5BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5bu4A00
5GSPA 4BIRA 1ZGXA 1HYFA 3WHOA 1LOVA 1RHLA 1BNFA 1I70A 1RN1A 1UCIA 3AGOA 1B27A 1I0XA 1BSEA 1BNJA 6RNTA 1BNIA 3DH2A 5BIRA 1BRJA 3A5EA 4J5KA 1FW7A 1BRHA 2KF4A 4BU4A 1YVSA 1I3FA 1LOYA 1UCLA 9RNTA 1DE3A 3HOHA 1X1WA 1BVIA 1RCLA 1FUSA 1BSCA 1RNBA 1RGHA 1RNTA 1TRQA 1LRAA 1B21A 1GMPA 1LNIA 4RNTA 1C54A 1X1YA 1T2IA 3D5IA 1HZ1A 1G02A 4HOHA 3WR2A 2KF3A 1IYYA 1BANA 1MGRA 1BUJA 1RLSA 1B2UA 4GSPA 1A2PA 1BRKA 1I8VA 1JBRA 1BRIA 1FYSA 1RGAA 1BOXA 3SYUA 1JBTA 1GSPA 1X1UA 1JBSA 1PYLA 2BIRA 1BSDA 1RDSA 1PY3A 1TTOA 2HOHA 1RTUA 7GSPA 1BSBA 2ZA4A 1RGLA 1I2GA 1B20A 2F4YA 6GSPA 1RGKA 2SARA 1I2EA 4J5GA 2F5MA 3D5GA 3AHSA 1RN4A 2F56A 1LOWA 2AAEA 1YNVX 2KF5A 1BNEA 1DETA 1GOUA 1RMSA 1T2HA 5BU4A 1B2XA 1Q9EA 3GSPA 2KF6A 5RNTA 1TRPA 1I0VA 1BNRA 2C4BA 1SARA 1RGGA 1B2MA 3AGNA 4HAAA 3BU4A 1BSAA 1UCKA 2KAAA 1AY7A 1CH0A 1B3SA 1BAOA 8RNTA 7RNTA 1I3IA 2AADA 2RNTA 3RNTA 2BU4A 3DGYA 1BGSA 1BNGA 3Q3FA 3URPA 1R4YA 1RCKA 1RSNA 1UCJA 3KCHA 1B2SA 3D4AA 1RGFA 4GHOA 1X1XA 1I2FA 1GOYA 1BU4A 1FZUA 3BIRA 1BIRA 3AHWA 1GMQA 1BRSA 1BNSA 1BRGA 1FUTA 1RGEA 2GSPA 1GMRA 1GOVA 5HOHA 1AQZA 1MGWA 1RGCA 1YGWA 2RBIA 1B2ZA 1BRNL 2F5WA
chains in the Genus database with same CATH superfamily
3B8LA 3G16A 3HX8A 4HM8B 3RDEA 3MG2A 3WHOA 1OF5A 1UW1A 1TP6A 1GY6A 1UCIA 2B24B 4FMDA 5D83A 4X2OA 1VQM3 3MWZA 1Q864 3CCV3 2Z76A 3LTDA 5JPUA 1BNJA 4EXRA 1BNIA 2ZDJA 2INXA 3NBRA 1G96A 1BRJA 3KIIA 3A5EA 1IT7A 3QK9A 4JF8A 1O7NB 5BIRA 4IIAA 1BRHA 1PFPA 1FA3A 2IYJA 3VF1A 3CCL3 2Z77A 2MC8A 9RNTA 4FCMA 4N6TA 4FMAA 3S29A 1OACA 1BVIA 1FUSA 1NB3I 1YGEA 4KT3B 3NM2A 4MMXB 4N6LA 4CCVA 1N8R4 1RNBA 1RNTA 3PGBA 1M904 4Q53A 1EQKA 2W0QA 1D6UA 3D5IA 5I97A 3D3LA 4FCZA 1G02A 4HM0B 5CF1A 1NU3A 2KF3A 3LMLA 4OK0A 4L8PA 3V98A 2UUGC 2W03A 4O8SA 1A2KA 2GBXB 2RCDA 2V1LA 1BUJA 1O7WB 1OH0A 2KRTA 2XFTA 1WNHA 1UGIA 1JBRA 4HM6B 3V92A 1U5OA 3WA2X 1JBTA 2HMOB 1D6ZA 3G0KA 1SIHA 2HMMB 1IK3A 1NDOB 1RDSA 3B4OA 1AVKA 1VQ83 1RTUA 3K7CA 2K3DA 5G1LA 4LYLB 4HZ9B 1I2GA 4WWUC 3CC23 1RGKA 4J8TA 1WMPA 3JUQA 3MSOA 1NO3A 3AHSA 1MWSA 4K1UA 1AVLA 1LOWA 4FCJA 1YNVX 2IUJA 1TU5A 4L8OA 2W04A 3AMOA 4O3VA 2B1XB 1RMSA 1SJWA 4BL2A 1GS3A 1ZS7A 2H0IA 1Q9EA 2GEXA 1M1K4 3GZYB 1W6YA 2C4BA 1VZZA 3LT9A 4FMCA 1FGRA 5A0OB 3NHXA 4STDA 3EC9A 3LOYA 1JJ22 4DKIA 2W2CA 1KSIA 5JPPA 1S723 2K54A 1B3SA 3RGRA 3X3ZA 2QIYA 2A15A 3ZG5A 3CNMA 1KC84 1VQ53 3U97A 4CDLA 3RNTA 2AADA 3TDGA 3T8UA 3MKIA 3DGLA 3F14A 1MWTA 2Q07A 3K63A 3Q3FA 2E2UA 3CNXA 3CCU3 1YJW3 1RSNA 1LQGC 1B2SA 5M19A 5STDA 1QAKA 4K1VA 2WOHA 3G4S3 1Q824 4GHOA 3MG1A 1QJGA 5CLKA 2OOVA 1GOYA 1JZDA 4WYKA 3Q2PA 3BIRA 1FZUA 3NV0B 2GU3A 3GZBA 3NBJA 1BIRA 5AI1A 2Y74A 1GMQA 2XRXB 3F8XA 2XR8B 1UUVB 4HM7B 3HIGA 1BNSA 1K41A 1RGEA 3DGOA 5AYRB 2SBLA 4BTWA 3SOYA 3X42A 2ML6A 3NQYA 1JKGB 2GU1A 5HOHA 1RGCA 2RBIA 3DH2A 1W7CA 2F5WA 2FNQA 3DGMA 1D6YA 3I0YA 1IVXA 1ZGXA 4N6NB 1BRNL 3KSED 1LQMB 3FSDA 3FGYA 3K9MC 3LYGA 1BNFA 1GD3A 1US1A 4RNYA 1I70A 1RN1A 3JUMA 4XDWA 1UI7A 4HM4B 5TGNA 1QVG2 3DXOA 1ZO2A 2JDIH 5KP1A 3NUVA 1CEWI 2E2VA 3OWUA 3CU3A 6RNTA 1ULIB 3SLUA 2YX9A 2Z7AA 1OUNA 3M8CA 1O7GB 4R9KA 1Q814 4HBRA 1MWUA 5ELUA 2W9QA 5DREA 1IQYA 5IG0A 3WOEB 2D1WA 1YVSA 1FGOA 1UCLA 3EJVA 1YHQ3 1HU9A 3KSPA 1OHSA 2R4IA 1G0TA 1WMOA 1BSCA 4MJDA 1RGHA 1RKYA 2OTJ3 1TRQA 1GMPA 1LNIA 3LH4A 1N9EA 4CPKA 1EKMA 1X1YA 4NPBA 2YFLB 3GRDA 2RFRA 3OXAA 3X41A 2E2TA 3WR2A 2CWTA 4MEIA 4RBNA 2IUKA 1YVBI 2H0HA 1L5GB 1YIJ3 2W56A 1DVDA 1MGRA 3DY5A 1B2UA 1BRKA 1Y4KA 3T0UA 1U8CB 3F7SA 1BRIA 1VQQA 5IERA 1W6GA 2HMKB 1BOXA 5AIIA 3J7Yd 4G1MB 1TIJA 3S67A 3HIIA 1GSPA 2BHMA 1JBSA 3MG3A 2PNCA 1WMNA 1W00A 2HOHA 1ROVA 1M1XB 4OVMA 2ZA4A 1B20A 3L0RA 4O2HA 3OW22 4IPBA 1FGTA 2F56A 2AAEA 1OHOA 2BMQB 2KF5A 3DMCA 4HM5B 1DETA 4N6OB 2XGLA 2CKFB 3WOFB 1LXEA 4GB5A 5LC6A 1GY7A 3X3YA 2KF6A 5G2GA 2BMRB 3F9SA 4WHAA 1BNRA 1ULJB 3ZG0A 4L7KA 1SARA 1B2MA 1JB5A 1LOXA 4XB5A 3JUPA 1Q7Y4 3BU4A 7STDA 1T5YA 1W2B2 4LSOA 3G6E3 2BMOB 3LTCA 4HZBB 4EC6A 3CMA3 3EBTA 3HK4A 1AY7A 3N9HA 3EBYA 4AKZA 1IVVA 2CFWA 1IDPA 4LEHA 1RN7A 3FG4A 2XF3A 1DMMA 2IA7A 3X40A 2CK3H 3QRDA 2GBWB 1Q40A 2OCTA 4N6V0 1N9JA 4AEQA 1JV2B 3DGYA 3KE7A 4KFEA 2OQEA 1JNQA 3AMOB 2P09A 3GWRA 1YIT3 3WMDA 3BNBA 1RCKA 3KCHA 5IG5A 1VQO3 1EA2A 1C7HA 3KN4A 1ROAA 2C10A 2WOFA 3D4AA 3JUNA 4IT7A 1T3BA 1W5ZA 3CXC2 3FG3A 3EN1B 2IY2A 3N8BA 1JRQA 1RRLA 3PS8A 1Q42A 1BU4A 2IMJA 2MF7A 3CD63 3IMAB 3BB9A 3E99A 4XM4A 2F98A 2CWVA 1EG9B 2CG0A 2Y73A 3WA3A 2CIUA 1QMAA 3DZLA 3CME3 1Z1SA 1FGQA 4XBYA 1GMRA 1MGWA 2RSXA 1YGWA 1AV4A 3B4PA 1IQXA 4MMZB 1WQLB 4R1KA 5GSPA 5LC7A 4H61A 1IU7A 1HYFA 2XGNA 1LOVA 5AEWB 4N6UA 2CC3A 1RHLA 1RRHA 2KXGA 1QAFA 3KFQC 3OWSA 1KWIA 1O7PB 1B27A 1I0XA 3CC43 1BSEA 3DUKA 4J9AA 3LZAA 2CWUA 1HKXA 3RGAA 1IV9A 3U1WA 3BNDA 1JB2A 1E97A 3Q90A 3DM8A 4QWTA 5FGOA 5HGRA 4WYKB 3PCSA 3UL5A 6STDA 1FW7A 2LYXA 2KF4A 1QALA 1K8A4 2BNGA 1I3FA 1LOYA 3MYTA 2CX1A 4FR9A 3BNCA 3K0ZA 1A67A 4LMIA 4K61A 3UB1A 1WTHA 3BNEA 5BVBA 4XBXA 1LRAA 1B21A 4RNTA 1C54A 4FMBA 1OPYA 1T2IA 3ALAA 3HI7A 4I4KA 1BUQA 2BO9B 5AIFA 2F86B 1OGZA 4KZ1A 1IYYA 5M1AA 3LT8A 3D9RA 1DVCA 5AIHA 4GSPA 1A2PA 1UDII 4EW5A 1TUHA 1JN5A 2UX0A 1FYSA 3DGNA 1RGAA 1NB5I 3SYUA 1VQN3 4WP5A 1STFI 1GYBA 1UUGB 1X1UA 2BIRA 4EBGA 1VQ43 1BSDA 1YJN3 1TTOA 2P38A 3B7CA 2GEYA 7GSPA 3FKAA 1N8QA 1RGLA 2CHCA 2YFIB 3A76A 2F99A 2F4YA 6GSPA 2OOVC 1SQWA 1LNHA 1I2EA 5JBSA 3CPOA 3D5GA 5EQLA 2I9WA 3FLJA 2HMJB 3CCJ3 3CCR3 1A2VA 1O7MB 2L1SA 2XH9A 1GOUA 1OF5B 1T2HA 2W56B 3EB8A 3F40A 3GSPA 5RNTA 3JUOA 1TRPA 1F8NA 3EHCA 1UUWB 1I0VA 2O9UX 1N5PA 5KP3A 3N54B 3AGNA 4HAAA 1MNLA 2BT3A 1LVNA 3G713 2ZHXB 1BSAA 2D42A 1UCKA 3G8ZA 2UGIA 3OX9A 5EEOA 4EYCA 5CK6A 1YJ93 3NBBA 5IG3A 5ELJA 1EEJA 4WFOA 4EV5A 1CH0A 5CF2A 3H51A 1S5AA 4NHFA 5IENA 5KP4A 4HM1B 2XSOB 7RNTA 3KKGA 2PZVA 2QEX3 1I3IA 1O7HB 1Q7HA 2RNTA 4ZM8A 3ROBA 2JQ5A 3NX0A 2CFKA 3S27A 1PU4A 1KD14 2O3OA 1DYUA 3FZWA 1BGSA 1BNGA 3O8YA 5BXQA 1R4YA 1IVUA 3PXMA 3MPHA 2CFDA 3EX9A 2CFLA 3FF2A 5IEOA 3S28A 1X1XA 5IF6A 1I2FA 1GY5A 4O02B 1R4CA 3LTBA 2CFGA 1ISKA 1GD4A 2WGQA 2HMNB 5IG4A 1DMQA 3KZTA 4OUQA 3ER7A 1KQS2 3AHWA 2QA43 1VQ93 3NXJA 3LTAA 4RNZA 4BTYA 1BRSA 3D79A 4R9LA 2GSPA 5AEUB 2W9PA 1K734 4GL6A 1J2BA 1OGXA 3SVAA 1SPUA 3WDGB 1V58A 2P0MA 1NWWA 4CJNA 3FH1A 1V57A 1B2ZA 1Q40B 4BIRA 3WODG 1W01A 3EQQB 1VQL3 2P05A 1A90A 3AGOA 3VSYA 4HVNA 3SEDA 2Z6BA 3CCQ3 2HMLB 4RZMA 3I563 1VQ73 3V99A 1TFKA 1OCVA 3SOAA 2FGTA 3Q1CA 3CCS3 4J5KA 1STDA 4LZIA 3JVCA 4BU4A 3MHEA 3PYJA 2LQVA 1VQP3 5FW5A 1DE3A 4AKYA 3HOHA 4TX4A 2GXFA 1X1WA 1RCLA 2XFSA 4ORLA 2RGQA 3ECFA 4U13A 3OWYA 1IT8A 3GZXB 2CW9A 4BL3A 1JB4A 8CHOA 2CX0A 5AIGA 3SXXA 3CC73 4R4KA 1HZ1A 4XDVA 4ILFA 2J8XB 4HOHA 5CXOA 1BANA 2WGOA 3PZWA 4BTXA 1RLSA 2H0GA 1ZX2A 3F8HA 1VQK3 5M18A 1I8VA 4EV2A 3UNLA 2CH9A 3PCRA 5IEPA 1EUIC 1IQ8A 2K0MA 1PYLA 1SIIA 3CCE3 1OHPA 2ML5A 2C11A 2W6JH 2OQEC 1PY3A 5AYSC 3STDA 1M9GA 5G1KA 2XEPA 2YFJB 1BSBA 3LXUX 1FUWA 4HKVB 1MOLA 4K90B 3IPTA 2SARA 3VGNA 4J5GA 3EE1A 1W6CA 2STDA 2F5MA 2ZL8A 1RN4A 4X2HA 1RJOA 1YI23 3FG1A 3NM7A 1UGHI 1W2ZA 1CYUA 1BNEA 1NNVA 1TFOA 1W4NA 4LGQA 3GZRA 3IJEB 5BU4A 3I553 1B2XA 1K9M4 4R80A 1RGGA 4MMYB 1DMNA 1JN5B 1FGMA 1E3VA 3NQZA 3NV0A 2FXTA 3CPW2 2KAAA 1UI8A 1IV7A 2P0XA 5IW9A 1TJDA 3SX1A 2M7OA 1BAOA 8RNTA 4N3VA 2L4VA 1JKGA 1V74A 1JZOA 1W02A 3OV4A 4H3UA 2WO0A 1NJI4 1VQ63 1CYVA 3EN8A 1N5HA 2BU4A 4HM2B 2OWPA 4N6MA 3UJMA 3BLZA 3X3XA 3URPA 1ASKA 2OTL3 1QVF2 1E3RA 1UCJA 4HJLB 2R41A 2CG1A 3EF8A 5DRVA 1RGFA 4JRFA 4NREA 5D82A 4I5QA 5EVHA 3FCSB 3CCM3 1CQSA 5D81A 3GAXA 3H3HA 4KVHA 3FF0A 2XSHB 3UL6A 1K28A 3ZFZA 2QGUA 1MWRA 1BRGA 1FUTA 4KFFA 3T8NA 1GOVA 1AQZA 3K5TA 1AR0A 1IVWA 2KCDA 3HZPA 4HM3B 4KFDA 4PEJA 4XBTA 3S5CA 3F7XA 4HYZA
chains in the Genus database with same CATH topology
5GSPA 4BIRA 1ZGXA 1HYFA 3WHOA 1LOVA 1RHLA 1BNFA 1I70A 1RN1A 1UCIA 3AGOA 1B27A 1I0XA 1BSEA 1BNJA 6RNTA 1BNIA 3DH2A 5BIRA 1BRJA 3A5EA 4J5KA 1FW7A 1BRHA 2KF4A 4BU4A 1YVSA 1I3FA 1LOYA 1UCLA 9RNTA 1DE3A 3HOHA 1X1WA 1BVIA 1RCLA 1FUSA 1BSCA 1RNBA 1RGHA 1RNTA 1TRQA 1LRAA 1B21A 1GMPA 1LNIA 4RNTA 1C54A 1X1YA 1T2IA 3D5IA 1HZ1A 1G02A 4HOHA 3WR2A 2KF3A 1IYYA 1BANA 1MGRA 1BUJA 1RLSA 1B2UA 4GSPA 1A2PA 1BRKA 1I8VA 1JBRA 1BRIA 1FYSA 1RGAA 1BOXA 3SYUA 1JBTA 1GSPA 1X1UA 1JBSA 1PYLA 2BIRA 1BSDA 1RDSA 1PY3A 1TTOA 2HOHA 1RTUA 7GSPA 1BSBA 2ZA4A 1RGLA 1I2GA 1B20A 2F4YA 6GSPA 1RGKA 2SARA 1I2EA 4J5GA 2F5MA 3D5GA 3AHSA 1RN4A 2F56A 1LOWA 2AAEA 1YNVX 2KF5A 1BNEA 1DETA 1GOUA 1RMSA 1T2HA 5BU4A 1B2XA 1Q9EA 3GSPA 2KF6A 5RNTA 1TRPA 1I0VA 1BNRA 2C4BA 1SARA 1RGGA 1B2MA 3AGNA 4HAAA 3BU4A 1BSAA 1UCKA 2KAAA 1AY7A 1CH0A 1B3SA 1BAOA 8RNTA 7RNTA 1I3IA 2AADA 2RNTA 3RNTA 2BU4A 3DGYA 1BGSA 1BNGA 3Q3FA 3URPA 1R4YA 1RCKA 1RSNA 1UCJA 3KCHA 1B2SA 3D4AA 1RGFA 4GHOA 1X1XA 1I2FA 1GOYA 1BU4A 1FZUA 3BIRA 1BIRA 3AHWA 1GMQA 1BRSA 1BNSA 1BRGA 1FUTA 1RGEA 2GSPA 1GMRA 1GOVA 5HOHA 1AQZA 1MGWA 1RGCA 1YGWA 2RBIA 1B2ZA 1BRNL 2F5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSP A;  4BIR A;  1ZGX A;  1HYF A;  3WHO A;  1LOV A;  1RHL A;  1BNF A;  1I70 A;  1RN1 A;  1UCI A;  3AGO A;  1B27 A;  1I0X A;  1BSE A;  1BNJ A;  6RNT A;  1BNI A;  3DH2 A;  5BIR A;  1BRJ A;  3A5E A;  4J5K A;  1FW7 A;  1BRH A;  2KF4 A;  4BU4 A;  1YVS A;  1I3F A;  1LOY A;  1UCL A;  9RNT A;  1DE3 A;  3HOH A;  1X1W A;  1BVI A;  1RCL A;  1FUS A;  1BSC A;  1RNB A;  1RGH A;  1RNT A;  1TRQ A;  1LRA A;  1B21 A;  1GMP A;  1LNI A;  4RNT A;  1C54 A;  1X1Y A;  1T2I A;  3D5I A;  1HZ1 A;  1G02 A;  4HOH A;  3WR2 A;  2KF3 A;  1IYY A;  1BAN A;  1MGR A;  1BUJ A;  1RLS A;  1B2U A;  4GSP A;  1A2P A;  1BRK A;  1I8V A;  1JBR A;  1BRI A;  1FYS A;  1RGA A;  1BOX A;  3SYU A;  1JBT A;  1GSP A;  1X1U A;  1JBS A;  1PYL A;  2BIR A;  1BSD A;  1RDS A;  1PY3 A;  1TTO A;  2HOH A;  1RTU A;  7GSP A;  1BSB A;  2ZA4 A;  1RGL A;  1I2G A;  1B20 A;  2F4Y A;  6GSP A;  1RGK A;  2SAR A;  1I2E A;  4J5G A;  2F5M A;  3D5G A;  3AHS A;  1RN4 A;  2F56 A;  1LOW A;  2AAE A;  1YNV X;  2KF5 A;  1BNE A;  1DET A;  1GOU A;  1RMS A;  1T2H A;  5BU4 A;  1B2X A;  1Q9E A;  3GSP A;  2KF6 A;  5RNT A;  1TRP A;  1I0V A;  1BNR A;  2C4B A;  1SAR A;  1RGG A;  1B2M A;  3AGN A;  4HAA A;  3BU4 A;  1BSA A;  1UCK A;  2KAA A;  1AY7 A;  1CH0 A;  1B3S A;  1BAO A;  8RNT A;  7RNT A;  1I3I A;  2AAD A;  2RNT A;  3RNT A;  2BU4 A;  3DGY A;  1BGS A;  1BNG A;  3Q3F A;  3URP A;  1R4Y A;  1RCK A;  1RSN A;  1UCJ A;  3KCH A;  1B2S A;  3D4A A;  1RGF A;  4GHO A;  1X1X A;  1I2F A;  1GOY A;  1BU4 A;  1FZU A;  3BIR A;  1BIR A;  3AHW A;  1GMQ A;  1BRS A;  1BNS A;  1BRG A;  1FUT A;  1RGE A;  2GSP A;  1GMR A;  1GOV A;  5HOH A;  1AQZ A;  1MGW A;  1RGC A;  1YGW A;  2RBI A;  1B2Z A;  1BRN L;  2F5W A; 
#chains in the Genus database with same CATH topology
 3B8L A;  3G16 A;  3HX8 A;  4HM8 B;  3RDE A;  3MG2 A;  3WHO A;  1OF5 A;  1UW1 A;  1TP6 A;  1GY6 A;  1UCI A;  2B24 B;  4FMD A;  5D83 A;  4X2O A;  1VQM 3;  3MWZ A;  1Q86 4;  3CCV 3;  2Z76 A;  3LTD A;  5JPU A;  1BNJ A;  4EXR A;  1BNI A;  2ZDJ A;  2INX A;  3NBR A;  1G96 A;  1BRJ A;  3KII A;  3A5E A;  1IT7 A;  3QK9 A;  4JF8 A;  1O7N B;  5BIR A;  4IIA A;  1BRH A;  1PFP A;  1FA3 A;  2IYJ A;  3VF1 A;  3CCL 3;  2Z77 A;  2MC8 A;  9RNT A;  4FCM A;  4N6T A;  4FMA A;  3S29 A;  1OAC A;  1BVI A;  1FUS A;  1NB3 I;  1YGE A;  4KT3 B;  3NM2 A;  4MMX B;  4N6L A;  4CCV A;  1N8R 4;  1RNB A;  1RNT A;  3PGB A;  1M90 4;  4Q53 A;  1EQK A;  2W0Q A;  1D6U A;  3D5I A;  5I97 A;  3D3L A;  4FCZ A;  1G02 A;  4HM0 B;  5CF1 A;  1NU3 A;  2KF3 A;  3LML A;  4OK0 A;  4L8P A;  3V98 A;  2UUG C;  2W03 A;  4O8S A;  1A2K A;  2GBX B;  2RCD A;  2V1L A;  1BUJ A;  1O7W B;  1OH0 A;  2KRT A;  2XFT A;  1WNH A;  1UGI A;  1JBR A;  4HM6 B;  3V92 A;  1U5O A;  3WA2 X;  1JBT A;  2HMO B;  1D6Z A;  3G0K A;  1SIH A;  2HMM B;  1IK3 A;  1NDO B;  1RDS A;  3B4O A;  1AVK A;  1VQ8 3;  1RTU A;  3K7C A;  2K3D A;  5G1L A;  4LYL B;  4HZ9 B;  1I2G A;  4WWU C;  3CC2 3;  1RGK A;  4J8T A;  1WMP A;  3JUQ A;  3MSO A;  1NO3 A;  3AHS A;  1MWS A;  4K1U A;  1AVL A;  1LOW A;  4FCJ A;  1YNV X;  2IUJ A;  1TU5 A;  4L8O A;  2W04 A;  3AMO A;  4O3V A;  2B1X B;  1RMS A;  1SJW A;  4BL2 A;  1GS3 A;  1ZS7 A;  2H0I A;  1Q9E A;  2GEX A;  1M1K 4;  3GZY B;  1W6Y A;  2C4B A;  1VZZ A;  3LT9 A;  4FMC A;  1FGR A;  5A0O B;  3NHX A;  4STD A;  3EC9 A;  3LOY A;  1JJ2 2;  4DKI A;  2W2C A;  1KSI A;  5JPP A;  1S72 3;  2K54 A;  1B3S A;  3RGR A;  3X3Z A;  2QIY A;  2A15 A;  3ZG5 A;  3CNM A;  1KC8 4;  1VQ5 3;  3U97 A;  4CDL A;  3RNT A;  2AAD A;  3TDG A;  3T8U A;  3MKI A;  3DGL A;  3F14 A;  1MWT A;  2Q07 A;  3K63 A;  3Q3F A;  2E2U A;  3CNX A;  3CCU 3;  1YJW 3;  1RSN A;  1LQG C;  1B2S A;  5M19 A;  5STD A;  1QAK A;  4K1V A;  2WOH A;  3G4S 3;  1Q82 4;  4GHO A;  3MG1 A;  1QJG A;  5CLK A;  2OOV A;  1GOY A;  1JZD A;  4WYK A;  3Q2P A;  3BIR A;  1FZU A;  3NV0 B;  2GU3 A;  3GZB A;  3NBJ A;  1BIR A;  5AI1 A;  2Y74 A;  1GMQ A;  2XRX B;  3F8X A;  2XR8 B;  1UUV B;  4HM7 B;  3HIG A;  1BNS A;  1K41 A;  1RGE A;  3DGO A;  5AYR B;  2SBL A;  4BTW A;  3SOY A;  3X42 A;  2ML6 A;  3NQY A;  1JKG B;  2GU1 A;  5HOH A;  1RGC A;  2RBI A;  3DH2 A;  1W7C A;  2F5W A;  2FNQ A;  3DGM A;  1D6Y A;  3I0Y A;  1IVX A;  1ZGX A;  4N6N B;  1BRN L;  3KSE D;  1LQM B;  3FSD A;  3FGY A;  3K9M C;  3LYG A;  1BNF A;  1GD3 A;  1US1 A;  4RNY A;  1I70 A;  1RN1 A;  3JUM A;  4XDW A;  1UI7 A;  4HM4 B;  5TGN A;  1QVG 2;  3DXO A;  1ZO2 A;  2JDI H;  5KP1 A;  3NUV A;  1CEW I;  2E2V A;  3OWU A;  3CU3 A;  6RNT A;  1ULI B;  3SLU A;  2YX9 A;  2Z7A A;  1OUN A;  3M8C A;  1O7G B;  4R9K A;  1Q81 4;  4HBR A;  1MWU A;  5ELU A;  2W9Q A;  5DRE A;  1IQY A;  5IG0 A;  3WOE B;  2D1W A;  1YVS A;  1FGO A;  1UCL A;  3EJV A;  1YHQ 3;  1HU9 A;  3KSP A;  1OHS A;  2R4I A;  1G0T A;  1WMO A;  1BSC A;  4MJD A;  1RGH A;  1RKY A;  2OTJ 3;  1TRQ A;  1GMP A;  1LNI A;  3LH4 A;  1N9E A;  4CPK A;  1EKM A;  1X1Y A;  4NPB A;  2YFL B;  3GRD A;  2RFR A;  3OXA A;  3X41 A;  2E2T A;  3WR2 A;  2CWT A;  4MEI A;  4RBN A;  2IUK A;  1YVB I;  2H0H A;  1L5G B;  1YIJ 3;  2W56 A;  1DVD A;  1MGR A;  3DY5 A;  1B2U A;  1BRK A;  1Y4K A;  3T0U A;  1U8C B;  3F7S A;  1BRI A;  1VQQ A;  5IER A;  1W6G A;  2HMK B;  1BOX A;  5AII A;  3J7Y d;  4G1M B;  1TIJ A;  3S67 A;  3HII A;  1GSP A;  2BHM A;  1JBS A;  3MG3 A;  2PNC A;  1WMN A;  1W00 A;  2HOH A;  1ROV A;  1M1X B;  4OVM A;  2ZA4 A;  1B20 A;  3L0R A;  4O2H A;  3OW2 2;  4IPB A;  1FGT A;  2F56 A;  2AAE A;  1OHO A;  2BMQ B;  2KF5 A;  3DMC A;  4HM5 B;  1DET A;  4N6O B;  2XGL A;  2CKF B;  3WOF B;  1LXE A;  4GB5 A;  5LC6 A;  1GY7 A;  3X3Y A;  2KF6 A;  5G2G A;  2BMR B;  3F9S A;  4WHA A;  1BNR A;  1ULJ B;  3ZG0 A;  4L7K A;  1SAR A;  1B2M A;  1JB5 A;  1LOX A;  4XB5 A;  3JUP A;  1Q7Y 4;  3BU4 A;  7STD A;  1T5Y A;  1W2B 2;  4LSO A;  3G6E 3;  2BMO B;  3LTC A;  4HZB B;  4EC6 A;  3CMA 3;  3EBT A;  3HK4 A;  1AY7 A;  3N9H A;  3EBY A;  4AKZ A;  1IVV A;  2CFW A;  1IDP A;  4LEH A;  1RN7 A;  3FG4 A;  2XF3 A;  1DMM A;  2IA7 A;  3X40 A;  2CK3 H;  3QRD A;  2GBW B;  1Q40 A;  2OCT A;  4N6V 0;  1N9J A;  4AEQ A;  1JV2 B;  3DGY A;  3KE7 A;  4KFE A;  2OQE A;  1JNQ A;  3AMO B;  2P09 A;  3GWR A;  1YIT 3;  3WMD A;  3BNB A;  1RCK A;  3KCH A;  5IG5 A;  1VQO 3;  1EA2 A;  1C7H A;  3KN4 A;  1ROA A;  2C10 A;  2WOF A;  3D4A A;  3JUN A;  4IT7 A;  1T3B A;  1W5Z A;  3CXC 2;  3FG3 A;  3EN1 B;  2IY2 A;  3N8B A;  1JRQ A;  1RRL A;  3PS8 A;  1Q42 A;  1BU4 A;  2IMJ A;  2MF7 A;  3CD6 3;  3IMA B;  3BB9 A;  3E99 A;  4XM4 A;  2F98 A;  2CWV A;  1EG9 B;  2CG0 A;  2Y73 A;  3WA3 A;  2CIU A;  1QMA A;  3DZL A;  3CME 3;  1Z1S A;  1FGQ A;  4XBY A;  1GMR A;  1MGW A;  2RSX A;  1YGW A;  1AV4 A;  3B4P A;  1IQX A;  4MMZ B;  1WQL B;  4R1K A;  5GSP A;  5LC7 A;  4H61 A;  1IU7 A;  1HYF A;  2XGN A;  1LOV A;  5AEW B;  4N6U A;  2CC3 A;  1RHL A;  1RRH A;  2KXG A;  1QAF A;  3KFQ C;  3OWS A;  1KWI A;  1O7P B;  1B27 A;  1I0X A;  3CC4 3;  1BSE A;  3DUK A;  4J9A A;  3LZA A;  2CWU A;  1HKX A;  3RGA A;  1IV9 A;  3U1W A;  3BND A;  1JB2 A;  1E97 A;  3Q90 A;  3DM8 A;  4QWT A;  5FGO A;  5HGR A;  4WYK B;  3PCS A;  3UL5 A;  6STD A;  1FW7 A;  2LYX A;  2KF4 A;  1QAL A;  1K8A 4;  2BNG A;  1I3F A;  1LOY A;  3MYT A;  2CX1 A;  4FR9 A;  3BNC A;  3K0Z A;  1A67 A;  4LMI A;  4K61 A;  3UB1 A;  1WTH A;  3BNE A;  5BVB A;  4XBX A;  1LRA A;  1B21 A;  4RNT A;  1C54 A;  4FMB A;  1OPY A;  1T2I A;  3ALA A;  3HI7 A;  4I4K A;  1BUQ A;  2BO9 B;  5AIF A;  2F86 B;  1OGZ A;  4KZ1 A;  1IYY A;  5M1A A;  3LT8 A;  3D9R A;  1DVC A;  5AIH A;  4GSP A;  1A2P A;  1UDI I;  4EW5 A;  1TUH A;  1JN5 A;  2UX0 A;  1FYS A;  3DGN A;  1RGA A;  1NB5 I;  3SYU A;  1VQN 3;  4WP5 A;  1STF I;  1GYB A;  1UUG B;  1X1U A;  2BIR A;  4EBG A;  1VQ4 3;  1BSD A;  1YJN 3;  1TTO A;  2P38 A;  3B7C A;  2GEY A;  7GSP A;  3FKA A;  1N8Q A;  1RGL A;  2CHC A;  2YFI B;  3A76 A;  2F99 A;  2F4Y A;  6GSP A;  2OOV C;  1SQW A;  1LNH A;  1I2E A;  5JBS A;  3CPO A;  3D5G A;  5EQL A;  2I9W A;  3FLJ A;  2HMJ B;  3CCJ 3;  3CCR 3;  1A2V A;  1O7M B;  2L1S A;  2XH9 A;  1GOU A;  1OF5 B;  1T2H A;  2W56 B;  3EB8 A;  3F40 A;  3GSP A;  5RNT A;  3JUO A;  1TRP A;  1F8N A;  3EHC A;  1UUW B;  1I0V A;  2O9U X;  1N5P A;  5KP3 A;  3N54 B;  3AGN A;  4HAA A;  1MNL A;  2BT3 A;  1LVN A;  3G71 3;  2ZHX B;  1BSA A;  2D42 A;  1UCK A;  3G8Z A;  2UGI A;  3OX9 A;  5EEO A;  4EYC A;  5CK6 A;  1YJ9 3;  3NBB A;  5IG3 A;  5ELJ A;  1EEJ A;  4WFO A;  4EV5 A;  1CH0 A;  5CF2 A;  3H51 A;  1S5A A;  4NHF A;  5IEN A;  5KP4 A;  4HM1 B;  2XSO B;  7RNT A;  3KKG A;  2PZV A;  2QEX 3;  1I3I A;  1O7H B;  1Q7H A;  2RNT A;  4ZM8 A;  3ROB A;  2JQ5 A;  3NX0 A;  2CFK A;  3S27 A;  1PU4 A;  1KD1 4;  2O3O A;  1DYU A;  3FZW A;  1BGS A;  1BNG A;  3O8Y A;  5BXQ A;  1R4Y A;  1IVU A;  3PXM A;  3MPH A;  2CFD A;  3EX9 A;  2CFL A;  3FF2 A;  5IEO A;  3S28 A;  1X1X A;  5IF6 A;  1I2F A;  1GY5 A;  4O02 B;  1R4C A;  3LTB A;  2CFG A;  1ISK A;  1GD4 A;  2WGQ A;  2HMN B;  5IG4 A;  1DMQ A;  3KZT A;  4OUQ A;  3ER7 A;  1KQS 2;  3AHW A;  2QA4 3;  1VQ9 3;  3NXJ A;  3LTA A;  4RNZ A;  4BTY A;  1BRS A;  3D79 A;  4R9L A;  2GSP A;  5AEU B;  2W9P A;  1K73 4;  4GL6 A;  1J2B A;  1OGX A;  3SVA A;  1SPU A;  3WDG B;  1V58 A;  2P0M A;  1NWW A;  4CJN A;  3FH1 A;  1V57 A;  1B2Z A;  1Q40 B;  4BIR A;  3WOD G;  1W01 A;  3EQQ B;  1VQL 3;  2P05 A;  1A90 A;  3AGO A;  3VSY A;  4HVN A;  3SED A;  2Z6B A;  3CCQ 3;  2HML B;  4RZM A;  3I56 3;  1VQ7 3;  3V99 A;  1TFK A;  1OCV A;  3SOA A;  2FGT A;  3Q1C A;  3CCS 3;  4J5K A;  1STD A;  4LZI A;  3JVC A;  4BU4 A;  3MHE A;  3PYJ A;  2LQV A;  1VQP 3;  5FW5 A;  1DE3 A;  4AKY A;  3HOH A;  4TX4 A;  2GXF A;  1X1W A;  1RCL A;  2XFS A;  4ORL A;  2RGQ A;  3ECF A;  4U13 A;  3OWY A;  1IT8 A;  3GZX B;  2CW9 A;  4BL3 A;  1JB4 A;  8CHO A;  2CX0 A;  5AIG A;  3SXX A;  3CC7 3;  4R4K A;  1HZ1 A;  4XDV A;  4ILF A;  2J8X B;  4HOH A;  5CXO A;  1BAN A;  2WGO A;  3PZW A;  4BTX A;  1RLS A;  2H0G A;  1ZX2 A;  3F8H A;  1VQK 3;  5M18 A;  1I8V A;  4EV2 A;  3UNL A;  2CH9 A;  3PCR A;  5IEP A;  1EUI C;  1IQ8 A;  2K0M A;  1PYL A;  1SII A;  3CCE 3;  1OHP A;  2ML5 A;  2C11 A;  2W6J H;  2OQE C;  1PY3 A;  5AYS C;  3STD A;  1M9G A;  5G1K A;  2XEP A;  2YFJ B;  1BSB A;  3LXU X;  1FUW A;  4HKV B;  1MOL A;  4K90 B;  3IPT A;  2SAR A;  3VGN A;  4J5G A;  3EE1 A;  1W6C A;  2STD A;  2F5M A;  2ZL8 A;  1RN4 A;  4X2H A;  1RJO A;  1YI2 3;  3FG1 A;  3NM7 A;  1UGH I;  1W2Z A;  1CYU A;  1BNE A;  1NNV A;  1TFO A;  1W4N A;  4LGQ A;  3GZR A;  3IJE B;  5BU4 A;  3I55 3;  1B2X A;  1K9M 4;  4R80 A;  1RGG A;  4MMY B;  1DMN A;  1JN5 B;  1FGM A;  1E3V A;  3NQZ A;  3NV0 A;  2FXT A;  3CPW 2;  2KAA A;  1UI8 A;  1IV7 A;  2P0X A;  5IW9 A;  1TJD A;  3SX1 A;  2M7O A;  1BAO A;  8RNT A;  4N3V A;  2L4V A;  1JKG A;  1V74 A;  1JZO A;  1W02 A;  3OV4 A;  4H3U A;  2WO0 A;  1NJI 4;  1VQ6 3;  1CYV A;  3EN8 A;  1N5H A;  2BU4 A;  4HM2 B;  2OWP A;  4N6M A;  3UJM A;  3BLZ A;  3X3X A;  3URP A;  1ASK A;  2OTL 3;  1QVF 2;  1E3R A;  1UCJ A;  4HJL B;  2R41 A;  2CG1 A;  3EF8 A;  5DRV A;  1RGF A;  4JRF A;  4NRE A;  5D82 A;  4I5Q A;  5EVH A;  3FCS B;  3CCM 3;  1CQS A;  5D81 A;  3GAX A;  3H3H A;  4KVH A;  3FF0 A;  2XSH B;  3UL6 A;  1K28 A;  3ZFZ A;  2QGU A;  1MWR A;  1BRG A;  1FUT A;  4KFF A;  3T8N A;  1GOV A;  1AQZ A;  3K5T A;  1AR0 A;  1IVW A;  2KCD A;  3HZP A;  4HM3 B;  4KFD A;  4PEJ A;  4XBT A;  3S5C A;  3F7X A;  4HYZ A; 
#chains in the Genus database with same CATH homology
 5GSP A;  4BIR A;  1ZGX A;  1HYF A;  3WHO A;  1LOV A;  1RHL A;  1BNF A;  1I70 A;  1RN1 A;  1UCI A;  3AGO A;  1B27 A;  1I0X A;  1BSE A;  1BNJ A;  6RNT A;  1BNI A;  3DH2 A;  5BIR A;  1BRJ A;  3A5E A;  4J5K A;  1FW7 A;  1BRH A;  2KF4 A;  4BU4 A;  1YVS A;  1I3F A;  1LOY A;  1UCL A;  9RNT A;  1DE3 A;  3HOH A;  1X1W A;  1BVI A;  1RCL A;  1FUS A;  1BSC A;  1RNB A;  1RGH A;  1RNT A;  1TRQ A;  1LRA A;  1B21 A;  1GMP A;  1LNI A;  4RNT A;  1C54 A;  1X1Y A;  1T2I A;  3D5I A;  1HZ1 A;  1G02 A;  4HOH A;  3WR2 A;  2KF3 A;  1IYY A;  1BAN A;  1MGR A;  1BUJ A;  1RLS A;  1B2U A;  4GSP A;  1A2P A;  1BRK A;  1I8V A;  1JBR A;  1BRI A;  1FYS A;  1RGA A;  1BOX A;  3SYU A;  1JBT A;  1GSP A;  1X1U A;  1JBS A;  1PYL A;  2BIR A;  1BSD A;  1RDS A;  1PY3 A;  1TTO A;  2HOH A;  1RTU A;  7GSP A;  1BSB A;  2ZA4 A;  1RGL A;  1I2G A;  1B20 A;  2F4Y A;  6GSP A;  1RGK A;  2SAR A;  1I2E A;  4J5G A;  2F5M A;  3D5G A;  3AHS A;  1RN4 A;  2F56 A;  1LOW A;  2AAE A;  1YNV X;  2KF5 A;  1BNE A;  1DET A;  1GOU A;  1RMS A;  1T2H A;  5BU4 A;  1B2X A;  1Q9E A;  3GSP A;  2KF6 A;  5RNT A;  1TRP A;  1I0V A;  1BNR A;  2C4B A;  1SAR A;  1RGG A;  1B2M A;  3AGN A;  4HAA A;  3BU4 A;  1BSA A;  1UCK A;  2KAA A;  1AY7 A;  1CH0 A;  1B3S A;  1BAO A;  8RNT A;  7RNT A;  1I3I A;  2AAD A;  2RNT A;  3RNT A;  2BU4 A;  3DGY A;  1BGS A;  1BNG A;  3Q3F A;  3URP A;  1R4Y A;  1RCK A;  1RSN A;  1UCJ A;  3KCH A;  1B2S A;  3D4A A;  1RGF A;  4GHO A;  1X1X A;  1I2F A;  1GOY A;  1BU4 A;  1FZU A;  3BIR A;  1BIR A;  3AHW A;  1GMQ A;  1BRS A;  1BNS A;  1BRG A;  1FUT A;  1RGE A;  2GSP A;  1GMR A;  1GOV A;  5HOH A;  1AQZ A;  1MGW A;  1RGC A;  1YGW A;  2RBI A;  1B2Z A;  1BRN L;  2F5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...