3ROBA

The crystal structure of a conserved protein from planctomyces limnophilus dsm 3776
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
GAGRHADELAIRTVQYRWLEATRKFDRQVLSSLMTDDVVFLTPGRLPFGKEEFLAACEQNDQRVIIEASATFEEIVIVEPMAYTRTHLHIKVTPRSGGAVRELAGHAMSIFRRSMFGEWQLARDANLVVPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized conserved protein
publication title The crystal structure of a conserved protein from Planctomyces limnophilus DSM 3776
rcsb
source organism Planctomyces limnophilus
molecule tags Structural genomics, unknown function
total genus 41
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3robA00
1E3VA 4HM2B 2XRXB 3H51A 2IMJA 4XB5A 3CNXA 2HMJB 3LZAA 3MKIA 1C7HA 3GZYB 4XBTA 2HMLB 3MYTA 2XR8B 4XDWA 3ECFA 2RGQA 2STDA 4PEJA 1OHPA 1JN5A 5IERA 3JUMA 4WWUC 2K54A 3CU3A 5TGNA 1SJWA 4N3VA 1JN5B 3HZPA 3EX9A 1QMAA 5IEPA 2B24B 1O7WB 5CK6A 3GRDA 1ASKA 3F8XA 3FGYA 3STDA 4HM0B 2OWPA 1OH0A 3Q90A 4XBXA 5CXOA 2HMMB 1GY5A 3FLJA 3SOYA 2CHCA 4Q53A 3B4OA 1NDOB 1JB2A 3NM2A 3MHEA 3EC9A 3ER7A 3EQQB 4RZMA 1HKXA 3VSYA 5JPPA 1OGZA 4HM4B 1OPYA 5AEWB 1GY6A 5BXQA 4LGQA 1TUHA 5STDA 3KZTA 4XM4A 3BLZA 3EF8A 2BMRB 7STDA 1VZZA 4IIAA 1A2KA 2YFIB 4J8TA 5IENA 4XDVA 3GZXB 5EVHA 3JUNA 3K7CA 4LEHA 3F14A 3MG2A 5JPUA 4R9LA 3NV0A 2HMKB 3UNLA 3NV0B 1OHOA 3T8UA 3SOAA 4HM7B 2UX0A 1UUWB 1DMQA 4FCJA 1OCVA 4HM8B 3VGNA 3FH1A 4LMIA 4GB5A 2BNGA 3GWRA 3MG3A 1NU3A 5IG3A 2GEYA 1JB5A 3UJMA 2I9WA 3B4PA 3S5CA 4HVNA 4HKVB 2BMOB 4HZBB 4K1UA 1TP6A 4U13A 3FF2A 1O7GB 1STDA 3M8CA 1W02A 3HK4A 1ULIB 3DUKA 4OVMA 1S5AA 4R9KA 5IF6A 3CNMA 2XSHB 3H3HA 1U5OA 4WYKA 1OF5A 1K41A 4WYKB 1GS3A 4CDLA 1JB4A 1OF5B 1Q42A 3FZWA 3DM8A 3OXAA 5CF1A 5IG0A 3NBRA 3B7CA 5CLKA 3EN1B 3ROBA 3KKGA 3A76A 3FKAA 3DZLA 4OUQA 3NXJA 5D82A 3JUQA 2JQ5A 4R1KA 3NUVA 4I4KA 3DMCA 3OWSA 4WP5A 4L7KA 3JUPA 5IEOA 3OWYA 1WQLB 3IPTA 2QGUA 3NHXA 3FF0A 2GXFA 1OGXA 2F86B 1DMNA 4XBYA 1E97A 5KP1A 4X2HA 4HZ9B 2GEXA 3F7XA 4H3UA 2F98A 1Q40A 3E99A 5D81A 1O7HB 2YFJB 1Q40B 4HM3B 3GZRA 5D83A 3JUOA 4L8OA 5DREA 1O7NB 4J9AA 5G2GA 1E3RA 4L8PA 2HMOB 1JKGA 1OUNA 4MJDA 3I0YA 1JKGB 5AIGA 3KE7A 4X2OA 4HJLB 1W00A 2RCDA 4ORLA 3F9SA 3OV4A 3MG1A 1GYBA 4FCMA 1CQSA 2GBXB 1UUVB 3EHCA 3CPOA 3HX8A 2B1XB 3MSOA 3T8NA 1W01A 3FSDA 2Z77A 1O7MB 1BUQA 5AIFA 3DXOA 1ZX2A 4HM1B 3F8HA 1O7PB 2PZVA 8CHOA 5AIIA 3EJVA 2BMQB 3BB9A 5BVBA 1Z1SA 5KP3A 5IG4A 1AR0A 2HMNB 1GY7A 2GBWB 5AEUB 3OX9A 3G8ZA 2YFLB 6STDA 4K1VA 3EN8A 3F40A 4STDA 3EBYA 2Z7AA 2A15A 5IG5A 5DRVA 1EA2A 3K0ZA 3G0KA 5KP4A 3G16A 2CKFB 4HM6B 3SEDA 3WMDA 3RGRA 3GZBA 5CF2A 2QIYA 1ZO2A 3RGAA 1IDPA 1W6YA 1ULJB 3D9RA 1OHSA 2W2CA 2F99A 2INXA 2R4IA 1QJGA 3B8LA 2RFRA 3EBTA 5FW5A 3KSPA 1EG9B 3OWUA 2Z76A 4KVHA 2XSOB 5AI1A 5AIHA 5HGRA 1NWWA 1DMMA 3LYGA 4HM5B 1ISKA 3F7SA
chains in the Genus database with same CATH superfamily
1E3VA 3BNCA 1MNLA 2QEX3 4FMCA 1BNIA 5G1LA 5AYRB 1IVUA 1ROAA 1YNVX 4HM2B 3CCJ3 1J2BA 2XRXB 1MGRA 4AKZA 3H51A 2IMJA 5M1AA 1DE3A 4XB5A 1D6ZA 3CNXA 1FGRA 1EQKA 4O8SA 1V74A 2HMJB 6GSPA 3LZAA 5GSPA 4BTXA 1EKMA 1C54A 3J7Yd 1YJN3 1JBRA 1RTUA 1B2XA 3MKIA 1C7HA 3GZYB 1I3IA 6RNTA 1LOXA 1BGSA 2KCDA 3S29A 1KWIA 4XBTA 1BRKA 1EEJA 1ZGXA 3NQYA 1LOWA 2BIRA 2HMLB 1B21A 2J8XB 2XR8B 3MYTA 4XDWA 7RNTA 1VQO3 3PS8A 3ECFA 1L5GB 1W6CA 3RNTA 2ML6A 5BIRA 2RGQA 1FYSA 2STDA 4PEJA 4RNTA 3UL6A 1YI23 3G713 2IUKA 3CME3 1OHPA 1JN5A 2XFTA 5IERA 2XGNA 3JUMA 3PGBA 4WWUC 4BL3A 2K0MA 2K54A 5M18A 3I563 1Q814 1QVG2 3AGOA 3WHOA 1DVDA 3UL5A 3CU3A 3DH2A 5TGNA 1SJWA 4N3VA 1JN5B 1IT8A 1R4YA 1RJOA 3HZPA 1BRIA 3EX9A 1QMAA 3IMAB 3FCSB 1BAOA 3KSED 5IEPA 1Q9EA 1X1UA 1LNIA 1QALA 5AYSC 2B24B 3DGYA 3AHSA 1O7WB 4OK0A 5CK6A 3ZG5A 4FMDA 3GRDA 2AAEA 4RNYA 1ASKA 3BIRA 3F8XA 1NJI4 2XGLA 3FGYA 2LQVA 3STDA 1A90A 4HM0B 3EE1A 2OWPA 4BL2A 2CK3H 1OH0A 2GSPA 1FGTA 1VQM3 4EV5A 5LC6A 1B27A 3Q90A 1IT7A 4O3VA 4XBXA 1GD3A 5CXOA 4CCVA 4CPKA 3LMLA 1PY3A 2HMMB 4R80A 2E2UA 1AV4A 1BNJA 3VF1A 1GY5A 3FLJA 3X40A 3G4S3 1RHLA 3SOYA 2CHCA 4Q53A 1Q824 3PCRA 3B4OA 1BSBA 1NDOB 8RNTA 1T3BA 1JB2A 3NM2A 3MHEA 1VQ83 2W9PA 3EC9A 3NBJA 4EBGA 3ER7A 1VQ73 3EQQB 1HZ1A 1GMRA 3SLUA 4RZMA 4ZM8A 1HKXA 1HYFA 1K28A 2UUGC 2XF3A 3VSYA 4K61A 5JPPA 1OGZA 1RGFA 1OPYA 4HM4B 5AEWB 1GY6A 2HOHA 4LGQA 5BXQA 3G6E3 1FUTA 1TUHA 3CCM3 3LTBA 4KFDA 4NHFA 5HOHA 5STDA 3KZTA 1VQ53 4XM4A 3BLZA 2WGQA 2IY2A 1QVF2 3EF8A 2BMRB 2BU4A 1A2VA 3FG3A 2OCTA 1KD14 1BSEA 1VQK3 1YVBI 1BNFA 7STDA 3CPW2 2SARA 1VZZA 1X1XA 4IIAA 1A2KA 1RGGA 2YFIB 1U8CB 2YX9A 1MOLA 4J8TA 4XDVA 2KF5A 5IENA 1FA3A 1BSCA 1RSNA 2UGIA 1NNVA 3GZXB 1WMOA 5EVHA 2KRTA 3JUNA 3K7CA 3GAXA 4LEHA 1I2GA 3F14A 3MG2A 2P0MA 1TU5A 1T5YA 5JPUA 3AGNA 4HOHA 3GSPA 4R9LA 4N6LA 3NV0A 1VQL3 1N8R4 1WMNA 2JDIH 5G1KA 3K9MC 2HMKB 1B3SA 3DGMA 3UNLA 2KF3A 3NV0B 1OHOA 3T8UA 4LYLB 3NQZA 3SOAA 4HM7B 2KF4A 4MMXB 3UB1A 3U97A 1UUGB 2CWUA 5ELUA 1UCLA 4BIRA 3CCV3 1W2B2 2UX0A 1X1WA 3SVAA 1UUWB 2CWTA 2XEPA 1DMQA 4FCJA 1OCVA 1SQWA 4FMAA 1EUIC 5FGOA 1PYLA 3SX1A 3NX0A 4HM8B 1B2UA 3VGNA 3FH1A 4KT3B 2Y74A 4LMIA 5RNTA 1IYYA 1IU7A 1BNRA 2CFGA 1PU4A 4GB5A 2BNGA 2KXGA 1I70A 3GWRA 1WMPA 3MG3A 1NU3A 3AHWA 2OQEA 5IG3A 3V92A 2GEYA 3LT9A 1JB5A 3UJMA 2I9WA 2WOFA 3CXC2 1AVLA 1TFKA 3B4PA 3PYJA 2O3OA 3S5CA 1SPUA 3Q1CA 4HVNA 5A0OB 4HKVB 2BMOB 1HU9A 3PXMA 4HZBB 2OQEC 3PZWA 4K1UA 1TP6A 4U13A 1W2ZA 2GU3A 3BNEA 1RRHA 3KCHA 4H61A 3FF2A 1O7GB 1YIT3 1K9M4 1STDA 3M8CA 3MPHA 1X1YA 1W02A 3HK4A 3ZFZA 1ULIB 1TFOA 3DY5A 3DUKA 4G1MB 1AY7A 1S5AA 4HAAA 4OVMA 4R9KA 3EB8A 5IF6A 3CNMA 2XSHB 4N6UA 2KAAA 1B2MA 1V58A 3H3HA 1U5OA 4WYKA 4WHAA 5JBSA 1N8QA 1UCKA 1BRSA 1OF5A 3V99A 1SIIA 1K41A 2ML5A 4WYKB 3WA3A 1US1A 1GS3A 4CDLA 1BUJA 1BANA 3DGOA 1JB4A 2F5WA 4MMZB 2SBLA 1OF5B 1Q42A 3FZWA 1VQ63 3S67A 3SXXA 3DM8A 4TX4A 3BNBA 4GHOA 4N6OB 1UCIA 1DVCA 3PCSA 3OXAA 3ZG0A 4K90B 5CF1A 2H0HA 5IG0A 3NBRA 3B7CA 1CEWI 7GSPA 1JNQA 3LXUX 5CLKA 2C11A 3EN1B 3ROBA 1G0TA 2ZDJA 3KKGA 3A76A 1ZS7A 3FKAA 4N6MA 3U1WA 1BSAA 3A5EA 3DZLA 4R4KA 3N8BA 4OUQA 3NXJA 4RNZA 2IUJA 3X3ZA 2RSXA 1WTHA 2ZL8A 5D82A 3JUQA 2JQ5A 1BIRA 1BU4A 3NUVA 4R1KA 1B2SA 2RBIA 1RNTA 4I4KA 1QAFA 2LYXA 3CCR3 3DMCA 3OWSA 4WP5A 4L7KA 1BVIA 1UDII 3V98A 1IK3A 3JUPA 4FR9A 5IEOA 1TRPA 3OWYA 1I0VA 1CH0A 1WQLB 2R41A 3WDGB 2RNTA 1LXEA 1LOVA 1N5HA 2QGUA 3IPTA 3RDEA 3NHXA 5IW9A 3CCL3 3FF0A 1RMSA 1STFI 2M7OA 4CJNA 4O2HA 1MGWA 1VQ43 2GXFA 2CC3A 4EYCA 4LSOA 1OGXA 2XFSA 4GL6A 1WNHA 1TRQA 4LZIA 2F86B 2OTJ3 3LOYA 1DMNA 4XBYA 1E97A 1I0XA 4QWTA 5KP1A 1GMQA 4X2HA 3FG4A 4HZ9B 4J5GA 1BRHA 1UW1A 3NBBA 1T2HA 1A67A 2GEXA 3F7XA 1BOXA 1RDSA 2MF7A 4H3UA 1CYUA 2F98A 1RCLA 3KN4A 2C10A 4I5QA 1YHQ3 2CX0A 1Q40A 1Y4KA 3E99A 1W6GA 1DETA 4HBRA 5D81A 1AQZA 4RBNA 3LTDA 1O7HB 1RGEA 2YFJB 5ELJA 2KF6A 1UGHI 1NB3I 5LC7A 1Q40B 4HM3B 1JV2B 3GZRA 2IA7A 5D83A 3JUOA 2F5MA 2CG0A 4L8OA 5DREA 2H0IA 1LVNA 1JBTA 1IV9A 1O7NB 4AEQA 1YJ93 3N9HA 1VQ93 4J9AA 2OTL3 1D6YA 5G2GA 1I2FA 1E3RA 1BNGA 4L8PA 2W03A 2HMOB 2O9UX 3WODG 3DGNA 1JKGA 1JRQA 1OUNA 3TDGA 2XH9A 1BNSA 1MWSA 3N54B 4MJDA 4N6V0 3I0YA 3HIIA 1TIJA 3URPA 1JKGB 1R4CA 2CX1A 1LQMB 3WOFB 1SARA 1JZOA 1RCKA 1RGKA 1K734 4FCZA 5AIGA 4HYZA 2Q07A 3KE7A 4X2OA 3CC73 2FXTA 1VQQA 4HJLB 1W00A 3CCE3 9RNTA 2QA43 2E2TA 2RCDA 1YVSA 2MC8A 1BNEA 4ORLA 4NREA 3F9SA 3OV4A 1FGQA 2WGOA 1IV7A 1FUSA 2C4BA 3MG1A 1GYBA 1GOVA 1M904 5EEOA 1JJ22 3FG1A 3HIGA 3Q2PA 3QK9A 1YGEA 4N6TA 2BT3A 3D4AA 3KIIA 4FCMA 1CQSA 2W6JH 3WOEB 2GBXB 3S27A 1UUVB 2W0QA 3EHCA 3WR2A 1FZUA 3X3YA 2CFKA 3HOHA 1I3FA 3S28A 1IQXA 3CPOA 1A2PA 3HX8A 4AKYA 2WO0A 1KC84 1LRAA 2B1XB 4BTWA 1TJDA 3MSOA 2L4VA 2Y73A 3IJEB 1W01A 3T8NA 1FGMA 3FSDA 3CC43 1BRGA 4N6NB 4MEIA 2F56A 1FW7A 1N9EA 2Z77A 1O7MB 3AMOA 1RN1A 1BUQA 1G96A 1IQ8A 2GU1A 3ALAA 3LTAA 4EC6A 1TTOA 5AIFA 1N9JA 3DXOA 1OACA 3BU4A 2E2VA 4JF8A 1ZX2A 4HM1B 3AMOB 3CCU3 3F8HA 4JRFA 1O7PB 1KSIA 1RGLA 2PNCA 2PZVA 8CHOA 1KQS2 1BRNL 2D42A 3HI7A 2D1WA 1W4NA 2W04A 1UGIA 5AIIA 4HM5B 2FGTA 1FGOA 3O8YA 1IVXA 5EQLA 2CFDA 2H0GA 3EJVA 2CFLA 2BMQB 3BNDA 1LNHA 4EW5A 3BB9A 5BVBA 1RN7A 1PFPA 1Z1SA 5KP3A 5IG4A 1AR0A 1VQP3 2HMNB 1G02A 1GY7A 1MWTA 1RGAA 2P0XA 2P38A 3CCS3 1JBSA 1F8NA 1Q7HA 2GBWB 2K3DA 5AEUB 2BHMA 3OX9A 3LH4A 1VQN3 3DGLA 3G8ZA 1LQGC 4DKIA 2YFLB 3X41A 6STDA 4K1VA 3EN8A 4KZ1A 3F40A 4EV2A 2ZHXB 2W56A 3WA2X 1N5PA 4STDA 2OOVA 1AVKA 1V57A 1Q864 1M1XB 3EBYA 3CCQ3 2Z7AA 1RGCA 1I8VA 2A15A 1YGWA 5IG5A 2W56B 3K5TA 1I2EA 2WOHA 2CH9A 1RN4A 5DRVA 3D5IA 3T0UA 3KFQC 4MMYB 3L0RA 1EA2A 2OOVC 3K0ZA 1YIJ3 3G0KA 5BU4A 5KP4A 1IVVA 1M9GA 3G16A 2CKFB 4HM6B 4IPBA 3CC23 1GMPA 1QAKA 3MWZA 2CIUA 5I97A 3I553 3SEDA 1SIHA 1JZDA 3D79A 3WMDA 1D6UA 3RGRA 3GZBA 2Z6BA 3D5GA 5M19A 5CF2A 4O02B 2QIYA 1ZO2A 2ZA4A 1UI7A 3RGAA 4EXRA 4BU4A 1K8A4 2FNQA 1RGHA 1CYVA 1IDPA 1W6YA 4IT7A 1B2ZA 3Q3FA 2P09A 3LTCA 4GSPA 4ILFA 1ULJB 4BTYA 3LT8A 1NO3A 2P05A 3X3XA 1T2IA 1UCJA 3D9RA 1OHSA 2IYJA 3QRDA 1FUWA 1IQYA 2CFWA 3JVCA 3SYUA 4KFFA 2L1SA 2W2CA 3X42A 2F99A 2INXA 2R4IA 1MWUA 1UI8A 1W5ZA 1QJGA 1B20A 3B8LA 4NPBA 1S723 3CMA3 2RFRA 3NM7A 1GD4A 2W9QA 3EBTA 1YJW3 5FW5A 3OW22 1LOYA 1M1K4 3KSPA 3D3LA 1RRLA 1EG9B 3OWUA 1BRJA 2Z76A 1NB5I 1GOUA 2AADA 2CG1A 1RKYA 3CD63 1BSDA 1ROVA 4KVHA 2V1LA 1Q7Y4 2XSOB 5AI1A 2F4YA 5AIHA 1RNBA 1IVWA 1RLSA 4WFOA 5HGRA 4J5KA 1NWWA 2CW9A 1DMMA 4KFEA 2BO9B 3K63A 1W7CA 3LYGA 1GSPA 2CWVA 1MWRA 1DYUA 1GOYA 4FMBA 1ISKA 3F7SA
chains in the Genus database with same CATH topology
1E3VA 3BNCA 1MNLA 2QEX3 4FMCA 5AYRB 1IVUA 1ROAA 4HM2B 3CCJ3 1J2BA 2XRXB 4AKZA 3H51A 2IMJA 4XB5A 1D6ZA 3CNXA 1FGRA 1EQKA 4O8SA 1V74A 2HMJB 3LZAA 4BTXA 1EKMA 3J7Yd 1YJN3 3MKIA 1C7HA 3GZYB 1LOXA 2KCDA 3S29A 1KWIA 4XBTA 3NQYA 2HMLB 3MYTA 2XR8B 4XDWA 1VQO3 3PS8A 3ECFA 1L5GB 1W6CA 2ML6A 2RGQA 2STDA 4PEJA 3UL6A 1YI23 3G713 2IUKA 3CME3 1OHPA 1JN5A 2XFTA 5IERA 2XGNA 3JUMA 3PGBA 4WWUC 3I563 2K0MA 2K54A 1QVG2 1Q814 1DVDA 3UL5A 3CU3A 5TGNA 1SJWA 4N3VA 1JN5B 1IT8A 1RJOA 3HZPA 3EX9A 1QMAA 3IMAB 3FCSB 3KSED 5IEPA 1QALA 5AYSC 2B24B 1O7WB 4OK0A 5CK6A 4FMDA 3GRDA 4RNYA 1ASKA 1A90A 3F8XA 1NJI4 2XGLA 3FGYA 2LQVA 3STDA 4HM0B 3EE1A 2OWPA 2CK3H 1OH0A 1FGTA 1VQM3 4EV5A 5LC6A 3Q90A 1IT7A 4O3VA 4XBXA 1GD3A 5CXOA 4CCVA 3LMLA 4R80A 2HMMB 2E2UA 1AV4A 3VF1A 1GY5A 3FLJA 3X40A 3G4S3 3SOYA 2CHCA 4Q53A 1Q824 3PCRA 3B4OA 1NDOB 1JB2A 3NM2A 3MHEA 1VQ83 2W9PA 3EC9A 3NBJA 4EBGA 3ER7A 1VQ73 3EQQB 3SLUA 4RZMA 4ZM8A 1HKXA 1K28A 3VSYA 2XF3A 4K61A 5JPPA 1OGZA 4HM4B 1OPYA 5AEWB 1GY6A 5BXQA 4LGQA 3G6E3 1TUHA 3CCM3 3LTBA 4KFDA 4NHFA 5STDA 3KZTA 1VQ53 4XM4A 3BLZA 2WGQA 1QVF2 3EF8A 2BMRB 1A2VA 3FG3A 2OCTA 1KD14 1VQK3 1YVBI 7STDA 3CPW2 1VZZA 4IIAA 1A2KA 2YFIB 4J8TA 1U8CB 2YX9A 1MOLA 4XDVA 5IENA 1FA3A 3GZXB 1WMOA 5EVHA 2KRTA 3JUNA 3K7CA 3GAXA 4LEHA 3F14A 3MG2A 2P0MA 1TU5A 1T5YA 5JPUA 4R9LA 4N6LA 3NV0A 1VQL3 1N8R4 1WMNA 2JDIH 3K9MC 2HMKB 3UNLA 3DGMA 3NV0B 1OHOA 3T8UA 3NQZA 3SOAA 4HM7B 4MMXB 3UB1A 3U97A 2CWUA 5ELUA 3CCV3 1W2B2 2UX0A 3SVAA 1UUWB 2CWTA 2XEPA 1DMQA 4FCJA 1OCVA 1SQWA 4FMAA 5FGOA 3SX1A 3NX0A 4HM8B 3VGNA 3FH1A 2Y74A 4LMIA 1IU7A 2CFGA 1PU4A 4GB5A 2BNGA 2KXGA 3GWRA 1WMPA 3MG3A 1NU3A 2OQEA 5IG3A 3V92A 2GEYA 3LT9A 1JB5A 3UJMA 2I9WA 2WOFA 3CXC2 1AVLA 1TFKA 3B4PA 3PYJA 2O3OA 3S5CA 1SPUA 3Q1CA 4HVNA 5A0OB 4HKVB 2BMOB 1HU9A 3PXMA 4HZBB 2OQEC 3PZWA 4K1UA 1TP6A 4U13A 1W2ZA 2GU3A 3BNEA 1RRHA 4H61A 3FF2A 1O7GB 1YIT3 1K9M4 1STDA 3M8CA 3MPHA 1W02A 3HK4A 1ULIB 1TFOA 3DY5A 3DUKA 4G1MB 4OVMA 1S5AA 4R9KA 3EB8A 5IF6A 3CNMA 2XSHB 4N6UA 3H3HA 1U5OA 4WYKA 4WHAA 5JBSA 1N8QA 1OF5A 3V99A 1SIIA 1K41A 2ML5A 4WYKB 3WA3A 1US1A 1GS3A 4CDLA 3DGOA 1JB4A 4MMZB 2SBLA 1OF5B 1Q42A 3FZWA 1VQ63 3S67A 3SXXA 3DM8A 4TX4A 3BNBA 4N6OB 1DVCA 3PCSA 3OXAA 4K90B 5CF1A 5IG0A 3NBRA 3B7CA 1CEWI 1JNQA 3LXUX 5CLKA 2C11A 3EN1B 3ROBA 2ZDJA 3KKGA 3A76A 3FKAA 4N6MA 3U1WA 3DZLA 4R4KA 3N8BA 4OUQA 3NXJA 4RNZA 2IUJA 3X3ZA 2RSXA 1WTHA 2ZL8A 5D82A 3JUQA 2JQ5A 4R1KA 3NUVA 4I4KA 1QAFA 2LYXA 3CCR3 3DMCA 3OWSA 4WP5A 4L7KA 3V98A 1IK3A 3JUPA 4FR9A 5IEOA 3OWYA 1WQLB 3WDGB 1LXEA 2QGUA 1N5HA 3IPTA 3RDEA 3NHXA 5IW9A 3CCL3 3FF0A 1STFI 2M7OA 4O2HA 1VQ43 2GXFA 2CC3A 4EYCA 4LSOA 1OGXA 2XFSA 4GL6A 1WNHA 4LZIA 2OTJ3 2F86B 3LOYA 1DMNA 4XBYA 1E97A 4QWTA 5KP1A 4X2HA 3FG4A 4HZ9B 1UW1A 3NBBA 1A67A 2GEXA 3F7XA 2MF7A 4H3UA 1CYUA 2F98A 3KN4A 2C10A 1YHQ3 1Q40A 1Y4KA 3E99A 1W6GA 4HBRA 5D81A 4RBNA 3LTDA 1O7HB 2YFJB 5ELJA 1NB3I 5LC7A 1Q40B 4HM3B 1JV2B 3GZRA 2IA7A 5D83A 3JUOA 4L8OA 2CG0A 5DREA 1LVNA 1IV9A 1O7NB 4AEQA 1YJ93 3N9HA 1VQ93 4J9AA 2OTL3 1D6YA 5G2GA 1E3RA 4L8PA 2W03A 2HMOB 2O9UX 3WODG 3DGNA 1JKGA 1JRQA 1OUNA 3TDGA 2XH9A 3N54B 4MJDA 4N6V0 3I0YA 3HIIA 1TIJA 1JKGB 1R4CA 3WOFB 1K734 4FCZA 5AIGA 4HYZA 2Q07A 3KE7A 4X2OA 3CC73 2FXTA 4HJLB 1W00A 3CCE3 2QA43 2E2TA 2RCDA 2MC8A 4ORLA 4NREA 3F9SA 3OV4A 1FGQA 2WGOA 1IV7A 3MG1A 1GYBA 1M904 5EEOA 1JJ22 3FG1A 3HIGA 3Q2PA 3QK9A 1YGEA 4N6TA 2BT3A 3KIIA 4FCMA 1CQSA 2W6JH 3WOEB 2GBXB 3S27A 1UUVB 2W0QA 3EHCA 3X3YA 2CFKA 3S28A 1IQXA 3CPOA 3HX8A 4AKYA 2WO0A 1KC84 2B1XB 4BTWA 3MSOA 2L4VA 2Y73A 3IJEB 1W01A 3T8NA 1FGMA 3FSDA 3CC43 4N6NB 4MEIA 1N9EA 2Z77A 1O7MB 3AMOA 1BUQA 1G96A 1IQ8A 2GU1A 3ALAA 3LTAA 4EC6A 5AIFA 1N9JA 3DXOA 1OACA 2E2VA 4JF8A 1ZX2A 4HM1B 3AMOB 3CCU3 3F8HA 4JRFA 1O7PB 1KSIA 2PNCA 2PZVA 8CHOA 1KQS2 2D42A 3HI7A 2D1WA 1W4NA 2W04A 5AIIA 2FGTA 1FGOA 3O8YA 1IVXA 5EQLA 2CFDA 3EJVA 2CFLA 2BMQB 3BNDA 1LNHA 3BB9A 5BVBA 1RN7A 1PFPA 1Z1SA 5KP3A 5IG4A 1AR0A 1VQP3 2HMNB 1GY7A 2P0XA 3CCS3 2P38A 1F8NA 2GBWB 5AEUB 2BHMA 3OX9A 3LH4A 1VQN3 3DGLA 3G8ZA 2YFLB 3X41A 6STDA 4K1VA 3EN8A 4KZ1A 3F40A 4EV2A 2W56A 3WA2X 1N5PA 4STDA 2OOVA 1AVKA 1Q864 1M1XB 3EBYA 3CCQ3 2Z7AA 2A15A 5IG5A 2W56B 3K5TA 2WOHA 2CH9A 5DRVA 3T0UA 3KFQC 4MMYB 3L0RA 1EA2A 2OOVC 3K0ZA 1YIJ3 3G0KA 5KP4A 1IVVA 1M9GA 3G16A 2CKFB 4HM6B 4IPBA 3CC23 1QAKA 3MWZA 2CIUA 5I97A 3I553 3SEDA 1SIHA 3WMDA 1D6UA 3RGRA 3GZBA 2Z6BA 5CF2A 4O02B 2QIYA 1ZO2A 3RGAA 1UI7A 4EXRA 1K8A4 2FNQA 4IT7A 1CYVA 1IDPA 1W6YA 2P09A 3LTCA 1ULJB 4BTYA 3LT8A 1NO3A 2P05A 3X3XA 3D9RA 1OHSA 3QRDA 1FUWA 1IQYA 2CFWA 3JVCA 4KFFA 2W2CA 3X42A 2F99A 2INXA 2R4IA 1UI8A 1W5ZA 1QJGA 3B8LA 1S723 3CMA3 2RFRA 3NM7A 1GD4A 2W9QA 3EBTA 1YJW3 5FW5A 3OW22 1M1K4 3KSPA 3D3LA 1RRLA 1EG9B 3OWUA 2Z76A 1NB5I 2CG1A 1RKYA 3CD63 1ROVA 4KVHA 2V1LA 1Q7Y4 2XSOB 5AI1A 5AIHA 1IVWA 4WFOA 5HGRA 1NWWA 2CW9A 1DMMA 4KFEA 2BO9B 3K63A 1W7CA 3LYGA 2CWVA 1DYUA 4HM5B 4FMBA 1ISKA 3F7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3V A;  4HM2 B;  2XRX B;  3H51 A;  2IMJ A;  4XB5 A;  3CNX A;  2HMJ B;  3LZA A;  3MKI A;  1C7H A;  3GZY B;  4XBT A;  2HML B;  3MYT A;  2XR8 B;  4XDW A;  3ECF A;  2RGQ A;  2STD A;  4PEJ A;  1OHP A;  1JN5 A;  5IER A;  3JUM A;  4WWU C;  2K54 A;  3CU3 A;  5TGN A;  1SJW A;  4N3V A;  1JN5 B;  3HZP A;  3EX9 A;  1QMA A;  5IEP A;  2B24 B;  1O7W B;  5CK6 A;  3GRD A;  1ASK A;  3F8X A;  3FGY A;  3STD A;  4HM0 B;  2OWP A;  1OH0 A;  3Q90 A;  4XBX A;  5CXO A;  2HMM B;  1GY5 A;  3FLJ A;  3SOY A;  2CHC A;  4Q53 A;  3B4O A;  1NDO B;  1JB2 A;  3NM2 A;  3MHE A;  3EC9 A;  3ER7 A;  3EQQ B;  4RZM A;  1HKX A;  3VSY A;  5JPP A;  1OGZ A;  4HM4 B;  1OPY A;  5AEW B;  1GY6 A;  5BXQ A;  4LGQ A;  1TUH A;  5STD A;  3KZT A;  4XM4 A;  3BLZ A;  3EF8 A;  2BMR B;  7STD A;  1VZZ A;  4IIA A;  1A2K A;  2YFI B;  4J8T A;  5IEN A;  4XDV A;  3GZX B;  5EVH A;  3JUN A;  3K7C A;  4LEH A;  3F14 A;  3MG2 A;  5JPU A;  4R9L A;  3NV0 A;  2HMK B;  3UNL A;  3NV0 B;  1OHO A;  3T8U A;  3SOA A;  4HM7 B;  2UX0 A;  1UUW B;  1DMQ A;  4FCJ A;  1OCV A;  4HM8 B;  3VGN A;  3FH1 A;  4LMI A;  4GB5 A;  2BNG A;  3GWR A;  3MG3 A;  1NU3 A;  5IG3 A;  2GEY A;  1JB5 A;  3UJM A;  2I9W A;  3B4P A;  3S5C A;  4HVN A;  4HKV B;  2BMO B;  4HZB B;  4K1U A;  1TP6 A;  4U13 A;  3FF2 A;  1O7G B;  1STD A;  3M8C A;  1W02 A;  3HK4 A;  1ULI B;  3DUK A;  4OVM A;  1S5A A;  4R9K A;  5IF6 A;  3CNM A;  2XSH B;  3H3H A;  1U5O A;  4WYK A;  1OF5 A;  1K41 A;  4WYK B;  1GS3 A;  4CDL A;  1JB4 A;  1OF5 B;  1Q42 A;  3FZW A;  3DM8 A;  3OXA A;  5CF1 A;  5IG0 A;  3NBR A;  3B7C A;  5CLK A;  3EN1 B;  3ROB A;  3KKG A;  3A76 A;  3FKA A;  3DZL A;  4OUQ A;  3NXJ A;  5D82 A;  3JUQ A;  2JQ5 A;  4R1K A;  3NUV A;  4I4K A;  3DMC A;  3OWS A;  4WP5 A;  4L7K A;  3JUP A;  5IEO A;  3OWY A;  1WQL B;  3IPT A;  2QGU A;  3NHX A;  3FF0 A;  2GXF A;  1OGX A;  2F86 B;  1DMN A;  4XBY A;  1E97 A;  5KP1 A;  4X2H A;  4HZ9 B;  2GEX A;  3F7X A;  4H3U A;  2F98 A;  1Q40 A;  3E99 A;  5D81 A;  1O7H B;  2YFJ B;  1Q40 B;  4HM3 B;  3GZR A;  5D83 A;  3JUO A;  4L8O A;  5DRE A;  1O7N B;  4J9A A;  5G2G A;  1E3R A;  4L8P A;  2HMO B;  1JKG A;  1OUN A;  4MJD A;  3I0Y A;  1JKG B;  5AIG A;  3KE7 A;  4X2O A;  4HJL B;  1W00 A;  2RCD A;  4ORL A;  3F9S A;  3OV4 A;  3MG1 A;  1GYB A;  4FCM A;  1CQS A;  2GBX B;  1UUV B;  3EHC A;  3CPO A;  3HX8 A;  2B1X B;  3MSO A;  3T8N A;  1W01 A;  3FSD A;  2Z77 A;  1O7M B;  1BUQ A;  5AIF A;  3DXO A;  1ZX2 A;  4HM1 B;  3F8H A;  1O7P B;  2PZV A;  8CHO A;  5AII A;  3EJV A;  2BMQ B;  3BB9 A;  5BVB A;  1Z1S A;  5KP3 A;  5IG4 A;  1AR0 A;  2HMN B;  1GY7 A;  2GBW B;  5AEU B;  3OX9 A;  3G8Z A;  2YFL B;  6STD A;  4K1V A;  3EN8 A;  3F40 A;  4STD A;  3EBY A;  2Z7A A;  2A15 A;  5IG5 A;  5DRV A;  1EA2 A;  3K0Z A;  3G0K A;  5KP4 A;  3G16 A;  2CKF B;  4HM6 B;  3SED A;  3WMD A;  3RGR A;  3GZB A;  5CF2 A;  2QIY A;  1ZO2 A;  3RGA A;  1IDP A;  1W6Y A;  1ULJ B;  3D9R A;  1OHS A;  2W2C A;  2F99 A;  2INX A;  2R4I A;  1QJG A;  3B8L A;  2RFR A;  3EBT A;  5FW5 A;  3KSP A;  1EG9 B;  3OWU A;  2Z76 A;  4KVH A;  2XSO B;  5AI1 A;  5AIH A;  5HGR A;  1NWW A;  1DMM A;  3LYG A;  4HM5 B;  1ISK A;  3F7S A; 
#chains in the Genus database with same CATH topology
 1E3V A;  3BNC A;  1MNL A;  2QEX 3;  4FMC A;  1BNI A;  5G1L A;  5AYR B;  1IVU A;  1ROA A;  1YNV X;  4HM2 B;  3CCJ 3;  1J2B A;  2XRX B;  1MGR A;  4AKZ A;  3H51 A;  2IMJ A;  5M1A A;  1DE3 A;  4XB5 A;  1D6Z A;  3CNX A;  1FGR A;  1EQK A;  4O8S A;  1V74 A;  2HMJ B;  6GSP A;  3LZA A;  5GSP A;  4BTX A;  1EKM A;  1C54 A;  3J7Y d;  1YJN 3;  1JBR A;  1RTU A;  1B2X A;  3MKI A;  1C7H A;  3GZY B;  1I3I A;  6RNT A;  1LOX A;  1BGS A;  2KCD A;  3S29 A;  1KWI A;  4XBT A;  1BRK A;  1EEJ A;  1ZGX A;  3NQY A;  1LOW A;  2BIR A;  2HML B;  1B21 A;  2J8X B;  2XR8 B;  3MYT A;  4XDW A;  7RNT A;  1VQO 3;  3PS8 A;  3ECF A;  1L5G B;  1W6C A;  3RNT A;  2ML6 A;  5BIR A;  2RGQ A;  1FYS A;  2STD A;  4PEJ A;  4RNT A;  3UL6 A;  1YI2 3;  3G71 3;  2IUK A;  3CME 3;  1OHP A;  1JN5 A;  2XFT A;  5IER A;  2XGN A;  3JUM A;  3PGB A;  4WWU C;  4BL3 A;  2K0M A;  2K54 A;  5M18 A;  3I56 3;  1Q81 4;  1QVG 2;  3AGO A;  3WHO A;  1DVD A;  3UL5 A;  3CU3 A;  3DH2 A;  5TGN A;  1SJW A;  4N3V A;  1JN5 B;  1IT8 A;  1R4Y A;  1RJO A;  3HZP A;  1BRI A;  3EX9 A;  1QMA A;  3IMA B;  3FCS B;  1BAO A;  3KSE D;  5IEP A;  1Q9E A;  1X1U A;  1LNI A;  1QAL A;  5AYS C;  2B24 B;  3DGY A;  3AHS A;  1O7W B;  4OK0 A;  5CK6 A;  3ZG5 A;  4FMD A;  3GRD A;  2AAE A;  4RNY A;  1ASK A;  3BIR A;  3F8X A;  1NJI 4;  2XGL A;  3FGY A;  2LQV A;  3STD A;  1A90 A;  4HM0 B;  3EE1 A;  2OWP A;  4BL2 A;  2CK3 H;  1OH0 A;  2GSP A;  1FGT A;  1VQM 3;  4EV5 A;  5LC6 A;  1B27 A;  3Q90 A;  1IT7 A;  4O3V A;  4XBX A;  1GD3 A;  5CXO A;  4CCV A;  4CPK A;  3LML A;  1PY3 A;  2HMM B;  4R80 A;  2E2U A;  1AV4 A;  1BNJ A;  3VF1 A;  1GY5 A;  3FLJ A;  3X40 A;  3G4S 3;  1RHL A;  3SOY A;  2CHC A;  4Q53 A;  1Q82 4;  3PCR A;  3B4O A;  1BSB A;  1NDO B;  8RNT A;  1T3B A;  1JB2 A;  3NM2 A;  3MHE A;  1VQ8 3;  2W9P A;  3EC9 A;  3NBJ A;  4EBG A;  3ER7 A;  1VQ7 3;  3EQQ B;  1HZ1 A;  1GMR A;  3SLU A;  4RZM A;  4ZM8 A;  1HKX A;  1HYF A;  1K28 A;  2UUG C;  2XF3 A;  3VSY A;  4K61 A;  5JPP A;  1OGZ A;  1RGF A;  1OPY A;  4HM4 B;  5AEW B;  1GY6 A;  2HOH A;  4LGQ A;  5BXQ A;  3G6E 3;  1FUT A;  1TUH A;  3CCM 3;  3LTB A;  4KFD A;  4NHF A;  5HOH A;  5STD A;  3KZT A;  1VQ5 3;  4XM4 A;  3BLZ A;  2WGQ A;  2IY2 A;  1QVF 2;  3EF8 A;  2BMR B;  2BU4 A;  1A2V A;  3FG3 A;  2OCT A;  1KD1 4;  1BSE A;  1VQK 3;  1YVB I;  1BNF A;  7STD A;  3CPW 2;  2SAR A;  1VZZ A;  1X1X A;  4IIA A;  1A2K A;  1RGG A;  2YFI B;  1U8C B;  2YX9 A;  1MOL A;  4J8T A;  4XDV A;  2KF5 A;  5IEN A;  1FA3 A;  1BSC A;  1RSN A;  2UGI A;  1NNV A;  3GZX B;  1WMO A;  5EVH A;  2KRT A;  3JUN A;  3K7C A;  3GAX A;  4LEH A;  1I2G A;  3F14 A;  3MG2 A;  2P0M A;  1TU5 A;  1T5Y A;  5JPU A;  3AGN A;  4HOH A;  3GSP A;  4R9L A;  4N6L A;  3NV0 A;  1VQL 3;  1N8R 4;  1WMN A;  2JDI H;  5G1K A;  3K9M C;  2HMK B;  1B3S A;  3DGM A;  3UNL A;  2KF3 A;  3NV0 B;  1OHO A;  3T8U A;  4LYL B;  3NQZ A;  3SOA A;  4HM7 B;  2KF4 A;  4MMX B;  3UB1 A;  3U97 A;  1UUG B;  2CWU A;  5ELU A;  1UCL A;  4BIR A;  3CCV 3;  1W2B 2;  2UX0 A;  1X1W A;  3SVA A;  1UUW B;  2CWT A;  2XEP A;  1DMQ A;  4FCJ A;  1OCV A;  1SQW A;  4FMA A;  1EUI C;  5FGO A;  1PYL A;  3SX1 A;  3NX0 A;  4HM8 B;  1B2U A;  3VGN A;  3FH1 A;  4KT3 B;  2Y74 A;  4LMI A;  5RNT A;  1IYY A;  1IU7 A;  1BNR A;  2CFG A;  1PU4 A;  4GB5 A;  2BNG A;  2KXG A;  1I70 A;  3GWR A;  1WMP A;  3MG3 A;  1NU3 A;  3AHW A;  2OQE A;  5IG3 A;  3V92 A;  2GEY A;  3LT9 A;  1JB5 A;  3UJM A;  2I9W A;  2WOF A;  3CXC 2;  1AVL A;  1TFK A;  3B4P A;  3PYJ A;  2O3O A;  3S5C A;  1SPU A;  3Q1C A;  4HVN A;  5A0O B;  4HKV B;  2BMO B;  1HU9 A;  3PXM A;  4HZB B;  2OQE C;  3PZW A;  4K1U A;  1TP6 A;  4U13 A;  1W2Z A;  2GU3 A;  3BNE A;  1RRH A;  3KCH A;  4H61 A;  3FF2 A;  1O7G B;  1YIT 3;  1K9M 4;  1STD A;  3M8C A;  3MPH A;  1X1Y A;  1W02 A;  3HK4 A;  3ZFZ A;  1ULI B;  1TFO A;  3DY5 A;  3DUK A;  4G1M B;  1AY7 A;  1S5A A;  4HAA A;  4OVM A;  4R9K A;  3EB8 A;  5IF6 A;  3CNM A;  2XSH B;  4N6U A;  2KAA A;  1B2M A;  1V58 A;  3H3H A;  1U5O A;  4WYK A;  4WHA A;  5JBS A;  1N8Q A;  1UCK A;  1BRS A;  1OF5 A;  3V99 A;  1SII A;  1K41 A;  2ML5 A;  4WYK B;  3WA3 A;  1US1 A;  1GS3 A;  4CDL A;  1BUJ A;  1BAN A;  3DGO A;  1JB4 A;  2F5W A;  4MMZ B;  2SBL A;  1OF5 B;  1Q42 A;  3FZW A;  1VQ6 3;  3S67 A;  3SXX A;  3DM8 A;  4TX4 A;  3BNB A;  4GHO A;  4N6O B;  1UCI A;  1DVC A;  3PCS A;  3OXA A;  3ZG0 A;  4K90 B;  5CF1 A;  2H0H A;  5IG0 A;  3NBR A;  3B7C A;  1CEW I;  7GSP A;  1JNQ A;  3LXU X;  5CLK A;  2C11 A;  3EN1 B;  3ROB A;  1G0T A;  2ZDJ A;  3KKG A;  3A76 A;  1ZS7 A;  3FKA A;  4N6M A;  3U1W A;  1BSA A;  3A5E A;  3DZL A;  4R4K A;  3N8B A;  4OUQ A;  3NXJ A;  4RNZ A;  2IUJ A;  3X3Z A;  2RSX A;  1WTH A;  2ZL8 A;  5D82 A;  3JUQ A;  2JQ5 A;  1BIR A;  1BU4 A;  3NUV A;  4R1K A;  1B2S A;  2RBI A;  1RNT A;  4I4K A;  1QAF A;  2LYX A;  3CCR 3;  3DMC A;  3OWS A;  4WP5 A;  4L7K A;  1BVI A;  1UDI I;  3V98 A;  1IK3 A;  3JUP A;  4FR9 A;  5IEO A;  1TRP A;  3OWY A;  1I0V A;  1CH0 A;  1WQL B;  2R41 A;  3WDG B;  2RNT A;  1LXE A;  1LOV A;  1N5H A;  2QGU A;  3IPT A;  3RDE A;  3NHX A;  5IW9 A;  3CCL 3;  3FF0 A;  1RMS A;  1STF I;  2M7O A;  4CJN A;  4O2H A;  1MGW A;  1VQ4 3;  2GXF A;  2CC3 A;  4EYC A;  4LSO A;  1OGX A;  2XFS A;  4GL6 A;  1WNH A;  1TRQ A;  4LZI A;  2F86 B;  2OTJ 3;  3LOY A;  1DMN A;  4XBY A;  1E97 A;  1I0X A;  4QWT A;  5KP1 A;  1GMQ A;  4X2H A;  3FG4 A;  4HZ9 B;  4J5G A;  1BRH A;  1UW1 A;  3NBB A;  1T2H A;  1A67 A;  2GEX A;  3F7X A;  1BOX A;  1RDS A;  2MF7 A;  4H3U A;  1CYU A;  2F98 A;  1RCL A;  3KN4 A;  2C10 A;  4I5Q A;  1YHQ 3;  2CX0 A;  1Q40 A;  1Y4K A;  3E99 A;  1W6G A;  1DET A;  4HBR A;  5D81 A;  1AQZ A;  4RBN A;  3LTD A;  1O7H B;  1RGE A;  2YFJ B;  5ELJ A;  2KF6 A;  1UGH I;  1NB3 I;  5LC7 A;  1Q40 B;  4HM3 B;  1JV2 B;  3GZR A;  2IA7 A;  5D83 A;  3JUO A;  2F5M A;  2CG0 A;  4L8O A;  5DRE A;  2H0I A;  1LVN A;  1JBT A;  1IV9 A;  1O7N B;  4AEQ A;  1YJ9 3;  3N9H A;  1VQ9 3;  4J9A A;  2OTL 3;  1D6Y A;  5G2G A;  1I2F A;  1E3R A;  1BNG A;  4L8P A;  2W03 A;  2HMO B;  2O9U X;  3WOD G;  3DGN A;  1JKG A;  1JRQ A;  1OUN A;  3TDG A;  2XH9 A;  1BNS A;  1MWS A;  3N54 B;  4MJD A;  4N6V 0;  3I0Y A;  3HII A;  1TIJ A;  3URP A;  1JKG B;  1R4C A;  2CX1 A;  1LQM B;  3WOF B;  1SAR A;  1JZO A;  1RCK A;  1RGK A;  1K73 4;  4FCZ A;  5AIG A;  4HYZ A;  2Q07 A;  3KE7 A;  4X2O A;  3CC7 3;  2FXT A;  1VQQ A;  4HJL B;  1W00 A;  3CCE 3;  9RNT A;  2QA4 3;  2E2T A;  2RCD A;  1YVS A;  2MC8 A;  1BNE A;  4ORL A;  4NRE A;  3F9S A;  3OV4 A;  1FGQ A;  2WGO A;  1IV7 A;  1FUS A;  2C4B A;  3MG1 A;  1GYB A;  1GOV A;  1M90 4;  5EEO A;  1JJ2 2;  3FG1 A;  3HIG A;  3Q2P A;  3QK9 A;  1YGE A;  4N6T A;  2BT3 A;  3D4A A;  3KII A;  4FCM A;  1CQS A;  2W6J H;  3WOE B;  2GBX B;  3S27 A;  1UUV B;  2W0Q A;  3EHC A;  3WR2 A;  1FZU A;  3X3Y A;  2CFK A;  3HOH A;  1I3F A;  3S28 A;  1IQX A;  3CPO A;  1A2P A;  3HX8 A;  4AKY A;  2WO0 A;  1KC8 4;  1LRA A;  2B1X B;  4BTW A;  1TJD A;  3MSO A;  2L4V A;  2Y73 A;  3IJE B;  1W01 A;  3T8N A;  1FGM A;  3FSD A;  3CC4 3;  1BRG A;  4N6N B;  4MEI A;  2F56 A;  1FW7 A;  1N9E A;  2Z77 A;  1O7M B;  3AMO A;  1RN1 A;  1BUQ A;  1G96 A;  1IQ8 A;  2GU1 A;  3ALA A;  3LTA A;  4EC6 A;  1TTO A;  5AIF A;  1N9J A;  3DXO A;  1OAC A;  3BU4 A;  2E2V A;  4JF8 A;  1ZX2 A;  4HM1 B;  3AMO B;  3CCU 3;  3F8H A;  4JRF A;  1O7P B;  1KSI A;  1RGL A;  2PNC A;  2PZV A;  8CHO A;  1KQS 2;  1BRN L;  2D42 A;  3HI7 A;  2D1W A;  1W4N A;  2W04 A;  1UGI A;  5AII A;  4HM5 B;  2FGT A;  1FGO A;  3O8Y A;  1IVX A;  5EQL A;  2CFD A;  2H0G A;  3EJV A;  2CFL A;  2BMQ B;  3BND A;  1LNH A;  4EW5 A;  3BB9 A;  5BVB A;  1RN7 A;  1PFP A;  1Z1S A;  5KP3 A;  5IG4 A;  1AR0 A;  1VQP 3;  2HMN B;  1G02 A;  1GY7 A;  1MWT A;  1RGA A;  2P0X A;  2P38 A;  3CCS 3;  1JBS A;  1F8N A;  1Q7H A;  2GBW B;  2K3D A;  5AEU B;  2BHM A;  3OX9 A;  3LH4 A;  1VQN 3;  3DGL A;  3G8Z A;  1LQG C;  4DKI A;  2YFL B;  3X41 A;  6STD A;  4K1V A;  3EN8 A;  4KZ1 A;  3F40 A;  4EV2 A;  2ZHX B;  2W56 A;  3WA2 X;  1N5P A;  4STD A;  2OOV A;  1AVK A;  1V57 A;  1Q86 4;  1M1X B;  3EBY A;  3CCQ 3;  2Z7A A;  1RGC A;  1I8V A;  2A15 A;  1YGW A;  5IG5 A;  2W56 B;  3K5T A;  1I2E A;  2WOH A;  2CH9 A;  1RN4 A;  5DRV A;  3D5I A;  3T0U A;  3KFQ C;  4MMY B;  3L0R A;  1EA2 A;  2OOV C;  3K0Z A;  1YIJ 3;  3G0K A;  5BU4 A;  5KP4 A;  1IVV A;  1M9G A;  3G16 A;  2CKF B;  4HM6 B;  4IPB A;  3CC2 3;  1GMP A;  1QAK A;  3MWZ A;  2CIU A;  5I97 A;  3I55 3;  3SED A;  1SIH A;  1JZD A;  3D79 A;  3WMD A;  1D6U A;  3RGR A;  3GZB A;  2Z6B A;  3D5G A;  5M19 A;  5CF2 A;  4O02 B;  2QIY A;  1ZO2 A;  2ZA4 A;  1UI7 A;  3RGA A;  4EXR A;  4BU4 A;  1K8A 4;  2FNQ A;  1RGH A;  1CYV A;  1IDP A;  1W6Y A;  4IT7 A;  1B2Z A;  3Q3F A;  2P09 A;  3LTC A;  4GSP A;  4ILF A;  1ULJ B;  4BTY A;  3LT8 A;  1NO3 A;  2P05 A;  3X3X A;  1T2I A;  1UCJ A;  3D9R A;  1OHS A;  2IYJ A;  3QRD A;  1FUW A;  1IQY A;  2CFW A;  3JVC A;  3SYU A;  4KFF A;  2L1S A;  2W2C A;  3X42 A;  2F99 A;  2INX A;  2R4I A;  1MWU A;  1UI8 A;  1W5Z A;  1QJG A;  1B20 A;  3B8L A;  4NPB A;  1S72 3;  3CMA 3;  2RFR A;  3NM7 A;  1GD4 A;  2W9Q A;  3EBT A;  1YJW 3;  5FW5 A;  3OW2 2;  1LOY A;  1M1K 4;  3KSP A;  3D3L A;  1RRL A;  1EG9 B;  3OWU A;  1BRJ A;  2Z76 A;  1NB5 I;  1GOU A;  2AAD A;  2CG1 A;  1RKY A;  3CD6 3;  1BSD A;  1ROV A;  4KVH A;  2V1L A;  1Q7Y 4;  2XSO B;  5AI1 A;  2F4Y A;  5AIH A;  1RNB A;  1IVW A;  1RLS A;  4WFO A;  5HGR A;  4J5K A;  1NWW A;  2CW9 A;  1DMM A;  4KFE A;  2BO9 B;  3K63 A;  1W7C A;  3LYG A;  1GSP A;  2CWV A;  1MWR A;  1DYU A;  1GOY A;  4FMB A;  1ISK A;  3F7S A; 
#chains in the Genus database with same CATH homology
 1E3V A;  3BNC A;  1MNL A;  2QEX 3;  4FMC A;  5AYR B;  1IVU A;  1ROA A;  4HM2 B;  3CCJ 3;  1J2B A;  2XRX B;  4AKZ A;  3H51 A;  2IMJ A;  4XB5 A;  1D6Z A;  3CNX A;  1FGR A;  1EQK A;  4O8S A;  1V74 A;  2HMJ B;  3LZA A;  4BTX A;  1EKM A;  3J7Y d;  1YJN 3;  3MKI A;  1C7H A;  3GZY B;  1LOX A;  2KCD A;  3S29 A;  1KWI A;  4XBT A;  3NQY A;  2HML B;  3MYT A;  2XR8 B;  4XDW A;  1VQO 3;  3PS8 A;  3ECF A;  1L5G B;  1W6C A;  2ML6 A;  2RGQ A;  2STD A;  4PEJ A;  3UL6 A;  1YI2 3;  3G71 3;  2IUK A;  3CME 3;  1OHP A;  1JN5 A;  2XFT A;  5IER A;  2XGN A;  3JUM A;  3PGB A;  4WWU C;  3I56 3;  2K0M A;  2K54 A;  1QVG 2;  1Q81 4;  1DVD A;  3UL5 A;  3CU3 A;  5TGN A;  1SJW A;  4N3V A;  1JN5 B;  1IT8 A;  1RJO A;  3HZP A;  3EX9 A;  1QMA A;  3IMA B;  3FCS B;  3KSE D;  5IEP A;  1QAL A;  5AYS C;  2B24 B;  1O7W B;  4OK0 A;  5CK6 A;  4FMD A;  3GRD A;  4RNY A;  1ASK A;  1A90 A;  3F8X A;  1NJI 4;  2XGL A;  3FGY A;  2LQV A;  3STD A;  4HM0 B;  3EE1 A;  2OWP A;  2CK3 H;  1OH0 A;  1FGT A;  1VQM 3;  4EV5 A;  5LC6 A;  3Q90 A;  1IT7 A;  4O3V A;  4XBX A;  1GD3 A;  5CXO A;  4CCV A;  3LML A;  4R80 A;  2HMM B;  2E2U A;  1AV4 A;  3VF1 A;  1GY5 A;  3FLJ A;  3X40 A;  3G4S 3;  3SOY A;  2CHC A;  4Q53 A;  1Q82 4;  3PCR A;  3B4O A;  1NDO B;  1JB2 A;  3NM2 A;  3MHE A;  1VQ8 3;  2W9P A;  3EC9 A;  3NBJ A;  4EBG A;  3ER7 A;  1VQ7 3;  3EQQ B;  3SLU A;  4RZM A;  4ZM8 A;  1HKX A;  1K28 A;  3VSY A;  2XF3 A;  4K61 A;  5JPP A;  1OGZ A;  4HM4 B;  1OPY A;  5AEW B;  1GY6 A;  5BXQ A;  4LGQ A;  3G6E 3;  1TUH A;  3CCM 3;  3LTB A;  4KFD A;  4NHF A;  5STD A;  3KZT A;  1VQ5 3;  4XM4 A;  3BLZ A;  2WGQ A;  1QVF 2;  3EF8 A;  2BMR B;  1A2V A;  3FG3 A;  2OCT A;  1KD1 4;  1VQK 3;  1YVB I;  7STD A;  3CPW 2;  1VZZ A;  4IIA A;  1A2K A;  2YFI B;  4J8T A;  1U8C B;  2YX9 A;  1MOL A;  4XDV A;  5IEN A;  1FA3 A;  3GZX B;  1WMO A;  5EVH A;  2KRT A;  3JUN A;  3K7C A;  3GAX A;  4LEH A;  3F14 A;  3MG2 A;  2P0M A;  1TU5 A;  1T5Y A;  5JPU A;  4R9L A;  4N6L A;  3NV0 A;  1VQL 3;  1N8R 4;  1WMN A;  2JDI H;  3K9M C;  2HMK B;  3UNL A;  3DGM A;  3NV0 B;  1OHO A;  3T8U A;  3NQZ A;  3SOA A;  4HM7 B;  4MMX B;  3UB1 A;  3U97 A;  2CWU A;  5ELU A;  3CCV 3;  1W2B 2;  2UX0 A;  3SVA A;  1UUW B;  2CWT A;  2XEP A;  1DMQ A;  4FCJ A;  1OCV A;  1SQW A;  4FMA A;  5FGO A;  3SX1 A;  3NX0 A;  4HM8 B;  3VGN A;  3FH1 A;  2Y74 A;  4LMI A;  1IU7 A;  2CFG A;  1PU4 A;  4GB5 A;  2BNG A;  2KXG A;  3GWR A;  1WMP A;  3MG3 A;  1NU3 A;  2OQE A;  5IG3 A;  3V92 A;  2GEY A;  3LT9 A;  1JB5 A;  3UJM A;  2I9W A;  2WOF A;  3CXC 2;  1AVL A;  1TFK A;  3B4P A;  3PYJ A;  2O3O A;  3S5C A;  1SPU A;  3Q1C A;  4HVN A;  5A0O B;  4HKV B;  2BMO B;  1HU9 A;  3PXM A;  4HZB B;  2OQE C;  3PZW A;  4K1U A;  1TP6 A;  4U13 A;  1W2Z A;  2GU3 A;  3BNE A;  1RRH A;  4H61 A;  3FF2 A;  1O7G B;  1YIT 3;  1K9M 4;  1STD A;  3M8C A;  3MPH A;  1W02 A;  3HK4 A;  1ULI B;  1TFO A;  3DY5 A;  3DUK A;  4G1M B;  4OVM A;  1S5A A;  4R9K A;  3EB8 A;  5IF6 A;  3CNM A;  2XSH B;  4N6U A;  3H3H A;  1U5O A;  4WYK A;  4WHA A;  5JBS A;  1N8Q A;  1OF5 A;  3V99 A;  1SII A;  1K41 A;  2ML5 A;  4WYK B;  3WA3 A;  1US1 A;  1GS3 A;  4CDL A;  3DGO A;  1JB4 A;  4MMZ B;  2SBL A;  1OF5 B;  1Q42 A;  3FZW A;  1VQ6 3;  3S67 A;  3SXX A;  3DM8 A;  4TX4 A;  3BNB A;  4N6O B;  1DVC A;  3PCS A;  3OXA A;  4K90 B;  5CF1 A;  5IG0 A;  3NBR A;  3B7C A;  1CEW I;  1JNQ A;  3LXU X;  5CLK A;  2C11 A;  3EN1 B;  3ROB A;  2ZDJ A;  3KKG A;  3A76 A;  3FKA A;  4N6M A;  3U1W A;  3DZL A;  4R4K A;  3N8B A;  4OUQ A;  3NXJ A;  4RNZ A;  2IUJ A;  3X3Z A;  2RSX A;  1WTH A;  2ZL8 A;  5D82 A;  3JUQ A;  2JQ5 A;  4R1K A;  3NUV A;  4I4K A;  1QAF A;  2LYX A;  3CCR 3;  3DMC A;  3OWS A;  4WP5 A;  4L7K A;  3V98 A;  1IK3 A;  3JUP A;  4FR9 A;  5IEO A;  3OWY A;  1WQL B;  3WDG B;  1LXE A;  2QGU A;  1N5H A;  3IPT A;  3RDE A;  3NHX A;  5IW9 A;  3CCL 3;  3FF0 A;  1STF I;  2M7O A;  4O2H A;  1VQ4 3;  2GXF A;  2CC3 A;  4EYC A;  4LSO A;  1OGX A;  2XFS A;  4GL6 A;  1WNH A;  4LZI A;  2OTJ 3;  2F86 B;  3LOY A;  1DMN A;  4XBY A;  1E97 A;  4QWT A;  5KP1 A;  4X2H A;  3FG4 A;  4HZ9 B;  1UW1 A;  3NBB A;  1A67 A;  2GEX A;  3F7X A;  2MF7 A;  4H3U A;  1CYU A;  2F98 A;  3KN4 A;  2C10 A;  1YHQ 3;  1Q40 A;  1Y4K A;  3E99 A;  1W6G A;  4HBR A;  5D81 A;  4RBN A;  3LTD A;  1O7H B;  2YFJ B;  5ELJ A;  1NB3 I;  5LC7 A;  1Q40 B;  4HM3 B;  1JV2 B;  3GZR A;  2IA7 A;  5D83 A;  3JUO A;  4L8O A;  2CG0 A;  5DRE A;  1LVN A;  1IV9 A;  1O7N B;  4AEQ A;  1YJ9 3;  3N9H A;  1VQ9 3;  4J9A A;  2OTL 3;  1D6Y A;  5G2G A;  1E3R A;  4L8P A;  2W03 A;  2HMO B;  2O9U X;  3WOD G;  3DGN A;  1JKG A;  1JRQ A;  1OUN A;  3TDG A;  2XH9 A;  3N54 B;  4MJD A;  4N6V 0;  3I0Y A;  3HII A;  1TIJ A;  1JKG B;  1R4C A;  3WOF B;  1K73 4;  4FCZ A;  5AIG A;  4HYZ A;  2Q07 A;  3KE7 A;  4X2O A;  3CC7 3;  2FXT A;  4HJL B;  1W00 A;  3CCE 3;  2QA4 3;  2E2T A;  2RCD A;  2MC8 A;  4ORL A;  4NRE A;  3F9S A;  3OV4 A;  1FGQ A;  2WGO A;  1IV7 A;  3MG1 A;  1GYB A;  1M90 4;  5EEO A;  1JJ2 2;  3FG1 A;  3HIG A;  3Q2P A;  3QK9 A;  1YGE A;  4N6T A;  2BT3 A;  3KII A;  4FCM A;  1CQS A;  2W6J H;  3WOE B;  2GBX B;  3S27 A;  1UUV B;  2W0Q A;  3EHC A;  3X3Y A;  2CFK A;  3S28 A;  1IQX A;  3CPO A;  3HX8 A;  4AKY A;  2WO0 A;  1KC8 4;  2B1X B;  4BTW A;  3MSO A;  2L4V A;  2Y73 A;  3IJE B;  1W01 A;  3T8N A;  1FGM A;  3FSD A;  3CC4 3;  4N6N B;  4MEI A;  1N9E A;  2Z77 A;  1O7M B;  3AMO A;  1BUQ A;  1G96 A;  1IQ8 A;  2GU1 A;  3ALA A;  3LTA A;  4EC6 A;  5AIF A;  1N9J A;  3DXO A;  1OAC A;  2E2V A;  4JF8 A;  1ZX2 A;  4HM1 B;  3AMO B;  3CCU 3;  3F8H A;  4JRF A;  1O7P B;  1KSI A;  2PNC A;  2PZV A;  8CHO A;  1KQS 2;  2D42 A;  3HI7 A;  2D1W A;  1W4N A;  2W04 A;  5AII A;  2FGT A;  1FGO A;  3O8Y A;  1IVX A;  5EQL A;  2CFD A;  3EJV A;  2CFL A;  2BMQ B;  3BND A;  1LNH A;  3BB9 A;  5BVB A;  1RN7 A;  1PFP A;  1Z1S A;  5KP3 A;  5IG4 A;  1AR0 A;  1VQP 3;  2HMN B;  1GY7 A;  2P0X A;  3CCS 3;  2P38 A;  1F8N A;  2GBW B;  5AEU B;  2BHM A;  3OX9 A;  3LH4 A;  1VQN 3;  3DGL A;  3G8Z A;  2YFL B;  3X41 A;  6STD A;  4K1V A;  3EN8 A;  4KZ1 A;  3F40 A;  4EV2 A;  2W56 A;  3WA2 X;  1N5P A;  4STD A;  2OOV A;  1AVK A;  1Q86 4;  1M1X B;  3EBY A;  3CCQ 3;  2Z7A A;  2A15 A;  5IG5 A;  2W56 B;  3K5T A;  2WOH A;  2CH9 A;  5DRV A;  3T0U A;  3KFQ C;  4MMY B;  3L0R A;  1EA2 A;  2OOV C;  3K0Z A;  1YIJ 3;  3G0K A;  5KP4 A;  1IVV A;  1M9G A;  3G16 A;  2CKF B;  4HM6 B;  4IPB A;  3CC2 3;  1QAK A;  3MWZ A;  2CIU A;  5I97 A;  3I55 3;  3SED A;  1SIH A;  3WMD A;  1D6U A;  3RGR A;  3GZB A;  2Z6B A;  5CF2 A;  4O02 B;  2QIY A;  1ZO2 A;  3RGA A;  1UI7 A;  4EXR A;  1K8A 4;  2FNQ A;  4IT7 A;  1CYV A;  1IDP A;  1W6Y A;  2P09 A;  3LTC A;  1ULJ B;  4BTY A;  3LT8 A;  1NO3 A;  2P05 A;  3X3X A;  3D9R A;  1OHS A;  3QRD A;  1FUW A;  1IQY A;  2CFW A;  3JVC A;  4KFF A;  2W2C A;  3X42 A;  2F99 A;  2INX A;  2R4I A;  1UI8 A;  1W5Z A;  1QJG A;  3B8L A;  1S72 3;  3CMA 3;  2RFR A;  3NM7 A;  1GD4 A;  2W9Q A;  3EBT A;  1YJW 3;  5FW5 A;  3OW2 2;  1M1K 4;  3KSP A;  3D3L A;  1RRL A;  1EG9 B;  3OWU A;  2Z76 A;  1NB5 I;  2CG1 A;  1RKY A;  3CD6 3;  1ROV A;  4KVH A;  2V1L A;  1Q7Y 4;  2XSO B;  5AI1 A;  5AIH A;  1IVW A;  4WFO A;  5HGR A;  1NWW A;  2CW9 A;  1DMM A;  4KFE A;  2BO9 B;  3K63 A;  1W7C A;  3LYG A;  2CWV A;  1DYU A;  4HM5 B;  4FMB A;  1ISK A;  3F7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...