5BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5bu4A00
1RGCA 2BU4A 5RNTA 1GOVA 1TRQA 7RNTA 1JBRA 1B2ZA 1BRGA 1B20A 1T2HA 3AHSA 1FYSA 1LOYA 1Q9EA 4HOHA 2KF4A 6RNTA 1RTUA 3URPA 5BIRA 1RGLA 1RGGA 3AHWA 1RN1A 3WR2A 1I0XA 2SARA 2KF3A 1X1WA 2GSPA 3BIRA 1X1XA 4J5GA 1HZ1A 1A2PA 1B2MA 2F5MA 1ZGXA 1BANA 1RDSA 2F5WA 1UCLA 1BOXA 1I3IA 1MGWA 1IYYA 1AY7A 4J5KA 1B2SA 1T2IA 1GMPA 1BGSA 2RBIA 2HOHA 9RNTA 1I2GA 3HOHA 4BU4A 1BSEA 1BNGA 2AAEA 3D5GA 1R4YA 1BRHA 1B2XA 1BRSA 5HOHA 1UCJA 2BIRA 3D4AA 3WHOA 4GHOA 1BNEA 3BU4A 1BRKA 1MGRA 1BVIA 3D5IA 3DH2A 1BRIA 1I3FA 5BU4A 1GOUA 1HYFA 1LNIA 7GSPA 1LOVA 1FZUA 1RNBA 1RGKA 3GSPA 4BIRA 1X1YA 1B21A 1TTOA 1CH0A 4RNTA 2KF6A 6GSPA 1PY3A 2KF5A 2F56A 1LRAA 1B3SA 1RGHA 1C54A 1I70A 8RNTA 1AQZA 1RHLA 1BIRA 1I2EA 1RGAA 1GMQA 2AADA 1I2FA 1GMRA 1YGWA 1RCLA 1BRNL 1PYLA 1BSAA 1FUTA 2KAAA 2C4BA 5GSPA 1BNJA 1I8VA 1YVSA 1RLSA 1I0VA 1RMSA 1BU4A 1X1UA 4HAAA 3Q3FA 1SARA 1JBTA 1BNRA 1RCKA 1BSBA 1TRPA 2ZA4A 1BSCA 2RNTA 1B2UA 1G02A 1DE3A 1BNFA 1FUSA 1RGFA 1UCKA 1RSNA 3AGNA 1RGEA 2F4YA 1YNVX 3SYUA 3AGOA 1FW7A 4GSPA 1RN4A 3KCHA 1BNIA 1B27A 1BNSA 1RNTA 3RNTA 1GOYA 1DETA 1UCIA 3A5EA 1LOWA 1JBSA 1BUJA 1BRJA 1GSPA 1BAOA 3DGYA 1BSDA
chains in the Genus database with same CATH superfamily
1D6UA 1YGEA 3M8CA 1GOVA 5RNTA 5IG5A 4R4KA 2LYXA 2CK3H 1WTHA 5I97A 3EE1A 5DRVA 2QIYA 1W5ZA 1B2ZA 2KRTA 1B20A 4H3UA 1JN5A 3AHSA 4ILFA 3ZFZA 2QEX3 3CCL3 2KF4A 3HK4A 1TJDA 3SLUA 1RN1A 4ORLA 3PS8A 3V98A 3CCV3 1W02A 3NM7A 1NO3A 2SARA 2E2UA 2E2VA 1M1K4 2H0GA 3NBBA 5AYRB 1ZX2A 2WGOA 4J5GA 1HZ1A 4QWTA 1N5PA 2F5MA 1ZGXA 1E3VA 2D42A 2Q07A 3NQZA 1AV4A 3CCJ3 4HM8B 4O8SA 3S67A 4FMCA 1Q40A 2PNCA 3FZWA 3JUOA 1KWIA 4FMDA 2HMMB 2YX9A 3UNLA 3NV0A 2YFLB 2WGQA 3HOHA 1OGZA 4BU4A 1BSEA 1JNQA 4BL2A 4R9KA 4MJDA 4BTYA 2CG0A 4G1MB 4K61A 1B2XA 1YJN3 5HOHA 1UCJA 4N6TA 4GHOA 3N8BA 1BRKA 3X3YA 4EC6A 3EN8A 1O7PB 1MGRA 3OV4A 3DGNA 3NBRA 2IUJA 3SXXA 4AKZA 3WA2X 1PFPA 4OUQA 1UGIA 2R41A 5IW9A 3FG1A 2UX0A 1LVNA 4U13A 1NWWA 3D3LA 1V74A 1NDOB 1LNIA 3PCRA 1RRHA 2CFWA 1LOVA 3JUPA 2V1LA 1JJ22 3DGLA 2H0HA 4BIRA 1UDII 4HBRA 4HKVB 2GU3A 3FLJA 1SIIA 3QRDA 3KSED 1W6CA 2KF5A 5KP4A 5IEPA 3MG2A 2HMLB 1OH0A 3VGNA 1ROAA 3QK9A 5BXQA 5CK6A 1VZZA 3PYJA 1AQZA 3AMOB 4WWUC 5AYSC 1MNLA 2RCDA 1I2EA 1QAKA 3FG4A 2AADA 3WOFB 1YGWA 3MG1A 4K90B 1VQP3 1BSAA 4K1VA 1FUTA 2HMJB 2GXFA 3SEDA 3CD63 5GSPA 1DMNA 3SVAA 1RLSA 3JVCA 2OQEC 1WQLB 1TFKA 4O2HA 2INXA 4EXRA 1BU4A 1ULIB 4O3VA 2ZL8A 3BNCA 5M1AA 4XBYA 1US1A 2W9QA 4K1UA 1NB3I 3JUNA 1ZS7A 3CU3A 3ECFA 1RCKA 3KZTA 3IMAB 1BSBA 2ZA4A 3NXJA 1BSCA 3BNDA 2CH9A 2OQEA 1EEJA 1YI23 3F8HA 1RGFA 2CX1A 3MG3A 5JBSA 3CCR3 3S29A 3KIIA 1W01A 1WMNA 1OHPA 2CFKA 2C10A 1A67A 2CIUA 1FW7A 3KCHA 1RNTA 4BTWA 2HMKB 2XGLA 1IQXA 2OTJ3 1NU3A 1JBSA 3KE7A 5JPUA 2CFGA 4LSOA 1BAOA 4WFOA 1S723 2Z76A 2Z6BA 1QALA 2E2TA 3BIRA 2F86B 5AIGA 2OWPA 1RGCA 2BU4A 8CHOA 1TRQA 3G6E3 2FGTA 3KN4A 1AR0A 7RNTA 3GZRA 3WODG 3LTAA 2GEXA 3UB1A 1S5AA 1KC84 1T2HA 1MWSA 1LOYA 1Q9EA 6RNTA 4N6V0 3GZXB 3CMA3 1JN5B 1RTUA 3URPA 4GL6A 2B1XB 1RGLA 3AHWA 3OWSA 1E97A 3WR2A 4RZMA 3HIIA 3GWRA 5M19A 3K63A 3TDGA 2B24B 2IMJA 1X1XA 2IUKA 1VQO3 4NREA 1ISKA 4NPBA 4IIAA 5ELJA 5AIHA 1BANA 1BUQA 1JB5A 4KFDA 1RDSA 1VQN3 1UCLA 1IVWA 4LMIA 1BOXA 1MGWA 2D1WA 1IYYA 3GRDA 4J5KA 1Q40B 3STDA 1SIHA 1EG9B 2H0IA 1TIJA 5G1KA 3EX9A 1OF5A 2ML6A 2HMOB 2HOHA 1IQ8A 3MPHA 3JUQA 4J8TA 4KZ1A 3CNXA 3X41A 3NV0B 1BNGA 1ASKA 4N6NB 1STFI 2Z7AA 1BRHA 1BRSA 1IDPA 4LEHA 5EQLA 5FGOA 1STDA 3D4AA 3MWZA 2W03A 1GY7A 4XBXA 1BNEA 3BU4A 3FCSB 4R1KA 1N8QA 1JV2B 2O9UX 3LH4A 3A76A 3D5IA 3DH2A 4WYKA 2Z77A 2BT3A 1ZO2A 3UL5A 4CCVA 3DM8A 1T3BA 3NBJA 4HJLB 4HM3B 2XRXB 1RGKA 4AEQA 2CFLA 3DXOA 2OOVC 1C7HA 7STDA 2GBXB 1Q814 3F7SA 1PY3A 4FCZA 1KD14 4CDLA 1B3SA 1M1XB 3KFQC 1FGTA 3DUKA 2MF7A 3Q1CA 3UL6A 3CPW2 3VF1A 1EKMA 2XFTA 2CWVA 3LTDA 3LT8A 1AVKA 1YJ93 8RNTA 3I553 1OACA 4EV2A 5JPPA 3SOAA 3E99A 3BNEA 2OOVA 3J7Yd 3RDEA 1RGAA 5IENA 2CKFB 1GMQA 3HZPA 4H61A 1GMRA 1CYVA 2UUGC 2P38A 4MMZB 4RBNA 1BRNL 2R4IA 1PYLA 1UUGB 3WDGB 3LMLA 3CCQ3 5IERA 1I8VA 3CC73 1K41A 3B7CA 1FA3A 4N6UA 3LTCA 1IV7A 1YJW3 3WOEB 5EVHA 4EW5A 3Q3FA 4HM6B 3X3XA 1O7HB 3K5TA 5IEOA 4FMBA 3RGAA 1W00A 2P0MA 3VSYA 2WOHA 3LT9A 2GEYA 3X42A 1K734 5CF2A 2QA43 1G02A 2ZDJA 1EA2A 1WNHA 1DE3A 4HM1B 1BNFA 1YHQ3 1RN7A 1WMOA 2XEPA 3DZLA 3F7XA 5CXOA 1YNVX 5AIFA 2WO0A 1HKXA 2RGQA 3AGOA 4PEJA 1LNHA 1LQGC 1RN4A 1B27A 1LOXA 2XSOB 1GOYA 5DREA 1M904 1DETA 3V99A 4EYCA 4BTXA 1BUJA 5HGRA 1IVUA 5KP3A 1J2BA 1OUNA 1F8NA 1BSDA 1JRQA 4HM0B 2IA7A 1DMMA 3LTBA 3U1WA 3MHEA 3T0UA 1VQL3 2JDIH 4HZ9B 1GS3A 1Q7HA 4AKYA 3T8UA 2CX0A 1BRGA 3PXMA 3IPTA 4NHFA 3G0KA 4HOHA 1IQYA 1JB4A 5BIRA 1QJGA 1RGGA 3MKIA 1Q42A 2BHMA 2GU1A 3EC9A 1X1WA 5D82A 2CHCA 1A2PA 1FGQA 1W2B2 3H51A 2A15A 1K28A 3GAXA 2F5WA 2FNQA 1OHSA 4KFFA 4DKIA 1O7MB 1PU4A 1GYBA 1I3IA 1RKYA 1MWUA 1GY5A 1B2SA 1T2IA 1GMPA 3K7CA 1BGSA 1V58A 1CEWI 1JZOA 2RBIA 3FGYA 4XB5A 4XM4A 5STDA 3I563 1VQK3 9RNTA 1NJI4 1OF5B 5AI1A 1I2GA 3LYGA 3Q2PA 4IT7A 4WP5A 1JKGA 2XH9A 1W6GA 4HYZA 4O02B 3OX9A 2XSHB 1IU7A 3I0YA 4R9LA 4EBGA 2BIRA 2FXTA 2I9WA 2BMQB 2UGIA 3F40A 1ROVA 2XGNA 3LOYA 3CCS3 1W6YA 1BVIA 3CPOA 3NM2A 3PZWA 5ELUA 1CQSA 4L8OA 4WYKB 4KT3B 1HYFA 3ER7A 3G4S3 1Q824 3F8XA 2GBWB 3DMCA 4ZM8A 3WMDA 1KSIA 2BMRB 2M7OA 3LXUX 1IVXA 2ZHXB 1X1YA 3GSPA 5AEUB 1UI8A 2C11A 1YIT3 1B21A 4HVNA 3BB9A 2SBLA 1LQMB 2KF6A 2QGUA 2Y73A 6GSPA 1VQM3 1A90A 1DYUA 2F56A 1IV9A 1G96A 2W04A 2YFIB 1FGRA 4N6LA 1UI7A 1YIJ3 1RGHA 1UGHI 1GD4A 1TFOA 2O3OA 3K9MC 3CCU3 2F99A 1C54A 1I70A 1NB5I 4L7KA 4JF8A 1VQ83 3CNMA 4OK0A 1CYUA 1IT7A 1V57A 1TU5A 3B4PA 1JZDA 3BNBA 1I2FA 4JRFA 1RCLA 3H3HA 5G2GA 1QMAA 4I5QA 1Q864 2CG1A 4X2OA 1BNJA 3NUVA 1MWRA 3G8ZA 1YVSA 1E3RA 1EUIC 4FMAA 1D6ZA 3WA3A 2YFJB 1VQ53 4LYLB 1RMSA 4J9AA 1UW1A 1X1UA 4CPKA 4HAAA 1N5HA 3Q90A 1R4CA 3KKGA 3F14A 1KQS2 2STDA 5BVBA 4HM5B 1VQ73 1VQQA 3EN1B 4XDWA 1W2ZA 3D79A 2RNTA 2W56A 3S27A 1B2UA 2L4VA 3T8NA 5CLKA 5CF1A 3NX0A 4MMYB 4HM7B 1SJWA 5KP1A 1UCKA 2W6JH 3AGNA 2XF3A 1FGMA 1WMPA 2F4YA 2OCTA 1U8CB 1DVCA 1G0TA 3SYUA 4FCJA 3UJMA 2W0QA 4GSPA 4KVHA 3MYTA 1QVF2 1BNIA 4GB5A 1DVDA 4Q53A 2KXGA 3EHCA 3OWYA 1UCIA 3B8LA 1ULJB 3O8YA 4I4KA 1BRJA 1FGOA 3DGYA 4HM4B 1YVBI 5A0OB 3CC43 2CW9A 2K3DA 1A2KA 1UUVB 2WOFA 3NQYA 1JBRA 3HI7A 1FYSA 6STDA 5IG0A 1T5YA 3K0ZA 1D6YA 1I0XA 2BNGA 4FCMA 2KF3A 2L1SA 4N3VA 2GSPA 3L0RA 3FF0A 2JQ5A 1B2MA 2CWTA 3U97A 3FSDA 1L5GB 1NNVA 3BLZA 3JUMA 5D81A 5FW5A 4LGQA 3B4OA 3EB8A 3HIGA 3OWUA 4TX4A 1VQ43 5D83A 1AY7A 2CFDA 4LZIA 3IJEB 3PCSA 3GZYB 3G713 1O7WB 2W9PA 1O7NB 4R80A 4RNYA 3EBYA 3EJVA 1A2VA 1N9EA 3GZBA 3OW22 2AAEA 4BL3A 2F98A 1RJOA 3D9RA 3HX8A 3DY5A 3D5GA 3KSPA 1JKGB 1R4YA 3FH1A 2PZVA 3F9SA 1EQKA 2P05A 3WHOA 1LXEA 4MMXB 1N9JA 5IG3A 1GD3A 3DGOA 3MSOA 1N8R4 1AVLA 1SQWA 2BMOB 1DMQA 1BRIA 2CWUA 1K9M4 1RRLA 2CC3A 1I3FA 2IY2A 5BU4A 1JB2A 1GOUA 3FKAA 3ROBA 3V92A 7GSPA 5TGNA 3CXC2 1FZUA 3OXAA 2HMNB 1OCVA 4HM2B 1RNBA 4MEIA 1QVG2 2BO9B 1TTOA 1Z1SA 4X2HA 1IT8A 1CH0A 4RNTA 4XBTA 1W4NA 1IK3A 4HZBB 4STDA 1Y4KA 3CC23 2P09A 2P0XA 3CCM3 3LZAA 1LRAA 4XDVA 1SPUA 1OHOA 1IVVA 3PGBA 4EV5A 1K8A4 3RGRA 3EBTA 2K54A 3AMOA 1TUHA 4CJNA 4N6MA 1HU9A 2RFRA 4RNZA 1VQ93 1RHLA 1BIRA 4N6OB 3S28A 4L8PA 5IG4A 5IF6A 4IPBA 5LC7A 3ZG0A 2KAAA 2C4BA 3SX1A 2Y74A 3FF2A 1TP6A 2ML5A 5AIIA 1OPYA 3CME3 3DGMA 1I0VA 2XFSA 3EF8A 3S5CA 3X40A 1OGXA 4FR9A 3CCE3 1MOLA 3NHXA 2J8XB 3ALAA 1SARA 3EQQB 2W2CA 1JBTA 1BNRA 2K0MA 1TRPA 1QAFA 2RSXA 3N54B 5EEOA 1U5OA 2KCDA 3N9HA 3SOYA 4WHAA 5LC6A 1FUSA 2W56B 4OVMA 1FUWA 1RSNA 3G16A 1VQ63 1RGEA 2LQVA 4KFEA 1MWTA 1GY6A 5AEWB 1UUWB 2MC8A 2XR8B 1BNSA 1O7GB 3X3ZA 3RNTA 5M18A 3A5EA 5G1LA 1LOWA 2OTL3 1Q7Y4 1GSPA 3ZG5A 1M9GA 3FG3A 2IYJA 1W7CA
chains in the Genus database with same CATH topology
1RGCA 2BU4A 5RNTA 1GOVA 1TRQA 7RNTA 1JBRA 1B2ZA 1BRGA 1B20A 1T2HA 3AHSA 1FYSA 1LOYA 1Q9EA 4HOHA 2KF4A 6RNTA 1RTUA 3URPA 5BIRA 1RGLA 1RGGA 3AHWA 1RN1A 3WR2A 1I0XA 2SARA 2KF3A 1X1WA 2GSPA 3BIRA 1X1XA 4J5GA 1HZ1A 1A2PA 1B2MA 2F5MA 1ZGXA 1BANA 1RDSA 2F5WA 1UCLA 1BOXA 1I3IA 1MGWA 1IYYA 1AY7A 4J5KA 1B2SA 1T2IA 1GMPA 1BGSA 2RBIA 2HOHA 9RNTA 1I2GA 3HOHA 4BU4A 1BSEA 1BNGA 2AAEA 3D5GA 1R4YA 1BRHA 1B2XA 1BRSA 5HOHA 1UCJA 2BIRA 3D4AA 3WHOA 4GHOA 1BNEA 3BU4A 1BRKA 1MGRA 1BVIA 3D5IA 3DH2A 1BRIA 1I3FA 5BU4A 1GOUA 1HYFA 1LNIA 7GSPA 1LOVA 1FZUA 1RNBA 1RGKA 3GSPA 4BIRA 1X1YA 1B21A 1TTOA 1CH0A 4RNTA 2KF6A 6GSPA 1PY3A 2KF5A 2F56A 1LRAA 1B3SA 1RGHA 1C54A 1I70A 8RNTA 1AQZA 1RHLA 1BIRA 1I2EA 1RGAA 1GMQA 2AADA 1I2FA 1GMRA 1YGWA 1RCLA 1BRNL 1PYLA 1BSAA 1FUTA 2KAAA 2C4BA 5GSPA 1BNJA 1I8VA 1YVSA 1RLSA 1I0VA 1RMSA 1BU4A 1X1UA 4HAAA 3Q3FA 1SARA 1JBTA 1BNRA 1RCKA 1BSBA 1TRPA 2ZA4A 1BSCA 2RNTA 1B2UA 1G02A 1DE3A 1BNFA 1FUSA 1RGFA 1UCKA 1RSNA 3AGNA 1RGEA 2F4YA 1YNVX 3SYUA 3AGOA 1FW7A 4GSPA 1RN4A 3KCHA 1BNIA 1B27A 1BNSA 1RNTA 3RNTA 1GOYA 1DETA 1UCIA 3A5EA 1LOWA 1JBSA 1BUJA 1BRJA 1GSPA 1BAOA 3DGYA 1BSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGC A;  2BU4 A;  5RNT A;  1GOV A;  1TRQ A;  7RNT A;  1JBR A;  1B2Z A;  1BRG A;  1B20 A;  1T2H A;  3AHS A;  1FYS A;  1LOY A;  1Q9E A;  4HOH A;  2KF4 A;  6RNT A;  1RTU A;  3URP A;  5BIR A;  1RGL A;  1RGG A;  3AHW A;  1RN1 A;  3WR2 A;  1I0X A;  2SAR A;  2KF3 A;  1X1W A;  2GSP A;  3BIR A;  1X1X A;  4J5G A;  1HZ1 A;  1A2P A;  1B2M A;  2F5M A;  1ZGX A;  1BAN A;  1RDS A;  2F5W A;  1UCL A;  1BOX A;  1I3I A;  1MGW A;  1IYY A;  1AY7 A;  4J5K A;  1B2S A;  1T2I A;  1GMP A;  1BGS A;  2RBI A;  2HOH A;  9RNT A;  1I2G A;  3HOH A;  4BU4 A;  1BSE A;  1BNG A;  2AAE A;  3D5G A;  1R4Y A;  1BRH A;  1B2X A;  1BRS A;  5HOH A;  1UCJ A;  2BIR A;  3D4A A;  3WHO A;  4GHO A;  1BNE A;  3BU4 A;  1BRK A;  1MGR A;  1BVI A;  3D5I A;  3DH2 A;  1BRI A;  1I3F A;  5BU4 A;  1GOU A;  1HYF A;  1LNI A;  7GSP A;  1LOV A;  1FZU A;  1RNB A;  1RGK A;  3GSP A;  4BIR A;  1X1Y A;  1B21 A;  1TTO A;  1CH0 A;  4RNT A;  2KF6 A;  6GSP A;  1PY3 A;  2KF5 A;  2F56 A;  1LRA A;  1B3S A;  1RGH A;  1C54 A;  1I70 A;  8RNT A;  1AQZ A;  1RHL A;  1BIR A;  1I2E A;  1RGA A;  1GMQ A;  2AAD A;  1I2F A;  1GMR A;  1YGW A;  1RCL A;  1BRN L;  1PYL A;  1BSA A;  1FUT A;  2KAA A;  2C4B A;  5GSP A;  1BNJ A;  1I8V A;  1YVS A;  1RLS A;  1I0V A;  1RMS A;  1BU4 A;  1X1U A;  4HAA A;  3Q3F A;  1SAR A;  1JBT A;  1BNR A;  1RCK A;  1BSB A;  1TRP A;  2ZA4 A;  1BSC A;  2RNT A;  1B2U A;  1G02 A;  1DE3 A;  1BNF A;  1FUS A;  1RGF A;  1UCK A;  1RSN A;  3AGN A;  1RGE A;  2F4Y A;  1YNV X;  3SYU A;  3AGO A;  1FW7 A;  4GSP A;  1RN4 A;  3KCH A;  1BNI A;  1B27 A;  1BNS A;  1RNT A;  3RNT A;  1GOY A;  1DET A;  1UCI A;  3A5E A;  1LOW A;  1JBS A;  1BUJ A;  1BRJ A;  1GSP A;  1BAO A;  3DGY A;  1BSD A; 
#chains in the Genus database with same CATH topology
 1D6U A;  1YGE A;  3M8C A;  1GOV A;  5RNT A;  5IG5 A;  4R4K A;  2LYX A;  2CK3 H;  1WTH A;  5I97 A;  3EE1 A;  5DRV A;  2QIY A;  1W5Z A;  1B2Z A;  2KRT A;  1B20 A;  4H3U A;  1JN5 A;  3AHS A;  4ILF A;  3ZFZ A;  2QEX 3;  3CCL 3;  2KF4 A;  3HK4 A;  1TJD A;  3SLU A;  1RN1 A;  4ORL A;  3PS8 A;  3V98 A;  3CCV 3;  1W02 A;  3NM7 A;  1NO3 A;  2SAR A;  2E2U A;  2E2V A;  1M1K 4;  2H0G A;  3NBB A;  5AYR B;  1ZX2 A;  2WGO A;  4J5G A;  1HZ1 A;  4QWT A;  1N5P A;  2F5M A;  1ZGX A;  1E3V A;  2D42 A;  2Q07 A;  3NQZ A;  1AV4 A;  3CCJ 3;  4HM8 B;  4O8S A;  3S67 A;  4FMC A;  1Q40 A;  2PNC A;  3FZW A;  3JUO A;  1KWI A;  4FMD A;  2HMM B;  2YX9 A;  3UNL A;  3NV0 A;  2YFL B;  2WGQ A;  3HOH A;  1OGZ A;  4BU4 A;  1BSE A;  1JNQ A;  4BL2 A;  4R9K A;  4MJD A;  4BTY A;  2CG0 A;  4G1M B;  4K61 A;  1B2X A;  1YJN 3;  5HOH A;  1UCJ A;  4N6T A;  4GHO A;  3N8B A;  1BRK A;  3X3Y A;  4EC6 A;  3EN8 A;  1O7P B;  1MGR A;  3OV4 A;  3DGN A;  3NBR A;  2IUJ A;  3SXX A;  4AKZ A;  3WA2 X;  1PFP A;  4OUQ A;  1UGI A;  2R41 A;  5IW9 A;  3FG1 A;  2UX0 A;  1LVN A;  4U13 A;  1NWW A;  3D3L A;  1V74 A;  1NDO B;  1LNI A;  3PCR A;  1RRH A;  2CFW A;  1LOV A;  3JUP A;  2V1L A;  1JJ2 2;  3DGL A;  2H0H A;  4BIR A;  1UDI I;  4HBR A;  4HKV B;  2GU3 A;  3FLJ A;  1SII A;  3QRD A;  3KSE D;  1W6C A;  2KF5 A;  5KP4 A;  5IEP A;  3MG2 A;  2HML B;  1OH0 A;  3VGN A;  1ROA A;  3QK9 A;  5BXQ A;  5CK6 A;  1VZZ A;  3PYJ A;  1AQZ A;  3AMO B;  4WWU C;  5AYS C;  1MNL A;  2RCD A;  1I2E A;  1QAK A;  3FG4 A;  2AAD A;  3WOF B;  1YGW A;  3MG1 A;  4K90 B;  1VQP 3;  1BSA A;  4K1V A;  1FUT A;  2HMJ B;  2GXF A;  3SED A;  3CD6 3;  5GSP A;  1DMN A;  3SVA A;  1RLS A;  3JVC A;  2OQE C;  1WQL B;  1TFK A;  4O2H A;  2INX A;  4EXR A;  1BU4 A;  1ULI B;  4O3V A;  2ZL8 A;  3BNC A;  5M1A A;  4XBY A;  1US1 A;  2W9Q A;  4K1U A;  1NB3 I;  3JUN A;  1ZS7 A;  3CU3 A;  3ECF A;  1RCK A;  3KZT A;  3IMA B;  1BSB A;  2ZA4 A;  3NXJ A;  1BSC A;  3BND A;  2CH9 A;  2OQE A;  1EEJ A;  1YI2 3;  3F8H A;  1RGF A;  2CX1 A;  3MG3 A;  5JBS A;  3CCR 3;  3S29 A;  3KII A;  1W01 A;  1WMN A;  1OHP A;  2CFK A;  2C10 A;  1A67 A;  2CIU A;  1FW7 A;  3KCH A;  1RNT A;  4BTW A;  2HMK B;  2XGL A;  1IQX A;  2OTJ 3;  1NU3 A;  1JBS A;  3KE7 A;  5JPU A;  2CFG A;  4LSO A;  1BAO A;  4WFO A;  1S72 3;  2Z76 A;  2Z6B A;  1QAL A;  2E2T A;  3BIR A;  2F86 B;  5AIG A;  2OWP A;  1RGC A;  2BU4 A;  8CHO A;  1TRQ A;  3G6E 3;  2FGT A;  3KN4 A;  1AR0 A;  7RNT A;  3GZR A;  3WOD G;  3LTA A;  2GEX A;  3UB1 A;  1S5A A;  1KC8 4;  1T2H A;  1MWS A;  1LOY A;  1Q9E A;  6RNT A;  4N6V 0;  3GZX B;  3CMA 3;  1JN5 B;  1RTU A;  3URP A;  4GL6 A;  2B1X B;  1RGL A;  3AHW A;  3OWS A;  1E97 A;  3WR2 A;  4RZM A;  3HII A;  3GWR A;  5M19 A;  3K63 A;  3TDG A;  2B24 B;  2IMJ A;  1X1X A;  2IUK A;  1VQO 3;  4NRE A;  1ISK A;  4NPB A;  4IIA A;  5ELJ A;  5AIH A;  1BAN A;  1BUQ A;  1JB5 A;  4KFD A;  1RDS A;  1VQN 3;  1UCL A;  1IVW A;  4LMI A;  1BOX A;  1MGW A;  2D1W A;  1IYY A;  3GRD A;  4J5K A;  1Q40 B;  3STD A;  1SIH A;  1EG9 B;  2H0I A;  1TIJ A;  5G1K A;  3EX9 A;  1OF5 A;  2ML6 A;  2HMO B;  2HOH A;  1IQ8 A;  3MPH A;  3JUQ A;  4J8T A;  4KZ1 A;  3CNX A;  3X41 A;  3NV0 B;  1BNG A;  1ASK A;  4N6N B;  1STF I;  2Z7A A;  1BRH A;  1BRS A;  1IDP A;  4LEH A;  5EQL A;  5FGO A;  1STD A;  3D4A A;  3MWZ A;  2W03 A;  1GY7 A;  4XBX A;  1BNE A;  3BU4 A;  3FCS B;  4R1K A;  1N8Q A;  1JV2 B;  2O9U X;  3LH4 A;  3A76 A;  3D5I A;  3DH2 A;  4WYK A;  2Z77 A;  2BT3 A;  1ZO2 A;  3UL5 A;  4CCV A;  3DM8 A;  1T3B A;  3NBJ A;  4HJL B;  4HM3 B;  2XRX B;  1RGK A;  4AEQ A;  2CFL A;  3DXO A;  2OOV C;  1C7H A;  7STD A;  2GBX B;  1Q81 4;  3F7S A;  1PY3 A;  4FCZ A;  1KD1 4;  4CDL A;  1B3S A;  1M1X B;  3KFQ C;  1FGT A;  3DUK A;  2MF7 A;  3Q1C A;  3UL6 A;  3CPW 2;  3VF1 A;  1EKM A;  2XFT A;  2CWV A;  3LTD A;  3LT8 A;  1AVK A;  1YJ9 3;  8RNT A;  3I55 3;  1OAC A;  4EV2 A;  5JPP A;  3SOA A;  3E99 A;  3BNE A;  2OOV A;  3J7Y d;  3RDE A;  1RGA A;  5IEN A;  2CKF B;  1GMQ A;  3HZP A;  4H61 A;  1GMR A;  1CYV A;  2UUG C;  2P38 A;  4MMZ B;  4RBN A;  1BRN L;  2R4I A;  1PYL A;  1UUG B;  3WDG B;  3LML A;  3CCQ 3;  5IER A;  1I8V A;  3CC7 3;  1K41 A;  3B7C A;  1FA3 A;  4N6U A;  3LTC A;  1IV7 A;  1YJW 3;  3WOE B;  5EVH A;  4EW5 A;  3Q3F A;  4HM6 B;  3X3X A;  1O7H B;  3K5T A;  5IEO A;  4FMB A;  3RGA A;  1W00 A;  2P0M A;  3VSY A;  2WOH A;  3LT9 A;  2GEY A;  3X42 A;  1K73 4;  5CF2 A;  2QA4 3;  1G02 A;  2ZDJ A;  1EA2 A;  1WNH A;  1DE3 A;  4HM1 B;  1BNF A;  1YHQ 3;  1RN7 A;  1WMO A;  2XEP A;  3DZL A;  3F7X A;  5CXO A;  1YNV X;  5AIF A;  2WO0 A;  1HKX A;  2RGQ A;  3AGO A;  4PEJ A;  1LNH A;  1LQG C;  1RN4 A;  1B27 A;  1LOX A;  2XSO B;  1GOY A;  5DRE A;  1M90 4;  1DET A;  3V99 A;  4EYC A;  4BTX A;  1BUJ A;  5HGR A;  1IVU A;  5KP3 A;  1J2B A;  1OUN A;  1F8N A;  1BSD A;  1JRQ A;  4HM0 B;  2IA7 A;  1DMM A;  3LTB A;  3U1W A;  3MHE A;  3T0U A;  1VQL 3;  2JDI H;  4HZ9 B;  1GS3 A;  1Q7H A;  4AKY A;  3T8U A;  2CX0 A;  1BRG A;  3PXM A;  3IPT A;  4NHF A;  3G0K A;  4HOH A;  1IQY A;  1JB4 A;  5BIR A;  1QJG A;  1RGG A;  3MKI A;  1Q42 A;  2BHM A;  2GU1 A;  3EC9 A;  1X1W A;  5D82 A;  2CHC A;  1A2P A;  1FGQ A;  1W2B 2;  3H51 A;  2A15 A;  1K28 A;  3GAX A;  2F5W A;  2FNQ A;  1OHS A;  4KFF A;  4DKI A;  1O7M B;  1PU4 A;  1GYB A;  1I3I A;  1RKY A;  1MWU A;  1GY5 A;  1B2S A;  1T2I A;  1GMP A;  3K7C A;  1BGS A;  1V58 A;  1CEW I;  1JZO A;  2RBI A;  3FGY A;  4XB5 A;  4XM4 A;  5STD A;  3I56 3;  1VQK 3;  9RNT A;  1NJI 4;  1OF5 B;  5AI1 A;  1I2G A;  3LYG A;  3Q2P A;  4IT7 A;  4WP5 A;  1JKG A;  2XH9 A;  1W6G A;  4HYZ A;  4O02 B;  3OX9 A;  2XSH B;  1IU7 A;  3I0Y A;  4R9L A;  4EBG A;  2BIR A;  2FXT A;  2I9W A;  2BMQ B;  2UGI A;  3F40 A;  1ROV A;  2XGN A;  3LOY A;  3CCS 3;  1W6Y A;  1BVI A;  3CPO A;  3NM2 A;  3PZW A;  5ELU A;  1CQS A;  4L8O A;  4WYK B;  4KT3 B;  1HYF A;  3ER7 A;  3G4S 3;  1Q82 4;  3F8X A;  2GBW B;  3DMC A;  4ZM8 A;  3WMD A;  1KSI A;  2BMR B;  2M7O A;  3LXU X;  1IVX A;  2ZHX B;  1X1Y A;  3GSP A;  5AEU B;  1UI8 A;  2C11 A;  1YIT 3;  1B21 A;  4HVN A;  3BB9 A;  2SBL A;  1LQM B;  2KF6 A;  2QGU A;  2Y73 A;  6GSP A;  1VQM 3;  1A90 A;  1DYU A;  2F56 A;  1IV9 A;  1G96 A;  2W04 A;  2YFI B;  1FGR A;  4N6L A;  1UI7 A;  1YIJ 3;  1RGH A;  1UGH I;  1GD4 A;  1TFO A;  2O3O A;  3K9M C;  3CCU 3;  2F99 A;  1C54 A;  1I70 A;  1NB5 I;  4L7K A;  4JF8 A;  1VQ8 3;  3CNM A;  4OK0 A;  1CYU A;  1IT7 A;  1V57 A;  1TU5 A;  3B4P A;  1JZD A;  3BNB A;  1I2F A;  4JRF A;  1RCL A;  3H3H A;  5G2G A;  1QMA A;  4I5Q A;  1Q86 4;  2CG1 A;  4X2O A;  1BNJ A;  3NUV A;  1MWR A;  3G8Z A;  1YVS A;  1E3R A;  1EUI C;  4FMA A;  1D6Z A;  3WA3 A;  2YFJ B;  1VQ5 3;  4LYL B;  1RMS A;  4J9A A;  1UW1 A;  1X1U A;  4CPK A;  4HAA A;  1N5H A;  3Q90 A;  1R4C A;  3KKG A;  3F14 A;  1KQS 2;  2STD A;  5BVB A;  4HM5 B;  1VQ7 3;  1VQQ A;  3EN1 B;  4XDW A;  1W2Z A;  3D79 A;  2RNT A;  2W56 A;  3S27 A;  1B2U A;  2L4V A;  3T8N A;  5CLK A;  5CF1 A;  3NX0 A;  4MMY B;  4HM7 B;  1SJW A;  5KP1 A;  1UCK A;  2W6J H;  3AGN A;  2XF3 A;  1FGM A;  1WMP A;  2F4Y A;  2OCT A;  1U8C B;  1DVC A;  1G0T A;  3SYU A;  4FCJ A;  3UJM A;  2W0Q A;  4GSP A;  4KVH A;  3MYT A;  1QVF 2;  1BNI A;  4GB5 A;  1DVD A;  4Q53 A;  2KXG A;  3EHC A;  3OWY A;  1UCI A;  3B8L A;  1ULJ B;  3O8Y A;  4I4K A;  1BRJ A;  1FGO A;  3DGY A;  4HM4 B;  1YVB I;  5A0O B;  3CC4 3;  2CW9 A;  2K3D A;  1A2K A;  1UUV B;  2WOF A;  3NQY A;  1JBR A;  3HI7 A;  1FYS A;  6STD A;  5IG0 A;  1T5Y A;  3K0Z A;  1D6Y A;  1I0X A;  2BNG A;  4FCM A;  2KF3 A;  2L1S A;  4N3V A;  2GSP A;  3L0R A;  3FF0 A;  2JQ5 A;  1B2M A;  2CWT A;  3U97 A;  3FSD A;  1L5G B;  1NNV A;  3BLZ A;  3JUM A;  5D81 A;  5FW5 A;  4LGQ A;  3B4O A;  3EB8 A;  3HIG A;  3OWU A;  4TX4 A;  1VQ4 3;  5D83 A;  1AY7 A;  2CFD A;  4LZI A;  3IJE B;  3PCS A;  3GZY B;  3G71 3;  1O7W B;  2W9P A;  1O7N B;  4R80 A;  4RNY A;  3EBY A;  3EJV A;  1A2V A;  1N9E A;  3GZB A;  3OW2 2;  2AAE A;  4BL3 A;  2F98 A;  1RJO A;  3D9R A;  3HX8 A;  3DY5 A;  3D5G A;  3KSP A;  1JKG B;  1R4Y A;  3FH1 A;  2PZV A;  3F9S A;  1EQK A;  2P05 A;  3WHO A;  1LXE A;  4MMX B;  1N9J A;  5IG3 A;  1GD3 A;  3DGO A;  3MSO A;  1N8R 4;  1AVL A;  1SQW A;  2BMO B;  1DMQ A;  1BRI A;  2CWU A;  1K9M 4;  1RRL A;  2CC3 A;  1I3F A;  2IY2 A;  5BU4 A;  1JB2 A;  1GOU A;  3FKA A;  3ROB A;  3V92 A;  7GSP A;  5TGN A;  3CXC 2;  1FZU A;  3OXA A;  2HMN B;  1OCV A;  4HM2 B;  1RNB A;  4MEI A;  1QVG 2;  2BO9 B;  1TTO A;  1Z1S A;  4X2H A;  1IT8 A;  1CH0 A;  4RNT A;  4XBT A;  1W4N A;  1IK3 A;  4HZB B;  4STD A;  1Y4K A;  3CC2 3;  2P09 A;  2P0X A;  3CCM 3;  3LZA A;  1LRA A;  4XDV A;  1SPU A;  1OHO A;  1IVV A;  3PGB A;  4EV5 A;  1K8A 4;  3RGR A;  3EBT A;  2K54 A;  3AMO A;  1TUH A;  4CJN A;  4N6M A;  1HU9 A;  2RFR A;  4RNZ A;  1VQ9 3;  1RHL A;  1BIR A;  4N6O B;  3S28 A;  4L8P A;  5IG4 A;  5IF6 A;  4IPB A;  5LC7 A;  3ZG0 A;  2KAA A;  2C4B A;  3SX1 A;  2Y74 A;  3FF2 A;  1TP6 A;  2ML5 A;  5AII A;  1OPY A;  3CME 3;  3DGM A;  1I0V A;  2XFS A;  3EF8 A;  3S5C A;  3X40 A;  1OGX A;  4FR9 A;  3CCE 3;  1MOL A;  3NHX A;  2J8X B;  3ALA A;  1SAR A;  3EQQ B;  2W2C A;  1JBT A;  1BNR A;  2K0M A;  1TRP A;  1QAF A;  2RSX A;  3N54 B;  5EEO A;  1U5O A;  2KCD A;  3N9H A;  3SOY A;  4WHA A;  5LC6 A;  1FUS A;  2W56 B;  4OVM A;  1FUW A;  1RSN A;  3G16 A;  1VQ6 3;  1RGE A;  2LQV A;  4KFE A;  1MWT A;  1GY6 A;  5AEW B;  1UUW B;  2MC8 A;  2XR8 B;  1BNS A;  1O7G B;  3X3Z A;  3RNT A;  5M18 A;  3A5E A;  5G1L A;  1LOW A;  2OTL 3;  1Q7Y 4;  1GSP A;  3ZG5 A;  1M9G A;  3FG3 A;  2IYJ A;  1W7C A; 
#chains in the Genus database with same CATH homology
 1RGC A;  2BU4 A;  5RNT A;  1GOV A;  1TRQ A;  7RNT A;  1JBR A;  1B2Z A;  1BRG A;  1B20 A;  1T2H A;  3AHS A;  1FYS A;  1LOY A;  1Q9E A;  4HOH A;  2KF4 A;  6RNT A;  1RTU A;  3URP A;  5BIR A;  1RGL A;  1RGG A;  3AHW A;  1RN1 A;  3WR2 A;  1I0X A;  2SAR A;  2KF3 A;  1X1W A;  2GSP A;  3BIR A;  1X1X A;  4J5G A;  1HZ1 A;  1A2P A;  1B2M A;  2F5M A;  1ZGX A;  1BAN A;  1RDS A;  2F5W A;  1UCL A;  1BOX A;  1I3I A;  1MGW A;  1IYY A;  1AY7 A;  4J5K A;  1B2S A;  1T2I A;  1GMP A;  1BGS A;  2RBI A;  2HOH A;  9RNT A;  1I2G A;  3HOH A;  4BU4 A;  1BSE A;  1BNG A;  2AAE A;  3D5G A;  1R4Y A;  1BRH A;  1B2X A;  1BRS A;  5HOH A;  1UCJ A;  2BIR A;  3D4A A;  3WHO A;  4GHO A;  1BNE A;  3BU4 A;  1BRK A;  1MGR A;  1BVI A;  3D5I A;  3DH2 A;  1BRI A;  1I3F A;  5BU4 A;  1GOU A;  1HYF A;  1LNI A;  7GSP A;  1LOV A;  1FZU A;  1RNB A;  1RGK A;  3GSP A;  4BIR A;  1X1Y A;  1B21 A;  1TTO A;  1CH0 A;  4RNT A;  2KF6 A;  6GSP A;  1PY3 A;  2KF5 A;  2F56 A;  1LRA A;  1B3S A;  1RGH A;  1C54 A;  1I70 A;  8RNT A;  1AQZ A;  1RHL A;  1BIR A;  1I2E A;  1RGA A;  1GMQ A;  2AAD A;  1I2F A;  1GMR A;  1YGW A;  1RCL A;  1BRN L;  1PYL A;  1BSA A;  1FUT A;  2KAA A;  2C4B A;  5GSP A;  1BNJ A;  1I8V A;  1YVS A;  1RLS A;  1I0V A;  1RMS A;  1BU4 A;  1X1U A;  4HAA A;  3Q3F A;  1SAR A;  1JBT A;  1BNR A;  1RCK A;  1BSB A;  1TRP A;  2ZA4 A;  1BSC A;  2RNT A;  1B2U A;  1G02 A;  1DE3 A;  1BNF A;  1FUS A;  1RGF A;  1UCK A;  1RSN A;  3AGN A;  1RGE A;  2F4Y A;  1YNV X;  3SYU A;  3AGO A;  1FW7 A;  4GSP A;  1RN4 A;  3KCH A;  1BNI A;  1B27 A;  1BNS A;  1RNT A;  3RNT A;  1GOY A;  1DET A;  1UCI A;  3A5E A;  1LOW A;  1JBS A;  1BUJ A;  1BRJ A;  1GSP A;  1BAO A;  3DGY A;  1BSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...