3ROBA

The crystal structure of a conserved protein from planctomyces limnophilus dsm 3776
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
GAGRHADELAIRTVQYRWLEATRKFDRQVLSSLMTDDVVFLTPGRLPFGKEEFLAACEQNDQRVIIEASATFEEIVIVEPMAYTRTHLHIKVTPRSGGAVRELAGHAMSIFRRSMFGEWQLARDANLVVPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized conserved protein
publication title The crystal structure of a conserved protein from Planctomyces limnophilus DSM 3776
rcsb
source organism Planctomyces limnophilus
total genus 41
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3robA00
1NDOB 4LMIA 4CDLA 4XB5A 1ULIB 1Z1SA 3G0KA 4HM0B 2XRXB 4HM2B 4FCMA 4HZ9B 1U5OA 3OV4A 3WMDA 5BXQA 5FW5A 3MG2A 2STDA 1DMQA 1O7HB 1GS3A 3EBYA 4J9AA 5KP1A 1TP6A 3SOYA 5IEOA 1UUWB 1WQLB 3DUKA 1NWWA 4I4KA 3NV0A 5IG3A 1JKGB 3Q90A 4HJLB 3NM2A 4K1VA 1ZX2A 1W02A 3MYTA 5IG4A 4X2OA 1O7GB 3DXOA 2OWPA 3B4PA 1O7NB 3MKIA 3OWYA 3K7CA 3I0YA 1OCVA 3FZWA 3OWUA 4XDVA 1W00A 3BB9A 5CF2A 3FGYA 2HMKB 5DREA 3F40A 3EF8A 3OX9A 1OPYA 3H3HA 1ISKA 2GXFA 3F8XA 2CKFB 2RGQA 3VSYA 4J8TA 3UJMA 2B24B 4X2HA 5IG5A 3UNLA 2GBWB 3LZAA 4HKVB 4XDWA 3FLJA 2A15A 4GB5A 5CLKA 2GEYA 1OHSA 3MSOA 3EHCA 4L8OA 3F9SA 4L8PA 3B4OA 5AIIA 1E97A 5AIGA 5D81A 3STDA 3ECFA 5IF6A 3IPTA 7STDA 3M8CA 3FH1A 4XM4A 2GBXB 1JB4A 2HMLB 2BMQB 4HM7B 5G2GA 2F99A 4HM3B 2YFJB 1JN5A 2XSHB 5KP3A 4LGQA 3T8NA 1O7WB 3E99A 2R4IA 3BLZA 2XSOB 1GY7A 3F7SA 1HKXA 3T8UA 1S5AA 5AIFA 1STDA 4HM6B 3EBTA 3KE7A 3CNXA 1UUVB 3NV0B 5AEUB 2CHCA 3NUVA 3B8LA 5IG0A 5DRVA 1E3RA 4XBYA 1DMNA 3HX8A 1BUQA 5TGNA 1Q42A 1W01A 3JUQA 1A2KA 1JB2A 4HM8B 3FF0A 4U13A 1Q40A 3OWSA 4R9KA 3FSDA 4N3VA 1CQSA 1O7MB 3K0ZA 2B1XB 5AI1A 1AR0A 1E3VA 3GWRA 2Z7AA 3OXAA 2XR8B 4HM1B 2I9WA 5EVHA 3MHEA 5BVBA 1JB5A 2HMMB 3F7XA 2YFLB 4K1UA 5CXOA 3EX9A 3EN8A 1QJGA 1C7HA 1OUNA 4RZMA 3GZYB 3D9RA 5JPPA 2Z76A 5AIHA 5IEPA 4HZBB 5D82A 4LEHA 3HZPA 5STDA 1OHPA 2IMJA 1OGXA 3GZRA 4FCJA 4XBTA 2F98A 4STDA 1VZZA 1K41A 3G8ZA 1QMAA 4KVHA 1JN5B 3FF2A 1O7PB 4WP5A 2YFIB 4HVNA 3KSPA 3ER7A 1DMMA 1OF5A 3RGAA 5KP4A 2GEXA 3F8HA 1OF5B 1GYBA 5AEWB 3CPOA 4Q53A 3DM8A 3VGNA 3HK4A 2RCDA 2RFRA 3DZLA 3B7CA 3G16A 3A76A 3S5CA 1GY5A 1ULJB 1IDPA 1JKGA 3EN1B 3JUOA 1EA2A 3ROBA 3DMCA 3MG1A 4WYKA 4R1KA 2W2CA 3CNMA 2PZVA 4ORLA 3CU3A 4WYKB 4H3UA 5HGRA 1OH0A 1EG9B 2HMJB 3JUMA 2BMOB 4MJDA 4OUQA 6STDA 1OHOA 2HMOB 2BNGA 3SOAA 1W6YA 1Q40B 5IENA 1NU3A 3EC9A 3EQQB 3KKGA 3JUNA 3MG3A 4WWUC 2INXA 5D83A 1TUHA 3GZXB 4HM5B 1SJWA 1ASKA 3GRDA 2QGUA 3SEDA 4R9LA 2BMRB 3GZBA 3JUPA 5JPUA 3H51A 5IERA 4XBXA 2QIYA 4L7KA 4HM4B 3RGRA 3F14A 2HMNB 1ZO2A 4OVMA 5CF1A 2F86B 3KZTA 2Z77A 2JQ5A 3FKAA 2K54A 4IIAA 1OGZA 3EJVA 1GY6A 3NXJA 4PEJA 3NHXA 8CHOA 3LYGA 5CK6A 3NBRA 2UX0A
chains in the Genus database with same CATH superfamily
1LQGC 1NDOB 4LMIA 2SARA 4CDLA 4GL6A 4NPBA 4XB5A 5RNTA 2W9PA 1ULIB 1Z1SA 2H0IA 3G0KA 2XRXB 4HM0B 3CC23 3FG1A 2R41A 3K5TA 4I5QA 4HM2B 2Y74A 2BT3A 4HAAA 1N9EA 1N5PA 1A2PA 1M1XB 1X1WA 3EB8A 4FCMA 4HZ9B 1STFI 1U5OA 1R4YA 3KN4A 3OV4A 3WMDA 2D42A 2RSXA 5FW5A 5BXQA 2IY2A 1W4NA 3QRDA 3MG2A 1NO3A 1MWTA 4HOHA 3TDGA 1M904 1DE3A 3BU4A 1BGSA 3CCL3 3UB1A 3LTDA 2STDA 1MGRA 2FGTA 1JBSA 1DYUA 2CFLA 1VQ53 1BSDA 1DMQA 3CMA3 1O7HB 3WODG 1UGHI 1GS3A 2L4VA 1IQXA 3WR2A 3KCHA 3J7Yd 3EBYA 4J9AA 1JBTA 4O02B 1Q9EA 1F8NA 3MPHA 5KP1A 1TP6A 1BRHA 3CC73 3SOYA 5IEOA 2OTJ3 5G1LA 2MC8A 5LC7A 3X41A 1FZUA 1I2GA 1UUWB 1WQLB 1NNVA 2FNQA 4EXRA 3G6E3 3DUKA 1X1YA 3LOYA 3CPW2 1NWWA 4I4KA 1BAOA 1RTUA 5M18A 1CYUA 3NV0A 1WMOA 4N6OB 1YGEA 2OTL3 3PCRA 5IG3A 1B2SA 1MNLA 1KSIA 3AGOA 1JKGB 3Q90A 4LSOA 4CPKA 1IVWA 2ML5A 1U8CB 3NM2A 4HJLB 2H0GA 2SBLA 3V98A 4EYCA 1G0TA 1GMQA 1VQQA 4K1VA 1IV7A 2OQEA 1VQ43 1ZX2A 4KT3B 1UCKA 1W02A 2CK3H 2E2VA 3MYTA 1PU4A 1JNQA 8RNTA 5IG4A 4X2OA 1O7GB 3DXOA 2OWPA 3B4PA 3SVAA 1VQL3 3NM7A 1IVUA 3N54B 1GSPA 2JDIH 1O7NB 2KRTA 1BSCA 1I3FA 2E2UA 4K61A 3MKIA 3OWYA 3K7CA 1BNJA 1GOYA 3I0YA 1OCVA 1N9JA 3LTAA 2P38A 1RLSA 3FZWA 3OWUA 2Q07A 1FGOA 4XDVA 5ELJA 3UL6A 1W00A 1IQYA 3SLUA 3BB9A 5CF2A 3FGYA 4BL2A 2HMKB 5DREA 4BTWA 3F40A 2CG1A 3SX1A 1RJOA 1GMPA 2UGIA 3EF8A 1B27A 3PZWA 5I97A 3OX9A 4CCVA 3CCQ3 2OQEC 1OPYA 3H3HA 3Q1CA 3CXC2 1YI23 1ISKA 1C54A 1V74A 2CIUA 2W9QA 1IU7A 2GXFA 3F8XA 3V99A 2CKFB 2RGQA 2K0MA 3VSYA 1LXEA 1FYSA 4J8TA 3UJMA 4RNYA 1X1UA 2B24B 1HYFA 1ROVA 3PGBA 4X2HA 5IG5A 3LH4A 2XFTA 2CH9A 4BL3A 4MMXB 2P0MA 3IJEB 1K28A 3UNLA 3CME3 2GBWB 3LZAA 4HKVB 4RNZA 4XDWA 3FLJA 2YX9A 1NJI4 2A15A 1N8QA 2ML6A 4GB5A 1UCLA 5CLKA 3KIIA 1M1K4 1YHQ3 1KQS2 1RGHA 1JRQA 1RN7A 3V92A 2GEYA 1BRGA 3X3ZA 1OHSA 3A5EA 3Q3FA 5ELUA 5BIRA 1JBRA 3MSOA 1N5HA 3T0UA 3PXMA 2RNTA 3EHCA 1IVXA 3CCU3 4L8OA 2L1SA 3I563 3F9SA 3BIRA 4L8PA 2KXGA 4EV2A 3MWZA 3B4OA 4FMBA 5AIIA 2W03A 2KF3A 4AEQA 1E97A 1I0XA 1BVIA 3JVCA 4WHAA 3K9MC 5AIGA 5D81A 1KC84 3STDA 1BNIA 3ECFA 4EC6A 5IF6A 3IPTA 1WTHA 2GSPA 7STDA 1BUJA 3AGNA 3M8CA 1K8A4 3GAXA 3FH1A 4XM4A 1A67A 1B21A 2GBXB 1TRPA 2HOHA 3DH2A 1JB4A 1ZS7A 2HMLB 3X40A 2BMQB 3N8BA 3D5IA 4HM7B 5FGOA 1SIIA 3ALAA 3K63A 1ZGXA 5G2GA 2F99A 1D6UA 3DGOA 2WGQA 1YJN3 1RRHA 4HM3B 2W04A 2YFJB 1JN5A 1RGAA 2CWUA 6RNTA 4IT7A 1BRNL 2XSHB 2GU3A 5KP3A 3U97A 1I0VA 4KFFA 3X3YA 3ZG0A 2UUGC 5G1KA 2CFKA 4BIRA 4LGQA 3WA2X 3FG3A 3ZFZA 1RSNA 4R4KA 1AVKA 1RGEA 3T8NA 2M7OA 1O7WB 1BSEA 3D5GA 3E99A 2R4IA 3BLZA 2XSOB 1GY7A 1LOXA 1YIJ3 3F7SA 1TTOA 3HIGA 2CX1A 3KSED 4N6UA 1A2VA 3CCR3 2CW9A 2KCDA 1HKXA 1W6CA 4QWTA 3T8UA 1S5AA 4EW5A 1HU9A 1WMPA 1I70A 2PNCA 1FUSA 5AIFA 1STDA 4HM6B 1I3IA 2F56A 3NQYA 3D79A 1OACA 3EBTA 1UGIA 3KE7A 4HYZA 1G02A 1V58A 2H0HA 3CNXA 1FUTA 1UUVB 3NV0B 3I553 5AEUB 2WO0A 2CHCA 3NUVA 1FUWA 1BU4A 1YVSA 1TFOA 3B8LA 3DGNA 3ZG5A 1I8VA 5IG0A 4KFDA 1E3RA 5DRVA 4XBYA 1BRKA 3DY5A 3GSPA 1DMNA 3UL5A 3HX8A 1MWRA 1TIJA 1BUQA 3KFQC 1FW7A 5TGNA 1Q42A 2C11A 1UCIA 2KF4A 2ZHXB 1SIHA 2CFDA 4O3VA 2BO9B 1W01A 3AHWA 1T2HA 3JUQA 1A2KA 3QK9A 3X3XA 1SARA 1JB2A 1FGRA 5M1AA 1BNGA 5GSPA 3LTCA 4HM8B 1EUIC 3BNBA 1WMNA 3FF0A 2QEX3 3PCSA 4U13A 2ZDJA 1Q40A 3LTBA 3OWSA 4R9KA 1B2XA 4J5GA 3FSDA 2XGLA 4FMCA 1BRIA 1NB5I 4N3VA 1RGCA 4K90B 1W2ZA 1J2BA 1M9GA 1CQSA 2W56A 3D4AA 5EQLA 5EEOA 2C4BA 3CD63 1YNVX 1EQKA 4RBNA 1I2FA 1O7MB 2XH9A 2C10A 3K0ZA 4R80A 1BOXA 2B1XB 5AI1A 3AMOA 4JF8A 1KD14 4N6MA 1B2UA 1CH0A 3BNDA 3LXUX 1AR0A 2W56B 4JRFA 3RNTA 1FGQA 1E3VA 1QAFA 3GWRA 1JV2B 2LYXA 2Z7AA 3AMOB 3OXAA 1T3BA 2KF5A 2J8XB 1UDII 2XR8B 4HM1B 1EEJA 1DVDA 2I9WA 5EVHA 3MHEA 2XGNA 2OOVA 5BVBA 1IK3A 1JB5A 1QALA 2P05A 1TRQA 2FXTA 4NREA 2HMMB 3F7XA 4EBGA 3G4S3 1MGWA 2CX0A 2YFLB 2W0QA 4K1UA 2MF7A 1GOVA 1GD4A 2KAAA 3RDEA 1T2IA 4MEIA 5CXOA 3EX9A 1UI8A 3EN8A 3URPA 4ZM8A 5JBSA 4N6V0 1D6ZA 1QJGA 1C7HA 1OUNA 1PFPA 1FGMA 3LT8A 4G1MB 4CJNA 4RZMA 1TJDA 4N6LA 2IUJA 3GZYB 3D9RA 5JPPA 2Z76A 1NB3I 1TFKA 1RCLA 1LNHA 3NQZA 5AIHA 5IEPA 1RMSA 3L0RA 1FA3A 3S28A 3HOHA 1YVBI 3SXXA 1QVF2 4HZBB 5D82A 5BU4A 1D6YA 4FMAA 4LEHA 1RGLA 1G96A 3CC43 3NX0A 1K734 7RNTA 1A90A 3BNEA 5A0OB 1LOVA 1X1XA 3HZPA 3LT9A 1BRJA 5STDA 2OOVC 1OHPA 3DGYA 2IMJA 1OGXA 2P09A 1R4CA 1BNEA 1I2EA 1Q7HA 2AAEA 1LOWA 1RGKA 1BSAA 3DGLA 3GZRA 4FR9A 1L5GB 1VQ73 1Q864 4FCJA 3BNCA 2WOHA 4XBTA 4O2HA 1Y4KA 2F98A 1AV4A 4STDA 1DVCA 1BNSA 1VZZA 4OK0A 5AYSC 1B2MA 1K41A 1ROAA 3G8ZA 1QMAA 4KVHA 1AQZA 1UUGB 1JN5B 1AVLA 3FF2A 1O7PB 3O8YA 4WP5A 1V57A 2YFIB 4HVNA 1PYLA 1IYYA 3KSPA 2BU4A 1RCKA 2K3DA 1DMMA 3ER7A 3HIIA 3WOEB 4O8SA 1W6GA 1OF5A 1B20A 1Q814 2BIRA 3RGAA 1IT8A 5KP4A 1CEWI 2XFSA 2CFGA 2GEXA 3F8HA 4FCZA 4MMYB 1OF5B 3U1WA 1GYBA 1PY3A 5AEWB 3CPOA 4Q53A 3CCM3 1JJ22 3DM8A 4AKYA 3SYUA 3VGNA 1JZDA 1RDSA 1RN1A 2RCDA 1LVNA 2RFRA 2XF3A 3B7CA 1MWSA 1LQMB 3DZLA 3HK4A 1VQ93 3G16A 3HI7A 4J5KA 2IA7A 3A76A 2D1WA 3S5CA 4EV5A 1GY5A 2V1LA 1VQ83 1ULJB 1QAKA 4BU4A 1IDPA 1W2B2 1EKMA 1JKGA 4LZIA 3EN1B 3JUOA 1EA2A 1AY7A 1UI7A 2F5WA 2O3OA 3ROBA 3DMCA 7GSPA 3MG1A 4WYKA 1BANA 2RBIA 3X42A 1RNBA 4R1KA 9RNTA 1BNRA 2ZL8A 2W2CA 1B3SA 3CCV3 1BIRA 3CNMA 2CG0A 2PZVA 1VQK3 1YIT3 4ORLA 1FGTA 2XEPA 3CU3A 4GSPA 4HBRA 4WYKB 3D3LA 1VQP3 3S67A 4H3UA 1N8R4 1BRSA 1TU5A 5HGRA 1OH0A 1EG9B 2HMJB 2Y73A 4BTXA 3JUMA 2GU1A 3AHSA 3LMLA 4TX4A 1GMRA 3WHOA 1YGWA 2BMOB 1CYVA 1LRAA 2IUKA 4MJDA 4OUQA 4WFOA 4N6TA 6STDA 5IW9A 1OHOA 2HMOB 1RRLA 1VQM3 2BNGA 1US1A 3SOAA 1W6YA 2P0XA 3WDGB 2CWVA 1BNFA 1Q40B 1SPUA 5IENA 1NU3A 1SQWA 4DKIA 1WNHA 1RN4A 3EC9A 2LQVA 3EQQB 1K9M4 2CWTA 3Q2PA 3KKGA 3JUNA 2IYJA 3MG3A 4WWUC 3CCJ3 2INXA 5D83A 1TUHA 1W7CA 1LOYA 3GZXB 3VF1A 1UW1A 3WA3A 4HM5B 1VQO3 2OCTA 1SJWA 1ASKA 3IMAB 2O9UX 1JZOA 2WGOA 2W6JH 3N9HA 1IT7A 3PS8A 2WOFA 1IQ8A 3G713 3GRDA 2ZA4A 4AKZA 1VQ63 2QGUA 3SEDA 4ILFA 1QVG2 1RKYA 4RNTA 4R9LA 1RGFA 4LYLB 3NBBA 1UCJA 2BMRB 1YJW3 3EE1A 3GZBA 2CC3A 3JUPA 5JPUA 3CCE3 2AADA 3H51A 3CCS3 3FG4A 1B2ZA 2QA43 4FMDA 3FCSB 4N6NB 1BSBA 3PYJA 5IERA 1YJ93 4KFEA 4XBXA 3OW22 2QIYA 4IPBA 2F4YA 2KF6A 4L7KA 4HM4B 3RGRA 1T5YA 2CFWA 3F14A 2E2TA 2HMNB 1ZO2A 3DGMA 4GHOA 4OVMA 4MMZB 1IV9A 1RGGA 5CF1A 2F86B 1LNIA 2Z77A 2JQ5A 1MWUA 3KZTA 3FKAA 2K54A 3S27A 6GSPA 4IIAA 1OGZA 5M19A 3EJVA 1RNTA 5LC6A 3S29A 1GY6A 1Q7Y4 4NHFA 1W5ZA 4H61A 1RHLA 1GD3A 5AYRB 1IVVA 3WOFB 4BTYA 1DETA 3NXJA 1GOUA 4KZ1A 5HOHA 4PEJA 1HZ1A 1MOLA 2BHMA 3NHXA 8CHOA 1S723 1KWIA 3LYGA 5CK6A 3NBRA 1Q824 1VQN3 3NBJA 2Z6BA 2UX0A 2F5MA
chains in the Genus database with same CATH topology
1NDOB 4LMIA 4CDLA 4GL6A 4XB5A 2W9PA 1ULIB 1Z1SA 3G0KA 4HM0B 2XRXB 3CC23 3FG1A 3K5TA 4HM2B 2Y74A 2BT3A 1N9EA 1N5PA 1M1XB 3EB8A 4FCMA 4HZ9B 1STFI 1U5OA 3KN4A 3OV4A 3WMDA 2D42A 2RSXA 5FW5A 5BXQA 3QRDA 1W4NA 3MG2A 1NO3A 3TDGA 1M904 3CCL3 3UB1A 3LTDA 2STDA 2FGTA 1DYUA 2CFLA 1VQ53 1DMQA 3CMA3 1O7HB 3WODG 1GS3A 2L4VA 1IQXA 3J7Yd 3EBYA 4J9AA 4O02B 1F8NA 3MPHA 5KP1A 1TP6A 3CC73 3SOYA 5IEOA 2OTJ3 2MC8A 5LC7A 3X41A 1UUWB 1WQLB 2FNQA 4EXRA 3G6E3 3DUKA 3LOYA 3CPW2 1NWWA 4I4KA 1CYUA 3NV0A 1WMOA 4N6OB 1YGEA 2OTL3 3PCRA 5IG3A 1MNLA 1KSIA 4LSOA 1JKGB 3Q90A 1IVWA 2ML5A 1U8CB 3NM2A 4HJLB 2SBLA 3V98A 4EYCA 4K1VA 1IV7A 2OQEA 1VQ43 1ZX2A 1W02A 2CK3H 2E2VA 3MYTA 1PU4A 1JNQA 5IG4A 4X2OA 1O7GB 3DXOA 2OWPA 3B4PA 3SVAA 1VQL3 3NM7A 1IVUA 3N54B 2JDIH 1O7NB 2KRTA 2E2UA 4K61A 3MKIA 3OWYA 3K7CA 3I0YA 1OCVA 1N9JA 3LTAA 2P38A 3FZWA 3OWUA 2Q07A 1FGOA 4XDVA 5ELJA 3UL6A 1W00A 1IQYA 3SLUA 3BB9A 5CF2A 3FGYA 2HMKB 5DREA 4BTWA 3F40A 2CG1A 3SX1A 1RJOA 3EF8A 3PZWA 5I97A 3OX9A 4CCVA 3CCQ3 2OQEC 1OPYA 3H3HA 3Q1CA 3CXC2 1ISKA 1V74A 2CIUA 2W9QA 1IU7A 2GXFA 3F8XA 3V99A 2CKFB 2RGQA 2K0MA 3VSYA 1LXEA 4J8TA 3UJMA 4RNYA 2B24B 4X2HA 1ROVA 3PGBA 5IG5A 3LH4A 2XFTA 2CH9A 4MMXB 2P0MA 3IJEB 1K28A 3UNLA 3CME3 2GBWB 3LZAA 4HKVB 4RNZA 4XDWA 3FLJA 2YX9A 1NJI4 2A15A 1N8QA 2ML6A 4GB5A 5CLKA 1KQS2 3KIIA 1M1K4 1YHQ3 3V92A 1JRQA 1RN7A 2GEYA 3X3ZA 1OHSA 5ELUA 3MSOA 1N5HA 3T0UA 3PXMA 3EHCA 1IVXA 3CCU3 4L8OA 3I563 3F9SA 4L8PA 2KXGA 4EV2A 3MWZA 3B4OA 4FMBA 5AIIA 2W03A 4AEQA 1E97A 1KC84 3JVCA 4WHAA 3K9MC 5AIGA 5D81A 3STDA 3ECFA 5IF6A 4EC6A 3IPTA 1WTHA 7STDA 3M8CA 1K8A4 3GAXA 3FH1A 4XM4A 1A67A 2GBXB 1JB4A 2HMLB 3X40A 2BMQB 3N8BA 4HM7B 5FGOA 1SIIA 3ALAA 3K63A 5G2GA 2F99A 1D6UA 3DGOA 2WGQA 1YJN3 1RRHA 4HM3B 2W04A 2YFJB 1JN5A 2CWUA 4IT7A 2XSHB 2GU3A 5KP3A 3U97A 4KFFA 3X3YA 2CFKA 4LGQA 3WA2X 3FG3A 4R4KA 1AVKA 3T8NA 2M7OA 1O7WB 3E99A 2R4IA 3BLZA 2XSOB 1GY7A 1LOXA 1YIJ3 3F7SA 3HIGA 3KSED 4N6UA 1A2VA 3CCR3 2CW9A 2KCDA 1HKXA 1W6CA 4QWTA 3T8UA 1S5AA 1HU9A 1WMPA 2PNCA 5AIFA 1STDA 4HM6B 3NQYA 1OACA 3EBTA 3KE7A 4HYZA 3CNXA 1UUVB 3NV0B 3I553 5AEUB 2WO0A 2CHCA 3NUVA 1FUWA 1TFOA 3B8LA 3DGNA 5IG0A 4KFDA 1E3RA 5DRVA 4XBYA 3DY5A 1DMNA 3UL5A 3HX8A 1TIJA 1BUQA 3KFQC 5TGNA 1Q42A 2C11A 1SIHA 2CFDA 4O3VA 2BO9B 1W01A 3JUQA 1A2KA 3QK9A 3X3XA 1JB2A 1FGRA 3LTCA 4HM8B 3BNBA 1WMNA 3FF0A 2QEX3 3PCSA 4U13A 2ZDJA 1Q40A 3LTBA 3OWSA 4R9KA 3FSDA 2XGLA 4FMCA 1NB5I 4N3VA 4K90B 1W2ZA 1J2BA 1M9GA 1CQSA 2W56A 5EEOA 5EQLA 3CD63 1EQKA 4RBNA 1O7MB 2XH9A 2C10A 3K0ZA 4R80A 2B1XB 5AI1A 3AMOA 4JF8A 1KD14 4N6MA 3BNDA 3LXUX 1AR0A 2W56B 4JRFA 1FGQA 1E3VA 1QAFA 3GWRA 1JV2B 2LYXA 2Z7AA 3AMOB 3OXAA 2XR8B 4HM1B 1DVDA 2I9WA 5EVHA 3MHEA 2XGNA 2OOVA 5BVBA 1IK3A 1JB5A 1QALA 2P05A 2FXTA 4NREA 2HMMB 3F7XA 4EBGA 3G4S3 2YFLB 2W0QA 4K1UA 2MF7A 1GD4A 3RDEA 4MEIA 5CXOA 3EX9A 1UI8A 3EN8A 4ZM8A 5JBSA 4N6V0 1D6ZA 1QJGA 1C7HA 1OUNA 1PFPA 1FGMA 3LT8A 4G1MB 4RZMA 4N6LA 2IUJA 3GZYB 3D9RA 5JPPA 2Z76A 1NB3I 1TFKA 1LNHA 3NQZA 5AIHA 5IEPA 1FA3A 3L0RA 3S28A 1YVBI 3SXXA 1QVF2 4HZBB 5D82A 1D6YA 4FMAA 4LEHA 1G96A 3CC43 3NX0A 1K734 1A90A 3BNEA 5A0OB 3HZPA 3LT9A 5STDA 2OOVC 1OHPA 2IMJA 1OGXA 2P09A 1R4CA 3DGLA 3GZRA 4FR9A 1L5GB 1VQ73 1Q864 4FCJA 3BNCA 2WOHA 4XBTA 4O2HA 1Y4KA 2F98A 1AV4A 4STDA 1DVCA 1VZZA 4OK0A 5AYSC 1K41A 1ROAA 3G8ZA 1QMAA 4KVHA 1JN5B 1AVLA 3FF2A 1O7PB 3O8YA 4WP5A 2YFIB 4HVNA 3KSPA 3ER7A 1DMMA 3HIIA 3WOEB 4O8SA 1W6GA 1OF5A 1Q814 3RGAA 1IT8A 5KP4A 1CEWI 2XFSA 2CFGA 2GEXA 3F8HA 4FCZA 4MMYB 1OF5B 3U1WA 1GYBA 5AEWB 3CPOA 4Q53A 3CCM3 1JJ22 3DM8A 4AKYA 3VGNA 3HK4A 2RCDA 1LVNA 2RFRA 2XF3A 3B7CA 3DZLA 1VQ93 3G16A 3HI7A 2IA7A 3A76A 2D1WA 3S5CA 4EV5A 1GY5A 2V1LA 1VQ83 1ULJB 1QAKA 1IDPA 1W2B2 1EKMA 1JKGA 4LZIA 3EN1B 3JUOA 1EA2A 1UI7A 2O3OA 3ROBA 3DMCA 3MG1A 4WYKA 3X42A 4R1KA 2ZL8A 2W2CA 3CCV3 3CNMA 2CG0A 2PZVA 1VQK3 1YIT3 4ORLA 1FGTA 2XEPA 3CU3A 4WYKB 4HBRA 1VQP3 3D3LA 3S67A 4H3UA 1N8R4 1TU5A 5HGRA 1OH0A 1EG9B 2HMJB 2Y73A 4BTXA 3JUMA 2GU1A 3LMLA 4TX4A 2BMOB 1CYVA 2IUKA 4MJDA 4OUQA 4WFOA 4N6TA 6STDA 5IW9A 1OHOA 2HMOB 1RRLA 1VQM3 2BNGA 1US1A 3SOAA 1W6YA 2P0XA 3WDGB 2CWVA 1Q40B 1SPUA 5IENA 1NU3A 1SQWA 1WNHA 3EC9A 2LQVA 3EQQB 1K9M4 2CWTA 3Q2PA 3KKGA 3JUNA 3MG3A 3CCJ3 4WWUC 2INXA 5D83A 1TUHA 1W7CA 3VF1A 3GZXB 3WA3A 1UW1A 4HM5B 1VQO3 2OCTA 1SJWA 1ASKA 3IMAB 2O9UX 2WGOA 2W6JH 3N9HA 1IT7A 3PS8A 2WOFA 1IQ8A 3G713 3GRDA 4AKZA 1VQ63 2QGUA 3SEDA 1QVG2 1RKYA 4R9LA 3NBBA 1YJW3 2BMRB 3EE1A 3GZBA 2CC3A 3JUPA 5JPUA 3CCE3 3H51A 3CCS3 3FG4A 2QA43 4FMDA 3FCSB 4N6NB 3PYJA 5IERA 1YJ93 4KFEA 4XBXA 3OW22 2QIYA 4IPBA 4L7KA 4HM4B 3RGRA 1T5YA 2CFWA 3F14A 2E2TA 2HMNB 1ZO2A 3DGMA 4OVMA 4MMZB 1IV9A 5CF1A 2F86B 3KZTA 2Z77A 2JQ5A 3FKAA 2K54A 3S27A 4IIAA 1OGZA 3EJVA 5LC6A 3S29A 1GY6A 1Q7Y4 4NHFA 1W5ZA 4H61A 1YI23 1GD3A 5AYRB 1IVVA 3WOFB 4BTYA 3NXJA 4KZ1A 4PEJA 1MOLA 2BHMA 3NHXA 8CHOA 1S723 1KWIA 3LYGA 5CK6A 3NBRA 1Q824 1VQN3 3NBJA 2Z6BA 2UX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDO B;  4LMI A;  4CDL A;  4XB5 A;  1ULI B;  1Z1S A;  3G0K A;  4HM0 B;  2XRX B;  4HM2 B;  4FCM A;  4HZ9 B;  1U5O A;  3OV4 A;  3WMD A;  5BXQ A;  5FW5 A;  3MG2 A;  2STD A;  1DMQ A;  1O7H B;  1GS3 A;  3EBY A;  4J9A A;  5KP1 A;  1TP6 A;  3SOY A;  5IEO A;  1UUW B;  1WQL B;  3DUK A;  1NWW A;  4I4K A;  3NV0 A;  5IG3 A;  1JKG B;  3Q90 A;  4HJL B;  3NM2 A;  4K1V A;  1ZX2 A;  1W02 A;  3MYT A;  5IG4 A;  4X2O A;  1O7G B;  3DXO A;  2OWP A;  3B4P A;  1O7N B;  3MKI A;  3OWY A;  3K7C A;  3I0Y A;  1OCV A;  3FZW A;  3OWU A;  4XDV A;  1W00 A;  3BB9 A;  5CF2 A;  3FGY A;  2HMK B;  5DRE A;  3F40 A;  3EF8 A;  3OX9 A;  1OPY A;  3H3H A;  1ISK A;  2GXF A;  3F8X A;  2CKF B;  2RGQ A;  3VSY A;  4J8T A;  3UJM A;  2B24 B;  4X2H A;  5IG5 A;  3UNL A;  2GBW B;  3LZA A;  4HKV B;  4XDW A;  3FLJ A;  2A15 A;  4GB5 A;  5CLK A;  2GEY A;  1OHS A;  3MSO A;  3EHC A;  4L8O A;  3F9S A;  4L8P A;  3B4O A;  5AII A;  1E97 A;  5AIG A;  5D81 A;  3STD A;  3ECF A;  5IF6 A;  3IPT A;  7STD A;  3M8C A;  3FH1 A;  4XM4 A;  2GBX B;  1JB4 A;  2HML B;  2BMQ B;  4HM7 B;  5G2G A;  2F99 A;  4HM3 B;  2YFJ B;  1JN5 A;  2XSH B;  5KP3 A;  4LGQ A;  3T8N A;  1O7W B;  3E99 A;  2R4I A;  3BLZ A;  2XSO B;  1GY7 A;  3F7S A;  1HKX A;  3T8U A;  1S5A A;  5AIF A;  1STD A;  4HM6 B;  3EBT A;  3KE7 A;  3CNX A;  1UUV B;  3NV0 B;  5AEU B;  2CHC A;  3NUV A;  3B8L A;  5IG0 A;  5DRV A;  1E3R A;  4XBY A;  1DMN A;  3HX8 A;  1BUQ A;  5TGN A;  1Q42 A;  1W01 A;  3JUQ A;  1A2K A;  1JB2 A;  4HM8 B;  3FF0 A;  4U13 A;  1Q40 A;  3OWS A;  4R9K A;  3FSD A;  4N3V A;  1CQS A;  1O7M B;  3K0Z A;  2B1X B;  5AI1 A;  1AR0 A;  1E3V A;  3GWR A;  2Z7A A;  3OXA A;  2XR8 B;  4HM1 B;  2I9W A;  5EVH A;  3MHE A;  5BVB A;  1JB5 A;  2HMM B;  3F7X A;  2YFL B;  4K1U A;  5CXO A;  3EX9 A;  3EN8 A;  1QJG A;  1C7H A;  1OUN A;  4RZM A;  3GZY B;  3D9R A;  5JPP A;  2Z76 A;  5AIH A;  5IEP A;  4HZB B;  5D82 A;  4LEH A;  3HZP A;  5STD A;  1OHP A;  2IMJ A;  1OGX A;  3GZR A;  4FCJ A;  4XBT A;  2F98 A;  4STD A;  1VZZ A;  1K41 A;  3G8Z A;  1QMA A;  4KVH A;  1JN5 B;  3FF2 A;  1O7P B;  4WP5 A;  2YFI B;  4HVN A;  3KSP A;  3ER7 A;  1DMM A;  1OF5 A;  3RGA A;  5KP4 A;  2GEX A;  3F8H A;  1OF5 B;  1GYB A;  5AEW B;  3CPO A;  4Q53 A;  3DM8 A;  3VGN A;  3HK4 A;  2RCD A;  2RFR A;  3DZL A;  3B7C A;  3G16 A;  3A76 A;  3S5C A;  1GY5 A;  1ULJ B;  1IDP A;  1JKG A;  3EN1 B;  3JUO A;  1EA2 A;  3ROB A;  3DMC A;  3MG1 A;  4WYK A;  4R1K A;  2W2C A;  3CNM A;  2PZV A;  4ORL A;  3CU3 A;  4WYK B;  4H3U A;  5HGR A;  1OH0 A;  1EG9 B;  2HMJ B;  3JUM A;  2BMO B;  4MJD A;  4OUQ A;  6STD A;  1OHO A;  2HMO B;  2BNG A;  3SOA A;  1W6Y A;  1Q40 B;  5IEN A;  1NU3 A;  3EC9 A;  3EQQ B;  3KKG A;  3JUN A;  3MG3 A;  4WWU C;  2INX A;  5D83 A;  1TUH A;  3GZX B;  4HM5 B;  1SJW A;  1ASK A;  3GRD A;  2QGU A;  3SED A;  4R9L A;  2BMR B;  3GZB A;  3JUP A;  5JPU A;  3H51 A;  5IER A;  4XBX A;  2QIY A;  4L7K A;  4HM4 B;  3RGR A;  3F14 A;  2HMN B;  1ZO2 A;  4OVM A;  5CF1 A;  2F86 B;  3KZT A;  2Z77 A;  2JQ5 A;  3FKA A;  2K54 A;  4IIA A;  1OGZ A;  3EJV A;  1GY6 A;  3NXJ A;  4PEJ A;  3NHX A;  8CHO A;  3LYG A;  5CK6 A;  3NBR A;  2UX0 A; 
#chains in the Genus database with same CATH topology
 1LQG C;  1NDO B;  4LMI A;  2SAR A;  4CDL A;  4GL6 A;  4NPB A;  4XB5 A;  5RNT A;  2W9P A;  1ULI B;  1Z1S A;  2H0I A;  3G0K A;  2XRX B;  4HM0 B;  3CC2 3;  3FG1 A;  2R41 A;  3K5T A;  4I5Q A;  4HM2 B;  2Y74 A;  2BT3 A;  4HAA A;  1N9E A;  1N5P A;  1A2P A;  1M1X B;  1X1W A;  3EB8 A;  4FCM A;  4HZ9 B;  1STF I;  1U5O A;  1R4Y A;  3KN4 A;  3OV4 A;  3WMD A;  2D42 A;  2RSX A;  5FW5 A;  5BXQ A;  2IY2 A;  1W4N A;  3QRD A;  3MG2 A;  1NO3 A;  1MWT A;  4HOH A;  3TDG A;  1M90 4;  1DE3 A;  3BU4 A;  1BGS A;  3CCL 3;  3UB1 A;  3LTD A;  2STD A;  1MGR A;  2FGT A;  1JBS A;  1DYU A;  2CFL A;  1VQ5 3;  1BSD A;  1DMQ A;  3CMA 3;  1O7H B;  3WOD G;  1UGH I;  1GS3 A;  2L4V A;  1IQX A;  3WR2 A;  3KCH A;  3J7Y d;  3EBY A;  4J9A A;  1JBT A;  4O02 B;  1Q9E A;  1F8N A;  3MPH A;  5KP1 A;  1TP6 A;  1BRH A;  3CC7 3;  3SOY A;  5IEO A;  2OTJ 3;  5G1L A;  2MC8 A;  5LC7 A;  3X41 A;  1FZU A;  1I2G A;  1UUW B;  1WQL B;  1NNV A;  2FNQ A;  4EXR A;  3G6E 3;  3DUK A;  1X1Y A;  3LOY A;  3CPW 2;  1NWW A;  4I4K A;  1BAO A;  1RTU A;  5M18 A;  1CYU A;  3NV0 A;  1WMO A;  4N6O B;  1YGE A;  2OTL 3;  3PCR A;  5IG3 A;  1B2S A;  1MNL A;  1KSI A;  3AGO A;  1JKG B;  3Q90 A;  4LSO A;  4CPK A;  1IVW A;  2ML5 A;  1U8C B;  3NM2 A;  4HJL B;  2H0G A;  2SBL A;  3V98 A;  4EYC A;  1G0T A;  1GMQ A;  1VQQ A;  4K1V A;  1IV7 A;  2OQE A;  1VQ4 3;  1ZX2 A;  4KT3 B;  1UCK A;  1W02 A;  2CK3 H;  2E2V A;  3MYT A;  1PU4 A;  1JNQ A;  8RNT A;  5IG4 A;  4X2O A;  1O7G B;  3DXO A;  2OWP A;  3B4P A;  3SVA A;  1VQL 3;  3NM7 A;  1IVU A;  3N54 B;  1GSP A;  2JDI H;  1O7N B;  2KRT A;  1BSC A;  1I3F A;  2E2U A;  4K61 A;  3MKI A;  3OWY A;  3K7C A;  1BNJ A;  1GOY A;  3I0Y A;  1OCV A;  1N9J A;  3LTA A;  2P38 A;  1RLS A;  3FZW A;  3OWU A;  2Q07 A;  1FGO A;  4XDV A;  5ELJ A;  3UL6 A;  1W00 A;  1IQY A;  3SLU A;  3BB9 A;  5CF2 A;  3FGY A;  4BL2 A;  2HMK B;  5DRE A;  4BTW A;  3F40 A;  2CG1 A;  3SX1 A;  1RJO A;  1GMP A;  2UGI A;  3EF8 A;  1B27 A;  3PZW A;  5I97 A;  3OX9 A;  4CCV A;  3CCQ 3;  2OQE C;  1OPY A;  3H3H A;  3Q1C A;  3CXC 2;  1YI2 3;  1ISK A;  1C54 A;  1V74 A;  2CIU A;  2W9Q A;  1IU7 A;  2GXF A;  3F8X A;  3V99 A;  2CKF B;  2RGQ A;  2K0M A;  3VSY A;  1LXE A;  1FYS A;  4J8T A;  3UJM A;  4RNY A;  1X1U A;  2B24 B;  1HYF A;  1ROV A;  3PGB A;  4X2H A;  5IG5 A;  3LH4 A;  2XFT A;  2CH9 A;  4BL3 A;  4MMX B;  2P0M A;  3IJE B;  1K28 A;  3UNL A;  3CME 3;  2GBW B;  3LZA A;  4HKV B;  4RNZ A;  4XDW A;  3FLJ A;  2YX9 A;  1NJI 4;  2A15 A;  1N8Q A;  2ML6 A;  4GB5 A;  1UCL A;  5CLK A;  3KII A;  1M1K 4;  1YHQ 3;  1KQS 2;  1RGH A;  1JRQ A;  1RN7 A;  3V92 A;  2GEY A;  1BRG A;  3X3Z A;  1OHS A;  3A5E A;  3Q3F A;  5ELU A;  5BIR A;  1JBR A;  3MSO A;  1N5H A;  3T0U A;  3PXM A;  2RNT A;  3EHC A;  1IVX A;  3CCU 3;  4L8O A;  2L1S A;  3I56 3;  3F9S A;  3BIR A;  4L8P A;  2KXG A;  4EV2 A;  3MWZ A;  3B4O A;  4FMB A;  5AII A;  2W03 A;  2KF3 A;  4AEQ A;  1E97 A;  1I0X A;  1BVI A;  3JVC A;  4WHA A;  3K9M C;  5AIG A;  5D81 A;  1KC8 4;  3STD A;  1BNI A;  3ECF A;  4EC6 A;  5IF6 A;  3IPT A;  1WTH A;  2GSP A;  7STD A;  1BUJ A;  3AGN A;  3M8C A;  1K8A 4;  3GAX A;  3FH1 A;  4XM4 A;  1A67 A;  1B21 A;  2GBX B;  1TRP A;  2HOH A;  3DH2 A;  1JB4 A;  1ZS7 A;  2HML B;  3X40 A;  2BMQ B;  3N8B A;  3D5I A;  4HM7 B;  5FGO A;  1SII A;  3ALA A;  3K63 A;  1ZGX A;  5G2G A;  2F99 A;  1D6U A;  3DGO A;  2WGQ A;  1YJN 3;  1RRH A;  4HM3 B;  2W04 A;  2YFJ B;  1JN5 A;  1RGA A;  2CWU A;  6RNT A;  4IT7 A;  1BRN L;  2XSH B;  2GU3 A;  5KP3 A;  3U97 A;  1I0V A;  4KFF A;  3X3Y A;  3ZG0 A;  2UUG C;  5G1K A;  2CFK A;  4BIR A;  4LGQ A;  3WA2 X;  3FG3 A;  3ZFZ A;  1RSN A;  4R4K A;  1AVK A;  1RGE A;  3T8N A;  2M7O A;  1O7W B;  1BSE A;  3D5G A;  3E99 A;  2R4I A;  3BLZ A;  2XSO B;  1GY7 A;  1LOX A;  1YIJ 3;  3F7S A;  1TTO A;  3HIG A;  2CX1 A;  3KSE D;  4N6U A;  1A2V A;  3CCR 3;  2CW9 A;  2KCD A;  1HKX A;  1W6C A;  4QWT A;  3T8U A;  1S5A A;  4EW5 A;  1HU9 A;  1WMP A;  1I70 A;  2PNC A;  1FUS A;  5AIF A;  1STD A;  4HM6 B;  1I3I A;  2F56 A;  3NQY A;  3D79 A;  1OAC A;  3EBT A;  1UGI A;  3KE7 A;  4HYZ A;  1G02 A;  1V58 A;  2H0H A;  3CNX A;  1FUT A;  1UUV B;  3NV0 B;  3I55 3;  5AEU B;  2WO0 A;  2CHC A;  3NUV A;  1FUW A;  1BU4 A;  1YVS A;  1TFO A;  3B8L A;  3DGN A;  3ZG5 A;  1I8V A;  5IG0 A;  4KFD A;  1E3R A;  5DRV A;  4XBY A;  1BRK A;  3DY5 A;  3GSP A;  1DMN A;  3UL5 A;  3HX8 A;  1MWR A;  1TIJ A;  1BUQ A;  3KFQ C;  1FW7 A;  5TGN A;  1Q42 A;  2C11 A;  1UCI A;  2KF4 A;  2ZHX B;  1SIH A;  2CFD A;  4O3V A;  2BO9 B;  1W01 A;  3AHW A;  1T2H A;  3JUQ A;  1A2K A;  3QK9 A;  3X3X A;  1SAR A;  1JB2 A;  1FGR A;  5M1A A;  1BNG A;  5GSP A;  3LTC A;  4HM8 B;  1EUI C;  3BNB A;  1WMN A;  3FF0 A;  2QEX 3;  3PCS A;  4U13 A;  2ZDJ A;  1Q40 A;  3LTB A;  3OWS A;  4R9K A;  1B2X A;  4J5G A;  3FSD A;  2XGL A;  4FMC A;  1BRI A;  1NB5 I;  4N3V A;  1RGC A;  4K90 B;  1W2Z A;  1J2B A;  1M9G A;  1CQS A;  2W56 A;  3D4A A;  5EQL A;  5EEO A;  2C4B A;  3CD6 3;  1YNV X;  1EQK A;  4RBN A;  1I2F A;  1O7M B;  2XH9 A;  2C10 A;  3K0Z A;  4R80 A;  1BOX A;  2B1X B;  5AI1 A;  3AMO A;  4JF8 A;  1KD1 4;  4N6M A;  1B2U A;  1CH0 A;  3BND A;  3LXU X;  1AR0 A;  2W56 B;  4JRF A;  3RNT A;  1FGQ A;  1E3V A;  1QAF A;  3GWR A;  1JV2 B;  2LYX A;  2Z7A A;  3AMO B;  3OXA A;  1T3B A;  2KF5 A;  2J8X B;  1UDI I;  2XR8 B;  4HM1 B;  1EEJ A;  1DVD A;  2I9W A;  5EVH A;  3MHE A;  2XGN A;  2OOV A;  5BVB A;  1IK3 A;  1JB5 A;  1QAL A;  2P05 A;  1TRQ A;  2FXT A;  4NRE A;  2HMM B;  3F7X A;  4EBG A;  3G4S 3;  1MGW A;  2CX0 A;  2YFL B;  2W0Q A;  4K1U A;  2MF7 A;  1GOV A;  1GD4 A;  2KAA A;  3RDE A;  1T2I A;  4MEI A;  5CXO A;  3EX9 A;  1UI8 A;  3EN8 A;  3URP A;  4ZM8 A;  5JBS A;  4N6V 0;  1D6Z A;  1QJG A;  1C7H A;  1OUN A;  1PFP A;  1FGM A;  3LT8 A;  4G1M B;  4CJN A;  4RZM A;  1TJD A;  4N6L A;  2IUJ A;  3GZY B;  3D9R A;  5JPP A;  2Z76 A;  1NB3 I;  1TFK A;  1RCL A;  1LNH A;  3NQZ A;  5AIH A;  5IEP A;  1RMS A;  3L0R A;  1FA3 A;  3S28 A;  3HOH A;  1YVB I;  3SXX A;  1QVF 2;  4HZB B;  5D82 A;  5BU4 A;  1D6Y A;  4FMA A;  4LEH A;  1RGL A;  1G96 A;  3CC4 3;  3NX0 A;  1K73 4;  7RNT A;  1A90 A;  3BNE A;  5A0O B;  1LOV A;  1X1X A;  3HZP A;  3LT9 A;  1BRJ A;  5STD A;  2OOV C;  1OHP A;  3DGY A;  2IMJ A;  1OGX A;  2P09 A;  1R4C A;  1BNE A;  1I2E A;  1Q7H A;  2AAE A;  1LOW A;  1RGK A;  1BSA A;  3DGL A;  3GZR A;  4FR9 A;  1L5G B;  1VQ7 3;  1Q86 4;  4FCJ A;  3BNC A;  2WOH A;  4XBT A;  4O2H A;  1Y4K A;  2F98 A;  1AV4 A;  4STD A;  1DVC A;  1BNS A;  1VZZ A;  4OK0 A;  5AYS C;  1B2M A;  1K41 A;  1ROA A;  3G8Z A;  1QMA A;  4KVH A;  1AQZ A;  1UUG B;  1JN5 B;  1AVL A;  3FF2 A;  1O7P B;  3O8Y A;  4WP5 A;  1V57 A;  2YFI B;  4HVN A;  1PYL A;  1IYY A;  3KSP A;  2BU4 A;  1RCK A;  2K3D A;  1DMM A;  3ER7 A;  3HII A;  3WOE B;  4O8S A;  1W6G A;  1OF5 A;  1B20 A;  1Q81 4;  2BIR A;  3RGA A;  1IT8 A;  5KP4 A;  1CEW I;  2XFS A;  2CFG A;  2GEX A;  3F8H A;  4FCZ A;  4MMY B;  1OF5 B;  3U1W A;  1GYB A;  1PY3 A;  5AEW B;  3CPO A;  4Q53 A;  3CCM 3;  1JJ2 2;  3DM8 A;  4AKY A;  3SYU A;  3VGN A;  1JZD A;  1RDS A;  1RN1 A;  2RCD A;  1LVN A;  2RFR A;  2XF3 A;  3B7C A;  1MWS A;  1LQM B;  3DZL A;  3HK4 A;  1VQ9 3;  3G16 A;  3HI7 A;  4J5K A;  2IA7 A;  3A76 A;  2D1W A;  3S5C A;  4EV5 A;  1GY5 A;  2V1L A;  1VQ8 3;  1ULJ B;  1QAK A;  4BU4 A;  1IDP A;  1W2B 2;  1EKM A;  1JKG A;  4LZI A;  3EN1 B;  3JUO A;  1EA2 A;  1AY7 A;  1UI7 A;  2F5W A;  2O3O A;  3ROB A;  3DMC A;  7GSP A;  3MG1 A;  4WYK A;  1BAN A;  2RBI A;  3X42 A;  1RNB A;  4R1K A;  9RNT A;  1BNR A;  2ZL8 A;  2W2C A;  1B3S A;  3CCV 3;  1BIR A;  3CNM A;  2CG0 A;  2PZV A;  1VQK 3;  1YIT 3;  4ORL A;  1FGT A;  2XEP A;  3CU3 A;  4GSP A;  4HBR A;  4WYK B;  3D3L A;  1VQP 3;  3S67 A;  4H3U A;  1N8R 4;  1BRS A;  1TU5 A;  5HGR A;  1OH0 A;  1EG9 B;  2HMJ B;  2Y73 A;  4BTX A;  3JUM A;  2GU1 A;  3AHS A;  3LML A;  4TX4 A;  1GMR A;  3WHO A;  1YGW A;  2BMO B;  1CYV A;  1LRA A;  2IUK A;  4MJD A;  4OUQ A;  4WFO A;  4N6T A;  6STD A;  5IW9 A;  1OHO A;  2HMO B;  1RRL A;  1VQM 3;  2BNG A;  1US1 A;  3SOA A;  1W6Y A;  2P0X A;  3WDG B;  2CWV A;  1BNF A;  1Q40 B;  1SPU A;  5IEN A;  1NU3 A;  1SQW A;  4DKI A;  1WNH A;  1RN4 A;  3EC9 A;  2LQV A;  3EQQ B;  1K9M 4;  2CWT A;  3Q2P A;  3KKG A;  3JUN A;  2IYJ A;  3MG3 A;  4WWU C;  3CCJ 3;  2INX A;  5D83 A;  1TUH A;  1W7C A;  1LOY A;  3GZX B;  3VF1 A;  1UW1 A;  3WA3 A;  4HM5 B;  1VQO 3;  2OCT A;  1SJW A;  1ASK A;  3IMA B;  2O9U X;  1JZO A;  2WGO A;  2W6J H;  3N9H A;  1IT7 A;  3PS8 A;  2WOF A;  1IQ8 A;  3G71 3;  3GRD A;  2ZA4 A;  4AKZ A;  1VQ6 3;  2QGU A;  3SED A;  4ILF A;  1QVG 2;  1RKY A;  4RNT A;  4R9L A;  1RGF A;  4LYL B;  3NBB A;  1UCJ A;  2BMR B;  1YJW 3;  3EE1 A;  3GZB A;  2CC3 A;  3JUP A;  5JPU A;  3CCE 3;  2AAD A;  3H51 A;  3CCS 3;  3FG4 A;  1B2Z A;  2QA4 3;  4FMD A;  3FCS B;  4N6N B;  1BSB A;  3PYJ A;  5IER A;  1YJ9 3;  4KFE A;  4XBX A;  3OW2 2;  2QIY A;  4IPB A;  2F4Y A;  2KF6 A;  4L7K A;  4HM4 B;  3RGR A;  1T5Y A;  2CFW A;  3F14 A;  2E2T A;  2HMN B;  1ZO2 A;  3DGM A;  4GHO A;  4OVM A;  4MMZ B;  1IV9 A;  1RGG A;  5CF1 A;  2F86 B;  1LNI A;  2Z77 A;  2JQ5 A;  1MWU A;  3KZT A;  3FKA A;  2K54 A;  3S27 A;  6GSP A;  4IIA A;  1OGZ A;  5M19 A;  3EJV A;  1RNT A;  5LC6 A;  3S29 A;  1GY6 A;  1Q7Y 4;  4NHF A;  1W5Z A;  4H61 A;  1RHL A;  1GD3 A;  5AYR B;  1IVV A;  3WOF B;  4BTY A;  1DET A;  3NXJ A;  1GOU A;  4KZ1 A;  5HOH A;  4PEJ A;  1HZ1 A;  1MOL A;  2BHM A;  3NHX A;  8CHO A;  1S72 3;  1KWI A;  3LYG A;  5CK6 A;  3NBR A;  1Q82 4;  1VQN 3;  3NBJ A;  2Z6B A;  2UX0 A;  2F5M A; 
#chains in the Genus database with same CATH homology
 1NDO B;  4LMI A;  4CDL A;  4GL6 A;  4XB5 A;  2W9P A;  1ULI B;  1Z1S A;  3G0K A;  4HM0 B;  2XRX B;  3CC2 3;  3FG1 A;  3K5T A;  4HM2 B;  2Y74 A;  2BT3 A;  1N9E A;  1N5P A;  1M1X B;  3EB8 A;  4FCM A;  4HZ9 B;  1STF I;  1U5O A;  3KN4 A;  3OV4 A;  3WMD A;  2D42 A;  2RSX A;  5FW5 A;  5BXQ A;  3QRD A;  1W4N A;  3MG2 A;  1NO3 A;  3TDG A;  1M90 4;  3CCL 3;  3UB1 A;  3LTD A;  2STD A;  2FGT A;  1DYU A;  2CFL A;  1VQ5 3;  1DMQ A;  3CMA 3;  1O7H B;  3WOD G;  1GS3 A;  2L4V A;  1IQX A;  3J7Y d;  3EBY A;  4J9A A;  4O02 B;  1F8N A;  3MPH A;  5KP1 A;  1TP6 A;  3CC7 3;  3SOY A;  5IEO A;  2OTJ 3;  2MC8 A;  5LC7 A;  3X41 A;  1UUW B;  1WQL B;  2FNQ A;  4EXR A;  3G6E 3;  3DUK A;  3LOY A;  3CPW 2;  1NWW A;  4I4K A;  1CYU A;  3NV0 A;  1WMO A;  4N6O B;  1YGE A;  2OTL 3;  3PCR A;  5IG3 A;  1MNL A;  1KSI A;  4LSO A;  1JKG B;  3Q90 A;  1IVW A;  2ML5 A;  1U8C B;  3NM2 A;  4HJL B;  2SBL A;  3V98 A;  4EYC A;  4K1V A;  1IV7 A;  2OQE A;  1VQ4 3;  1ZX2 A;  1W02 A;  2CK3 H;  2E2V A;  3MYT A;  1PU4 A;  1JNQ A;  5IG4 A;  4X2O A;  1O7G B;  3DXO A;  2OWP A;  3B4P A;  3SVA A;  1VQL 3;  3NM7 A;  1IVU A;  3N54 B;  2JDI H;  1O7N B;  2KRT A;  2E2U A;  4K61 A;  3MKI A;  3OWY A;  3K7C A;  3I0Y A;  1OCV A;  1N9J A;  3LTA A;  2P38 A;  3FZW A;  3OWU A;  2Q07 A;  1FGO A;  4XDV A;  5ELJ A;  3UL6 A;  1W00 A;  1IQY A;  3SLU A;  3BB9 A;  5CF2 A;  3FGY A;  2HMK B;  5DRE A;  4BTW A;  3F40 A;  2CG1 A;  3SX1 A;  1RJO A;  3EF8 A;  3PZW A;  5I97 A;  3OX9 A;  4CCV A;  3CCQ 3;  2OQE C;  1OPY A;  3H3H A;  3Q1C A;  3CXC 2;  1ISK A;  1V74 A;  2CIU A;  2W9Q A;  1IU7 A;  2GXF A;  3F8X A;  3V99 A;  2CKF B;  2RGQ A;  2K0M A;  3VSY A;  1LXE A;  4J8T A;  3UJM A;  4RNY A;  2B24 B;  4X2H A;  1ROV A;  3PGB A;  5IG5 A;  3LH4 A;  2XFT A;  2CH9 A;  4MMX B;  2P0M A;  3IJE B;  1K28 A;  3UNL A;  3CME 3;  2GBW B;  3LZA A;  4HKV B;  4RNZ A;  4XDW A;  3FLJ A;  2YX9 A;  1NJI 4;  2A15 A;  1N8Q A;  2ML6 A;  4GB5 A;  5CLK A;  1KQS 2;  3KII A;  1M1K 4;  1YHQ 3;  3V92 A;  1JRQ A;  1RN7 A;  2GEY A;  3X3Z A;  1OHS A;  5ELU A;  3MSO A;  1N5H A;  3T0U A;  3PXM A;  3EHC A;  1IVX A;  3CCU 3;  4L8O A;  3I56 3;  3F9S A;  4L8P A;  2KXG A;  4EV2 A;  3MWZ A;  3B4O A;  4FMB A;  5AII A;  2W03 A;  4AEQ A;  1E97 A;  1KC8 4;  3JVC A;  4WHA A;  3K9M C;  5AIG A;  5D81 A;  3STD A;  3ECF A;  5IF6 A;  4EC6 A;  3IPT A;  1WTH A;  7STD A;  3M8C A;  1K8A 4;  3GAX A;  3FH1 A;  4XM4 A;  1A67 A;  2GBX B;  1JB4 A;  2HML B;  3X40 A;  2BMQ B;  3N8B A;  4HM7 B;  5FGO A;  1SII A;  3ALA A;  3K63 A;  5G2G A;  2F99 A;  1D6U A;  3DGO A;  2WGQ A;  1YJN 3;  1RRH A;  4HM3 B;  2W04 A;  2YFJ B;  1JN5 A;  2CWU A;  4IT7 A;  2XSH B;  2GU3 A;  5KP3 A;  3U97 A;  4KFF A;  3X3Y A;  2CFK A;  4LGQ A;  3WA2 X;  3FG3 A;  4R4K A;  1AVK A;  3T8N A;  2M7O A;  1O7W B;  3E99 A;  2R4I A;  3BLZ A;  2XSO B;  1GY7 A;  1LOX A;  1YIJ 3;  3F7S A;  3HIG A;  3KSE D;  4N6U A;  1A2V A;  3CCR 3;  2CW9 A;  2KCD A;  1HKX A;  1W6C A;  4QWT A;  3T8U A;  1S5A A;  1HU9 A;  1WMP A;  2PNC A;  5AIF A;  1STD A;  4HM6 B;  3NQY A;  1OAC A;  3EBT A;  3KE7 A;  4HYZ A;  3CNX A;  1UUV B;  3NV0 B;  3I55 3;  5AEU B;  2WO0 A;  2CHC A;  3NUV A;  1FUW A;  1TFO A;  3B8L A;  3DGN A;  5IG0 A;  4KFD A;  1E3R A;  5DRV A;  4XBY A;  3DY5 A;  1DMN A;  3UL5 A;  3HX8 A;  1TIJ A;  1BUQ A;  3KFQ C;  5TGN A;  1Q42 A;  2C11 A;  1SIH A;  2CFD A;  4O3V A;  2BO9 B;  1W01 A;  3JUQ A;  1A2K A;  3QK9 A;  3X3X A;  1JB2 A;  1FGR A;  3LTC A;  4HM8 B;  3BNB A;  1WMN A;  3FF0 A;  2QEX 3;  3PCS A;  4U13 A;  2ZDJ A;  1Q40 A;  3LTB A;  3OWS A;  4R9K A;  3FSD A;  2XGL A;  4FMC A;  1NB5 I;  4N3V A;  4K90 B;  1W2Z A;  1J2B A;  1M9G A;  1CQS A;  2W56 A;  5EEO A;  5EQL A;  3CD6 3;  1EQK A;  4RBN A;  1O7M B;  2XH9 A;  2C10 A;  3K0Z A;  4R80 A;  2B1X B;  5AI1 A;  3AMO A;  4JF8 A;  1KD1 4;  4N6M A;  3BND A;  3LXU X;  1AR0 A;  2W56 B;  4JRF A;  1FGQ A;  1E3V A;  1QAF A;  3GWR A;  1JV2 B;  2LYX A;  2Z7A A;  3AMO B;  3OXA A;  2XR8 B;  4HM1 B;  1DVD A;  2I9W A;  5EVH A;  3MHE A;  2XGN A;  2OOV A;  5BVB A;  1IK3 A;  1JB5 A;  1QAL A;  2P05 A;  2FXT A;  4NRE A;  2HMM B;  3F7X A;  4EBG A;  3G4S 3;  2YFL B;  2W0Q A;  4K1U A;  2MF7 A;  1GD4 A;  3RDE A;  4MEI A;  5CXO A;  3EX9 A;  1UI8 A;  3EN8 A;  4ZM8 A;  5JBS A;  4N6V 0;  1D6Z A;  1QJG A;  1C7H A;  1OUN A;  1PFP A;  1FGM A;  3LT8 A;  4G1M B;  4RZM A;  4N6L A;  2IUJ A;  3GZY B;  3D9R A;  5JPP A;  2Z76 A;  1NB3 I;  1TFK A;  1LNH A;  3NQZ A;  5AIH A;  5IEP A;  1FA3 A;  3L0R A;  3S28 A;  1YVB I;  3SXX A;  1QVF 2;  4HZB B;  5D82 A;  1D6Y A;  4FMA A;  4LEH A;  1G96 A;  3CC4 3;  3NX0 A;  1K73 4;  1A90 A;  3BNE A;  5A0O B;  3HZP A;  3LT9 A;  5STD A;  2OOV C;  1OHP A;  2IMJ A;  1OGX A;  2P09 A;  1R4C A;  3DGL A;  3GZR A;  4FR9 A;  1L5G B;  1VQ7 3;  1Q86 4;  4FCJ A;  3BNC A;  2WOH A;  4XBT A;  4O2H A;  1Y4K A;  2F98 A;  1AV4 A;  4STD A;  1DVC A;  1VZZ A;  4OK0 A;  5AYS C;  1K41 A;  1ROA A;  3G8Z A;  1QMA A;  4KVH A;  1JN5 B;  1AVL A;  3FF2 A;  1O7P B;  3O8Y A;  4WP5 A;  2YFI B;  4HVN A;  3KSP A;  3ER7 A;  1DMM A;  3HII A;  3WOE B;  4O8S A;  1W6G A;  1OF5 A;  1Q81 4;  3RGA A;  1IT8 A;  5KP4 A;  1CEW I;  2XFS A;  2CFG A;  2GEX A;  3F8H A;  4FCZ A;  4MMY B;  1OF5 B;  3U1W A;  1GYB A;  5AEW B;  3CPO A;  4Q53 A;  3CCM 3;  1JJ2 2;  3DM8 A;  4AKY A;  3VGN A;  3HK4 A;  2RCD A;  1LVN A;  2RFR A;  2XF3 A;  3B7C A;  3DZL A;  1VQ9 3;  3G16 A;  3HI7 A;  2IA7 A;  3A76 A;  2D1W A;  3S5C A;  4EV5 A;  1GY5 A;  2V1L A;  1VQ8 3;  1ULJ B;  1QAK A;  1IDP A;  1W2B 2;  1EKM A;  1JKG A;  4LZI A;  3EN1 B;  3JUO A;  1EA2 A;  1UI7 A;  2O3O A;  3ROB A;  3DMC A;  3MG1 A;  4WYK A;  3X42 A;  4R1K A;  2ZL8 A;  2W2C A;  3CCV 3;  3CNM A;  2CG0 A;  2PZV A;  1VQK 3;  1YIT 3;  4ORL A;  1FGT A;  2XEP A;  3CU3 A;  4WYK B;  4HBR A;  1VQP 3;  3D3L A;  3S67 A;  4H3U A;  1N8R 4;  1TU5 A;  5HGR A;  1OH0 A;  1EG9 B;  2HMJ B;  2Y73 A;  4BTX A;  3JUM A;  2GU1 A;  3LML A;  4TX4 A;  2BMO B;  1CYV A;  2IUK A;  4MJD A;  4OUQ A;  4WFO A;  4N6T A;  6STD A;  5IW9 A;  1OHO A;  2HMO B;  1RRL A;  1VQM 3;  2BNG A;  1US1 A;  3SOA A;  1W6Y A;  2P0X A;  3WDG B;  2CWV A;  1Q40 B;  1SPU A;  5IEN A;  1NU3 A;  1SQW A;  1WNH A;  3EC9 A;  2LQV A;  3EQQ B;  1K9M 4;  2CWT A;  3Q2P A;  3KKG A;  3JUN A;  3MG3 A;  3CCJ 3;  4WWU C;  2INX A;  5D83 A;  1TUH A;  1W7C A;  3VF1 A;  3GZX B;  3WA3 A;  1UW1 A;  4HM5 B;  1VQO 3;  2OCT A;  1SJW A;  1ASK A;  3IMA B;  2O9U X;  2WGO A;  2W6J H;  3N9H A;  1IT7 A;  3PS8 A;  2WOF A;  1IQ8 A;  3G71 3;  3GRD A;  4AKZ A;  1VQ6 3;  2QGU A;  3SED A;  1QVG 2;  1RKY A;  4R9L A;  3NBB A;  1YJW 3;  2BMR B;  3EE1 A;  3GZB A;  2CC3 A;  3JUP A;  5JPU A;  3CCE 3;  3H51 A;  3CCS 3;  3FG4 A;  2QA4 3;  4FMD A;  3FCS B;  4N6N B;  3PYJ A;  5IER A;  1YJ9 3;  4KFE A;  4XBX A;  3OW2 2;  2QIY A;  4IPB A;  4L7K A;  4HM4 B;  3RGR A;  1T5Y A;  2CFW A;  3F14 A;  2E2T A;  2HMN B;  1ZO2 A;  3DGM A;  4OVM A;  4MMZ B;  1IV9 A;  5CF1 A;  2F86 B;  3KZT A;  2Z77 A;  2JQ5 A;  3FKA A;  2K54 A;  3S27 A;  4IIA A;  1OGZ A;  3EJV A;  5LC6 A;  3S29 A;  1GY6 A;  1Q7Y 4;  4NHF A;  1W5Z A;  4H61 A;  1YI2 3;  1GD3 A;  5AYR B;  1IVV A;  3WOF B;  4BTY A;  3NXJ A;  4KZ1 A;  4PEJ A;  1MOL A;  2BHM A;  3NHX A;  8CHO A;  1S72 3;  1KWI A;  3LYG A;  5CK6 A;  3NBR A;  1Q82 4;  1VQN 3;  3NBJ A;  2Z6B A;  2UX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...