA 4HBRA 3CCS3 4HM7B 1JN5B 4HM1B 3CCV3 1KQS2 3U1WA 4MJDA 1N5HA 3GRDA 4N6TA 1I70A 3CCM3 2KRTA 1QALA 2B24B 1ZO2A 3MSOA 1UI8A 4OVMA 4N6UA 2C10A 4FCZA 3CC73 4NREA 1OPYA 4I4KA 3EBTA 1RNBA 5KP3A 2ML6A 2JDIH 5IG0A 1W6CA 3D79A 2QEX3 1T3BA 3X42A 1KWIA 1SIHA 1TU5A 2E2VA 1I2EA 4KZ1A 1DETA 5AYSC 3K9MC 3V92A 4EV5A 1IYYA 3LTAA 3WA3A 3O8YA 5AEUB 3G6E3 3FF0A 3MG1A 2LQVA 1RGGA 3G0KA 3D3LA 3SOAA 3UJMA 4L7KA 3BNEA 3JUPA 3CME3 1W4NA 2KF6A 1HYFA 2OOVA 1O7MB 1X1UA 1B2SA 1Q7HA 1ZX2A 3CPOA 1OF5B 1W6GA 3QK9A 1FGMA 3B8LA 1RSNA 3EX9A 2RFRA 4ORLA 1US1A 3S27A 1B2UA 1CH0A 2XRXB 1LOYA 2M7OA 3BLZA 7RNTA 2CIUA 3QRDA 1MNLA 1HU9A 1IQYA 2C11A 2Z7AA 2CK3H 3HOHA 4L8OA 1EQKA 1RRHA 2KXGA 4CJNA 2OWPA 2C4BA 5CK6A 4K1VA 1VQP3 3RDEA 4J5KA 2RSXA 1YVSA 1UDII 1WQLB 1YVBI 3H3HA 4RNYA 1GY7A 3GSPA 3WOEB 5AIFA 1JRQA 3FLJA 3N8BA 3WA2X 2ZA4A 3CXC2 1O7GB 1WMOA 1WNHA 3KSED 1JBSA 2QGUA 1JV2B 2UGIA 2UX0A 2L4VA 1BSCA 3CC23 1DMQA 1CEWI 3GZYB 1LNIA 3NM2A 3T0UA 2STDA 1R4YA 4ILFA 3TDGA 1S723 5AIIA 3MWZA 3KN4A 5FW5A 1YNVX 5JBSA 1BNSA 4X2OA 3MYTA 3Q1CA 3DGMA 2H0IA 2XR8B 1L5GB 2RCDA 1RGAA 2CWUA 4FMAA 5IERA 1VQ93 3WODG 2BO9B 2CW9A 5HGRA 5IF6A 3X3XA 3CCJ3 1IVXA 4RZMA 3FG4A 1BRKA 3DGOA 4BTXA 3CNXA 1X1WA 4I5QA 5CXOA 3UL6A 2W0QA 3T8NA 1JKGB 3HIIA 2W04A 1TTOA 2QIYA 1B20A 1I2FA 2CG0A 2HOHA 3KKGA 1UI7A 4HKVB 3ROBA 3G4S3 3DUKA 1FGTA 5DRVA 2HMNB 1I2GA 5G1KA 2CX1A 1MWUA 3EJVA 1DMNA 1ROVA 2CWTA 4GSPA 3ZG0A 1VQM3 1GMPA 2H0HA 3X3ZA 2HMLB 5LC7A 1OHPA 3FG3A 2AAEA 2PZVA 3NX0A 4MEIA 1X1XA 1Q814 4NPBA 3OWUA 5CF1A 4EBGA 1SJWA 3IPTA 5BVBA 3NHXA 4N6LA 1YJN3 1IVWA 3HZPA 1UCKA 2BMQB 2Z6BA 4KFDA 3EHCA 4O2HA 2HMOB 1A90A 3X41A 4MMZB 2RBIA 1NU3A 3NQYA 5LC6A 2CFLA 1B27A 1E3RA 1I3FA 5A0OB 1VQ53 4FMBA 3A5EA 1NJI4 4RNTA 2W03A 4K1UA 1X1YA 3FGYA 2W56A 2BNGA 3K0ZA 1RHLA 1RTUA 4KT3B 3ECFA 2CFKA 4CCVA 2XSHB 5AIGA 1NO3A 2K0MA 3VF1A 1I8VA 3LTDA 2OTJ3 1RNTA 5BXQA 5M1AA 1C7HA 1OACA 1IT8A 1QMAA 3CNMA 1UUWB 5GSPA 1GY5A 3UL5A 3NUVA 2XEPA 5DREA 4FR9A 2ZL8A 3GAXA 4R9KA 1MWTA 1EG9B 3NBJA 2XFTA 3A76A 3JUMA 3PS8A 4CPKA 1W01A 8CHOA 1SIIA 1OUNA 3AGOA 1YGWA 3LT8A 3X3YA 2QA43 1RKYA 4HM6B 1N8QA 1UCIA 3F14A 2GU3A 2WOHA 1JN5A 1A2VA 2O9UX 4XDVA 1BRHA 1Q40B 1RMSA 1QAFA 1IQ8A 2PNCA 3JVCA 3S5CA 2MF7A 1U8CB 1I0VA 2CC3A 3GZRA 3CCL3 2KF4A 3VGNA 3ALAA 4HZ9B 3SYUA 2SARA 3V98A 4J9AA 4LEHA 1SARA 1MWRA 2P05A 4JF8A 1FUSA 1BSEA 5CF2A 2H0GA 1ULIB 3JUOA 3EE1A 1IK3A 1AVLA 1V74A 3FH1A 4J8TA 1NB5I 2OQEC 3X40A 2BU4A 1Q9EA 4LMIA 3AMOB 4LYLB 1DE3A 1IQXA 3FF2A 1I0XA 1SPUA 3LT9A 5CLKA 3BIRA 2RNTA 1YJW3 1W00A 3NBBA 3SVAA 3HIGA 3T8UA 4HZBB 1Q864 1D6UA 1BUQA 3SX1A 3LXUX 2CG1A 1B2MA 3WR2A 3NV0B 3ZFZA 5JPUA 3B7CA 4HAAA 1W2B2 1JB2A 4HJLB 1EEJA 3MHEA 1LOVA 1MOLA 1W02A 2IMJA 2KF3A 4WYKA 4XBTA 9RNTA 1OF5A 1U5OA 2YFLB 1BANA 4X2HA 1OCVA 2AADA 1GMQA 4HM4B 4N3VA 1HZ1A 1GY6A 1W6YA 4R1KA 6RNTA 1B2XA 1TUHA 2XSOB 1UGHI 3IMAB 1EUIC 1RJOA 2F98A 1UCJA 2GBXB 3MKIA 4IIAA 4IT7A 4XBYA 3SEDA 2GU1A 4IPBA 2F4YA 1TFKA 2IY2A 4O02B 3LMLA 5I97A 1PY3A 4LSOA 2W6JH 1M1XB 1E3VA 1FUTA 1HKXA 1PYLA 1ULJB 1WMPA 1G0TA 3IJEB 2IUKA 2O3OA 2K54A 2KCDA 1MWSA 4CDLA 5KP4A 2SBLA 3KIIA 4H3UA 3BNCA 3J7Yd 2BIRA 3CCQ3 1W5ZA 4XB5A 5AYRB 5IENA 1GSPA 1R4CA 2YX9A 3F9SA 1QVG2 3UB1A 3K5TA 1M1K4 1K734 4EV2A
chains in the Genus database with same CATH topology
3Q3FA 1BVIA 1UCKA 1RGFA 1TRPA 2RBIA 2F56A 1I70A 3WHOA 1B27A 1I3FA 1BRNL 1AY7A 3D4AA 1BSAA 2GSPA 3A5EA 2F5WA 1BOXA 4RNTA 1BRJA 1RNBA 1X1YA 4BU4A 3AGNA 1RDSA 1RHLA 1RTUA 5RNTA 1BSDA 1I8VA 1I2EA 1RNTA 1DETA 1IYYA 1BNGA 3AHSA 6GSPA 1BNIA 1BNFA 4GHOA 5GSPA 1RGGA 1RLSA 4J5GA 5BU4A 2KF6A 1HYFA 1X1UA 3URPA 1B2SA 1RGCA 3AGOA 1YGWA 1T2HA 2KAAA 1RSNA 1RGEA 1BSBA 1RGHA 1C54A 1GOYA 1FW7A 1B2UA 1CH0A 1UCIA 3BU4A 3D5IA 1LOYA 1RGKA 7RNTA 1G02A 1A2PA 1BRHA 1RMSA 1RCLA 1BRSA 3HOHA 1FZUA 1I0VA 2KF4A 2F5MA 3SYUA 2C4BA 2SARA 4J5KA 1YVSA 4BIRA 1B2ZA 1SARA 3GSPA 3RNTA 3KCHA 1GMRA 1FUSA 1BSEA 2ZA4A 1FYSA 3DGYA 1BNRA 1JBSA 1AQZA 1BSCA 1RGLA 2BU4A 1Q9EA 1DE3A 1LNIA 3BIRA 1I0XA 1R4YA 7GSPA 1GOUA 1RN1A 1TRQA 1MGWA 2RNTA 1RCKA 1MGRA 1BRGA 1YNVX 1UCLA 1BNSA 1B21A 4HOHA 1BU4A 1B3SA 2KF5A 8RNTA 1B2MA 3WR2A 3D5GA 1RGAA 1GOVA 1RN4A 4HAAA 1LOVA 2KF3A 9RNTA 1LRAA 1BANA 1I3IA 1BAOA 1BRKA 1LOWA 1GMQA 2AADA 1X1WA 1HZ1A 1JBRA 1BNEA 6RNTA 1B2XA 1BNJA 1TTOA 1ZGXA 1B20A 1UCJA 1BIRA 1I2FA 2F4YA 2HOHA 3DH2A 1PY3A 1JBTA 1FUTA 1BGSA 1PYLA 3AHWA 1I2GA 5BIRA 1T2IA 5HOHA 4GSPA 1GMPA 2BIRA 2AAEA 1BUJA 1X1XA 1GSPA 1BRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3F A;  1BVI A;  1UCK A;  1RGF A;  1TRP A;  2RBI A;  2F56 A;  1I70 A;  3WHO A;  1B27 A;  1I3F A;  1BRN L;  1AY7 A;  3D4A A;  1BSA A;  2GSP A;  3A5E A;  2F5W A;  1BOX A;  4RNT A;  1BRJ A;  1RNB A;  1X1Y A;  4BU4 A;  3AGN A;  1RDS A;  1RHL A;  1RTU A;  5RNT A;  1BSD A;  1I8V A;  1I2E A;  1RNT A;  1DET A;  1IYY A;  1BNG A;  3AHS A;  6GSP A;  1BNI A;  1BNF A;  4GHO A;  5GSP A;  1RGG A;  1RLS A;  4J5G A;  5BU4 A;  2KF6 A;  1HYF A;  1X1U A;  3URP A;  1B2S A;  1RGC A;  3AGO A;  1YGW A;  1T2H A;  2KAA A;  1RSN A;  1RGE A;  1BSB A;  1RGH A;  1C54 A;  1GOY A;  1FW7 A;  1B2U A;  1CH0 A;  1UCI A;  3BU4 A;  3D5I A;  1LOY A;  1RGK A;  7RNT A;  1G02 A;  1A2P A;  1BRH A;  1RMS A;  1RCL A;  1BRS A;  3HOH A;  1FZU A;  1I0V A;  2KF4 A;  2F5M A;  3SYU A;  2C4B A;  2SAR A;  4J5K A;  1YVS A;  4BIR A;  1B2Z A;  1SAR A;  3GSP A;  3RNT A;  3KCH A;  1GMR A;  1FUS A;  1BSE A;  2ZA4 A;  1FYS A;  3DGY A;  1BNR A;  1JBS A;  1AQZ A;  1BSC A;  1RGL A;  2BU4 A;  1Q9E A;  1DE3 A;  1LNI A;  3BIR A;  1I0X A;  1R4Y A;  7GSP A;  1GOU A;  1RN1 A;  1TRQ A;  1MGW A;  2RNT A;  1RCK A;  1MGR A;  1BRG A;  1YNV X;  1UCL A;  1BNS A;  1B21 A;  4HOH A;  1BU4 A;  1B3S A;  2KF5 A;  8RNT A;  1B2M A;  3WR2 A;  3D5G A;  1RGA A;  1GOV A;  1RN4 A;  4HAA A;  1LOV A;  2KF3 A;  9RNT A;  1LRA A;  1BAN A;  1I3I A;  1BAO A;  1BRK A;  1LOW A;  1GMQ A;  2AAD A;  1X1W A;  1HZ1 A;  1JBR A;  1BNE A;  6RNT A;  1B2X A;  1BNJ A;  1TTO A;  1ZGX A;  1B20 A;  1UCJ A;  1BIR A;  1I2F A;  2F4Y A;  2HOH A;  3DH2 A;  1PY3 A;  1JBT A;  1FUT A;  1BGS A;  1PYL A;  3AHW A;  1I2G A;  5BIR A;  1T2I A;  5HOH A;  4GSP A;  1GMP A;  2BIR A;  2AAE A;  1BUJ A;  1X1X A;  1GSP A;  1BRI A; 
#chains in the Genus database with same CATH topology
 1UGI A;  3VSY A;  2W9P A;  2WO0 A;  2R41 A;  1VZZ A;  1RGF A;  3FG1 A;  5ELJ A;  1GD3 A;  5ELU A;  2Z76 A;  1OGZ A;  4R4K A;  1J2B A;  2B1X B;  3WHO A;  1GS3 A;  3DMC A;  3K7C A;  3LZA A;  1BRN L;  3D4A A;  2CH9 A;  4N6M A;  4BL3 A;  1JB4 A;  1V57 A;  2IYJ A;  3KZT A;  2WGO A;  6STD A;  1T5Y A;  4MMY B;  2F5W A;  2XGL A;  1FGO A;  3EN8 A;  4BL2 A;  4KFE A;  2FXT A;  2RGQ A;  3EC9 A;  4BU4 A;  3AGN A;  2Z77 A;  2HMM B;  1BSD A;  4XM4 A;  5G1L A;  1BNG A;  2IA7 A;  6GSP A;  1BNI A;  1BNF A;  1O7N B;  3WMD A;  2GXF A;  4FCJ A;  2YFI B;  3LH4 A;  4J5G A;  4N6V 0;  1O7P B;  1QAK A;  3NXJ A;  5BU4 A;  3CD6 3;  1UUG B;  2GEY A;  3B4O A;  3Q2P A;  1IDP A;  3F40 A;  1IU7 A;  3URP A;  3DGN A;  1IVV A;  3PXM A;  3K63 A;  4GB5 A;  4O8S A;  1YJ9 3;  1T2H A;  2K3D A;  2KAA A;  1RRL A;  2R4I A;  2CFD A;  1RGE A;  3H51 A;  3BNB A;  4HM0 B;  2BHM A;  4U13 A;  4AEQ A;  1Q82 4;  3JUN A;  1C54 A;  1FW7 A;  3D5I A;  3BU4 A;  2XGN A;  1AVK A;  2Q07 A;  1G02 A;  1QJG A;  4OUQ A;  3PCS A;  5JPP A;  3S29 A;  1BRS A;  4GL6 A;  2BMO B;  4XDW A;  1LNH A;  1VQ4 3;  3CCE 3;  5AEW B;  3D9R A;  3KFQ C;  3CU3 A;  3I0Y A;  1V58 A;  3BB9 A;  2MC8 A;  3KE7 A;  1B2Z A;  3WOF B;  1Q7Y 4;  1A67 A;  1WTH A;  1GMR A;  3SLU A;  1FYS A;  4HM5 B;  3GWR A;  3I55 3;  3DGY A;  3RGR A;  3B4P A;  1BNR A;  2OQE A;  1CQS A;  2W56 B;  1GD4 A;  3CCR 3;  4NHF A;  4WWU C;  3DZL A;  3PZW A;  2OTL 3;  4KFF A;  2F86 B;  3Q90 A;  4L8P A;  5G2G A;  2I9W A;  7GSP A;  1MGW A;  1RCK A;  2ZHX B;  1BRG A;  1EA2 A;  1UCL A;  3DY5 A;  3F8X A;  3MPH A;  4HOH A;  3HX8 A;  2KF5 A;  1AR0 A;  2CHC A;  3OXA A;  3D5G A;  1RN4 A;  2F99 A;  2GEX A;  2P09 A;  2P38 A;  3DGL A;  4LZI A;  4RNZ A;  2GBW B;  4TX4 A;  3UNL A;  1A2K A;  3M8C A;  1JB5 A;  3EF8 A;  3F7X A;  1BAO A;  1ZS7 A;  1VQK 3;  1VQ6 3;  5IG5 A;  2FGT A;  1JBR A;  1BNE A;  1Q40 A;  1N8R 4;  2P0X A;  1RN7 A;  1DVD A;  3G8Z A;  1KD1 4;  1Y4K A;  1VQL 3;  3FCS B;  3PYJ A;  5FGO A;  2WGQ A;  3LTC A;  2P0M A;  3DH2 A;  1FGQ A;  4BTY A;  3CCU 3;  1CYV A;  1VQ7 3;  1FA3 A;  1OH0 A;  1BGS A;  1E97 A;  2XH9 A;  1G96 A;  4KVH A;  1T2I A;  1DVC A;  1STF I;  3OX9 A;  1WMN A;  3E99 A;  1FGR A;  5AI1 A;  4EC6 A;  3OWY A;  2ML5 A;  4QWT A;  1GYB A;  1NWW A;  3AMO A;  2OCT A;  5IEO A;  1BUJ A;  2ZDJ A;  4EW5 A;  1OHO A;  1O7W B;  4XBX A;  4G1M B;  5AIH A;  2CX0 A;  2E2T A;  1EKM A;  1BVI A;  2UUG C;  5EVH A;  3NV0 A;  3EBY A;  1TRP A;  1CYU A;  4WYK B;  2F56 A;  1DYU A;  1VQQ A;  5KP1 A;  1VQN 3;  2W2C A;  3LTB A;  3L0R A;  4STD A;  1AY7 A;  1BSA A;  1Z1S A;  2GSP A;  2XF3 A;  2YFJ B;  5IW9 A;  4FCM A;  4HM2 B;  1N9E A;  1BOX A;  2CKF B;  3OV4 A;  2LYX A;  1BRJ A;  3ER7 A;  3OWS A;  4EXR A;  4AKY A;  5IG4 A;  1M9G A;  1RDS A;  4MMX B;  5RNT A;  1F8N A;  2A15 A;  1YIT 3;  3EN1 B;  1S5A A;  2CFG A;  3F7S A;  3GZX B;  3N54 B;  3RGA A;  5EEO A;  3AHS A;  4WFO A;  7STD A;  4HM8 B;  3SOY A;  1IT7 A;  3PGB A;  1ASK A;  1IVU A;  4GHO A;  4AKZ A;  3CPW 2;  1RLS A;  1N9J A;  5STD A;  1M90 4;  1Q42 A;  1UW1 A;  3SXX A;  3F8H A;  2Y73 A;  5D82 A;  4Q53 A;  2OOV C;  2J8X B;  1RGC A;  1TFO A;  1VQO 3;  5D83 A;  3PCR A;  4WHA A;  1W7C A;  3LOY A;  4OK0 A;  1BSB A;  1O7H B;  1RGH A;  1GOY A;  3CMA 3;  1QVF 2;  1ROA A;  3HI7 A;  4HYZ A;  3MG2 A;  2XFS A;  1RGK A;  4RBN A;  2CWV A;  1K8A 4;  1A2P A;  4JRF A;  1RCL A;  1JZO A;  1JKG A;  3S67 A;  1FZU A;  1W2Z A;  5M18 A;  5IG3 A;  2F5M A;  2INX A;  1NNV A;  2D1W A;  3FZW A;  1SQW A;  4O3V A;  4BIR A;  3JUQ A;  4K90 B;  3RNT A;  3KCH A;  1VQ8 3;  1IV9 A;  4LGQ A;  3ZG5 A;  1PU4 A;  1D6Y A;  1LQG C;  3WDG B;  1TIJ A;  4FMC A;  3G71 3;  1AQZ A;  2Y74 A;  3CC4 3;  4N6N B;  1RGL A;  2JQ5 A;  1TJD A;  1FUW A;  2D42 A;  2W9Q A;  1GOU A;  1RN1 A;  1TRQ A;  3N9H A;  3GZB A;  1MGR A;  4K61 A;  4R80 A;  4WP5 A;  1B21 A;  1ISK A;  1BU4 A;  1B3S A;  3DM8 A;  8RNT A;  2BT3 A;  5IEP A;  1YIJ 3;  1LXE A;  1GOV A;  3LYG A;  1LQM B;  2V1L A;  4PEJ A;  5EQL A;  3NM7 A;  1K28 A;  1NDO B;  2FNQ A;  3FKA A;  3OW2 2;  1JZD A;  1YHQ 3;  3S28 A;  3EQQ B;  3I56 3;  1LRA A;  1K41 A;  1N5P A;  1I3I A;  1JJ2 2;  1LOW A;  3MG3 A;  1STD A;  3FSD A;  2L1S A;  1AV4 A;  1PFP A;  1LOX A;  1KC8 4;  4HM3 B;  1UUV B;  1YGE A;  1OGX A;  2BMR B;  1TP6 A;  1BNJ A;  1OHS A;  2CFW A;  1ZGX A;  3DXO A;  3EB8 A;  4H61 A;  1BIR A;  3V99 A;  3HK4 A;  3BND A;  3KSP A;  4HVN A;  5M19 A;  1DMM A;  1JBT A;  3AHW A;  5BIR A;  1KSI A;  5TGN A;  3NQZ A;  2IUJ A;  5HOH A;  3STD A;  2HMJ B;  3NBR A;  1K9M 4;  1D6Z A;  4DKI A;  4ZM8 A;  1NB3 I;  3G16 A;  4N6O B;  3U97 A;  1YI2 3;  1LVN A;  4FMD A;  4BTW A;  5D81 A;  1JNQ A;  1BRI A;  4EYC A;  2E2U A;  2HMK B;  4R9L A;  2WOF A;  1IV7 A;  3Q3F A;  4HBR A;  3CCS 3;  4HM7 B;  1JN5 B;  4HM1 B;  3CCV 3;  1KQS 2;  3U1W A;  4MJD A;  1N5H A;  3GRD A;  4N6T A;  1I70 A;  3CCM 3;  2KRT A;  1QAL A;  2B24 B;  1ZO2 A;  3MSO A;  1UI8 A;  4OVM A;  4N6U A;  2C10 A;  4FCZ A;  3CC7 3;  4NRE A;  1OPY A;  4I4K A;  3EBT A;  1RNB A;  5KP3 A;  2ML6 A;  2JDI H;  5IG0 A;  1W6C A;  3D79 A;  2QEX 3;  1T3B A;  3X42 A;  1KWI A;  1SIH A;  1TU5 A;  2E2V A;  1I2E A;  4KZ1 A;  1DET A;  5AYS C;  3K9M C;  3V92 A;  4EV5 A;  1IYY A;  3LTA A;  3WA3 A;  3O8Y A;  5AEU B;  3G6E 3;  3FF0 A;  3MG1 A;  2LQV A;  1RGG A;  3G0K A;  3D3L A;  3SOA A;  3UJM A;  4L7K A;  3BNE A;  3JUP A;  3CME 3;  1W4N A;  2KF6 A;  1HYF A;  2OOV A;  1O7M B;  1X1U A;  1B2S A;  1Q7H A;  1ZX2 A;  3CPO A;  1OF5 B;  1W6G A;  3QK9 A;  1FGM A;  3B8L A;  1RSN A;  3EX9 A;  2RFR A;  4ORL A;  1US1 A;  3S27 A;  1B2U A;  1CH0 A;  2XRX B;  1LOY A;  2M7O A;  3BLZ A;  7RNT A;  2CIU A;  3QRD A;  1MNL A;  1HU9 A;  1IQY A;  2C11 A;  2Z7A A;  2CK3 H;  3HOH A;  4L8O A;  1EQK A;  1RRH A;  2KXG A;  4CJN A;  2OWP A;  2C4B A;  5CK6 A;  4K1V A;  1VQP 3;  3RDE A;  4J5K A;  2RSX A;  1YVS A;  1UDI I;  1WQL B;  1YVB I;  3H3H A;  4RNY A;  1GY7 A;  3GSP A;  3WOE B;  5AIF A;  1JRQ A;  3FLJ A;  3N8B A;  3WA2 X;  2ZA4 A;  3CXC 2;  1O7G B;  1WMO A;  1WNH A;  3KSE D;  1JBS A;  2QGU A;  1JV2 B;  2UGI A;  2UX0 A;  2L4V A;  1BSC A;  3CC2 3;  1DMQ A;  1CEW I;  3GZY B;  1LNI A;  3NM2 A;  3T0U A;  2STD A;  1R4Y A;  4ILF A;  3TDG A;  1S72 3;  5AII A;  3MWZ A;  3KN4 A;  5FW5 A;  1YNV X;  5JBS A;  1BNS A;  4X2O A;  3MYT A;  3Q1C A;  3DGM A;  2H0I A;  2XR8 B;  1L5G B;  2RCD A;  1RGA A;  2CWU A;  4FMA A;  5IER A;  1VQ9 3;  3WOD G;  2BO9 B;  2CW9 A;  5HGR A;  5IF6 A;  3X3X A;  3CCJ 3;  1IVX A;  4RZM A;  3FG4 A;  1BRK A;  3DGO A;  4BTX A;  3CNX A;  1X1W A;  4I5Q A;  5CXO A;  3UL6 A;  2W0Q A;  3T8N A;  1JKG B;  3HII A;  2W04 A;  1TTO A;  2QIY A;  1B20 A;  1I2F A;  2CG0 A;  2HOH A;  3KKG A;  1UI7 A;  4HKV B;  3ROB A;  3G4S 3;  3DUK A;  1FGT A;  5DRV A;  2HMN B;  1I2G A;  5G1K A;  2CX1 A;  1MWU A;  3EJV A;  1DMN A;  1ROV A;  2CWT A;  4GSP A;  3ZG0 A;  1VQM 3;  1GMP A;  2H0H A;  3X3Z A;  2HML B;  5LC7 A;  1OHP A;  3FG3 A;  2AAE A;  2PZV A;  3NX0 A;  4MEI A;  1X1X A;  1Q81 4;  4NPB A;  3OWU A;  5CF1 A;  4EBG A;  1SJW A;  3IPT A;  5BVB A;  3NHX A;  4N6L A;  1YJN 3;  1IVW A;  3HZP A;  1UCK A;  2BMQ B;  2Z6B A;  4KFD A;  3EHC A;  4O2H A;  2HMO B;  1A90 A;  3X41 A;  4MMZ B;  2RBI A;  1NU3 A;  3NQY A;  5LC6 A;  2CFL A;  1B27 A;  1E3R A;  1I3F A;  5A0O B;  1VQ5 3;  4FMB A;  3A5E A;  1NJI 4;  4RNT A;  2W03 A;  4K1U A;  1X1Y A;  3FGY A;  2W56 A;  2BNG A;  3K0Z A;  1RHL A;  1RTU A;  4KT3 B;  3ECF A;  2CFK A;  4CCV A;  2XSH B;  5AIG A;  1NO3 A;  2K0M A;  3VF1 A;  1I8V A;  3LTD A;  2OTJ 3;  1RNT A;  5BXQ A;  5M1A A;  1C7H A;  1OAC A;  1IT8 A;  1QMA A;  3CNM A;  1UUW B;  5GSP A;  1GY5 A;  3UL5 A;  3NUV A;  2XEP A;  5DRE A;  4FR9 A;  2ZL8 A;  3GAX A;  4R9K A;  1MWT A;  1EG9 B;  3NBJ A;  2XFT A;  3A76 A;  3JUM A;  3PS8 A;  4CPK A;  1W01 A;  8CHO A;  1SII A;  1OUN A;  3AGO A;  1YGW A;  3LT8 A;  3X3Y A;  2QA4 3;  1RKY A;  4HM6 B;  1N8Q A;  1UCI A;  3F14 A;  2GU3 A;  2WOH A;  1JN5 A;  1A2V A;  2O9U X;  4XDV A;  1BRH A;  1Q40 B;  1RMS A;  1QAF A;  1IQ8 A;  2PNC A;  3JVC A;  3S5C A;  2MF7 A;  1U8C B;  1I0V A;  2CC3 A;  3GZR A;  3CCL 3;  2KF4 A;  3VGN A;  3ALA A;  4HZ9 B;  3SYU A;  2SAR A;  3V98 A;  4J9A A;  4LEH A;  1SAR A;  1MWR A;  2P05 A;  4JF8 A;  1FUS A;  1BSE A;  5CF2 A;  2H0G A;  1ULI B;  3JUO A;  3EE1 A;  1IK3 A;  1AVL A;  1V74 A;  3FH1 A;  4J8T A;  1NB5 I;  2OQE C;  3X40 A;  2BU4 A;  1Q9E A;  4LMI A;  3AMO B;  4LYL B;  1DE3 A;  1IQX A;  3FF2 A;  1I0X A;  1SPU A;  3LT9 A;  5CLK A;  3BIR A;  2RNT A;  1YJW 3;  1W00 A;  3NBB A;  3SVA A;  3HIG A;  3T8U A;  4HZB B;  1Q86 4;  1D6U A;  1BUQ A;  3SX1 A;  3LXU X;  2CG1 A;  1B2M A;  3WR2 A;  3NV0 B;  3ZFZ A;  5JPU A;  3B7C A;  4HAA A;  1W2B 2;  1JB2 A;  4HJL B;  1EEJ A;  3MHE A;  1LOV A;  1MOL A;  1W02 A;  2IMJ A;  2KF3 A;  4WYK A;  4XBT A;  9RNT A;  1OF5 A;  1U5O A;  2YFL B;  1BAN A;  4X2H A;  1OCV A;  2AAD A;  1GMQ A;  4HM4 B;  4N3V A;  1HZ1 A;  1GY6 A;  1W6Y A;  4R1K A;  6RNT A;  1B2X A;  1TUH A;  2XSO B;  1UGH I;  3IMA B;  1EUI C;  1RJO A;  2F98 A;  1UCJ A;  2GBX B;  3MKI A;  4IIA A;  4IT7 A;  4XBY A;  3SED A;  2GU1 A;  4IPB A;  2F4Y A;  1TFK A;  2IY2 A;  4O02 B;  3LML A;  5I97 A;  1PY3 A;  4LSO A;  2W6J H;  1M1X B;  1E3V A;  1FUT A;  1HKX A;  1PYL A;  1ULJ B;  1WMP A;  1G0T A;  3IJE B;  2IUK A;  2O3O A;  2K54 A;  2KCD A;  1MWS A;  4CDL A;  5KP4 A;  2SBL A;  3KII A;  4H3U A;  3BNC A;  3J7Y d;  2BIR A;  3CCQ 3;  1W5Z A;  4XB5 A;  5AYR B;  5IEN A;  1GSP A;  1R4C A;  2YX9 A;  3F9S A;  1QVG 2;  3UB1 A;  3K5T A;  1M1K 4;  1K73 4;  4EV2 A; 
#chains in the Genus database with same CATH homology
 3Q3F A;  1BVI A;  1UCK A;  1RGF A;  1TRP A;  2RBI A;  2F56 A;  1I70 A;  3WHO A;  1B27 A;  1I3F A;  1BRN L;  1AY7 A;  3D4A A;  1BSA A;  2GSP A;  3A5E A;  2F5W A;  1BOX A;  4RNT A;  1BRJ A;  1RNB A;  1X1Y A;  4BU4 A;  3AGN A;  1RDS A;  1RHL A;  1RTU A;  5RNT A;  1BSD A;  1I8V A;  1I2E A;  1RNT A;  1DET A;  1IYY A;  1BNG A;  3AHS A;  6GSP A;  1BNI A;  1BNF A;  4GHO A;  5GSP A;  1RGG A;  1RLS A;  4J5G A;  5BU4 A;  2KF6 A;  1HYF A;  1X1U A;  3URP A;  1B2S A;  1RGC A;  3AGO A;  1YGW A;  1T2H A;  2KAA A;  1RSN A;  1RGE A;  1BSB A;  1RGH A;  1C54 A;  1GOY A;  1FW7 A;  1B2U A;  1CH0 A;  1UCI A;  3BU4 A;  3D5I A;  1LOY A;  1RGK A;  7RNT A;  1G02 A;  1A2P A;  1BRH A;  1RMS A;  1RCL A;  1BRS A;  3HOH A;  1FZU A;  1I0V A;  2KF4 A;  2F5M A;  3SYU A;  2C4B A;  2SAR A;  4J5K A;  1YVS A;  4BIR A;  1B2Z A;  1SAR A;  3GSP A;  3RNT A;  3KCH A;  1GMR A;  1FUS A;  1BSE A;  2ZA4 A;  1FYS A;  3DGY A;  1BNR A;  1JBS A;  1AQZ A;  1BSC A;  1RGL A;  2BU4 A;  1Q9E A;  1DE3 A;  1LNI A;  3BIR A;  1I0X A;  1R4Y A;  7GSP A;  1GOU A;  1RN1 A;  1TRQ A;  1MGW A;  2RNT A;  1RCK A;  1MGR A;  1BRG A;  1YNV X;  1UCL A;  1BNS A;  1B21 A;  4HOH A;  1BU4 A;  1B3S A;  2KF5 A;  8RNT A;  1B2M A;  3WR2 A;  3D5G A;  1RGA A;  1GOV A;  1RN4 A;  4HAA A;  1LOV A;  2KF3 A;  9RNT A;  1LRA A;  1BAN A;  1I3I A;  1BAO A;  1BRK A;  1LOW A;  1GMQ A;  2AAD A;  1X1W A;  1HZ1 A;  1JBR A;  1BNE A;  6RNT A;  1B2X A;  1BNJ A;  1TTO A;  1ZGX A;  1B20 A;  1UCJ A;  1BIR A;  1I2F A;  2F4Y A;  2HOH A;  3DH2 A;  1PY3 A;  1JBT A;  1FUT A;  1BGS A;  1PYL A;  3AHW A;  1I2G A;  5BIR A;  1T2I A;  5HOH A;  4GSP A;  1GMP A;  2BIR A;  2AAE A;  1BUJ A;  1X1X A;  1GSP A;  1BRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...