5BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5bu4A00
2SARA 1BSAA 2GSPA 1AQZA 1RGAA 4GHOA 1B2MA 1B2ZA 5BIRA 3WHOA 1YGWA 1GOYA 1JBTA 1DE3A 2KF3A 1BNJA 1RLSA 1BRSA 3GSPA 1RN1A 1BSEA 1I0XA 1BNEA 7GSPA 1X1YA 2RBIA 1YNVX 3AGNA 1MGWA 5BU4A 1B3SA 1PYLA 1UCLA 1TTOA 1Q9EA 2AAEA 2KF5A 3HOHA 1MGRA 1BRNL 2F5WA 3D4AA 3D5GA 1LNIA 2KF4A 1BRIA 1BOXA 1RTUA 1B20A 1FYSA 3SYUA 1BAOA 2HOHA 1LOWA 6GSPA 1LOYA 2RNTA 3DH2A 1TRQA 1I0VA 1BNRA 1BANA 1I8VA 2AADA 1GOVA 1BUJA 3RNTA 2C4BA 1GMPA 1RGCA 1HYFA 3URPA 1RSNA 1T2IA 4J5KA 3AHSA 1PY3A 1R4YA 1JBRA 1BU4A 1B21A 1BNIA 7RNTA 1T2HA 1RGHA 1I3IA 1GSPA 1I3FA 1BSCA 3DGYA 1X1UA 1B2XA 1FW7A 1A2PA 1RGEA 1JBSA 3Q3FA 1RGKA 3AHWA 1AY7A 1B2SA 1BRHA 4BIRA 1BNSA 1C54A 1LOVA 1RGLA 3BU4A 1G02A 1LRAA 3AGOA 1BSDA 9RNTA 1UCIA 1TRPA 6RNTA 1BRKA 1IYYA 1RGGA 4HAAA 1I2EA 2F56A 5GSPA 4GSPA 1FZUA 1X1XA 1YVSA 1BRJA 1SARA 2F5MA 2KF6A 1B27A 1RCKA 3A5EA 1I2FA 1RNBA 3BIRA 4BU4A 1RHLA 1RCLA 1FUTA 1BIRA 4HOHA 2BIRA 5RNTA 1GMRA 3WR2A 1BVIA 2F4YA 2KAAA 1RGFA 1RN4A 2BU4A 1CH0A 3D5IA 3KCHA 4J5GA 2ZA4A 8RNTA 1ZGXA 1RMSA 5HOHA 1RNTA 4RNTA 1DETA 1FUSA 1BNGA 1RDSA 1I70A 1I2GA 1HZ1A 1X1WA 1BRGA 1BGSA 1GMQA 1B2UA 1BSBA 1GOUA 1UCJA 1BNFA 1UCKA
chains in the Genus database with same CATH superfamily
3ALAA 1NO3A 2Z77A 4K61A 3ECFA 2GSPA 2Z7AA 1AQZA 4N6NB 3T0UA 1B2MA 4AEQA 3WHOA 3QK9A 3CCL3 2CH9A 2O3OA 2BMOB 2H0HA 1OCVA 2C11A 3KSPA 1QVG2 1I0XA 1BNEA 2Y73A 4GL6A 1EQKA 2BMQB 4R4KA 1EG9B 5BU4A 1B3SA 1IV9A 5IEPA 4KFDA 1G96A 1Q9EA 2AAEA 2RFRA 5IERA 2WOHA 3WOFB 3G713 3FF2A 2CFLA 3SOYA 2ZDJA 4HJLB 5FGOA 3HI7A 1O7NB 2W2CA 3EN1B 2CK3H 3DZLA 1RKYA 5AIHA 5LC6A 2HMJB 1JNQA 2IA7A 3SYUA 1BAOA 3ZFZA 1CYVA 3X40A 3S27A 3EBYA 3NXJA 3DH2A 4KFEA 1TRQA 3OXAA 3Q2PA 1BNRA 4N3VA 2YFJB 1BANA 3QRDA 1I8VA 1BUJA 3RNTA 1OGZA 3MPHA 1GY5A 3URPA 5IG4A 1DYUA 3MHEA 2IUJA 1JN5A 1BU4A 4L7KA 3V92A 3KSED 4EW5A 1NB5I 2ML5A 3N54B 3FG1A 3ER7A 3DGYA 1B2XA 1A2PA 3NBRA 1JBSA 2PZVA 1JRQA 2E2TA 2HMLB 1RGKA 2F98A 2R4IA 4HZBB 4R1KA 5M1AA 1ULJB 3WOEB 4DKIA 4K90B 2GBWB 1BRHA 3B4PA 4J8TA 4XB5A 1C54A 4MEIA 1W6YA 4XDVA 3BU4A 4XBYA 3NQYA 3A76A 3X3YA 5EQLA 9RNTA 1OHOA 1TRPA 1VQ53 2A15A 4WYKA 1IYYA 3NX0A 3GZRA 1M1K4 5GSPA 1E97A 1FGQA 2F56A 3OWUA 1IVXA 1X1XA 1Y4KA 4GSPA 3ZG5A 1T3BA 3WDGB 1SARA 3CCS3 2MC8A 1B27A 1A67A 1UDII 4CJNA 1IV7A 3AMOB 3BIRA 4L8OA 4WFOA 3IJEB 1FA3A 1RCLA 4N6TA 2BT3A 2CHCA 2IUKA 3T8UA 2BIRA 4N6UA 1L5GB 1GMRA 3DXOA 1YIJ3 3F40A 4ZM8A 2F4YA 1RGFA 3VF1A 3X3XA 1VZZA 4R80A 4CDLA 1CH0A 1S723 1EUIC 4J5GA 1STFI 2KXGA 2HMNB 1AVLA 4RNTA 4IT7A 3NBBA 1KD14 3LOYA 4FMCA 1UGIA 2KRTA 3CC73 3F9SA 1TFKA 4GB5A 1DETA 4HM4B 1MWUA 4O8SA 1OGXA 4LEHA 4WHAA 3KKGA 3MG3A 1JZDA 2OQEA 1SIHA 4O2HA 1VQP3 1IVWA 3BNDA 4JF8A 2GU3A 1RJOA 3I0YA 4H61A 3CCV3 3NM2A 2RSXA 2I9WA 5D82A 1BNFA 1IVVA 1UCKA 3RGAA 3T8NA 4BL2A 1EA2A 2STDA 1GD3A 4NHFA 3VGNA 4OVMA 4OUQA 5AIIA 4GHOA 1B2ZA 3FH1A 3EHCA 1YGWA 1LNHA 5JPUA 1JBTA 3KIIA 2KF3A 4HM2B 1A2VA 5KP1A 1IDPA 3CC23 2P0MA 4EBGA 2XFTA 1U8CB 4NPBA 1BSEA 1W02A 2IYJA 1X1YA 3AGNA 1QJGA 1MGWA 1TUHA 2B1XB 4K1VA 4N6MA 4R9KA 2CKFB 1DMQA 3X42A 1WMPA 1TU5A 3SVAA 2GBXB 2KF5A 4HM8B 4HVNA 1JN5B 2CG1A 3LTCA 5IW9A 3U1WA 2MF7A 1KC84 1BRNL 2F5WA 4Q53A 2XRXB 3D4AA 1E3VA 1UW1A 1UUWB 1VQL3 4CCVA 3FF0A 3JUMA 3CXC2 5IF6A 3DUKA 1BOXA 2XR8B 3BLZA 3NM7A 1RTUA 4JRFA 1FYSA 3PZWA 1FGMA 2HOHA 5EEOA 4FR9A 1ASKA 1LOWA 2CFKA 3PCRA 6GSPA 5JBSA 1Q7Y4 5HGRA 3H3HA 1TJDA 1I0VA 5AEWB 1MWTA 1UUGB 2ZL8A 1GOVA 3CC43 2C4BA 2W0QA 1RGCA 3GAXA 4WYKB 2OQEC 1IVUA 3FZWA 1WQLB 2BMRB 3KE7A 5KP3A 4BTYA 1CEWI 3AHSA 1W00A 1PY3A 3F8HA 3MKIA 3DGMA 3MWZA 3Q90A 4H3UA 1B21A 3U97A 3HX8A 2JDIH 7RNTA 1JBRA 1GY7A 1Q814 1YJW3 3G4S3 1RGHA 4FMBA 3JUNA 1GSPA 3EN8A 2XEPA 1FW7A 1IT8A 3UB1A 3SOAA 2JQ5A 3DMCA 4EXRA 3KZTA 1ZO2A 2XSHB 2K54A 1N9EA 1HU9A 2L1SA 3JVCA 5M19A 5CF1A 4OK0A 1NWWA 4XBXA 1W01A 3CCR3 3G16A 1G02A 1JKGA 1LRAA 3G0KA 4FCJA 1VQ43 2H0IA 1EEJA 2PNCA 3CCU3 3HK4A 3VSYA 1VQ83 1NU3A 1Q42A 4HAAA 2INXA 1I2EA 3EE1A 1ROVA 2IMJA 4BL3A 1DVCA 3J7Yd 1JB4A 1V57A 2F5MA 3MG2A 3A5EA 5IG5A 4TX4A 5DRVA 1TIJA 1W5ZA 2QIYA 2WGQA 2W04A 2D42A 2W9PA 1FUTA 1BIRA 1FGRA 2K0MA 1N8R4 2L4VA 3CCJ3 1JJ22 3S5CA 3WR2A 1A2KA 1BVIA 3CPW2 4N6LA 5AYRB 2KAAA 4LGQA 1RN4A 3S28A 4AKZA 1D6UA 1OACA 3NV0A 8RNTA 2YFLB 1ZGXA 4KFFA 2GXFA 3WA3A 2BHMA 2LYXA 1GD4A 1RNTA 3DY5A 3E99A 5IG3A 1WMOA 3DGOA 4HM3B 3KFQC 5A0OB 4BTWA 1IT7A 1R4CA 1OUNA 1RDSA 1I70A 1JB5A 2UGIA 1VQM3 2C10A 2FGTA 1BRGA 1O7MB 2WGOA 5CXOA 1B2UA 4IIAA 1BSBA 5STDA 1TFOA 3EX9A 4KZ1A 1GOUA 4XDWA 1W6GA 2CWTA 3S29A 5DREA 2SARA 1G0TA 4HM1B 3OV4A 1BSAA 5AYSC 2BNGA 5G2GA 3PCSA 1NB3I 1YGEA 2FXTA 3FSDA 2QEX3 3GWRA 4HZ9B 1EKMA 1BNJA 1RLSA 1LQMB 1W2B2 1RN1A 1K28A 4I4KA 1YNVX 2GU1A 3F8XA 3Q1CA 1ZX2A 1PYLA 3K5TA 1QAKA 2CG0A 3LMLA 3LYGA 4IPBA 1MWSA 2HMMB 4ORLA 2IY2A 4EV2A 3F7XA 1O7WB 1N5HA 5CF2A 2OTJ3 4AKYA 4XM4A 2OOVC 3D5GA 3EB8A 1LNIA 3F14A 4G1MB 1U5OA 7STDA 4BTXA 3CME3 1W7CA 1M1XB 1B20A 1NDOB 1OF5A 2H0GA 3LT8A 3LXUX 3TDGA 3OW22 3B8LA 3N9HA 2XF3A 3JUQA 3GZYB 1GY6A 1SJWA 1AR0A 1JV2B 2CFDA 2Z6BA 1JKGB 3S67A 4LMIA 1YVBI 1GMPA 5D83A 4MMZB 1OHSA 8CHOA 1RSNA 3K63A 1VQK3 2XSOB 1R4YA 2F86B 2W56A 2D1WA 3CU3A 4O02B 2QA43 2OCTA 1T2HA 3HZPA 3CCM3 3BNBA 3JUOA 4HKVB 1I3IA 1OHPA 3LZAA 1KSIA 2W9QA 1I3FA 3EC9A 4STDA 3RDEA 1X1UA 2UX0A 3DM8A 1UGHI 1RGEA 3FLJA 5G1LA 2W6JH 3HIIA 1T5YA 1IU7A 2HMOB 3FG3A 4LZIA 1B2SA 2OWPA 2RGQA 1AV4A 4HM6B 5CK6A 1AVKA 1N9JA 2J8XB 3N8BA 1W6CA 2FNQA 3D9RA 1ZS7A 3NV0B 1C7HA 3ROBA 3V99A 6RNTA 4K1UA 1N5PA 2W03A 3STDA 1RGGA 1FZUA 3CCE3 5AIGA 3CNXA 3D79A 1VQO3 1SPUA 2KF6A 1S5AA 3MSOA 1RCKA 3MYTA 4LYLB 4I5QA 1I2FA 1Q40A 3K7CA 1F8NA 3X3ZA 4QWTA 4FMDA 1O7PB 2RCDA 1QMAA 4WP5A 5LC7A 5I97A 4HOHA 3EF8A 4EV5A 2WO0A 1Z1SA 3SLUA 2HMKB 2CW9A 3NQZA 5RNTA 2P09A 3FGYA 3H51A 3JUPA 2Z76A 4WWUC 4XBTA 5G1KA 2BU4A 3WODG 3GZXB 2P38A 5FW5A 1CYUA 3D5IA 4O3VA 1FUWA 2ZA4A 5D81A 1YIT3 5IENA 4KVHA 4HM5B 4HM0B 2XH9A 2UUGC 3I563 1YHQ3 2ML6A 3LTAA 4NREA 4PEJA 4EYCA 1NJI4 1IQXA 3UNLA 1HZ1A 1LOXA 1VQ93 3IMAB 4J9AA 3GZBA 5KP4A 2P05A 1LQGC 3BNCA 2O9UX 1PFPA 2CFWA 1GYBA 3FG4A 4L8PA 1YJ93 4ILFA 1VQ63 3GRDA 1VQ73 5IEOA 5EVHA 1ROAA 1RGAA 3CNMA 4KT3B 1OF5B 1YJN3 3K0ZA 5BIRA 1O7HB 2OOVA 2XFSA 4FMAA 5AIFA 1GOYA 1DE3A 1QALA 3DGLA 1BRSA 3GSPA 1HKXA 7GSPA 1US1A 2RBIA 2KCDA 1KWIA 2QGUA 1UCLA 1WTHA 3HIGA 3SEDA 1TTOA 3PGBA 2W56B 1RN7A 3HOHA 1D6ZA 3CD63 1M9GA 4RBNA 2CWVA 1MGRA 4RNYA 3OWYA 1M904 4X2OA 3D3LA 1DMNA 4X2HA 2KF4A 1K41A 4RNZA 2E2VA 5ELJA 1RRHA 1FGTA 1BRIA 3FCSB 1UI7A 1CQSA 5M18A 3I553 1D6YA 2M7OA 3DGNA 1FGOA 1LVNA 3WA2X 5AEUB 1J2BA 3ZG0A 1LOYA 2RNTA 3CPOA 1WNHA 3L0RA 3K9MC 5JPPA 4R9LA 2SBLA 2AADA 2CIUA 2CWUA 2WOFA 1HYFA 3IPTA 3OX9A 1JZOA 1DMMA 3CMA3 1T2IA 3NHXA 4J5KA 1TP6A 2Y74A 3NBJA 1YI23 5IG0A 3EBTA 1K8A4 2YX9A 1BNIA 3EJVA 3BNEA 1JB2A 3PS8A 3RGRA 1Q864 2V1LA 1VQQA 1BSCA 3X41A 1ULIB 1Q40B 1MNLA 2B24B 4MMXB 1RRLA 3CCQ3 1ISKA 3Q3FA 3LTDA 3LH4A 3B4OA 4HBRA 1PU4A 3AHWA 1AY7A 2ZHXB 5BXQA 1BUQA 2F99A 4BIRA 2CFGA 1BNSA 3PYJA 3KN4A 1LOVA 3M8CA 2K3DA 1RGLA 3UJMA 4U13A 2E2UA 2CX0A 3AGOA 1BSDA 2BO9B 3EQQB 1UCIA 3NUVA 1BRKA 1IK3A 3UL6A 4EC6A 2OTL3 1N8QA 1O7GB 1GS3A 1UUVB 1MWRA 3F7SA 1K734 1OH0A 1YVSA 1BRJA 2GEXA 3MG1A 1W4NA 1KQS2 2LQVA 3FKAA 4N6V0 2CX1A 5CLKA 1Q824 1DVDA 3SXXA 1K9M4 1MOLA 1VQN3 1RNBA 3O8YA 1RHLA 5ELUA 4BU4A 3OWSA 1NNVA 5BVBA 5AI1A 1WMNA 3G8ZA 1V74A 1SIIA 1LXEA 3SX1A 2Q07A 3LTBA 3WMDA 2YFIB 2R41A 6STDA 2GEYA 2XGLA 3V98A 1A90A 1V58A 1QVF2 3PXMA 1QAFA 1IQ8A 1IQYA 3BB9A 3KCHA 1SQWA 2P0XA 4HYZA 1E3RA 1RMSA 1UI8A 4HM7B 5HOHA 5TGNA 4LSOA 4N6OB 2XGNA 4FCZA 1W2ZA 4MMYB 1FUSA 1BNGA 1I2GA 4CPKA 1STDA 4MJDA 1X1WA 3UL5A 1BGSA 1GMQA 1OPYA 3G6E3 3AMOA 3B7CA 1UCJA 3LT9A 4FCMA 4RZMA 1Q7HA 2CC3A
chains in the Genus database with same CATH topology
2SARA 1BSAA 2GSPA 1AQZA 1RGAA 4GHOA 1B2MA 1B2ZA 5BIRA 3WHOA 1YGWA 1GOYA 1JBTA 1DE3A 2KF3A 1BNJA 1RLSA 1BRSA 3GSPA 1RN1A 1BSEA 1I0XA 1BNEA 7GSPA 1X1YA 2RBIA 1YNVX 3AGNA 1MGWA 5BU4A 1B3SA 1PYLA 1UCLA 1TTOA 1Q9EA 2AAEA 2KF5A 3HOHA 1MGRA 1BRNL 2F5WA 3D4AA 3D5GA 1LNIA 2KF4A 1BRIA 1BOXA 1RTUA 1B20A 1FYSA 3SYUA 1BAOA 2HOHA 1LOWA 6GSPA 1LOYA 2RNTA 3DH2A 1TRQA 1I0VA 1BNRA 1BANA 1I8VA 2AADA 1GOVA 1BUJA 3RNTA 2C4BA 1GMPA 1RGCA 1HYFA 3URPA 1RSNA 1T2IA 4J5KA 3AHSA 1PY3A 1R4YA 1JBRA 1BU4A 1B21A 1BNIA 7RNTA 1T2HA 1RGHA 1I3IA 1GSPA 1I3FA 1BSCA 3DGYA 1X1UA 1B2XA 1FW7A 1A2PA 1RGEA 1JBSA 3Q3FA 1RGKA 3AHWA 1AY7A 1B2SA 1BRHA 4BIRA 1BNSA 1C54A 1LOVA 1RGLA 3BU4A 1G02A 1LRAA 3AGOA 1BSDA 9RNTA 1UCIA 1TRPA 6RNTA 1BRKA 1IYYA 1RGGA 4HAAA 1I2EA 2F56A 5GSPA 4GSPA 1FZUA 1X1XA 1YVSA 1BRJA 1SARA 2F5MA 2KF6A 1B27A 1RCKA 3A5EA 1I2FA 1RNBA 3BIRA 4BU4A 1RHLA 1RCLA 1FUTA 1BIRA 4HOHA 2BIRA 5RNTA 1GMRA 3WR2A 1BVIA 2F4YA 2KAAA 1RGFA 1RN4A 2BU4A 1CH0A 3D5IA 3KCHA 4J5GA 2ZA4A 8RNTA 1ZGXA 1RMSA 5HOHA 1RNTA 4RNTA 1DETA 1FUSA 1BNGA 1RDSA 1I70A 1I2GA 1HZ1A 1X1WA 1BRGA 1BGSA 1GMQA 1B2UA 1BSBA 1GOUA 1UCJA 1BNFA 1UCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SAR A;  1BSA A;  2GSP A;  1AQZ A;  1RGA A;  4GHO A;  1B2M A;  1B2Z A;  5BIR A;  3WHO A;  1YGW A;  1GOY A;  1JBT A;  1DE3 A;  2KF3 A;  1BNJ A;  1RLS A;  1BRS A;  3GSP A;  1RN1 A;  1BSE A;  1I0X A;  1BNE A;  7GSP A;  1X1Y A;  2RBI A;  1YNV X;  3AGN A;  1MGW A;  5BU4 A;  1B3S A;  1PYL A;  1UCL A;  1TTO A;  1Q9E A;  2AAE A;  2KF5 A;  3HOH A;  1MGR A;  1BRN L;  2F5W A;  3D4A A;  3D5G A;  1LNI A;  2KF4 A;  1BRI A;  1BOX A;  1RTU A;  1B20 A;  1FYS A;  3SYU A;  1BAO A;  2HOH A;  1LOW A;  6GSP A;  1LOY A;  2RNT A;  3DH2 A;  1TRQ A;  1I0V A;  1BNR A;  1BAN A;  1I8V A;  2AAD A;  1GOV A;  1BUJ A;  3RNT A;  2C4B A;  1GMP A;  1RGC A;  1HYF A;  3URP A;  1RSN A;  1T2I A;  4J5K A;  3AHS A;  1PY3 A;  1R4Y A;  1JBR A;  1BU4 A;  1B21 A;  1BNI A;  7RNT A;  1T2H A;  1RGH A;  1I3I A;  1GSP A;  1I3F A;  1BSC A;  3DGY A;  1X1U A;  1B2X A;  1FW7 A;  1A2P A;  1RGE A;  1JBS A;  3Q3F A;  1RGK A;  3AHW A;  1AY7 A;  1B2S A;  1BRH A;  4BIR A;  1BNS A;  1C54 A;  1LOV A;  1RGL A;  3BU4 A;  1G02 A;  1LRA A;  3AGO A;  1BSD A;  9RNT A;  1UCI A;  1TRP A;  6RNT A;  1BRK A;  1IYY A;  1RGG A;  4HAA A;  1I2E A;  2F56 A;  5GSP A;  4GSP A;  1FZU A;  1X1X A;  1YVS A;  1BRJ A;  1SAR A;  2F5M A;  2KF6 A;  1B27 A;  1RCK A;  3A5E A;  1I2F A;  1RNB A;  3BIR A;  4BU4 A;  1RHL A;  1RCL A;  1FUT A;  1BIR A;  4HOH A;  2BIR A;  5RNT A;  1GMR A;  3WR2 A;  1BVI A;  2F4Y A;  2KAA A;  1RGF A;  1RN4 A;  2BU4 A;  1CH0 A;  3D5I A;  3KCH A;  4J5G A;  2ZA4 A;  8RNT A;  1ZGX A;  1RMS A;  5HOH A;  1RNT A;  4RNT A;  1DET A;  1FUS A;  1BNG A;  1RDS A;  1I70 A;  1I2G A;  1HZ1 A;  1X1W A;  1BRG A;  1BGS A;  1GMQ A;  1B2U A;  1BSB A;  1GOU A;  1UCJ A;  1BNF A;  1UCK A; 
#chains in the Genus database with same CATH topology
 3ALA A;  1NO3 A;  2Z77 A;  4K61 A;  3ECF A;  2GSP A;  2Z7A A;  1AQZ A;  4N6N B;  3T0U A;  1B2M A;  4AEQ A;  3WHO A;  3QK9 A;  3CCL 3;  2CH9 A;  2O3O A;  2BMO B;  2H0H A;  1OCV A;  2C11 A;  3KSP A;  1QVG 2;  1I0X A;  1BNE A;  2Y73 A;  4GL6 A;  1EQK A;  2BMQ B;  4R4K A;  1EG9 B;  5BU4 A;  1B3S A;  1IV9 A;  5IEP A;  4KFD A;  1G96 A;  1Q9E A;  2AAE A;  2RFR A;  5IER A;  2WOH A;  3WOF B;  3G71 3;  3FF2 A;  2CFL A;  3SOY A;  2ZDJ A;  4HJL B;  5FGO A;  3HI7 A;  1O7N B;  2W2C A;  3EN1 B;  2CK3 H;  3DZL A;  1RKY A;  5AIH A;  5LC6 A;  2HMJ B;  1JNQ A;  2IA7 A;  3SYU A;  1BAO A;  3ZFZ A;  1CYV A;  3X40 A;  3S27 A;  3EBY A;  3NXJ A;  3DH2 A;  4KFE A;  1TRQ A;  3OXA A;  3Q2P A;  1BNR A;  4N3V A;  2YFJ B;  1BAN A;  3QRD A;  1I8V A;  1BUJ A;  3RNT A;  1OGZ A;  3MPH A;  1GY5 A;  3URP A;  5IG4 A;  1DYU A;  3MHE A;  2IUJ A;  1JN5 A;  1BU4 A;  4L7K A;  3V92 A;  3KSE D;  4EW5 A;  1NB5 I;  2ML5 A;  3N54 B;  3FG1 A;  3ER7 A;  3DGY A;  1B2X A;  1A2P A;  3NBR A;  1JBS A;  2PZV A;  1JRQ A;  2E2T A;  2HML B;  1RGK A;  2F98 A;  2R4I A;  4HZB B;  4R1K A;  5M1A A;  1ULJ B;  3WOE B;  4DKI A;  4K90 B;  2GBW B;  1BRH A;  3B4P A;  4J8T A;  4XB5 A;  1C54 A;  4MEI A;  1W6Y A;  4XDV A;  3BU4 A;  4XBY A;  3NQY A;  3A76 A;  3X3Y A;  5EQL A;  9RNT A;  1OHO A;  1TRP A;  1VQ5 3;  2A15 A;  4WYK A;  1IYY A;  3NX0 A;  3GZR A;  1M1K 4;  5GSP A;  1E97 A;  1FGQ A;  2F56 A;  3OWU A;  1IVX A;  1X1X A;  1Y4K A;  4GSP A;  3ZG5 A;  1T3B A;  3WDG B;  1SAR A;  3CCS 3;  2MC8 A;  1B27 A;  1A67 A;  1UDI I;  4CJN A;  1IV7 A;  3AMO B;  3BIR A;  4L8O A;  4WFO A;  3IJE B;  1FA3 A;  1RCL A;  4N6T A;  2BT3 A;  2CHC A;  2IUK A;  3T8U A;  2BIR A;  4N6U A;  1L5G B;  1GMR A;  3DXO A;  1YIJ 3;  3F40 A;  4ZM8 A;  2F4Y A;  1RGF A;  3VF1 A;  3X3X A;  1VZZ A;  4R80 A;  4CDL A;  1CH0 A;  1S72 3;  1EUI C;  4J5G A;  1STF I;  2KXG A;  2HMN B;  1AVL A;  4RNT A;  4IT7 A;  3NBB A;  1KD1 4;  3LOY A;  4FMC A;  1UGI A;  2KRT A;  3CC7 3;  3F9S A;  1TFK A;  4GB5 A;  1DET A;  4HM4 B;  1MWU A;  4O8S A;  1OGX A;  4LEH A;  4WHA A;  3KKG A;  3MG3 A;  1JZD A;  2OQE A;  1SIH A;  4O2H A;  1VQP 3;  1IVW A;  3BND A;  4JF8 A;  2GU3 A;  1RJO A;  3I0Y A;  4H61 A;  3CCV 3;  3NM2 A;  2RSX A;  2I9W A;  5D82 A;  1BNF A;  1IVV A;  1UCK A;  3RGA A;  3T8N A;  4BL2 A;  1EA2 A;  2STD A;  1GD3 A;  4NHF A;  3VGN A;  4OVM A;  4OUQ A;  5AII A;  4GHO A;  1B2Z A;  3FH1 A;  3EHC A;  1YGW A;  1LNH A;  5JPU A;  1JBT A;  3KII A;  2KF3 A;  4HM2 B;  1A2V A;  5KP1 A;  1IDP A;  3CC2 3;  2P0M A;  4EBG A;  2XFT A;  1U8C B;  4NPB A;  1BSE A;  1W02 A;  2IYJ A;  1X1Y A;  3AGN A;  1QJG A;  1MGW A;  1TUH A;  2B1X B;  4K1V A;  4N6M A;  4R9K A;  2CKF B;  1DMQ A;  3X42 A;  1WMP A;  1TU5 A;  3SVA A;  2GBX B;  2KF5 A;  4HM8 B;  4HVN A;  1JN5 B;  2CG1 A;  3LTC A;  5IW9 A;  3U1W A;  2MF7 A;  1KC8 4;  1BRN L;  2F5W A;  4Q53 A;  2XRX B;  3D4A A;  1E3V A;  1UW1 A;  1UUW B;  1VQL 3;  4CCV A;  3FF0 A;  3JUM A;  3CXC 2;  5IF6 A;  3DUK A;  1BOX A;  2XR8 B;  3BLZ A;  3NM7 A;  1RTU A;  4JRF A;  1FYS A;  3PZW A;  1FGM A;  2HOH A;  5EEO A;  4FR9 A;  1ASK A;  1LOW A;  2CFK A;  3PCR A;  6GSP A;  5JBS A;  1Q7Y 4;  5HGR A;  3H3H A;  1TJD A;  1I0V A;  5AEW B;  1MWT A;  1UUG B;  2ZL8 A;  1GOV A;  3CC4 3;  2C4B A;  2W0Q A;  1RGC A;  3GAX A;  4WYK B;  2OQE C;  1IVU A;  3FZW A;  1WQL B;  2BMR B;  3KE7 A;  5KP3 A;  4BTY A;  1CEW I;  3AHS A;  1W00 A;  1PY3 A;  3F8H A;  3MKI A;  3DGM A;  3MWZ A;  3Q90 A;  4H3U A;  1B21 A;  3U97 A;  3HX8 A;  2JDI H;  7RNT A;  1JBR A;  1GY7 A;  1Q81 4;  1YJW 3;  3G4S 3;  1RGH A;  4FMB A;  3JUN A;  1GSP A;  3EN8 A;  2XEP A;  1FW7 A;  1IT8 A;  3UB1 A;  3SOA A;  2JQ5 A;  3DMC A;  4EXR A;  3KZT A;  1ZO2 A;  2XSH B;  2K54 A;  1N9E A;  1HU9 A;  2L1S A;  3JVC A;  5M19 A;  5CF1 A;  4OK0 A;  1NWW A;  4XBX A;  1W01 A;  3CCR 3;  3G16 A;  1G02 A;  1JKG A;  1LRA A;  3G0K A;  4FCJ A;  1VQ4 3;  2H0I A;  1EEJ A;  2PNC A;  3CCU 3;  3HK4 A;  3VSY A;  1VQ8 3;  1NU3 A;  1Q42 A;  4HAA A;  2INX A;  1I2E A;  3EE1 A;  1ROV A;  2IMJ A;  4BL3 A;  1DVC A;  3J7Y d;  1JB4 A;  1V57 A;  2F5M A;  3MG2 A;  3A5E A;  5IG5 A;  4TX4 A;  5DRV A;  1TIJ A;  1W5Z A;  2QIY A;  2WGQ A;  2W04 A;  2D42 A;  2W9P A;  1FUT A;  1BIR A;  1FGR A;  2K0M A;  1N8R 4;  2L4V A;  3CCJ 3;  1JJ2 2;  3S5C A;  3WR2 A;  1A2K A;  1BVI A;  3CPW 2;  4N6L A;  5AYR B;  2KAA A;  4LGQ A;  1RN4 A;  3S28 A;  4AKZ A;  1D6U A;  1OAC A;  3NV0 A;  8RNT A;  2YFL B;  1ZGX A;  4KFF A;  2GXF A;  3WA3 A;  2BHM A;  2LYX A;  1GD4 A;  1RNT A;  3DY5 A;  3E99 A;  5IG3 A;  1WMO A;  3DGO A;  4HM3 B;  3KFQ C;  5A0O B;  4BTW A;  1IT7 A;  1R4C A;  1OUN A;  1RDS A;  1I70 A;  1JB5 A;  2UGI A;  1VQM 3;  2C10 A;  2FGT A;  1BRG A;  1O7M B;  2WGO A;  5CXO A;  1B2U A;  4IIA A;  1BSB A;  5STD A;  1TFO A;  3EX9 A;  4KZ1 A;  1GOU A;  4XDW A;  1W6G A;  2CWT A;  3S29 A;  5DRE A;  2SAR A;  1G0T A;  4HM1 B;  3OV4 A;  1BSA A;  5AYS C;  2BNG A;  5G2G A;  3PCS A;  1NB3 I;  1YGE A;  2FXT A;  3FSD A;  2QEX 3;  3GWR A;  4HZ9 B;  1EKM A;  1BNJ A;  1RLS A;  1LQM B;  1W2B 2;  1RN1 A;  1K28 A;  4I4K A;  1YNV X;  2GU1 A;  3F8X A;  3Q1C A;  1ZX2 A;  1PYL A;  3K5T A;  1QAK A;  2CG0 A;  3LML A;  3LYG A;  4IPB A;  1MWS A;  2HMM B;  4ORL A;  2IY2 A;  4EV2 A;  3F7X A;  1O7W B;  1N5H A;  5CF2 A;  2OTJ 3;  4AKY A;  4XM4 A;  2OOV C;  3D5G A;  3EB8 A;  1LNI A;  3F14 A;  4G1M B;  1U5O A;  7STD A;  4BTX A;  3CME 3;  1W7C A;  1M1X B;  1B20 A;  1NDO B;  1OF5 A;  2H0G A;  3LT8 A;  3LXU X;  3TDG A;  3OW2 2;  3B8L A;  3N9H A;  2XF3 A;  3JUQ A;  3GZY B;  1GY6 A;  1SJW A;  1AR0 A;  1JV2 B;  2CFD A;  2Z6B A;  1JKG B;  3S67 A;  4LMI A;  1YVB I;  1GMP A;  5D83 A;  4MMZ B;  1OHS A;  8CHO A;  1RSN A;  3K63 A;  1VQK 3;  2XSO B;  1R4Y A;  2F86 B;  2W56 A;  2D1W A;  3CU3 A;  4O02 B;  2QA4 3;  2OCT A;  1T2H A;  3HZP A;  3CCM 3;  3BNB A;  3JUO A;  4HKV B;  1I3I A;  1OHP A;  3LZA A;  1KSI A;  2W9Q A;  1I3F A;  3EC9 A;  4STD A;  3RDE A;  1X1U A;  2UX0 A;  3DM8 A;  1UGH I;  1RGE A;  3FLJ A;  5G1L A;  2W6J H;  3HII A;  1T5Y A;  1IU7 A;  2HMO B;  3FG3 A;  4LZI A;  1B2S A;  2OWP A;  2RGQ A;  1AV4 A;  4HM6 B;  5CK6 A;  1AVK A;  1N9J A;  2J8X B;  3N8B A;  1W6C A;  2FNQ A;  3D9R A;  1ZS7 A;  3NV0 B;  1C7H A;  3ROB A;  3V99 A;  6RNT A;  4K1U A;  1N5P A;  2W03 A;  3STD A;  1RGG A;  1FZU A;  3CCE 3;  5AIG A;  3CNX A;  3D79 A;  1VQO 3;  1SPU A;  2KF6 A;  1S5A A;  3MSO A;  1RCK A;  3MYT A;  4LYL B;  4I5Q A;  1I2F A;  1Q40 A;  3K7C A;  1F8N A;  3X3Z A;  4QWT A;  4FMD A;  1O7P B;  2RCD A;  1QMA A;  4WP5 A;  5LC7 A;  5I97 A;  4HOH A;  3EF8 A;  4EV5 A;  2WO0 A;  1Z1S A;  3SLU A;  2HMK B;  2CW9 A;  3NQZ A;  5RNT A;  2P09 A;  3FGY A;  3H51 A;  3JUP A;  2Z76 A;  4WWU C;  4XBT A;  5G1K A;  2BU4 A;  3WOD G;  3GZX B;  2P38 A;  5FW5 A;  1CYU A;  3D5I A;  4O3V A;  1FUW A;  2ZA4 A;  5D81 A;  1YIT 3;  5IEN A;  4KVH A;  4HM5 B;  4HM0 B;  2XH9 A;  2UUG C;  3I56 3;  1YHQ 3;  2ML6 A;  3LTA A;  4NRE A;  4PEJ A;  4EYC A;  1NJI 4;  1IQX A;  3UNL A;  1HZ1 A;  1LOX A;  1VQ9 3;  3IMA B;  4J9A A;  3GZB A;  5KP4 A;  2P05 A;  1LQG C;  3BNC A;  2O9U X;  1PFP A;  2CFW A;  1GYB A;  3FG4 A;  4L8P A;  1YJ9 3;  4ILF A;  1VQ6 3;  3GRD A;  1VQ7 3;  5IEO A;  5EVH A;  1ROA A;  1RGA A;  3CNM A;  4KT3 B;  1OF5 B;  1YJN 3;  3K0Z A;  5BIR A;  1O7H B;  2OOV A;  2XFS A;  4FMA A;  5AIF A;  1GOY A;  1DE3 A;  1QAL A;  3DGL A;  1BRS A;  3GSP A;  1HKX A;  7GSP A;  1US1 A;  2RBI A;  2KCD A;  1KWI A;  2QGU A;  1UCL A;  1WTH A;  3HIG A;  3SED A;  1TTO A;  3PGB A;  2W56 B;  1RN7 A;  3HOH A;  1D6Z A;  3CD6 3;  1M9G A;  4RBN A;  2CWV A;  1MGR A;  4RNY A;  3OWY A;  1M90 4;  4X2O A;  3D3L A;  1DMN A;  4X2H A;  2KF4 A;  1K41 A;  4RNZ A;  2E2V A;  5ELJ A;  1RRH A;  1FGT A;  1BRI A;  3FCS B;  1UI7 A;  1CQS A;  5M18 A;  3I55 3;  1D6Y A;  2M7O A;  3DGN A;  1FGO A;  1LVN A;  3WA2 X;  5AEU B;  1J2B A;  3ZG0 A;  1LOY A;  2RNT A;  3CPO A;  1WNH A;  3L0R A;  3K9M C;  5JPP A;  4R9L A;  2SBL A;  2AAD A;  2CIU A;  2CWU A;  2WOF A;  1HYF A;  3IPT A;  3OX9 A;  1JZO A;  1DMM A;  3CMA 3;  1T2I A;  3NHX A;  4J5K A;  1TP6 A;  2Y74 A;  3NBJ A;  1YI2 3;  5IG0 A;  3EBT A;  1K8A 4;  2YX9 A;  1BNI A;  3EJV A;  3BNE A;  1JB2 A;  3PS8 A;  3RGR A;  1Q86 4;  2V1L A;  1VQQ A;  1BSC A;  3X41 A;  1ULI B;  1Q40 B;  1MNL A;  2B24 B;  4MMX B;  1RRL A;  3CCQ 3;  1ISK A;  3Q3F A;  3LTD A;  3LH4 A;  3B4O A;  4HBR A;  1PU4 A;  3AHW A;  1AY7 A;  2ZHX B;  5BXQ A;  1BUQ A;  2F99 A;  4BIR A;  2CFG A;  1BNS A;  3PYJ A;  3KN4 A;  1LOV A;  3M8C A;  2K3D A;  1RGL A;  3UJM A;  4U13 A;  2E2U A;  2CX0 A;  3AGO A;  1BSD A;  2BO9 B;  3EQQ B;  1UCI A;  3NUV A;  1BRK A;  1IK3 A;  3UL6 A;  4EC6 A;  2OTL 3;  1N8Q A;  1O7G B;  1GS3 A;  1UUV B;  1MWR A;  3F7S A;  1K73 4;  1OH0 A;  1YVS A;  1BRJ A;  2GEX A;  3MG1 A;  1W4N A;  1KQS 2;  2LQV A;  3FKA A;  4N6V 0;  2CX1 A;  5CLK A;  1Q82 4;  1DVD A;  3SXX A;  1K9M 4;  1MOL A;  1VQN 3;  1RNB A;  3O8Y A;  1RHL A;  5ELU A;  4BU4 A;  3OWS A;  1NNV A;  5BVB A;  5AI1 A;  1WMN A;  3G8Z A;  1V74 A;  1SII A;  1LXE A;  3SX1 A;  2Q07 A;  3LTB A;  3WMD A;  2YFI B;  2R41 A;  6STD A;  2GEY A;  2XGL A;  3V98 A;  1A90 A;  1V58 A;  1QVF 2;  3PXM A;  1QAF A;  1IQ8 A;  1IQY A;  3BB9 A;  3KCH A;  1SQW A;  2P0X A;  4HYZ A;  1E3R A;  1RMS A;  1UI8 A;  4HM7 B;  5HOH A;  5TGN A;  4LSO A;  4N6O B;  2XGN A;  4FCZ A;  1W2Z A;  4MMY B;  1FUS A;  1BNG A;  1I2G A;  4CPK A;  1STD A;  4MJD A;  1X1W A;  3UL5 A;  1BGS A;  1GMQ A;  1OPY A;  3G6E 3;  3AMO A;  3B7C A;  1UCJ A;  3LT9 A;  4FCM A;  4RZM A;  1Q7H A;  2CC3 A; 
#chains in the Genus database with same CATH homology
 2SAR A;  1BSA A;  2GSP A;  1AQZ A;  1RGA A;  4GHO A;  1B2M A;  1B2Z A;  5BIR A;  3WHO A;  1YGW A;  1GOY A;  1JBT A;  1DE3 A;  2KF3 A;  1BNJ A;  1RLS A;  1BRS A;  3GSP A;  1RN1 A;  1BSE A;  1I0X A;  1BNE A;  7GSP A;  1X1Y A;  2RBI A;  1YNV X;  3AGN A;  1MGW A;  5BU4 A;  1B3S A;  1PYL A;  1UCL A;  1TTO A;  1Q9E A;  2AAE A;  2KF5 A;  3HOH A;  1MGR A;  1BRN L;  2F5W A;  3D4A A;  3D5G A;  1LNI A;  2KF4 A;  1BRI A;  1BOX A;  1RTU A;  1B20 A;  1FYS A;  3SYU A;  1BAO A;  2HOH A;  1LOW A;  6GSP A;  1LOY A;  2RNT A;  3DH2 A;  1TRQ A;  1I0V A;  1BNR A;  1BAN A;  1I8V A;  2AAD A;  1GOV A;  1BUJ A;  3RNT A;  2C4B A;  1GMP A;  1RGC A;  1HYF A;  3URP A;  1RSN A;  1T2I A;  4J5K A;  3AHS A;  1PY3 A;  1R4Y A;  1JBR A;  1BU4 A;  1B21 A;  1BNI A;  7RNT A;  1T2H A;  1RGH A;  1I3I A;  1GSP A;  1I3F A;  1BSC A;  3DGY A;  1X1U A;  1B2X A;  1FW7 A;  1A2P A;  1RGE A;  1JBS A;  3Q3F A;  1RGK A;  3AHW A;  1AY7 A;  1B2S A;  1BRH A;  4BIR A;  1BNS A;  1C54 A;  1LOV A;  1RGL A;  3BU4 A;  1G02 A;  1LRA A;  3AGO A;  1BSD A;  9RNT A;  1UCI A;  1TRP A;  6RNT A;  1BRK A;  1IYY A;  1RGG A;  4HAA A;  1I2E A;  2F56 A;  5GSP A;  4GSP A;  1FZU A;  1X1X A;  1YVS A;  1BRJ A;  1SAR A;  2F5M A;  2KF6 A;  1B27 A;  1RCK A;  3A5E A;  1I2F A;  1RNB A;  3BIR A;  4BU4 A;  1RHL A;  1RCL A;  1FUT A;  1BIR A;  4HOH A;  2BIR A;  5RNT A;  1GMR A;  3WR2 A;  1BVI A;  2F4Y A;  2KAA A;  1RGF A;  1RN4 A;  2BU4 A;  1CH0 A;  3D5I A;  3KCH A;  4J5G A;  2ZA4 A;  8RNT A;  1ZGX A;  1RMS A;  5HOH A;  1RNT A;  4RNT A;  1DET A;  1FUS A;  1BNG A;  1RDS A;  1I70 A;  1I2G A;  1HZ1 A;  1X1W A;  1BRG A;  1BGS A;  1GMQ A;  1B2U A;  1BSB A;  1GOU A;  1UCJ A;  1BNF A;  1UCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...