2PZVA

Crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound phenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Testing Electrostatic complementarity in Enzyme Catalysis: Hydrogen Bonding in the Ketosteroid Isomerase Oxyanion Hole
pubmed doi rcsb
source organism Pseudomonas putida
total genus 32
structure length 123
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2pzvA00
5D82A 3KE7A 4XBYA 3GZXB 1E3VA 4XBXA 5IENA 1S5AA 2YFJB 3JUNA 2YFLB 3K0ZA 1Q42A 1O7PB 5AIGA 3UJMA 4XDWA 1W6YA 3JUMA 1GS3A 3JUQA 1O7WB 2HMNB 3RGRA 4HM5B 4HM6B 4FCMA 2HMKB 4R1KA 3STDA 4H3UA 5BVBA 2F98A 3FF0A 4HM8B 2GEYA 3EJVA 2GBXB 3F40A 3F8HA 5CLKA 2RGQA 3MYTA 1QMAA 1U5OA 3E99A 3IPTA 1OHPA 3MKIA 5AIFA 2BMOB 4Q53A 3GWRA 3OWSA 3JUPA 2F99A 4J8TA 4CDLA 1TUHA 3H3HA 4K1VA 3DM8A 3F8XA 2PZVA 5IG0A 1DMNA 1CQSA 5IEPA 1W00A 3A76A 4N3VA 4PEJA 1OHSA 4GB5A 1K41A 3CPOA 3EN8A 3MG1A 1GY7A 4HKVB 3LYGA 3CNMA 3OV4A 4LEHA 3T8NA 5IF6A 3MG2A 1NDOB 6STDA 1C7HA 1OH0A 1OF5B 3HK4A 4WWUC 1O7MB 5CF1A 3CNXA 5AI1A 5BXQA 2W2CA 1ULJB 3B7CA 8CHOA 1OCVA 5D83A 3GRDA 4LMIA 4KVHA 3DXOA 3OXAA 3S5CA 5DRVA 3VSYA 3G8ZA 1OPYA 1JN5B 4MJDA 4HZ9B 3H51A 4L7KA 3F14A 1AR0A 2K54A 2YFIB 5CXOA 1O7NB 4FCJA 1OHOA 3ROBA 4XB5A 2F86B 1HKXA 5IERA 1ULIB 5HGRA 5AIIA 3NUVA 3F7XA 1OF5A 2A15A 5EVHA 5D81A 2UX0A 4L8PA 1ASKA 3FZWA 4XDVA 1OUNA 5DREA 4XM4A 3F9SA 2XR8B 2XSHB 5IG5A 3ER7A 1JKGB 3I0YA 3FLJA 4R9LA 3UNLA 3OWUA 4HZBB 1JN5A 3BB9A 2BMQB 1UUVB 3FGYA 4HJLB 1W01A 4XBTA 2GBWB 4HM1B 2RCDA 3EN1B 3FSDA 2Z7AA 1GY6A 3DUKA 3WMDA 5TGNA 3MHEA 3GZRA 3OX9A 2OWPA 5STDA 5IEOA 1ZX2A 3SOYA 3F7SA 3MSOA 1SJWA 2XRXB 4LGQA 1JKGA 3NBRA 1STDA 4X2OA 1O7GB 2BNGA 3DMCA 1Z1SA 3EQQB 5KP3A 4I4KA 4OVMA 2STDA 3KZTA 3NV0B 2GXFA 4HM0B 4WP5A 1BUQA 1TP6A 1JB4A 3G16A 4L8OA 3GZBA 1W02A 5KP1A 1JB2A 2CHCA 3FH1A 3NXJA 2HMLB 5G2GA 2I9WA 4OUQA 1ZO2A 7STDA 3K7CA 1E97A 1NWWA 3FKAA 5JPPA 1E3RA 1VZZA 3EX9A 3Q90A 4IIAA 3SEDA 2HMOB 3RGAA 4HM3B 5CF2A 5IG3A 3NV0A 1Q40B 3EBYA 1OGXA 1EA2A 1DMMA 3T8UA 3LZAA 5IG4A 1QJGA 4HVNA 2R4IA 3D9RA 3JUOA 3ECFA 2B24B 5CK6A 3EC9A 4HM7B 1O7HB 2B1XB 2IMJA 3NHXA 2QGUA 3OWYA 4X2HA 4WYKB 1A2KA 2Z76A 2QIYA 3B8LA 1OGZA 3SOAA 3CU3A 5AEWB 3EF8A 3MG3A 3DZLA 2XSOB 4K1UA 1WQLB 3BLZA 1ISKA 3B4OA 4STDA 5AEUB 2JQ5A 1Q40A 1NU3A 4HM4B 2HMMB 1EG9B 2HMJB 3G0KA 3EHCA 4HM2B 2BMRB 5FW5A 5AIHA 3EBTA 2GEXA 5JPUA 1GY5A 3FF2A 1UUWB 1JB5A 4RZMA 4ORLA 3HX8A 5KP4A 2INXA 2RFRA 4WYKA 3GZYB 4R9KA 3M8CA 3NM2A 3B4PA 3VGNA 4J9AA 2Z77A 3KKGA 2CKFB 1DMQA 1GYBA 3HZPA 1IDPA 3KSPA 4U13A
chains in the Genus database with same CATH superfamily
1MOLA 1IQXA 1BIRA 1QAFA 2Y74A 1IVXA 3ALAA 3S28A 5D82A 3NQZA 3KE7A 4XBYA 1BANA 2RBIA 1LNIA 2V1LA 2GU1A 1DETA 1LOXA 1UDII 1BSAA 4R80A 3GZXB 1E3VA 4MMYB 1GD3A 1M9GA 2KCDA 3OW22 1RNTA 2QEX3 4XBXA 1RCKA 2FXTA 3U97A 2O9UX 3MWZA 1LQMB 4KFEA 1VQQA 5IENA 1RGGA 4EW5A 5A0OB 1EQKA 1LVNA 1I3IA 1IYYA 2W03A 2R41A 2W6JH 2XH9A 5AYRB 1YVBI 3RNTA 1VQ93 1S5AA 5FGOA 3PCSA 1JJ22 2YFJB 1AY7A 2SARA 1BSDA 1TRPA 2CWTA 3LTDA 2M7OA 3JUNA 1RCLA 2YFLB 2F5MA 3K0ZA 3SLUA 2F4YA 4QWTA 3DY5A 1CEWI 3NX0A 1Q42A 4O2HA 4FMCA 4K61A 1TFOA 1FGMA 1O7PB 1MGRA 1T3BA 5AIGA 1Q814 3UJMA 3AGNA 4XDWA 5JBSA 1Q7HA 1UCKA 2E2VA 1FUSA 1ROAA 1W6YA 1Q864 3D4AA 2BO9B 2F56A 5LC6A 2ZL8A 1JBRA 3JUMA 1GS3A 3JUQA 5G1KA 1VQK3 3AHWA 2CFWA 1D6YA 1O7WB 1TIJA 2C10A 2HMNB 3AHSA 3KIIA 3RGRA 4HM5B 4HM6B 4FCMA 2HMKB 4R1KA 3STDA 1FZUA 1QALA 4N6MA 1AV4A 1EUIC 4H3UA 5BVBA 2F98A 4KFFA 4RNYA 1BNGA 1RN7A 4BL2A 3CC43 3FF0A 4IT7A 4HM8B 1WMOA 1FUTA 1YVSA 2GEYA 3EJVA 1KC84 2GBXB 3F40A 2J8XB 1YHQ3 1GOVA 4NPBA 3F8HA 3D5GA 5CLKA 2RGQA 4EC6A 1BRNL 3MYTA 1QMAA 1UUGB 3KFQC 1FGQA 3EB8A 3CCS3 3FCSB 2GSPA 3ZFZA 1I8VA 4LYLB 1BRSA 1SPUA 1VQ63 1U5OA 6RNTA 3E99A 4CDLA 4I5QA 3IPTA 1EKMA 1OHPA 3MKIA 5AIFA 4TX4A 2BMOB 4Q53A 1Q9EA 3UL5A 3GWRA 1BSBA 1WMNA 3OWSA 1BSCA 1BNEA 1BVIA 2OTL3 4KZ1A 3TDGA 3G4S3 1JNQA 1V57A 3CCV3 5HOHA 4BIRA 3JUPA 4K90B 2D42A 2F99A 4J8TA 1DYUA 1IT8A 3N9HA 1TUHA 2RSXA 2UUGC 3H3HA 4K1VA 1IQ8A 3CCE3 2P38A 3BU4A 3DM8A 1B2UA 1M1XB 1W2ZA 4FR9A 1YGEA 1I0VA 2PZVA 3F8XA 5IG0A 3GSPA 1DMNA 3UB1A 1UCJA 1CQSA 1VQ43 1QVF2 1TRQA 3N54B 1GD4A 2ZDJA 5IEPA 1W00A 4JRFA 3A76A 2CG0A 1MNLA 1X1WA 1Q7Y4 3DGMA 4AKYA 3BIRA 3DGNA 3V99A 1IVVA 4N3VA 4PEJA 1OHSA 2W0QA 3FG3A 4GB5A 1BAOA 2OQEA 1K41A 2AADA 3CPOA 3EN8A 4LZIA 1RRHA 3WOFB 4FMAA 3X3XA 1RSNA 2IUKA 3MG1A 1GY7A 4HKVB 3LYGA 3CNMA 3OV4A 4LEHA 4BTWA 3T8NA 2KF4A 5IF6A 2CWUA 3MG2A 3QRDA 1NDOB 3K9MC 1RN4A 3NM7A 3V98A 1I2GA 6STDA 1N8QA 1C7HA 1BNRA 3WODG 4LSOA 1OH0A 1K9M4 1OF5B 1DVCA 1V58A 1BNJA 2OQEC 3HK4A 2WO0A 4WWUC 1LNHA 3HIIA 1O7MB 2CK3H 5CF1A 4FMDA 3CNXA 1I70A 5AI1A 5BXQA 1Q824 2W2CA 1ULJB 3B7CA 4RBNA 1PFPA 2KAAA 1BGSA 4NHFA 1HYFA 8CHOA 1OCVA 1RNBA 1R4YA 1B2ZA 1MWUA 5D83A 1GMPA 1RRLA 3GRDA 4LMIA 1TJDA 1NB3I 4KVHA 2P0XA 3DXOA 3GAXA 3OXAA 1JRQA 3FG1A 3S5CA 5DRVA 2BIRA 3VSYA 3CC73 1K28A 2RNTA 3G8ZA 5GSPA 1OPYA 1JN5B 4MJDA 1TTOA 4O8SA 1VQO3 1N5HA 2KRTA 1CYUA 1B20A 1RGAA 1UCIA 1SIIA 1STFI 4HZ9B 3H51A 4L7KA 1VQ53 1D6UA 3U1WA 1DE3A 1DVDA 1QAKA 4J5KA 1LOWA 3F14A 2CIUA 1N9EA 5ELJA 1AR0A 2K54A 5G1LA 3AGOA 4N6LA 2IA7A 3SX1A 2YFIB 2CFKA 5CXOA 3VF1A 1O7NB 1FGTA 3Q1CA 4FCJA 3CPW2 1OHOA 1RGCA 2WOHA 2CG1A 2FGTA 1JV2B 3ROBA 3SXXA 1VQL3 4R4KA 2CWVA 1IQYA 3S29A 1LXEA 4XB5A 2F86B 1HKXA 5IERA 1AVKA 1ULIB 5HGRA 5AIIA 2SBLA 3NUVA 3F7XA 5LC7A 2O3OA 5AYSC 1C54A 1OF5A 2K0MA 1YGWA 2A15A 1M904 5EVHA 5D81A 3G6E3 1MGWA 2UX0A 4L8PA 1ASKA 2HOHA 4FMBA 3FZWA 4XDVA 1OACA 1OUNA 5DREA 4XM4A 3F9SA 3HI7A 2XR8B 2XSHB 1LQGC 4OK0A 1IV7A 1W4NA 1CH0A 1I3FA 5IG5A 3ER7A 1GOYA 3T0UA 3J7Yd 1JKGB 3I0YA 3FLJA 4R9LA 1HZ1A 3D5IA 3EE1A 3BNBA 3UNLA 1YIJ3 4HAAA 3OWUA 4HZBB 1JN5A 1BRIA 3BB9A 2L4VA 2BMQB 3K63A 1UUVB 3KSED 3Q2PA 1BRGA 3FGYA 2F5WA 3LOYA 4MMXB 2ML6A 4HJLB 4CPKA 1W01A 4XBTA 2GBWB 3O8YA 8RNTA 1IVWA 4EV5A 4G1MB 1YJN3 1W5ZA 4AEQA 1IV9A 3LTCA 3I553 4HM1B 1TFKA 1BNSA 2RCDA 5BIRA 3EN1B 1B2MA 3FSDA 2Z7AA 1GY6A 3PZWA 1SIHA 3DUKA 4HOHA 3WMDA 1T2HA 5TGNA 1BRKA 2W04A 3HOHA 1BNFA 3MHEA 3S27A 2JDIH 3LH4A 2BHMA 3WA2X 1A90A 3X40A 3ZG5A 1A67A 1G0TA 3D79A 3GZRA 2WGQA 1JBSA 2P0MA 3PXMA 1TU5A 1EEJA 3CCU3 3OX9A 2OWPA 4GSPA 5IEOA 4MEIA 5STDA 1ZX2A 2CW9A 5EQLA 2L1SA 3RDEA 3SOYA 3F7SA 1YJW3 1HU9A 3MSOA 2YX9A 1SJWA 2KF6A 1RGLA 2XRXB 1JKGA 4LGQA 4FCZA 5M19A 1Y4KA 3NBRA 4GHOA 1CYVA 1STDA 4X2OA 3URPA 1O7GB 3PGBA 2BNGA 2D1WA 1UCLA 3DMCA 3BNDA 5ELUA 9RNTA 3CC23 1Z1SA 1MWTA 1X1YA 3BNCA 3EQQB 3X42A 5KP3A 3X3ZA 2CX1A 1BRHA 1SQWA 4DKIA 4I4KA 2C11A 4ILFA 4OVMA 2XFTA 2E2TA 3I563 1JZDA 2XEPA 2STDA 3KZTA 3JVCA 3NV0B 2GXFA 2KF5A 3LT8A 4HM0B 1MWRA 1BOXA 3PYJA 4WP5A 1BUQA 1TP6A 1AQZA 1NO3A 2CFDA 1JBTA 1JB4A 1G02A 3AMOB 3G16A 3G713 4J5GA 1B3SA 1RGKA 3GZBA 4L8OA 2OOVC 5M1AA 4RNZA 3A5EA 1W02A 5KP1A 1UW1A 1JB2A 1V74A 2ZHXB 2CHCA 1RJOA 1L5GB 2FNQA 1W7CA 3FH1A 3HIGA 3NXJA 3L0RA 7GSPA 1KD14 1W2B2 4BTXA 2WGOA 1VQM3 2KF3A 2HMLB 1RDSA 3N8BA 4EXRA 2Q07A 4KFDA 3V92A 4O02B 1MWSA 3CCQ3 2CC3A 1B27A 1A2VA 3FG4A 5G2GA 2MF7A 5M18A 2QA43 1VQ73 2I9WA 2KXGA 1JZOA 2LQVA 2PNCA 4OUQA 1I2FA 2C4BA 7RNTA 3LXUX 4BU4A 1ZO2A 3ZG0A 3CME3 3DGLA 1KQS2 1T2IA 2H0GA 7STDA 1VQ83 3K7CA 3CCJ3 1U8CB 1W6GA 3IJEB 4EYCA 1YI23 1FA3A 1VQP3 1G96A 2P09A 1BNIA 3NBBA 1E97A 1NWWA 1T5YA 3X3YA 3FKAA 5JPPA 1LOVA 1E3RA 1VZZA 3EX9A 3Q90A 3K5TA 1GMRA 4HBRA 4IIAA 3SEDA 2HMOB 3RGAA 1RHLA 4HM3B 5CF2A 4WHAA 5IG3A 1LRAA 2E2UA 3LTBA 2ZA4A 3NV0A 1Q40B 1B21A 5I97A 3NQYA 1RLSA 1YIT3 4MMZB 1F8NA 3EBYA 1BSEA 1OGXA 2BT3A 4O3VA 3CCM3 3AMOA 2W9PA 4KT3B 1IK3A 1B2XA 1EA2A 5EEOA 1DMMA 1R4CA 3DGOA 3T8UA 3LZAA 1RTUA 1N9JA 1RKYA 2CH9A 5IG4A 2ML5A 2BU4A 1QJGA 3KN4A 2IUJA 1SARA 1UI8A 3WDGB 4GL6A 3WA3A 4HVNA 2XGNA 2R4IA 2XGLA 3D9RA 1FUWA 1I0XA 3JUOA 1BUJA 2WOFA 1M1K4 1FGOA 2OCTA 3ECFA 2B24B 5CK6A 2UGIA 2XF3A 1PYLA 2H0IA 4RNTA 1N5PA 1FW7A 3EC9A 4HM7B 1O7HB 2B1XB 1YNVX 1GMQA 2IMJA 3WOEB 4HYZA 1NB5I 3NHXA 2QGUA 1S723 1K8A4 3OWYA 3LTAA 4X2HA 2MC8A 1UGIA 4WYKB 1RGHA 1A2KA 4N6V0 4CCVA 4IPBA 3PS8A 2Z76A 2QIYA 1IT7A 2W56B 3B8LA 1OGZA 1N8R4 5IW9A 3KCHA 3CCR3 1A2PA 3CXC2 3SOAA 3IMAB 1GSPA 2H0HA 2W9QA 1X1XA 1B2SA 3CU3A 4BL3A 4EV2A 2XFSA 5AEWB 1ROVA 3EF8A 3MG3A 1GOUA 3DZLA 2XSOB 4K1UA 2P05A 4CJNA 1PU4A 1WQLB 3BLZA 2IY2A 1ISKA 5BU4A 3B4OA 4STDA 2CFLA 5AEUB 2JQ5A 1RMSA 1Q40A 1NU3A 1RN1A 4H61A 4HM4B 4AKZA 3CD63 2HMMB 4N6OB 1EG9B 1US1A 2HMJB 3G0KA 1NNVA 3EHCA 4HM2B 2AAEA 3D3LA 1PY3A 1WTHA 2BMRB 3X41A 4ZM8A 5FW5A 5AIHA 4BTYA 3MPHA 3EBTA 1YJ93 4N6NB 3S67A 1UI7A 1J2BA 1AVLA 4N6UA 2GEXA 1K734 2CFGA 1WMPA 1ZGXA 1D6ZA 1GY5A 2GU3A 5JPUA 3FF2A 5RNTA 4JF8A 3QK9A 1NJI4 3UL6A 1UUWB 1ZS7A 1JB5A 1BU4A 1IU7A 3Q3FA 4RZMA 1KSIA 1IVUA 4ORLA 3BNEA 3SVAA 2OOVA 3LMLA 1FYSA 6GSPA 3HX8A 3CCL3 1VQN3 1FGRA 2Y73A 2Z6BA 1X1UA 1LOYA 3DGYA 1W6CA 2CX0A 3SYUA 5KP4A 3WHOA 1RGEA 2INXA 4EBGA 2RFRA 3NBJA 4WYKA 3GZYB 4N6TA 4R9KA 3WR2A 3M8CA 2W56A 3LT9A 3NM2A 1WNHA 2IYJA 3B4PA 3VGNA 1I2EA 2K3DA 2LYXA 4J9AA 2Z77A 1UGHI 3KKGA 2CKFB 1DMQA 3PCRA 4WFOA 4NREA 1GYBA 1KWIA 3HZPA 3DH2A 1RGFA 1IDPA 3KSPA 1QVG2 2OTJ3 4U13A 3CMA3 1BRJA
chains in the Genus database with same CATH topology
1MOLA 1IQXA 1QAFA 2Y74A 3ALAA 1IVXA 3S28A 5D82A 3NQZA 3KE7A 4XBYA 2V1LA 2GU1A 1LOXA 4R80A 3GZXB 1E3VA 4MMYB 1GD3A 1M9GA 2KCDA 3OW22 2QEX3 4XBXA 2FXTA 3U97A 2O9UX 3MWZA 4KFEA 5IENA 5A0OB 1EQKA 1LVNA 2W03A 2W6JH 2XH9A 5AYRB 1YVBI 1VQ93 1S5AA 5FGOA 3PCSA 1JJ22 2YFJB 2CWTA 3LTDA 2M7OA 3JUNA 2YFLB 3K0ZA 3SLUA 4QWTA 3DY5A 1CEWI 3NX0A 1Q42A 4O2HA 4FMCA 4K61A 1TFOA 1FGMA 1O7PB 5AIGA 1Q814 3UJMA 4XDWA 5JBSA 2E2VA 1ROAA 1W6YA 1Q864 2BO9B 5LC6A 2ZL8A 3JUMA 1GS3A 3JUQA 1VQK3 1KQS2 2CFWA 1D6YA 1O7WB 1TIJA 2C10A 2HMNB 3KIIA 3RGRA 4HM5B 4HM6B 4FCMA 2HMKB 4R1KA 3STDA 1QALA 4N6MA 1AV4A 4H3UA 5BVBA 2F98A 4KFFA 4RNYA 1RN7A 3CC43 3FF0A 4IT7A 4HM8B 1WMOA 2GEYA 3EJVA 1KC84 2GBXB 3F40A 1YHQ3 3F8HA 5CLKA 2RGQA 4EC6A 3MYTA 1QMAA 3KFQC 1FGQA 3EB8A 3CCS3 3FCSB 1SPUA 1VQ63 1U5OA 3E99A 3IPTA 1EKMA 1OHPA 3MKIA 5AIFA 4TX4A 2BMOB 4Q53A 3UL5A 3GWRA 1WMNA 3OWSA 2OTL3 4KZ1A 3TDGA 3G4S3 1JNQA 3CCV3 3JUPA 4K90B 2D42A 2F99A 4J8TA 1DYUA 1IT8A 3N9HA 1TUHA 2RSXA 3H3HA 4K1VA 4CDLA 1IQ8A 3CCE3 2P38A 3DM8A 1M1XB 1W2ZA 4FR9A 1YGEA 3F8XA 2PZVA 5IG0A 1DMNA 3UB1A 1CQSA 1VQ43 1QVF2 3N54B 1GD4A 2ZDJA 5IEPA 1W00A 4JRFA 3A76A 2CG0A 1MNLA 1Q7Y4 3DGMA 4AKYA 3DGNA 3V99A 1IVVA 4N3VA 4PEJA 1OHSA 2W0QA 3FG3A 4GB5A 2OQEA 1K41A 3CPOA 3EN8A 4LZIA 1RRHA 3WOFB 4FMAA 3X3XA 2IUKA 3MG1A 1GY7A 4HKVB 3LYGA 3CNMA 3OV4A 4LEHA 4BTWA 3T8NA 5IF6A 2CWUA 3MG2A 3QRDA 1NDOB 3K9MC 3NM7A 3V98A 6STDA 1N8QA 1C7HA 3WODG 4LSOA 1OH0A 1K9M4 1OF5B 1DVCA 3HK4A 2OQEC 2WO0A 4WWUC 1LNHA 3HIIA 1O7MB 2CK3H 5CF1A 4FMDA 3CNXA 5AI1A 5BXQA 1Q824 2W2CA 1ULJB 3B7CA 4RBNA 1PFPA 4NHFA 8CHOA 1OCVA 5D83A 1RRLA 3GRDA 4LMIA 1NB3I 4KVHA 2P0XA 3DXOA 3GAXA 3OXAA 1JRQA 3FG1A 3S5CA 5DRVA 3VSYA 3CC73 1K28A 3G8ZA 1VQO3 1OPYA 1JN5B 4MJDA 4O8SA 1N5HA 2KRTA 1CYUA 1VQ53 1SIIA 1STFI 4HZ9B 3H51A 4L7KA 1D6UA 3U1WA 1DVDA 1QAKA 3F14A 2CIUA 1N9EA 5ELJA 1AR0A 2K54A 4N6LA 2IA7A 3SX1A 2YFIB 2CFKA 5CXOA 3VF1A 1O7NB 1FGTA 3Q1CA 4FCJA 3CPW2 1OHOA 2WOHA 2CG1A 2FGTA 1JV2B 3ROBA 3SXXA 1VQL3 4R4KA 2CWVA 1IQYA 3S29A 1LXEA 4XB5A 2F86B 1HKXA 5IERA 1AVKA 1ULIB 5HGRA 5AIIA 2SBLA 3NUVA 3F7XA 5LC7A 2O3OA 5AYSC 1OF5A 2K0MA 2A15A 1M904 5EVHA 5D81A 3G6E3 2UX0A 4L8PA 1ASKA 4FMBA 3FZWA 4XDVA 1OACA 1OUNA 5DREA 4XM4A 3F9SA 3HI7A 2XR8B 2XSHB 4OK0A 1IV7A 1W4NA 5IG5A 3ER7A 3T0UA 3J7Yd 1JKGB 3I0YA 3FLJA 4R9LA 3EE1A 1YIJ3 3BNBA 3UNLA 3OWUA 4HZBB 1JN5A 3BB9A 2L4VA 2BMQB 3K63A 1UUVB 3KSED 3Q2PA 3FGYA 3LOYA 4MMXB 2ML6A 4HJLB 1W01A 4XBTA 2GBWB 3O8YA 1IVWA 4EV5A 4G1MB 1YJN3 1W5ZA 4AEQA 1IV9A 3LTCA 3I553 4HM1B 1TFKA 2RCDA 3EN1B 3FSDA 2Z7AA 1GY6A 3PZWA 1SIHA 3DUKA 3WMDA 5TGNA 2W04A 3MHEA 3S27A 2JDIH 3LH4A 2BHMA 3WA2X 1A90A 3X40A 1A67A 3GZRA 2WGQA 2P0MA 3PXMA 1TU5A 3CCU3 3OX9A 2OWPA 5IEOA 5STDA 4MEIA 1ZX2A 2CW9A 5EQLA 3SOYA 3RDEA 3F7SA 1YJW3 1HU9A 3MSOA 2YX9A 1SJWA 2XRXB 4LGQA 1JKGA 4FCZA 1Y4KA 3NBRA 1CYVA 1STDA 4X2OA 1O7GB 3PGBA 2BNGA 2D1WA 5ELUA 3DMCA 3BNDA 3CC23 3CCL3 1Z1SA 3BNCA 3EQQB 3X42A 5KP3A 3X3ZA 1SQWA 4I4KA 2C11A 4OVMA 2XFTA 2E2TA 3I563 2XEPA 2STDA 3KZTA 3JVCA 3NV0B 2GXFA 3LT8A 4HM0B 3PYJA 4WP5A 1BUQA 1TP6A 1NO3A 2CFDA 1JB4A 3G713 3AMOB 3G16A 4L8OA 3GZBA 2OOVC 4RNZA 1W02A 5KP1A 1UW1A 1JB2A 1V74A 1L5GB 2CHCA 1RJOA 2FNQA 1W7CA 3FH1A 3HIGA 3NXJA 3L0RA 1KD14 1W2B2 4BTXA 2WGOA 1VQM3 2HMLB 3N8BA 4EXRA 2Q07A 4KFDA 3V92A 4O02B 3CCQ3 2CC3A 5G2GA 1A2VA 3FG4A 1VQ73 2MF7A 2QA43 2I9WA 2KXGA 2LQVA 2PNCA 4OUQA 3LXUX 1ZO2A 3CME3 3DGLA 7STDA 1VQ83 3K7CA 3CCJ3 1U8CB 1W6GA 3IJEB 4EYCA 1YI23 1FA3A 1VQP3 1G96A 2P09A 3NBBA 1E97A 1NWWA 1T5YA 3X3YA 3FKAA 5JPPA 1E3RA 1VZZA 3EX9A 3Q90A 3K5TA 4HBRA 4IIAA 3SEDA 2HMOB 3RGAA 4HM3B 5CF2A 4WHAA 5IG3A 2E2UA 3LTBA 3NV0A 1Q40B 5I97A 3NQYA 1YIT3 4MMZB 1F8NA 3EBYA 1OGXA 2BT3A 4O3VA 3CCM3 3AMOA 2W9PA 1IK3A 1EA2A 5EEOA 1DMMA 1R4CA 3DGOA 3T8UA 3LZAA 1N9JA 1RKYA 2CH9A 5IG4A 2ML5A 1QJGA 3KN4A 2IUJA 1UI8A 3WDGB 4GL6A 3WA3A 4HVNA 2XGNA 2R4IA 2XGLA 3D9RA 1FUWA 3JUOA 2WOFA 1M1K4 1FGOA 2OCTA 3ECFA 2B24B 5CK6A 2XF3A 1N5PA 3EC9A 4HM7B 1O7HB 2B1XB 3WOEB 2IMJA 1NB5I 4HYZA 3NHXA 2QGUA 1S723 1K8A4 3OWYA 3LTAA 4X2HA 2MC8A 4WYKB 4CCVA 4N6V0 1A2KA 4IPBA 3PS8A 2Z76A 2QIYA 1IT7A 2W56B 3B8LA 1OGZA 1N8R4 5IW9A 3CCR3 3CXC2 3SOAA 3IMAB 2W9QA 4EV2A 3CU3A 2XFSA 5AEWB 1ROVA 3EF8A 3MG3A 3DZLA 2XSOB 4K1UA 2P05A 1PU4A 1WQLB 3BLZA 1ISKA 3B4OA 4STDA 2CFLA 5AEUB 2JQ5A 1Q40A 1NU3A 4H61A 4HM4B 4AKZA 3CD63 2HMMB 4N6OB 1EG9B 1US1A 2HMJB 3G0KA 3EHCA 4HM2B 3D3LA 1WTHA 2BMRB 3X41A 4ZM8A 5FW5A 5AIHA 4BTYA 3MPHA 3EBTA 1YJ93 4N6NB 3S67A 1UI7A 1J2BA 1AVLA 4N6UA 2GEXA 1K734 2CFGA 1WMPA 5JPUA 1D6ZA 1GY5A 2GU3A 3FF2A 1NJI4 4JF8A 3QK9A 3UL6A 1UUWB 1JB5A 1IU7A 4RZMA 1KSIA 1IVUA 4ORLA 3BNEA 3SVAA 2OOVA 3LMLA 3HX8A 1VQN3 1FGRA 2Y73A 2Z6BA 5KP4A 1W6CA 2INXA 4EBGA 2RFRA 3NBJA 4WYKA 3GZYB 4N6TA 4R9KA 3M8CA 2W56A 3LT9A 3NM2A 1WNHA 3B4PA 3VGNA 2LYXA 4J9AA 2Z77A 3KKGA 2CKFB 1DMQA 3PCRA 4WFOA 4NREA 1GYBA 1KWIA 3HZPA 1IDPA 3KSPA 1QVG2 2OTJ3 4U13A 3CMA3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D82 A;  3KE7 A;  4XBY A;  3GZX B;  1E3V A;  4XBX A;  5IEN A;  1S5A A;  2YFJ B;  3JUN A;  2YFL B;  3K0Z A;  1Q42 A;  1O7P B;  5AIG A;  3UJM A;  4XDW A;  1W6Y A;  3JUM A;  1GS3 A;  3JUQ A;  1O7W B;  2HMN B;  3RGR A;  4HM5 B;  4HM6 B;  4FCM A;  2HMK B;  4R1K A;  3STD A;  4H3U A;  5BVB A;  2F98 A;  3FF0 A;  4HM8 B;  2GEY A;  3EJV A;  2GBX B;  3F40 A;  3F8H A;  5CLK A;  2RGQ A;  3MYT A;  1QMA A;  1U5O A;  3E99 A;  3IPT A;  1OHP A;  3MKI A;  5AIF A;  2BMO B;  4Q53 A;  3GWR A;  3OWS A;  3JUP A;  2F99 A;  4J8T A;  4CDL A;  1TUH A;  3H3H A;  4K1V A;  3DM8 A;  3F8X A;  2PZV A;  5IG0 A;  1DMN A;  1CQS A;  5IEP A;  1W00 A;  3A76 A;  4N3V A;  4PEJ A;  1OHS A;  4GB5 A;  1K41 A;  3CPO A;  3EN8 A;  3MG1 A;  1GY7 A;  4HKV B;  3LYG A;  3CNM A;  3OV4 A;  4LEH A;  3T8N A;  5IF6 A;  3MG2 A;  1NDO B;  6STD A;  1C7H A;  1OH0 A;  1OF5 B;  3HK4 A;  4WWU C;  1O7M B;  5CF1 A;  3CNX A;  5AI1 A;  5BXQ A;  2W2C A;  1ULJ B;  3B7C A;  8CHO A;  1OCV A;  5D83 A;  3GRD A;  4LMI A;  4KVH A;  3DXO A;  3OXA A;  3S5C A;  5DRV A;  3VSY A;  3G8Z A;  1OPY A;  1JN5 B;  4MJD A;  4HZ9 B;  3H51 A;  4L7K A;  3F14 A;  1AR0 A;  2K54 A;  2YFI B;  5CXO A;  1O7N B;  4FCJ A;  1OHO A;  3ROB A;  4XB5 A;  2F86 B;  1HKX A;  5IER A;  1ULI B;  5HGR A;  5AII A;  3NUV A;  3F7X A;  1OF5 A;  2A15 A;  5EVH A;  5D81 A;  2UX0 A;  4L8P A;  1ASK A;  3FZW A;  4XDV A;  1OUN A;  5DRE A;  4XM4 A;  3F9S A;  2XR8 B;  2XSH B;  5IG5 A;  3ER7 A;  1JKG B;  3I0Y A;  3FLJ A;  4R9L A;  3UNL A;  3OWU A;  4HZB B;  1JN5 A;  3BB9 A;  2BMQ B;  1UUV B;  3FGY A;  4HJL B;  1W01 A;  4XBT A;  2GBW B;  4HM1 B;  2RCD A;  3EN1 B;  3FSD A;  2Z7A A;  1GY6 A;  3DUK A;  3WMD A;  5TGN A;  3MHE A;  3GZR A;  3OX9 A;  2OWP A;  5STD A;  5IEO A;  1ZX2 A;  3SOY A;  3F7S A;  3MSO A;  1SJW A;  2XRX B;  4LGQ A;  1JKG A;  3NBR A;  1STD A;  4X2O A;  1O7G B;  2BNG A;  3DMC A;  1Z1S A;  3EQQ B;  5KP3 A;  4I4K A;  4OVM A;  2STD A;  3KZT A;  3NV0 B;  2GXF A;  4HM0 B;  4WP5 A;  1BUQ A;  1TP6 A;  1JB4 A;  3G16 A;  4L8O A;  3GZB A;  1W02 A;  5KP1 A;  1JB2 A;  2CHC A;  3FH1 A;  3NXJ A;  2HML B;  5G2G A;  2I9W A;  4OUQ A;  1ZO2 A;  7STD A;  3K7C A;  1E97 A;  1NWW A;  3FKA A;  5JPP A;  1E3R A;  1VZZ A;  3EX9 A;  3Q90 A;  4IIA A;  3SED A;  2HMO B;  3RGA A;  4HM3 B;  5CF2 A;  5IG3 A;  3NV0 A;  1Q40 B;  3EBY A;  1OGX A;  1EA2 A;  1DMM A;  3T8U A;  3LZA A;  5IG4 A;  1QJG A;  4HVN A;  2R4I A;  3D9R A;  3JUO A;  3ECF A;  2B24 B;  5CK6 A;  3EC9 A;  4HM7 B;  1O7H B;  2B1X B;  2IMJ A;  3NHX A;  2QGU A;  3OWY A;  4X2H A;  4WYK B;  1A2K A;  2Z76 A;  2QIY A;  3B8L A;  1OGZ A;  3SOA A;  3CU3 A;  5AEW B;  3EF8 A;  3MG3 A;  3DZL A;  2XSO B;  4K1U A;  1WQL B;  3BLZ A;  1ISK A;  3B4O A;  4STD A;  5AEU B;  2JQ5 A;  1Q40 A;  1NU3 A;  4HM4 B;  2HMM B;  1EG9 B;  2HMJ B;  3G0K A;  3EHC A;  4HM2 B;  2BMR B;  5FW5 A;  5AIH A;  3EBT A;  2GEX A;  5JPU A;  1GY5 A;  3FF2 A;  1UUW B;  1JB5 A;  4RZM A;  4ORL A;  3HX8 A;  5KP4 A;  2INX A;  2RFR A;  4WYK A;  3GZY B;  4R9K A;  3M8C A;  3NM2 A;  3B4P A;  3VGN A;  4J9A A;  2Z77 A;  3KKG A;  2CKF B;  1DMQ A;  1GYB A;  3HZP A;  1IDP A;  3KSP A;  4U13 A; 
#chains in the Genus database with same CATH topology
 1MOL A;  1IQX A;  1BIR A;  1QAF A;  2Y74 A;  1IVX A;  3ALA A;  3S28 A;  5D82 A;  3NQZ A;  3KE7 A;  4XBY A;  1BAN A;  2RBI A;  1LNI A;  2V1L A;  2GU1 A;  1DET A;  1LOX A;  1UDI I;  1BSA A;  4R80 A;  3GZX B;  1E3V A;  4MMY B;  1GD3 A;  1M9G A;  2KCD A;  3OW2 2;  1RNT A;  2QEX 3;  4XBX A;  1RCK A;  2FXT A;  3U97 A;  2O9U X;  3MWZ A;  1LQM B;  4KFE A;  1VQQ A;  5IEN A;  1RGG A;  4EW5 A;  5A0O B;  1EQK A;  1LVN A;  1I3I A;  1IYY A;  2W03 A;  2R41 A;  2W6J H;  2XH9 A;  5AYR B;  1YVB I;  3RNT A;  1VQ9 3;  1S5A A;  5FGO A;  3PCS A;  1JJ2 2;  2YFJ B;  1AY7 A;  2SAR A;  1BSD A;  1TRP A;  2CWT A;  3LTD A;  2M7O A;  3JUN A;  1RCL A;  2YFL B;  2F5M A;  3K0Z A;  3SLU A;  2F4Y A;  4QWT A;  3DY5 A;  1CEW I;  3NX0 A;  1Q42 A;  4O2H A;  4FMC A;  4K61 A;  1TFO A;  1FGM A;  1O7P B;  1MGR A;  1T3B A;  5AIG A;  1Q81 4;  3UJM A;  3AGN A;  4XDW A;  5JBS A;  1Q7H A;  1UCK A;  2E2V A;  1FUS A;  1ROA A;  1W6Y A;  1Q86 4;  3D4A A;  2BO9 B;  2F56 A;  5LC6 A;  2ZL8 A;  1JBR A;  3JUM A;  1GS3 A;  3JUQ A;  5G1K A;  1VQK 3;  3AHW A;  2CFW A;  1D6Y A;  1O7W B;  1TIJ A;  2C10 A;  2HMN B;  3AHS A;  3KII A;  3RGR A;  4HM5 B;  4HM6 B;  4FCM A;  2HMK B;  4R1K A;  3STD A;  1FZU A;  1QAL A;  4N6M A;  1AV4 A;  1EUI C;  4H3U A;  5BVB A;  2F98 A;  4KFF A;  4RNY A;  1BNG A;  1RN7 A;  4BL2 A;  3CC4 3;  3FF0 A;  4IT7 A;  4HM8 B;  1WMO A;  1FUT A;  1YVS A;  2GEY A;  3EJV A;  1KC8 4;  2GBX B;  3F40 A;  2J8X B;  1YHQ 3;  1GOV A;  4NPB A;  3F8H A;  3D5G A;  5CLK A;  2RGQ A;  4EC6 A;  1BRN L;  3MYT A;  1QMA A;  1UUG B;  3KFQ C;  1FGQ A;  3EB8 A;  3CCS 3;  3FCS B;  2GSP A;  3ZFZ A;  1I8V A;  4LYL B;  1BRS A;  1SPU A;  1VQ6 3;  1U5O A;  6RNT A;  3E99 A;  4CDL A;  4I5Q A;  3IPT A;  1EKM A;  1OHP A;  3MKI A;  5AIF A;  4TX4 A;  2BMO B;  4Q53 A;  1Q9E A;  3UL5 A;  3GWR A;  1BSB A;  1WMN A;  3OWS A;  1BSC A;  1BNE A;  1BVI A;  2OTL 3;  4KZ1 A;  3TDG A;  3G4S 3;  1JNQ A;  1V57 A;  3CCV 3;  5HOH A;  4BIR A;  3JUP A;  4K90 B;  2D42 A;  2F99 A;  4J8T A;  1DYU A;  1IT8 A;  3N9H A;  1TUH A;  2RSX A;  2UUG C;  3H3H A;  4K1V A;  1IQ8 A;  3CCE 3;  2P38 A;  3BU4 A;  3DM8 A;  1B2U A;  1M1X B;  1W2Z A;  4FR9 A;  1YGE A;  1I0V A;  2PZV A;  3F8X A;  5IG0 A;  3GSP A;  1DMN A;  3UB1 A;  1UCJ A;  1CQS A;  1VQ4 3;  1QVF 2;  1TRQ A;  3N54 B;  1GD4 A;  2ZDJ A;  5IEP A;  1W00 A;  4JRF A;  3A76 A;  2CG0 A;  1MNL A;  1X1W A;  1Q7Y 4;  3DGM A;  4AKY A;  3BIR A;  3DGN A;  3V99 A;  1IVV A;  4N3V A;  4PEJ A;  1OHS A;  2W0Q A;  3FG3 A;  4GB5 A;  1BAO A;  2OQE A;  1K41 A;  2AAD A;  3CPO A;  3EN8 A;  4LZI A;  1RRH A;  3WOF B;  4FMA A;  3X3X A;  1RSN A;  2IUK A;  3MG1 A;  1GY7 A;  4HKV B;  3LYG A;  3CNM A;  3OV4 A;  4LEH A;  4BTW A;  3T8N A;  2KF4 A;  5IF6 A;  2CWU A;  3MG2 A;  3QRD A;  1NDO B;  3K9M C;  1RN4 A;  3NM7 A;  3V98 A;  1I2G A;  6STD A;  1N8Q A;  1C7H A;  1BNR A;  3WOD G;  4LSO A;  1OH0 A;  1K9M 4;  1OF5 B;  1DVC A;  1V58 A;  1BNJ A;  2OQE C;  3HK4 A;  2WO0 A;  4WWU C;  1LNH A;  3HII A;  1O7M B;  2CK3 H;  5CF1 A;  4FMD A;  3CNX A;  1I70 A;  5AI1 A;  5BXQ A;  1Q82 4;  2W2C A;  1ULJ B;  3B7C A;  4RBN A;  1PFP A;  2KAA A;  1BGS A;  4NHF A;  1HYF A;  8CHO A;  1OCV A;  1RNB A;  1R4Y A;  1B2Z A;  1MWU A;  5D83 A;  1GMP A;  1RRL A;  3GRD A;  4LMI A;  1TJD A;  1NB3 I;  4KVH A;  2P0X A;  3DXO A;  3GAX A;  3OXA A;  1JRQ A;  3FG1 A;  3S5C A;  5DRV A;  2BIR A;  3VSY A;  3CC7 3;  1K28 A;  2RNT A;  3G8Z A;  5GSP A;  1OPY A;  1JN5 B;  4MJD A;  1TTO A;  4O8S A;  1VQO 3;  1N5H A;  2KRT A;  1CYU A;  1B20 A;  1RGA A;  1UCI A;  1SII A;  1STF I;  4HZ9 B;  3H51 A;  4L7K A;  1VQ5 3;  1D6U A;  3U1W A;  1DE3 A;  1DVD A;  1QAK A;  4J5K A;  1LOW A;  3F14 A;  2CIU A;  1N9E A;  5ELJ A;  1AR0 A;  2K54 A;  5G1L A;  3AGO A;  4N6L A;  2IA7 A;  3SX1 A;  2YFI B;  2CFK A;  5CXO A;  3VF1 A;  1O7N B;  1FGT A;  3Q1C A;  4FCJ A;  3CPW 2;  1OHO A;  1RGC A;  2WOH A;  2CG1 A;  2FGT A;  1JV2 B;  3ROB A;  3SXX A;  1VQL 3;  4R4K A;  2CWV A;  1IQY A;  3S29 A;  1LXE A;  4XB5 A;  2F86 B;  1HKX A;  5IER A;  1AVK A;  1ULI B;  5HGR A;  5AII A;  2SBL A;  3NUV A;  3F7X A;  5LC7 A;  2O3O A;  5AYS C;  1C54 A;  1OF5 A;  2K0M A;  1YGW A;  2A15 A;  1M90 4;  5EVH A;  5D81 A;  3G6E 3;  1MGW A;  2UX0 A;  4L8P A;  1ASK A;  2HOH A;  4FMB A;  3FZW A;  4XDV A;  1OAC A;  1OUN A;  5DRE A;  4XM4 A;  3F9S A;  3HI7 A;  2XR8 B;  2XSH B;  1LQG C;  4OK0 A;  1IV7 A;  1W4N A;  1CH0 A;  1I3F A;  5IG5 A;  3ER7 A;  1GOY A;  3T0U A;  3J7Y d;  1JKG B;  3I0Y A;  3FLJ A;  4R9L A;  1HZ1 A;  3D5I A;  3EE1 A;  3BNB A;  3UNL A;  1YIJ 3;  4HAA A;  3OWU A;  4HZB B;  1JN5 A;  1BRI A;  3BB9 A;  2L4V A;  2BMQ B;  3K63 A;  1UUV B;  3KSE D;  3Q2P A;  1BRG A;  3FGY A;  2F5W A;  3LOY A;  4MMX B;  2ML6 A;  4HJL B;  4CPK A;  1W01 A;  4XBT A;  2GBW B;  3O8Y A;  8RNT A;  1IVW A;  4EV5 A;  4G1M B;  1YJN 3;  1W5Z A;  4AEQ A;  1IV9 A;  3LTC A;  3I55 3;  4HM1 B;  1TFK A;  1BNS A;  2RCD A;  5BIR A;  3EN1 B;  1B2M A;  3FSD A;  2Z7A A;  1GY6 A;  3PZW A;  1SIH A;  3DUK A;  4HOH A;  3WMD A;  1T2H A;  5TGN A;  1BRK A;  2W04 A;  3HOH A;  1BNF A;  3MHE A;  3S27 A;  2JDI H;  3LH4 A;  2BHM A;  3WA2 X;  1A90 A;  3X40 A;  3ZG5 A;  1A67 A;  1G0T A;  3D79 A;  3GZR A;  2WGQ A;  1JBS A;  2P0M A;  3PXM A;  1TU5 A;  1EEJ A;  3CCU 3;  3OX9 A;  2OWP A;  4GSP A;  5IEO A;  4MEI A;  5STD A;  1ZX2 A;  2CW9 A;  5EQL A;  2L1S A;  3RDE A;  3SOY A;  3F7S A;  1YJW 3;  1HU9 A;  3MSO A;  2YX9 A;  1SJW A;  2KF6 A;  1RGL A;  2XRX B;  1JKG A;  4LGQ A;  4FCZ A;  5M19 A;  1Y4K A;  3NBR A;  4GHO A;  1CYV A;  1STD A;  4X2O A;  3URP A;  1O7G B;  3PGB A;  2BNG A;  2D1W A;  1UCL A;  3DMC A;  3BND A;  5ELU A;  9RNT A;  3CC2 3;  1Z1S A;  1MWT A;  1X1Y A;  3BNC A;  3EQQ B;  3X42 A;  5KP3 A;  3X3Z A;  2CX1 A;  1BRH A;  1SQW A;  4DKI A;  4I4K A;  2C11 A;  4ILF A;  4OVM A;  2XFT A;  2E2T A;  3I56 3;  1JZD A;  2XEP A;  2STD A;  3KZT A;  3JVC A;  3NV0 B;  2GXF A;  2KF5 A;  3LT8 A;  4HM0 B;  1MWR A;  1BOX A;  3PYJ A;  4WP5 A;  1BUQ A;  1TP6 A;  1AQZ A;  1NO3 A;  2CFD A;  1JBT A;  1JB4 A;  1G02 A;  3AMO B;  3G16 A;  3G71 3;  4J5G A;  1B3S A;  1RGK A;  3GZB A;  4L8O A;  2OOV C;  5M1A A;  4RNZ A;  3A5E A;  1W02 A;  5KP1 A;  1UW1 A;  1JB2 A;  1V74 A;  2ZHX B;  2CHC A;  1RJO A;  1L5G B;  2FNQ A;  1W7C A;  3FH1 A;  3HIG A;  3NXJ A;  3L0R A;  7GSP A;  1KD1 4;  1W2B 2;  4BTX A;  2WGO A;  1VQM 3;  2KF3 A;  2HML B;  1RDS A;  3N8B A;  4EXR A;  2Q07 A;  4KFD A;  3V92 A;  4O02 B;  1MWS A;  3CCQ 3;  2CC3 A;  1B27 A;  1A2V A;  3FG4 A;  5G2G A;  2MF7 A;  5M18 A;  2QA4 3;  1VQ7 3;  2I9W A;  2KXG A;  1JZO A;  2LQV A;  2PNC A;  4OUQ A;  1I2F A;  2C4B A;  7RNT A;  3LXU X;  4BU4 A;  1ZO2 A;  3ZG0 A;  3CME 3;  3DGL A;  1KQS 2;  1T2I A;  2H0G A;  7STD A;  1VQ8 3;  3K7C A;  3CCJ 3;  1U8C B;  1W6G A;  3IJE B;  4EYC A;  1YI2 3;  1FA3 A;  1VQP 3;  1G96 A;  2P09 A;  1BNI A;  3NBB A;  1E97 A;  1NWW A;  1T5Y A;  3X3Y A;  3FKA A;  5JPP A;  1LOV A;  1E3R A;  1VZZ A;  3EX9 A;  3Q90 A;  3K5T A;  1GMR A;  4HBR A;  4IIA A;  3SED A;  2HMO B;  3RGA A;  1RHL A;  4HM3 B;  5CF2 A;  4WHA A;  5IG3 A;  1LRA A;  2E2U A;  3LTB A;  2ZA4 A;  3NV0 A;  1Q40 B;  1B21 A;  5I97 A;  3NQY A;  1RLS A;  1YIT 3;  4MMZ B;  1F8N A;  3EBY A;  1BSE A;  1OGX A;  2BT3 A;  4O3V A;  3CCM 3;  3AMO A;  2W9P A;  4KT3 B;  1IK3 A;  1B2X A;  1EA2 A;  5EEO A;  1DMM A;  1R4C A;  3DGO A;  3T8U A;  3LZA A;  1RTU A;  1N9J A;  1RKY A;  2CH9 A;  5IG4 A;  2ML5 A;  2BU4 A;  1QJG A;  3KN4 A;  2IUJ A;  1SAR A;  1UI8 A;  3WDG B;  4GL6 A;  3WA3 A;  4HVN A;  2XGN A;  2R4I A;  2XGL A;  3D9R A;  1FUW A;  1I0X A;  3JUO A;  1BUJ A;  2WOF A;  1M1K 4;  1FGO A;  2OCT A;  3ECF A;  2B24 B;  5CK6 A;  2UGI A;  2XF3 A;  1PYL A;  2H0I A;  4RNT A;  1N5P A;  1FW7 A;  3EC9 A;  4HM7 B;  1O7H B;  2B1X B;  1YNV X;  1GMQ A;  2IMJ A;  3WOE B;  4HYZ A;  1NB5 I;  3NHX A;  2QGU A;  1S72 3;  1K8A 4;  3OWY A;  3LTA A;  4X2H A;  2MC8 A;  1UGI A;  4WYK B;  1RGH A;  1A2K A;  4N6V 0;  4CCV A;  4IPB A;  3PS8 A;  2Z76 A;  2QIY A;  1IT7 A;  2W56 B;  3B8L A;  1OGZ A;  1N8R 4;  5IW9 A;  3KCH A;  3CCR 3;  1A2P A;  3CXC 2;  3SOA A;  3IMA B;  1GSP A;  2H0H A;  2W9Q A;  1X1X A;  1B2S A;  3CU3 A;  4BL3 A;  4EV2 A;  2XFS A;  5AEW B;  1ROV A;  3EF8 A;  3MG3 A;  1GOU A;  3DZL A;  2XSO B;  4K1U A;  2P05 A;  4CJN A;  1PU4 A;  1WQL B;  3BLZ A;  2IY2 A;  1ISK A;  5BU4 A;  3B4O A;  4STD A;  2CFL A;  5AEU B;  2JQ5 A;  1RMS A;  1Q40 A;  1NU3 A;  1RN1 A;  4H61 A;  4HM4 B;  4AKZ A;  3CD6 3;  2HMM B;  4N6O B;  1EG9 B;  1US1 A;  2HMJ B;  3G0K A;  1NNV A;  3EHC A;  4HM2 B;  2AAE A;  3D3L A;  1PY3 A;  1WTH A;  2BMR B;  3X41 A;  4ZM8 A;  5FW5 A;  5AIH A;  4BTY A;  3MPH A;  3EBT A;  1YJ9 3;  4N6N B;  3S67 A;  1UI7 A;  1J2B A;  1AVL A;  4N6U A;  2GEX A;  1K73 4;  2CFG A;  1WMP A;  1ZGX A;  1D6Z A;  1GY5 A;  2GU3 A;  5JPU A;  3FF2 A;  5RNT A;  4JF8 A;  3QK9 A;  1NJI 4;  3UL6 A;  1UUW B;  1ZS7 A;  1JB5 A;  1BU4 A;  1IU7 A;  3Q3F A;  4RZM A;  1KSI A;  1IVU A;  4ORL A;  3BNE A;  3SVA A;  2OOV A;  3LML A;  1FYS A;  6GSP A;  3HX8 A;  3CCL 3;  1VQN 3;  1FGR A;  2Y73 A;  2Z6B A;  1X1U A;  1LOY A;  3DGY A;  1W6C A;  2CX0 A;  3SYU A;  5KP4 A;  3WHO A;  1RGE A;  2INX A;  4EBG A;  2RFR A;  3NBJ A;  4WYK A;  3GZY B;  4N6T A;  4R9K A;  3WR2 A;  3M8C A;  2W56 A;  3LT9 A;  3NM2 A;  1WNH A;  2IYJ A;  3B4P A;  3VGN A;  1I2E A;  2K3D A;  2LYX A;  4J9A A;  2Z77 A;  1UGH I;  3KKG A;  2CKF B;  1DMQ A;  3PCR A;  4WFO A;  4NRE A;  1GYB A;  1KWI A;  3HZP A;  3DH2 A;  1RGF A;  1IDP A;  3KSP A;  1QVG 2;  2OTJ 3;  4U13 A;  3CMA 3;  1BRJ A; 
#chains in the Genus database with same CATH homology
 1MOL A;  1IQX A;  1QAF A;  2Y74 A;  3ALA A;  1IVX A;  3S28 A;  5D82 A;  3NQZ A;  3KE7 A;  4XBY A;  2V1L A;  2GU1 A;  1LOX A;  4R80 A;  3GZX B;  1E3V A;  4MMY B;  1GD3 A;  1M9G A;  2KCD A;  3OW2 2;  2QEX 3;  4XBX A;  2FXT A;  3U97 A;  2O9U X;  3MWZ A;  4KFE A;  5IEN A;  5A0O B;  1EQK A;  1LVN A;  2W03 A;  2W6J H;  2XH9 A;  5AYR B;  1YVB I;  1VQ9 3;  1S5A A;  5FGO A;  3PCS A;  1JJ2 2;  2YFJ B;  2CWT A;  3LTD A;  2M7O A;  3JUN A;  2YFL B;  3K0Z A;  3SLU A;  4QWT A;  3DY5 A;  1CEW I;  3NX0 A;  1Q42 A;  4O2H A;  4FMC A;  4K61 A;  1TFO A;  1FGM A;  1O7P B;  5AIG A;  1Q81 4;  3UJM A;  4XDW A;  5JBS A;  2E2V A;  1ROA A;  1W6Y A;  1Q86 4;  2BO9 B;  5LC6 A;  2ZL8 A;  3JUM A;  1GS3 A;  3JUQ A;  1VQK 3;  1KQS 2;  2CFW A;  1D6Y A;  1O7W B;  1TIJ A;  2C10 A;  2HMN B;  3KII A;  3RGR A;  4HM5 B;  4HM6 B;  4FCM A;  2HMK B;  4R1K A;  3STD A;  1QAL A;  4N6M A;  1AV4 A;  4H3U A;  5BVB A;  2F98 A;  4KFF A;  4RNY A;  1RN7 A;  3CC4 3;  3FF0 A;  4IT7 A;  4HM8 B;  1WMO A;  2GEY A;  3EJV A;  1KC8 4;  2GBX B;  3F40 A;  1YHQ 3;  3F8H A;  5CLK A;  2RGQ A;  4EC6 A;  3MYT A;  1QMA A;  3KFQ C;  1FGQ A;  3EB8 A;  3CCS 3;  3FCS B;  1SPU A;  1VQ6 3;  1U5O A;  3E99 A;  3IPT A;  1EKM A;  1OHP A;  3MKI A;  5AIF A;  4TX4 A;  2BMO B;  4Q53 A;  3UL5 A;  3GWR A;  1WMN A;  3OWS A;  2OTL 3;  4KZ1 A;  3TDG A;  3G4S 3;  1JNQ A;  3CCV 3;  3JUP A;  4K90 B;  2D42 A;  2F99 A;  4J8T A;  1DYU A;  1IT8 A;  3N9H A;  1TUH A;  2RSX A;  3H3H A;  4K1V A;  4CDL A;  1IQ8 A;  3CCE 3;  2P38 A;  3DM8 A;  1M1X B;  1W2Z A;  4FR9 A;  1YGE A;  3F8X A;  2PZV A;  5IG0 A;  1DMN A;  3UB1 A;  1CQS A;  1VQ4 3;  1QVF 2;  3N54 B;  1GD4 A;  2ZDJ A;  5IEP A;  1W00 A;  4JRF A;  3A76 A;  2CG0 A;  1MNL A;  1Q7Y 4;  3DGM A;  4AKY A;  3DGN A;  3V99 A;  1IVV A;  4N3V A;  4PEJ A;  1OHS A;  2W0Q A;  3FG3 A;  4GB5 A;  2OQE A;  1K41 A;  3CPO A;  3EN8 A;  4LZI A;  1RRH A;  3WOF B;  4FMA A;  3X3X A;  2IUK A;  3MG1 A;  1GY7 A;  4HKV B;  3LYG A;  3CNM A;  3OV4 A;  4LEH A;  4BTW A;  3T8N A;  5IF6 A;  2CWU A;  3MG2 A;  3QRD A;  1NDO B;  3K9M C;  3NM7 A;  3V98 A;  6STD A;  1N8Q A;  1C7H A;  3WOD G;  4LSO A;  1OH0 A;  1K9M 4;  1OF5 B;  1DVC A;  3HK4 A;  2OQE C;  2WO0 A;  4WWU C;  1LNH A;  3HII A;  1O7M B;  2CK3 H;  5CF1 A;  4FMD A;  3CNX A;  5AI1 A;  5BXQ A;  1Q82 4;  2W2C A;  1ULJ B;  3B7C A;  4RBN A;  1PFP A;  4NHF A;  8CHO A;  1OCV A;  5D83 A;  1RRL A;  3GRD A;  4LMI A;  1NB3 I;  4KVH A;  2P0X A;  3DXO A;  3GAX A;  3OXA A;  1JRQ A;  3FG1 A;  3S5C A;  5DRV A;  3VSY A;  3CC7 3;  1K28 A;  3G8Z A;  1VQO 3;  1OPY A;  1JN5 B;  4MJD A;  4O8S A;  1N5H A;  2KRT A;  1CYU A;  1VQ5 3;  1SII A;  1STF I;  4HZ9 B;  3H51 A;  4L7K A;  1D6U A;  3U1W A;  1DVD A;  1QAK A;  3F14 A;  2CIU A;  1N9E A;  5ELJ A;  1AR0 A;  2K54 A;  4N6L A;  2IA7 A;  3SX1 A;  2YFI B;  2CFK A;  5CXO A;  3VF1 A;  1O7N B;  1FGT A;  3Q1C A;  4FCJ A;  3CPW 2;  1OHO A;  2WOH A;  2CG1 A;  2FGT A;  1JV2 B;  3ROB A;  3SXX A;  1VQL 3;  4R4K A;  2CWV A;  1IQY A;  3S29 A;  1LXE A;  4XB5 A;  2F86 B;  1HKX A;  5IER A;  1AVK A;  1ULI B;  5HGR A;  5AII A;  2SBL A;  3NUV A;  3F7X A;  5LC7 A;  2O3O A;  5AYS C;  1OF5 A;  2K0M A;  2A15 A;  1M90 4;  5EVH A;  5D81 A;  3G6E 3;  2UX0 A;  4L8P A;  1ASK A;  4FMB A;  3FZW A;  4XDV A;  1OAC A;  1OUN A;  5DRE A;  4XM4 A;  3F9S A;  3HI7 A;  2XR8 B;  2XSH B;  4OK0 A;  1IV7 A;  1W4N A;  5IG5 A;  3ER7 A;  3T0U A;  3J7Y d;  1JKG B;  3I0Y A;  3FLJ A;  4R9L A;  3EE1 A;  1YIJ 3;  3BNB A;  3UNL A;  3OWU A;  4HZB B;  1JN5 A;  3BB9 A;  2L4V A;  2BMQ B;  3K63 A;  1UUV B;  3KSE D;  3Q2P A;  3FGY A;  3LOY A;  4MMX B;  2ML6 A;  4HJL B;  1W01 A;  4XBT A;  2GBW B;  3O8Y A;  1IVW A;  4EV5 A;  4G1M B;  1YJN 3;  1W5Z A;  4AEQ A;  1IV9 A;  3LTC A;  3I55 3;  4HM1 B;  1TFK A;  2RCD A;  3EN1 B;  3FSD A;  2Z7A A;  1GY6 A;  3PZW A;  1SIH A;  3DUK A;  3WMD A;  5TGN A;  2W04 A;  3MHE A;  3S27 A;  2JDI H;  3LH4 A;  2BHM A;  3WA2 X;  1A90 A;  3X40 A;  1A67 A;  3GZR A;  2WGQ A;  2P0M A;  3PXM A;  1TU5 A;  3CCU 3;  3OX9 A;  2OWP A;  5IEO A;  5STD A;  4MEI A;  1ZX2 A;  2CW9 A;  5EQL A;  3SOY A;  3RDE A;  3F7S A;  1YJW 3;  1HU9 A;  3MSO A;  2YX9 A;  1SJW A;  2XRX B;  4LGQ A;  1JKG A;  4FCZ A;  1Y4K A;  3NBR A;  1CYV A;  1STD A;  4X2O A;  1O7G B;  3PGB A;  2BNG A;  2D1W A;  5ELU A;  3DMC A;  3BND A;  3CC2 3;  3CCL 3;  1Z1S A;  3BNC A;  3EQQ B;  3X42 A;  5KP3 A;  3X3Z A;  1SQW A;  4I4K A;  2C11 A;  4OVM A;  2XFT A;  2E2T A;  3I56 3;  2XEP A;  2STD A;  3KZT A;  3JVC A;  3NV0 B;  2GXF A;  3LT8 A;  4HM0 B;  3PYJ A;  4WP5 A;  1BUQ A;  1TP6 A;  1NO3 A;  2CFD A;  1JB4 A;  3G71 3;  3AMO B;  3G16 A;  4L8O A;  3GZB A;  2OOV C;  4RNZ A;  1W02 A;  5KP1 A;  1UW1 A;  1JB2 A;  1V74 A;  1L5G B;  2CHC A;  1RJO A;  2FNQ A;  1W7C A;  3FH1 A;  3HIG A;  3NXJ A;  3L0R A;  1KD1 4;  1W2B 2;  4BTX A;  2WGO A;  1VQM 3;  2HML B;  3N8B A;  4EXR A;  2Q07 A;  4KFD A;  3V92 A;  4O02 B;  3CCQ 3;  2CC3 A;  5G2G A;  1A2V A;  3FG4 A;  1VQ7 3;  2MF7 A;  2QA4 3;  2I9W A;  2KXG A;  2LQV A;  2PNC A;  4OUQ A;  3LXU X;  1ZO2 A;  3CME 3;  3DGL A;  7STD A;  1VQ8 3;  3K7C A;  3CCJ 3;  1U8C B;  1W6G A;  3IJE B;  4EYC A;  1YI2 3;  1FA3 A;  1VQP 3;  1G96 A;  2P09 A;  3NBB A;  1E97 A;  1NWW A;  1T5Y A;  3X3Y A;  3FKA A;  5JPP A;  1E3R A;  1VZZ A;  3EX9 A;  3Q90 A;  3K5T A;  4HBR A;  4IIA A;  3SED A;  2HMO B;  3RGA A;  4HM3 B;  5CF2 A;  4WHA A;  5IG3 A;  2E2U A;  3LTB A;  3NV0 A;  1Q40 B;  5I97 A;  3NQY A;  1YIT 3;  4MMZ B;  1F8N A;  3EBY A;  1OGX A;  2BT3 A;  4O3V A;  3CCM 3;  3AMO A;  2W9P A;  1IK3 A;  1EA2 A;  5EEO A;  1DMM A;  1R4C A;  3DGO A;  3T8U A;  3LZA A;  1N9J A;  1RKY A;  2CH9 A;  5IG4 A;  2ML5 A;  1QJG A;  3KN4 A;  2IUJ A;  1UI8 A;  3WDG B;  4GL6 A;  3WA3 A;  4HVN A;  2XGN A;  2R4I A;  2XGL A;  3D9R A;  1FUW A;  3JUO A;  2WOF A;  1M1K 4;  1FGO A;  2OCT A;  3ECF A;  2B24 B;  5CK6 A;  2XF3 A;  1N5P A;  3EC9 A;  4HM7 B;  1O7H B;  2B1X B;  3WOE B;  2IMJ A;  1NB5 I;  4HYZ A;  3NHX A;  2QGU A;  1S72 3;  1K8A 4;  3OWY A;  3LTA A;  4X2H A;  2MC8 A;  4WYK B;  4CCV A;  4N6V 0;  1A2K A;  4IPB A;  3PS8 A;  2Z76 A;  2QIY A;  1IT7 A;  2W56 B;  3B8L A;  1OGZ A;  1N8R 4;  5IW9 A;  3CCR 3;  3CXC 2;  3SOA A;  3IMA B;  2W9Q A;  4EV2 A;  3CU3 A;  2XFS A;  5AEW B;  1ROV A;  3EF8 A;  3MG3 A;  3DZL A;  2XSO B;  4K1U A;  2P05 A;  1PU4 A;  1WQL B;  3BLZ A;  1ISK A;  3B4O A;  4STD A;  2CFL A;  5AEU B;  2JQ5 A;  1Q40 A;  1NU3 A;  4H61 A;  4HM4 B;  4AKZ A;  3CD6 3;  2HMM B;  4N6O B;  1EG9 B;  1US1 A;  2HMJ B;  3G0K A;  3EHC A;  4HM2 B;  3D3L A;  1WTH A;  2BMR B;  3X41 A;  4ZM8 A;  5FW5 A;  5AIH A;  4BTY A;  3MPH A;  3EBT A;  1YJ9 3;  4N6N B;  3S67 A;  1UI7 A;  1J2B A;  1AVL A;  4N6U A;  2GEX A;  1K73 4;  2CFG A;  1WMP A;  5JPU A;  1D6Z A;  1GY5 A;  2GU3 A;  3FF2 A;  1NJI 4;  4JF8 A;  3QK9 A;  3UL6 A;  1UUW B;  1JB5 A;  1IU7 A;  4RZM A;  1KSI A;  1IVU A;  4ORL A;  3BNE A;  3SVA A;  2OOV A;  3LML A;  3HX8 A;  1VQN 3;  1FGR A;  2Y73 A;  2Z6B A;  5KP4 A;  1W6C A;  2INX A;  4EBG A;  2RFR A;  3NBJ A;  4WYK A;  3GZY B;  4N6T A;  4R9K A;  3M8C A;  2W56 A;  3LT9 A;  3NM2 A;  1WNH A;  3B4P A;  3VGN A;  2LYX A;  4J9A A;  2Z77 A;  3KKG A;  2CKF B;  1DMQ A;  3PCR A;  4WFO A;  4NRE A;  1GYB A;  1KWI A;  3HZP A;  1IDP A;  3KSP A;  1QVG 2;  2OTJ 3;  4U13 A;  3CMA 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...