2PZVA

Crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound phenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
123
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
molecule tags Isomerase
source organism Pseudomonas putida
publication title Testing Electrostatic complementarity in Enzyme Catalysis: Hydrogen Bonding in the Ketosteroid Isomerase Oxyanion Hole
pubmed doi rcsb
total genus 32
structure length 123
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2pzvA00
5IENA 2HMKB 2R4IA 4HM5B 1UUVB 4HJLB 2JQ5A 3Q90A 2W2CA 1OF5A 5DREA 3STDA 1JKGB 3GZXB 3F40A 3H51A 3HX8A 3ECFA 1W01A 5CF1A 2F99A 1GY5A 3MYTA 3FGYA 1GY6A 5EVHA 3EX9A 3JUQA 5IERA 5JPPA 2HMOB 2RFRA 3SOAA 5CF2A 4X2HA 3I0YA 3JUMA 3CNXA 4I4KA 4OUQA 5IG5A 1WQLB 3EN1B 3K7CA 2Z77A 4R9KA 3DMCA 4XDVA 2HMNB 3DZLA 5KP1A 2BMRB 3MSOA 3FH1A 5FW5A 3GZBA 1JN5A 3BB9A 1DMNA 3WMDA 3UNLA 5BVBA 3FLJA 1O7GB 1OHSA 4HM2B 4U13A 1BUQA 1GYBA 3OV4A 3FKAA 4FCMA 4XBTA 3GWRA 5AI1A 4X2OA 1CQSA 2Z7AA 5HGRA 5IF6A 2I9WA 1JB4A 3KE7A 1VZZA 3ROBA 4HM4B 1JB5A 5IEPA 7STDA 5KP3A 1ZO2A 3F7SA 3F8XA 3G16A 3B4OA 3GZRA 3CU3A 1STDA 3NV0A 4HKVB 4L7KA 4IIAA 3F14A 1ZX2A 3OWSA 4STDA 3HZPA 1UUWB 3A76A 1Z1SA 1O7HB 5G2GA 3EBTA 3B8LA 5AEUB 3CNMA 2RGQA 5AIHA 3NHXA 3DXOA 5TGNA 2QIYA 2GEYA 4WP5A 4K1UA 5IG4A 3NV0B 4WYKA 1O7MB 5IG3A 3IPTA 1Q40B 3VSYA 4GB5A 3DUKA 2GBWB 1AR0A 4FCJA 4WWUC 5CK6A 3FSDA 1OPYA 1ULJB 1JN5B 2YFLB 4L8OA 1OGZA 2INXA 2HMJB 4ORLA 5CLKA 1NWWA 2RCDA 5IG0A 3VGNA 1O7WB 1QJGA 1ASKA 2XSHB 1QMAA 1Q40A 2GXFA 2PZVA 3EF8A 3NM2A 4MJDA 3OX9A 1OF5B 1S5AA 3OWYA 4J9AA 1GY7A 5D82A 4R9LA 4HM6B 2BMQB 3E99A 3EN8A 1W00A 1U5OA 4HM3B 5IEOA 3ER7A 1OH0A 5AIGA 3T8NA 1TP6A 2A15A 5DRVA 2GEXA 4HVNA 1OUNA 1E3RA 4OVMA 3M8CA 3RGAA 5STDA 1DMQA 2GBXB 4RZMA 5JPUA 3MG1A 1NU3A 3G8ZA 1OHPA 3FF2A 3MG3A 3SOYA 3JUNA 3MKIA 3EHCA 4XDWA 2HMLB 3EC9A 4WYKB 1DMMA 4K1VA 1OHOA 2XSOB 3RGRA 3F9SA 1A2KA 2F86B 3NXJA 1Q42A 1ISKA 2XRXB 3T8UA 3B7CA 2UX0A 3CPOA 3H3HA 3FF0A 3KSPA 3UJMA 1TUHA 3EQQB 4Q53A 3KZTA 1OCVA 3EBYA 4N3VA 4XB5A 3B4PA 4HM8B 1IDPA 3LYGA 4XBXA 4CDLA 5KP4A 4HM0B 4R1KA 1JKGA 3NBRA 4KVHA 3MHEA 4PEJA 3F7XA 3GZYB 1EG9B 3F8HA 1K41A 3G0KA 5AIFA 3D9RA 1NDOB 5CXOA 2K54A 3DM8A 1W02A 1GS3A 1HKXA 1O7PB 2CKFB 2CHCA 1O7NB 2XR8B 1C7HA 3BLZA 3EJVA 1SJWA 3HK4A 3MG2A 4H3UA 5D83A 5BXQA 6STDA 3JUOA 4LMIA 1ULIB 3KKGA 1E97A 2IMJA 3OWUA 3SEDA 3GRDA 2QGUA 4LGQA 4HZBB 2BMOB 4HZ9B 3S5CA 4HM7B 2B1XB 4XBYA 2OWPA 4J8TA 4L8PA 1OGXA 4LEHA 3JUPA 4HM1B 8CHOA 3LZAA 1W6YA 2YFIB 2F98A 1EA2A 3FZWA 3K0ZA 2YFJB 2Z76A 3OXAA 4XM4A 5AEWB 5AIIA 1E3VA 2HMMB 3NUVA 2STDA 5D81A 1JB2A 2B24B 2BNGA
chains in the Genus database with same CATH superfamily
5IENA 3G6E3 1JBTA 2CX1A 3Q90A 2KF3A 3CC23 1YGWA 5CF1A 1LOXA 4DKIA 2KAAA 1HZ1A 3FGYA 3EX9A 7GSPA 1LNIA 2CFDA 4N6LA 1X1UA 1K734 3KFQC 1RGLA 3LTBA 3JUMA 2CH9A 3CNXA 4X2HA 2OOVA 4BU4A 1A2VA 1WQLB 3EN1B 5FGOA 1W5ZA 2BO9B 2FGTA 3Q2PA 1BNIA 3DMCA 2HMNB 3V92A 3MSOA 5FW5A 3GAXA 5BU4A 1JN5A 3FG1A 3WMDA 1BU4A 3K63A 1GOVA 2MF7A 3MPHA 1BUQA 3OV4A 3FKAA 4XBTA 1LQGC 3RNTA 1VQL3 1B2XA 5AI1A 4BTWA 4X2OA 3LMLA 1UCJA 3SYUA 1JB4A 4CPKA 1BRIA 4LZIA 2Y74A 2KRTA 7STDA 4FMBA 1QVF2 4HKVB 3GZRA 2BIRA 4HYZA 4HOHA 1BSCA 3AMOA 1BRSA 3WA2X 1LOVA 1YI23 2W0QA 1K9M4 1JJ22 3A76A 1Z1SA 3S67A 1TRQA 4ZM8A 1I2EA 5AEUB 1X1WA 1U8CB 2FNQA 3DXOA 3PGBA 3WHOA 3CCR3 2GEYA 3NV0B 1W4NA 1RN1A 1YVSA 3IPTA 3NX0A 1T2IA 1WNHA 1T2HA 3DUKA 3OW22 1AR0A 1IQXA 3FSDA 1ULJB 4EYCA 3LTDA 1OGZA 3NM7A 2HMJB 1BRJA 4ORLA 4AKZA 1S723 1NJI4 1A90A 5GSPA 4CCVA 1S5AA 1UGHI 2D42A 4EXRA 4RNYA 1GY7A 1EUIC 1M1XB 3D5IA 3ALAA 3RDEA 6RNTA 1PU4A 4AKYA 4QWTA 1U5OA 2SARA 4BL3A 3HOHA 1TP6A 2P09A 2C4BA 2GEXA 1VQN3 2WOHA 3N8BA 1VQM3 3M8CA 1AY7A 1DMQA 3D3LA 3VF1A 1OHPA 4OK0A 1YIT3 4ILFA 4XDWA 3FG4A 5IW9A 3LH4A 1UUGB 1BNRA 2IUJA 3DH2A 1N9JA 3H3HA 1Q7HA 4G1MB 1VQQA 4Q53A 4O8SA 3EBYA 3CD63 3BNCA 1IDPA 1V74A 2WO0A 3U97A 2J8XB 1V58A 5KP4A 1RN4A 3NBRA 4PEJA 1BSDA 3HIIA 2HOHA 3F8HA 1IVVA 1K41A 2QEX3 1UCLA 1Q864 4RBNA 1GS3A 3X3XA 3HK4A 3QK9A 1SQWA 3JUOA 4LYLB 3KKGA 1MNLA 1N9EA 2L1SA 1E97A 4MMXB 1FGRA 3I563 2FXTA 4LGQA 2BMOB 4HZ9B 4HM7B 2B1XB 2CFKA 5G2GA 1BVIA 3GSPA 1F8NA 1OGXA 4HM1B 4J8TA 4L8PA 1W2B2 1STFI 1W6YA 2YFIB 2F98A 5TGNA 3G4S3 2F5WA 2QA43 3SX1A 1G96A 5AEWB 1VQP3 3ZG5A 1MGWA 5EEOA 4N6MA 4O2HA 2P0XA 2W2CA 1K28A 1V57A 1RGHA 4N6OB 1WTHA 3F40A 3H51A 1IVXA 1GSPA 2E2VA 3MYTA 5IERA 3JUQA 2HMOB 2RFRA 1R4YA 4H61A 1RGEA 1GOYA 3D5GA 3K7CA 2Z77A 1TFOA 3DZLA 2XGNA 3CC73 1DMNA 1IT8A 1LQMB 3FLJA 2CWVA 2K3DA 4MMYB 3EB8A 3AHWA 3HI7A 4FCMA 3GWRA 2OTL3 1FGMA 1LXEA 2CFLA 4MEIA 1HYFA 1AVLA 1BNSA 1BSBA 3D79A 5A0OB 2P38A 3G16A 1BNFA 3F8XA 2SBLA 3NV0A 4TX4A 1N8R4 3IJEB 2ZHXB 3PCSA 4STDA 1WMPA 4I5QA 3AGNA 5BIRA 2AAEA 3EBTA 3B8LA 1DETA 3CNMA 2RGQA 4EV2A 1LOYA 1I3IA 3JVCA 4WP5A 4WYKA 5IG3A 1Q40B 1KWIA 3BU4A 4GB5A 4J5KA 4FCJA 3ZG0A 1G02A 2ML5A 1OPYA 2OOVC 1JN5B 3I553 2IY2A 3X3ZA 1SIIA 5CLKA 1GD3A 2RCDA 3VGNA 3WR2A 1M904 1FGTA 1QALA 1QJGA 1T3BA 1QMAA 1Q40A 2XSHB 3BIRA 1AV4A 2UGIA 3LXUX 3V98A 1VQO3 1SARA 1PYLA 2KF5A 1BRKA 2RBIA 1RNBA 4HM6B 2V1LA 5IEOA 2CG1A 3ER7A 3QRDA 2XGLA 1T5YA 1IV9A 3KCHA 2A15A 5DRVA 1RSNA 1OUNA 1E3RA 2C11A 1VQ53 1YHQ3 3MG3A 3G8ZA 2CX0A 5LC7A 3CMA3 1B21A 1EQKA 2F56A 1OHOA 1X1XA 1EEJA 1W6CA 2F86B 3NXJA 3CCJ3 3AGOA 4WHAA 4IPBA 3T8UA 1RDSA 1JRQA 2UX0A 3B7CA 3DGNA 4NREA 3FF0A 3KSPA 3CCE3 1TUHA 2CWUA 3U1WA 3CCV3 1BNGA 1WMNA 3WOEB 4N3VA 1UCKA 3B4PA 4CDLA 4HM0B 4R1KA 1JKGA 1N5PA 2H0IA 1FYSA 2O9UX 3F7XA 4IT7A 1A67A 1D6UA 3WDGB 2KCDA 3O8YA 4RNZA 2W04A 3DM8A 1W02A 4N6TA 2CKFB 1GD4A 1RNTA 1C7HA 1GMPA 3HIGA 4FCZA 1I2FA 1ULIB 2IMJA 1JBSA 2QGUA 4EC6A 4BIRA 1AVKA 1IYYA 4XBYA 3CCL3 4LEHA 5ELJA 1OACA 2KXGA 2Q07A 1L5GB 1YIJ3 3K0ZA 3J7Yd 1BANA 3OXAA 2Z76A 2XFSA 4KFDA 4XM4A 4WFOA 2RNTA 2STDA 4HBRA 3X41A 5RNTA 1TTOA 2BNGA 2W56A 2R4IA 4HM5B 1UUVB 1GOUA 4GSPA 4HJLB 1NB5I 1QVG2 3FCSB 1MWUA 3GZXB 3HX8A 3CXC2 1W01A 2WGQA 2XH9A 2F99A 1N8QA 2O3OA 2OQEA 3LOYA 1GY5A 5G1KA 2GU3A 1Q7Y4 4N6UA 3DY5A 5CF2A 5AYRB 4I4KA 2R41A 1DVDA 4JF8A 3T0UA 1M1K4 4R9KA 2W9QA 4XDVA 6GSPA 1KC84 3FH1A 1C54A 1CYUA 1RN7A 3BNEA 3KSED 5LC6A 5BVBA 1OHSA 1TFKA 4HM2B 5JBSA 4U13A 1GYBA 5HOHA 4K90B 1FUWA 2E2TA 1CQSA 5HGRA 4FMCA 3KE7A 9RNTA 1JZOA 2WGOA 2KF6A 1I2GA 3N9HA 1VZZA 4EW5A 2H0HA 5IEPA 5KP3A 2F5MA 1ZO2A 3F7SA 1X1YA 3B4OA 3CU3A 1EKMA 1Y4KA 4IIAA 1ZX2A 3OWSA 1RGKA 1RRHA 1UUWB 1O7HB 1RCLA 3KN4A 4HAAA 3UL6A 1I8VA 3CCM3 1ZGXA 4R4KA 4O02B 5IG4A 5EQLA 2W6JH 1YGEA 4N6NB 1BSAA 3PXMA 5I97A 4NPBA 4JRFA 2CFWA 1IQYA 4WWUC 1I0XA 2BHMA 2Z6BA 5CK6A 1AQZA 2YFLB 3BNBA 2P0MA 2XEPA 4FMAA 4O3VA 2INXA 5IG0A 1BRHA 3NM2A 1R4CA 1TU5A 3LTAA 3EF8A 1W7CA 3UL5A 3OX9A 1OF5B 1IVUA 1G0TA 1NNVA 3OWYA 1MWRA 4R9LA 1NB3I 2W03A 3EN8A 1W00A 2M7OA 4HM3B 4BTXA 2ZL8A 5M1AA 1KQS2 3A5EA 3PYJA 3WA3A 1KSIA 1UW1A 1RGFA 2GSPA 4BL2A 3LT9A 3RGAA 4RNTA 5STDA 1VQ63 1PY3A 3CPW2 1BRNL 1FW7A 1NU3A 3SOYA 3TDGA 1B3SA 2OCTA 2XFTA 3JUNA 1MOLA 3MKIA 3KIIA 3SXXA 2HMLB 3EC9A 1GMRA 4WYKB 1DMMA 1VQ93 4K1VA 2CC3A 2XSOB 4N6V0 3AHSA 2CW9A 2ZA4A 2BU4A 3CPOA 1KD14 4NHFA 3UJMA 3S27A 3CCS3 1OCVA 4K61A 4XB5A 1IU7A 2K0MA 4HM8B 1N5HA 3DGOA 3LYGA 5ELUA 4KVHA 1D6YA 1SPUA 3GZYB 3PZWA 3NQYA 3LTCA 4EV5A 5AIFA 3CCQ3 1IT7A 3D9RA 1NDOB 5CXOA 2PNCA 3SVAA 1HKXA 1O7PB 3MG2A 1RTUA 5D83A 4LMIA 1LRAA 3OWUA 1TJDA 3GRDA 3N54B 3X3YA 4HZBB 1RGCA 2CIUA 2OWPA 3PCRA 1Q824 1FGOA 3IMAB 3LZAA 3Q3FA 3FZWA 2H0GA 1LVNA 2JDIH 1US1A 1MWSA 2HMMB 4GL6A 1BAOA 2CWTA 1JB2A 1JV2B 1IQ8A 1M9GA 2IA7A 2LYXA 4R80A 2IUKA 7RNTA 1YJW3 1W6GA 3Q1CA 2GU1A 2HMKB 2Y73A 3NQZA 2JQ5A 1DVCA 5DREA 1OF5A 1Q9EA 3AMOB 3NBBA 4MMZB 3S28A 1JKGB 3STDA 1VQ83 1VQ73 3ECFA 1YNVX 2F4YA 1DE3A 1SIHA 3LT8A 1FUSA 5EVHA 5JPPA 1GY6A 3DGLA 1RCKA 2D1WA 3SOAA 3I0YA 4OUQA 1FZUA 5IG5A 1DYUA 2C10A 4AEQA 4GHOA 4J5GA 3URPA 1JBRA 1BIRA 1D6ZA 2BMRB 5G1LA 5KP1A 3GZBA 1B2SA 2UUGC 3BB9A 1UI7A 1O7GB 1BSEA 3CME3 3WODG 1IV7A 1IVWA 1WMOA 3V99A 1BNJA 3D4AA 4KT3B 4KFFA 2AADA 2Z7AA 1UI8A 1RJOA 5IF6A 2I9WA 1BGSA 1JZDA 3ROBA 3DGYA 4HM4B 1JB5A 3G713 1GMQA 2W56B 3UNLA 2OTJ3 1CH0A 2CFGA 1W2ZA 1STDA 2RSXA 3NBJA 4L7KA 3S29A 1RLSA 3F14A 1ROAA 3HZPA 1I70A 5AIHA 1RKYA 3NHXA 2ZDJA 2QIYA 2CG0A 4K1UA 2LQVA 1Q814 1O7MB 1NO3A 2OQEC 1UGIA 1IK3A 4BTYA 3VSYA 2GBWB 1LNHA 1A2PA 2P05A 3MWZA 4EBGA 1YJ93 4L8OA 1B20A 2W9PA 2KF4A 1NWWA 1TIJA 1VQ43 1ASKA 1O7WB 4MJDA 1CEWI 1TRPA 2GXFA 2PZVA 1BUJA 1UCIA 1FGQA 2XF3A 3K5TA 1MWTA 4J9AA 4LSOA 5D82A 3EE1A 3X40A 2BMQB 1QAFA 1B2ZA 1LOWA 3E99A 3T8NA 1OH0A 5AIGA 2E2UA 4KFEA 1MGRA 1B27A 2BT3A 2WOFA 4HVNA 1B2UA 4FR9A 4OVMA 3K9MC 2GBXB 4RZMA 1RGGA 5JPUA 3MG1A 1QAKA 3FF2A 1BOXA 3CCU3 2IYJA 1RGAA 3EHCA 1ZS7A 3RGRA 4FMDA 3F9SA 1A2KA 3CC43 1ISKA 1Q42A 1RHLA 2XRXB 1JNQA 3EQQB 3KZTA 1J2BA 4XBXA 1YJN3 1VQK3 3ZFZA 3PS8A 3MHEA 3BNDA 1EG9B 3G0KA 5M18A 5AYSC 4KZ1A 1K8A4 1RRLA 2CK3H 2K54A 2ML6A 2CHCA 3BLZA 2XR8B 1PFPA 1O7NB 3EJVA 5BXQA 6STDA 1ROVA 1SJWA 2YX9A 3SLUA 3L0RA 4H3UA 1B2MA 8RNTA 2L4VA 3SEDA 1YVBI 4CJNA 3S5CA 1CYVA 1HU9A 8CHOA 3JUPA 1I3FA 2MC8A 5M19A 1RMSA 1UDII 3UB1A 1EA2A 1FUTA 2YFJB 3X42A 5AIIA 3FG3A 3DGMA 3WOFB 1E3VA 3NUVA 1FA3A 1BNEA 5D81A 2B24B 1BRGA 1I0VA
chains in the Genus database with same CATH topology
5IENA 3G6E3 3Q90A 3CC23 5CF1A 1LOXA 3FGYA 3EX9A 4N6LA 2CFDA 1K734 3KFQC 3LTBA 3JUMA 2CH9A 3CNXA 4X2HA 2OOVA 1A2VA 1WQLB 3EN1B 5FGOA 1W5ZA 2BO9B 2FGTA 3Q2PA 3DMCA 2HMNB 3V92A 3MSOA 5FW5A 3GAXA 1JN5A 3FG1A 3WMDA 3MPHA 3K63A 2MF7A 1BUQA 3OV4A 3FKAA 4XBTA 1VQL3 5AI1A 4BTWA 4X2OA 3LMLA 1JB4A 4LZIA 2Y74A 2KRTA 7STDA 4FMBA 1QVF2 4HKVB 3GZRA 4HYZA 3AMOA 3WA2X 1JJ22 1YI23 2W0QA 1K9M4 3A76A 1Z1SA 3S67A 4ZM8A 5AEUB 2FNQA 1U8CB 3DXOA 3PGBA 3CCR3 2GEYA 3NV0B 1W4NA 3IPTA 3NX0A 1WNHA 3DUKA 3OW22 1AR0A 1IQXA 3FSDA 1ULJB 4EYCA 3LTDA 1OGZA 3NM7A 2HMJB 4ORLA 1S723 4AKZA 1NJI4 1A90A 4CCVA 1S5AA 2D42A 4EXRA 4RNYA 1GY7A 1M1XB 3RDEA 1PU4A 3ALAA 4AKYA 4QWTA 1U5OA 1TP6A 2P09A 2GEXA 1VQN3 2WOHA 3N8BA 1VQM3 3M8CA 1DMQA 3D3LA 3VF1A 1OHPA 4OK0A 1YIT3 4XDWA 3FG4A 5IW9A 3LH4A 2IUJA 1N9JA 3H3HA 4G1MB 4Q53A 4O8SA 3EBYA 3CD63 3BNCA 1IDPA 1V74A 2WO0A 3U97A 5KP4A 3NBRA 4PEJA 3HIIA 3F8HA 1IVVA 1K41A 2QEX3 1Q864 4RBNA 1GS3A 3X3XA 3HK4A 3QK9A 1SQWA 3JUOA 3KKGA 1MNLA 1N9EA 4MMXB 1E97A 3I563 1FGRA 2FXTA 4LGQA 2BMOB 4HZ9B 4HM7B 2B1XB 2CFKA 5G2GA 4J8TA 4L8PA 1F8NA 1OGXA 4HM1B 1W2B2 1STFI 1W6YA 2YFIB 2F98A 5TGNA 3G4S3 2QA43 3SX1A 1G96A 5AEWB 1VQP3 5EEOA 4N6MA 4O2HA 2P0XA 2W2CA 1K28A 4N6OB 1WTHA 3F40A 3H51A 1IVXA 2E2VA 3MYTA 5IERA 3JUQA 2HMOB 2RFRA 4H61A 3K7CA 2Z77A 1TFOA 3DZLA 2XGNA 3CC73 1DMNA 1IT8A 3FLJA 2CWVA 4MMYB 3EB8A 3HI7A 4FCMA 3GWRA 2OTL3 1FGMA 1LXEA 2CFLA 4MEIA 1AVLA 5A0OB 2P38A 3G16A 3F8XA 2SBLA 3NV0A 4TX4A 1N8R4 3IJEB 3PCSA 4STDA 1WMPA 3EBTA 3B8LA 3CNMA 2RGQA 4EV2A 3JVCA 4WP5A 4WYKA 5IG3A 1Q40B 1KWIA 4GB5A 4FCJA 2ML5A 1OPYA 2OOVC 1JN5B 3I553 3X3ZA 1SIIA 5CLKA 1GD3A 2RCDA 3VGNA 1M904 2XSHB 1FGTA 1QALA 1QJGA 1QMAA 1Q40A 1AV4A 3LXUX 3V98A 1VQO3 4HM6B 2V1LA 5IEOA 2CG1A 3ER7A 3QRDA 2XGLA 1T5YA 1IV9A 2A15A 5DRVA 1OUNA 1E3RA 2C11A 1VQ53 1YHQ3 3MG3A 3G8ZA 5LC7A 3CMA3 1EQKA 1OHOA 1W6CA 2F86B 3NXJA 3CCJ3 4WHAA 4IPBA 3T8UA 3B7CA 1JRQA 2UX0A 3DGNA 4NREA 3FF0A 3KSPA 3CCE3 1TUHA 2CWUA 3U1WA 3CCV3 1WMNA 3WOEB 4N3VA 3B4PA 4CDLA 4HM0B 4R1KA 1JKGA 1N5PA 3F7XA 4IT7A 2O9UX 1A67A 1D6UA 3WDGB 2KCDA 3O8YA 4RNZA 2W04A 3DM8A 1W02A 4N6TA 2CKFB 1GD4A 1C7HA 3HIGA 4FCZA 1ULIB 2IMJA 2QGUA 4EC6A 1AVKA 4XBYA 3CCL3 4LEHA 5ELJA 1OACA 2KXGA 2Q07A 1L5GB 1YIJ3 3K0ZA 3J7Yd 3OXAA 2Z76A 2XFSA 4KFDA 4XM4A 4WFOA 2STDA 4HBRA 2BNGA 2W56A 2R4IA 4HM5B 1UUVB 4HJLB 1NB5I 1QVG2 3FCSB 3GZXB 3HX8A 3CXC2 1W01A 2WGQA 2XH9A 2F99A 1N8QA 2O3OA 2OQEA 3LOYA 1GY5A 1Q7Y4 2GU3A 4N6UA 3DY5A 5CF2A 5AYRB 4I4KA 1DVDA 4JF8A 3T0UA 1M1K4 4R9KA 2W9QA 4XDVA 1KC84 3FH1A 1CYUA 1RN7A 3KSED 5LC6A 5BVBA 1OHSA 1TFKA 4HM2B 5JBSA 4U13A 1GYBA 4K90B 1FUWA 2E2TA 1CQSA 5HGRA 4FMCA 3KE7A 2WGOA 3N9HA 1VZZA 5IEPA 5KP3A 1ZO2A 3F7SA 3B4OA 3CU3A 1EKMA 1Y4KA 4IIAA 1ZX2A 3OWSA 1RRHA 1UUWB 1O7HB 3KN4A 3UL6A 3CCM3 4R4KA 4O02B 5IG4A 5EQLA 2W6JH 1YGEA 4N6NB 3PXMA 5I97A 4JRFA 2CFWA 1IQYA 4WWUC 5CK6A 2BHMA 2Z6BA 2YFLB 3BNBA 2P0MA 2XEPA 4FMAA 4O3VA 2INXA 5IG0A 3NM2A 1R4CA 1TU5A 3LTAA 3EF8A 1W7CA 3UL5A 3OX9A 1OF5B 1IVUA 3OWYA 4R9LA 1NB3I 2W03A 3EN8A 1W00A 2M7OA 4HM3B 4BTXA 2ZL8A 1KQS2 3PYJA 3WA3A 1KSIA 1UW1A 3LT9A 3RGAA 1VQ63 5STDA 3CPW2 1NU3A 3SOYA 3TDGA 2OCTA 2XFTA 3JUNA 3MKIA 1MOLA 3SXXA 3KIIA 2HMLB 3EC9A 4WYKB 1VQ93 1DMMA 4K1VA 2CC3A 2XSOB 4N6V0 2CW9A 3CPOA 1KD14 4NHFA 3UJMA 3S27A 3CCS3 1OCVA 4K61A 4XB5A 1IU7A 2K0MA 4HM8B 1N5HA 3DGOA 3LYGA 5ELUA 4KVHA 1D6YA 1SPUA 3GZYB 3PZWA 3NQYA 3LTCA 4EV5A 5AIFA 3CCQ3 1IT7A 3D9RA 1NDOB 5CXOA 3SVAA 1HKXA 1O7PB 3MG2A 5D83A 4LMIA 3OWUA 3GRDA 3N54B 3X3YA 4HZBB 2CIUA 2OWPA 3PCRA 1Q824 1FGOA 3IMAB 3LZAA 3FZWA 1LVNA 2JDIH 1US1A 2HMMB 4GL6A 2CWTA 1JB2A 1JV2B 1IQ8A 2IA7A 1M9GA 2LYXA 4R80A 2IUKA 1YJW3 1W6GA 3Q1CA 2GU1A 2HMKB 2Y73A 3NQZA 2JQ5A 1DVCA 5DREA 1OF5A 3AMOB 3NBBA 4MMZB 3S28A 3STDA 1JKGB 1VQ83 1VQ73 3ECFA 1SIHA 3LT8A 5EVHA 5JPPA 1GY6A 3DGLA 2D1WA 3SOAA 3I0YA 4OUQA 5IG5A 1DYUA 2C10A 4AEQA 1D6ZA 5KP1A 2BMRB 3GZBA 3BB9A 1UI7A 1O7GB 3CME3 3WODG 1IV7A 1IVWA 1WMOA 3V99A 4KFFA 2Z7AA 1UI8A 1RJOA 5IF6A 2I9WA 3ROBA 3G713 4HM4B 1JB5A 2W56B 3UNLA 2OTJ3 4L7KA 2CFGA 1W2ZA 1STDA 2RSXA 2B24B 3NBJA 3S29A 3F14A 1ROAA 3HZPA 5AIHA 1RKYA 3NHXA 2ZDJA 2QIYA 2CG0A 4K1UA 2LQVA 1Q814 1O7MB 1NO3A 2OQEC 1IK3A 4BTYA 3VSYA 2GBWB 1LNHA 2P05A 3MWZA 1YJ93 4EBGA 4L8OA 2W9PA 1NWWA 1TIJA 1VQ43 1ASKA 1O7WB 4MJDA 1CEWI 2GXFA 2PZVA 1FGQA 2XF3A 3K5TA 4J9AA 4LSOA 5D82A 3EE1A 3X40A 2BMQB 1QAFA 3E99A 3T8NA 1OH0A 5AIGA 2E2UA 4KFEA 2BT3A 2WOFA 4HVNA 4FR9A 4OVMA 3K9MC 2GBXB 4RZMA 5JPUA 3MG1A 1QAKA 3FF2A 3CCU3 3EHCA 3RGRA 4FMDA 3F9SA 1A2KA 3CC43 1ISKA 1Q42A 2XRXB 1JNQA 3EQQB 3KZTA 1J2BA 4XBXA 1YJN3 1VQK3 3PS8A 3MHEA 3BNDA 1EG9B 3G0KA 5AYSC 4KZ1A 1K8A4 1RRLA 2CK3H 2K54A 2ML6A 2CHCA 3BLZA 2XR8B 1PFPA 1O7NB 3EJVA 5BXQA 6STDA 1ROVA 1SJWA 2YX9A 3SLUA 3L0RA 4H3UA 2L4VA 3SEDA 1YVBI 3S5CA 1CYVA 1HU9A 8CHOA 3JUPA 2MC8A 3UB1A 1EA2A 2YFJB 3X42A 5AIIA 3FG3A 3DGMA 3WOFB 1E3VA 3NUVA 1FA3A 5D81A 3BNEA 2PNCA 3X41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IEN A;  2HMK B;  2R4I A;  4HM5 B;  1UUV B;  4HJL B;  2JQ5 A;  3Q90 A;  2W2C A;  1OF5 A;  5DRE A;  3STD A;  1JKG B;  3GZX B;  3F40 A;  3H51 A;  3HX8 A;  3ECF A;  1W01 A;  5CF1 A;  2F99 A;  1GY5 A;  3MYT A;  3FGY A;  1GY6 A;  5EVH A;  3EX9 A;  3JUQ A;  5IER A;  5JPP A;  2HMO B;  2RFR A;  3SOA A;  5CF2 A;  4X2H A;  3I0Y A;  3JUM A;  3CNX A;  4I4K A;  4OUQ A;  5IG5 A;  1WQL B;  3EN1 B;  3K7C A;  2Z77 A;  4R9K A;  3DMC A;  4XDV A;  2HMN B;  3DZL A;  5KP1 A;  2BMR B;  3MSO A;  3FH1 A;  5FW5 A;  3GZB A;  1JN5 A;  3BB9 A;  1DMN A;  3WMD A;  3UNL A;  5BVB A;  3FLJ A;  1O7G B;  1OHS A;  4HM2 B;  4U13 A;  1BUQ A;  1GYB A;  3OV4 A;  3FKA A;  4FCM A;  4XBT A;  3GWR A;  5AI1 A;  4X2O A;  1CQS A;  2Z7A A;  5HGR A;  5IF6 A;  2I9W A;  1JB4 A;  3KE7 A;  1VZZ A;  3ROB A;  4HM4 B;  1JB5 A;  5IEP A;  7STD A;  5KP3 A;  1ZO2 A;  3F7S A;  3F8X A;  3G16 A;  3B4O A;  3GZR A;  3CU3 A;  1STD A;  3NV0 A;  4HKV B;  4L7K A;  4IIA A;  3F14 A;  1ZX2 A;  3OWS A;  4STD A;  3HZP A;  1UUW B;  3A76 A;  1Z1S A;  1O7H B;  5G2G A;  3EBT A;  3B8L A;  5AEU B;  3CNM A;  2RGQ A;  5AIH A;  3NHX A;  3DXO A;  5TGN A;  2QIY A;  2GEY A;  4WP5 A;  4K1U A;  5IG4 A;  3NV0 B;  4WYK A;  1O7M B;  5IG3 A;  3IPT A;  1Q40 B;  3VSY A;  4GB5 A;  3DUK A;  2GBW B;  1AR0 A;  4FCJ A;  4WWU C;  5CK6 A;  3FSD A;  1OPY A;  1ULJ B;  1JN5 B;  2YFL B;  4L8O A;  1OGZ A;  2INX A;  2HMJ B;  4ORL A;  5CLK A;  1NWW A;  2RCD A;  5IG0 A;  3VGN A;  1O7W B;  1QJG A;  1ASK A;  2XSH B;  1QMA A;  1Q40 A;  2GXF A;  2PZV A;  3EF8 A;  3NM2 A;  4MJD A;  3OX9 A;  1OF5 B;  1S5A A;  3OWY A;  4J9A A;  1GY7 A;  5D82 A;  4R9L A;  4HM6 B;  2BMQ B;  3E99 A;  3EN8 A;  1W00 A;  1U5O A;  4HM3 B;  5IEO A;  3ER7 A;  1OH0 A;  5AIG A;  3T8N A;  1TP6 A;  2A15 A;  5DRV A;  2GEX A;  4HVN A;  1OUN A;  1E3R A;  4OVM A;  3M8C A;  3RGA A;  5STD A;  1DMQ A;  2GBX B;  4RZM A;  5JPU A;  3MG1 A;  1NU3 A;  3G8Z A;  1OHP A;  3FF2 A;  3MG3 A;  3SOY A;  3JUN A;  3MKI A;  3EHC A;  4XDW A;  2HML B;  3EC9 A;  4WYK B;  1DMM A;  4K1V A;  1OHO A;  2XSO B;  3RGR A;  3F9S A;  1A2K A;  2F86 B;  3NXJ A;  1Q42 A;  1ISK A;  2XRX B;  3T8U A;  3B7C A;  2UX0 A;  3CPO A;  3H3H A;  3FF0 A;  3KSP A;  3UJM A;  1TUH A;  3EQQ B;  4Q53 A;  3KZT A;  1OCV A;  3EBY A;  4N3V A;  4XB5 A;  3B4P A;  4HM8 B;  1IDP A;  3LYG A;  4XBX A;  4CDL A;  5KP4 A;  4HM0 B;  4R1K A;  1JKG A;  3NBR A;  4KVH A;  3MHE A;  4PEJ A;  3F7X A;  3GZY B;  1EG9 B;  3F8H A;  1K41 A;  3G0K A;  5AIF A;  3D9R A;  1NDO B;  5CXO A;  2K54 A;  3DM8 A;  1W02 A;  1GS3 A;  1HKX A;  1O7P B;  2CKF B;  2CHC A;  1O7N B;  2XR8 B;  1C7H A;  3BLZ A;  3EJV A;  1SJW A;  3HK4 A;  3MG2 A;  4H3U A;  5D83 A;  5BXQ A;  6STD A;  3JUO A;  4LMI A;  1ULI B;  3KKG A;  1E97 A;  2IMJ A;  3OWU A;  3SED A;  3GRD A;  2QGU A;  4LGQ A;  4HZB B;  2BMO B;  4HZ9 B;  3S5C A;  4HM7 B;  2B1X B;  4XBY A;  2OWP A;  4J8T A;  4L8P A;  1OGX A;  4LEH A;  3JUP A;  4HM1 B;  8CHO A;  3LZA A;  1W6Y A;  2YFI B;  2F98 A;  1EA2 A;  3FZW A;  3K0Z A;  2YFJ B;  2Z76 A;  3OXA A;  4XM4 A;  5AEW B;  5AII A;  1E3V A;  2HMM B;  3NUV A;  2STD A;  5D81 A;  1JB2 A;  2B24 B;  2BNG A; 
#chains in the Genus database with same CATH topology
 5IEN A;  3G6E 3;  1JBT A;  2CX1 A;  3Q90 A;  2KF3 A;  3CC2 3;  1YGW A;  5CF1 A;  1LOX A;  4DKI A;  2KAA A;  1HZ1 A;  3FGY A;  3EX9 A;  7GSP A;  1LNI A;  2CFD A;  4N6L A;  1X1U A;  1K73 4;  3KFQ C;  1RGL A;  3LTB A;  3JUM A;  2CH9 A;  3CNX A;  4X2H A;  2OOV A;  4BU4 A;  1A2V A;  1WQL B;  3EN1 B;  5FGO A;  1W5Z A;  2BO9 B;  2FGT A;  3Q2P A;  1BNI A;  3DMC A;  2HMN B;  3V92 A;  3MSO A;  5FW5 A;  3GAX A;  5BU4 A;  1JN5 A;  3FG1 A;  3WMD A;  1BU4 A;  3K63 A;  1GOV A;  2MF7 A;  3MPH A;  1BUQ A;  3OV4 A;  3FKA A;  4XBT A;  1LQG C;  3RNT A;  1VQL 3;  1B2X A;  5AI1 A;  4BTW A;  4X2O A;  3LML A;  1UCJ A;  3SYU A;  1JB4 A;  4CPK A;  1BRI A;  4LZI A;  2Y74 A;  2KRT A;  7STD A;  4FMB A;  1QVF 2;  4HKV B;  3GZR A;  2BIR A;  4HYZ A;  4HOH A;  1BSC A;  3AMO A;  1BRS A;  3WA2 X;  1LOV A;  1YI2 3;  2W0Q A;  1K9M 4;  1JJ2 2;  3A76 A;  1Z1S A;  3S67 A;  1TRQ A;  4ZM8 A;  1I2E A;  5AEU B;  1X1W A;  1U8C B;  2FNQ A;  3DXO A;  3PGB A;  3WHO A;  3CCR 3;  2GEY A;  3NV0 B;  1W4N A;  1RN1 A;  1YVS A;  3IPT A;  3NX0 A;  1T2I A;  1WNH A;  1T2H A;  3DUK A;  3OW2 2;  1AR0 A;  1IQX A;  3FSD A;  1ULJ B;  4EYC A;  3LTD A;  1OGZ A;  3NM7 A;  2HMJ B;  1BRJ A;  4ORL A;  4AKZ A;  1S72 3;  1NJI 4;  1A90 A;  5GSP A;  4CCV A;  1S5A A;  1UGH I;  2D42 A;  4EXR A;  4RNY A;  1GY7 A;  1EUI C;  1M1X B;  3D5I A;  3ALA A;  3RDE A;  6RNT A;  1PU4 A;  4AKY A;  4QWT A;  1U5O A;  2SAR A;  4BL3 A;  3HOH A;  1TP6 A;  2P09 A;  2C4B A;  2GEX A;  1VQN 3;  2WOH A;  3N8B A;  1VQM 3;  3M8C A;  1AY7 A;  1DMQ A;  3D3L A;  3VF1 A;  1OHP A;  4OK0 A;  1YIT 3;  4ILF A;  4XDW A;  3FG4 A;  5IW9 A;  3LH4 A;  1UUG B;  1BNR A;  2IUJ A;  3DH2 A;  1N9J A;  3H3H A;  1Q7H A;  4G1M B;  1VQQ A;  4Q53 A;  4O8S A;  3EBY A;  3CD6 3;  3BNC A;  1IDP A;  1V74 A;  2WO0 A;  3U97 A;  2J8X B;  1V58 A;  5KP4 A;  1RN4 A;  3NBR A;  4PEJ A;  1BSD A;  3HII A;  2HOH A;  3F8H A;  1IVV A;  1K41 A;  2QEX 3;  1UCL A;  1Q86 4;  4RBN A;  1GS3 A;  3X3X A;  3HK4 A;  3QK9 A;  1SQW A;  3JUO A;  4LYL B;  3KKG A;  1MNL A;  1N9E A;  2L1S A;  1E97 A;  4MMX B;  1FGR A;  3I56 3;  2FXT A;  4LGQ A;  2BMO B;  4HZ9 B;  4HM7 B;  2B1X B;  2CFK A;  5G2G A;  1BVI A;  3GSP A;  1F8N A;  1OGX A;  4HM1 B;  4J8T A;  4L8P A;  1W2B 2;  1STF I;  1W6Y A;  2YFI B;  2F98 A;  5TGN A;  3G4S 3;  2F5W A;  2QA4 3;  3SX1 A;  1G96 A;  5AEW B;  1VQP 3;  3ZG5 A;  1MGW A;  5EEO A;  4N6M A;  4O2H A;  2P0X A;  2W2C A;  1K28 A;  1V57 A;  1RGH A;  4N6O B;  1WTH A;  3F40 A;  3H51 A;  1IVX A;  1GSP A;  2E2V A;  3MYT A;  5IER A;  3JUQ A;  2HMO B;  2RFR A;  1R4Y A;  4H61 A;  1RGE A;  1GOY A;  3D5G A;  3K7C A;  2Z77 A;  1TFO A;  3DZL A;  2XGN A;  3CC7 3;  1DMN A;  1IT8 A;  1LQM B;  3FLJ A;  2CWV A;  2K3D A;  4MMY B;  3EB8 A;  3AHW A;  3HI7 A;  4FCM A;  3GWR A;  2OTL 3;  1FGM A;  1LXE A;  2CFL A;  4MEI A;  1HYF A;  1AVL A;  1BNS A;  1BSB A;  3D79 A;  5A0O B;  2P38 A;  3G16 A;  1BNF A;  3F8X A;  2SBL A;  3NV0 A;  4TX4 A;  1N8R 4;  3IJE B;  2ZHX B;  3PCS A;  4STD A;  1WMP A;  4I5Q A;  3AGN A;  5BIR A;  2AAE A;  3EBT A;  3B8L A;  1DET A;  3CNM A;  2RGQ A;  4EV2 A;  1LOY A;  1I3I A;  3JVC A;  4WP5 A;  4WYK A;  5IG3 A;  1Q40 B;  1KWI A;  3BU4 A;  4GB5 A;  4J5K A;  4FCJ A;  3ZG0 A;  1G02 A;  2ML5 A;  1OPY A;  2OOV C;  1JN5 B;  3I55 3;  2IY2 A;  3X3Z A;  1SII A;  5CLK A;  1GD3 A;  2RCD A;  3VGN A;  3WR2 A;  1M90 4;  1FGT A;  1QAL A;  1QJG A;  1T3B A;  1QMA A;  1Q40 A;  2XSH B;  3BIR A;  1AV4 A;  2UGI A;  3LXU X;  3V98 A;  1VQO 3;  1SAR A;  1PYL A;  2KF5 A;  1BRK A;  2RBI A;  1RNB A;  4HM6 B;  2V1L A;  5IEO A;  2CG1 A;  3ER7 A;  3QRD A;  2XGL A;  1T5Y A;  1IV9 A;  3KCH A;  2A15 A;  5DRV A;  1RSN A;  1OUN A;  1E3R A;  2C11 A;  1VQ5 3;  1YHQ 3;  3MG3 A;  3G8Z A;  2CX0 A;  5LC7 A;  3CMA 3;  1B21 A;  1EQK A;  2F56 A;  1OHO A;  1X1X A;  1EEJ A;  1W6C A;  2F86 B;  3NXJ A;  3CCJ 3;  3AGO A;  4WHA A;  4IPB A;  3T8U A;  1RDS A;  1JRQ A;  2UX0 A;  3B7C A;  3DGN A;  4NRE A;  3FF0 A;  3KSP A;  3CCE 3;  1TUH A;  2CWU A;  3U1W A;  3CCV 3;  1BNG A;  1WMN A;  3WOE B;  4N3V A;  1UCK A;  3B4P A;  4CDL A;  4HM0 B;  4R1K A;  1JKG A;  1N5P A;  2H0I A;  1FYS A;  2O9U X;  3F7X A;  4IT7 A;  1A67 A;  1D6U A;  3WDG B;  2KCD A;  3O8Y A;  4RNZ A;  2W04 A;  3DM8 A;  1W02 A;  4N6T A;  2CKF B;  1GD4 A;  1RNT A;  1C7H A;  1GMP A;  3HIG A;  4FCZ A;  1I2F A;  1ULI B;  2IMJ A;  1JBS A;  2QGU A;  4EC6 A;  4BIR A;  1AVK A;  1IYY A;  4XBY A;  3CCL 3;  4LEH A;  5ELJ A;  1OAC A;  2KXG A;  2Q07 A;  1L5G B;  1YIJ 3;  3K0Z A;  3J7Y d;  1BAN A;  3OXA A;  2Z76 A;  2XFS A;  4KFD A;  4XM4 A;  4WFO A;  2RNT A;  2STD A;  4HBR A;  3X41 A;  5RNT A;  1TTO A;  2BNG A;  2W56 A;  2R4I A;  4HM5 B;  1UUV B;  1GOU A;  4GSP A;  4HJL B;  1NB5 I;  1QVG 2;  3FCS B;  1MWU A;  3GZX B;  3HX8 A;  3CXC 2;  1W01 A;  2WGQ A;  2XH9 A;  2F99 A;  1N8Q A;  2O3O A;  2OQE A;  3LOY A;  1GY5 A;  5G1K A;  2GU3 A;  1Q7Y 4;  4N6U A;  3DY5 A;  5CF2 A;  5AYR B;  4I4K A;  2R41 A;  1DVD A;  4JF8 A;  3T0U A;  1M1K 4;  4R9K A;  2W9Q A;  4XDV A;  6GSP A;  1KC8 4;  3FH1 A;  1C54 A;  1CYU A;  1RN7 A;  3BNE A;  3KSE D;  5LC6 A;  5BVB A;  1OHS A;  1TFK A;  4HM2 B;  5JBS A;  4U13 A;  1GYB A;  5HOH A;  4K90 B;  1FUW A;  2E2T A;  1CQS A;  5HGR A;  4FMC A;  3KE7 A;  9RNT A;  1JZO A;  2WGO A;  2KF6 A;  1I2G A;  3N9H A;  1VZZ A;  4EW5 A;  2H0H A;  5IEP A;  5KP3 A;  2F5M A;  1ZO2 A;  3F7S A;  1X1Y A;  3B4O A;  3CU3 A;  1EKM A;  1Y4K A;  4IIA A;  1ZX2 A;  3OWS A;  1RGK A;  1RRH A;  1UUW B;  1O7H B;  1RCL A;  3KN4 A;  4HAA A;  3UL6 A;  1I8V A;  3CCM 3;  1ZGX A;  4R4K A;  4O02 B;  5IG4 A;  5EQL A;  2W6J H;  1YGE A;  4N6N B;  1BSA A;  3PXM A;  5I97 A;  4NPB A;  4JRF A;  2CFW A;  1IQY A;  4WWU C;  1I0X A;  2BHM A;  2Z6B A;  5CK6 A;  1AQZ A;  2YFL B;  3BNB A;  2P0M A;  2XEP A;  4FMA A;  4O3V A;  2INX A;  5IG0 A;  1BRH A;  3NM2 A;  1R4C A;  1TU5 A;  3LTA A;  3EF8 A;  1W7C A;  3UL5 A;  3OX9 A;  1OF5 B;  1IVU A;  1G0T A;  1NNV A;  3OWY A;  1MWR A;  4R9L A;  1NB3 I;  2W03 A;  3EN8 A;  1W00 A;  2M7O A;  4HM3 B;  4BTX A;  2ZL8 A;  5M1A A;  1KQS 2;  3A5E A;  3PYJ A;  3WA3 A;  1KSI A;  1UW1 A;  1RGF A;  2GSP A;  4BL2 A;  3LT9 A;  3RGA A;  4RNT A;  5STD A;  1VQ6 3;  1PY3 A;  3CPW 2;  1BRN L;  1FW7 A;  1NU3 A;  3SOY A;  3TDG A;  1B3S A;  2OCT A;  2XFT A;  3JUN A;  1MOL A;  3MKI A;  3KII A;  3SXX A;  2HML B;  3EC9 A;  1GMR A;  4WYK B;  1DMM A;  1VQ9 3;  4K1V A;  2CC3 A;  2XSO B;  4N6V 0;  3AHS A;  2CW9 A;  2ZA4 A;  2BU4 A;  3CPO A;  1KD1 4;  4NHF A;  3UJM A;  3S27 A;  3CCS 3;  1OCV A;  4K61 A;  4XB5 A;  1IU7 A;  2K0M A;  4HM8 B;  1N5H A;  3DGO A;  3LYG A;  5ELU A;  4KVH A;  1D6Y A;  1SPU A;  3GZY B;  3PZW A;  3NQY A;  3LTC A;  4EV5 A;  5AIF A;  3CCQ 3;  1IT7 A;  3D9R A;  1NDO B;  5CXO A;  2PNC A;  3SVA A;  1HKX A;  1O7P B;  3MG2 A;  1RTU A;  5D83 A;  4LMI A;  1LRA A;  3OWU A;  1TJD A;  3GRD A;  3N54 B;  3X3Y A;  4HZB B;  1RGC A;  2CIU A;  2OWP A;  3PCR A;  1Q82 4;  1FGO A;  3IMA B;  3LZA A;  3Q3F A;  3FZW A;  2H0G A;  1LVN A;  2JDI H;  1US1 A;  1MWS A;  2HMM B;  4GL6 A;  1BAO A;  2CWT A;  1JB2 A;  1JV2 B;  1IQ8 A;  1M9G A;  2IA7 A;  2LYX A;  4R80 A;  2IUK A;  7RNT A;  1YJW 3;  1W6G A;  3Q1C A;  2GU1 A;  2HMK B;  2Y73 A;  3NQZ A;  2JQ5 A;  1DVC A;  5DRE A;  1OF5 A;  1Q9E A;  3AMO B;  3NBB A;  4MMZ B;  3S28 A;  1JKG B;  3STD A;  1VQ8 3;  1VQ7 3;  3ECF A;  1YNV X;  2F4Y A;  1DE3 A;  1SIH A;  3LT8 A;  1FUS A;  5EVH A;  5JPP A;  1GY6 A;  3DGL A;  1RCK A;  2D1W A;  3SOA A;  3I0Y A;  4OUQ A;  1FZU A;  5IG5 A;  1DYU A;  2C10 A;  4AEQ A;  4GHO A;  4J5G A;  3URP A;  1JBR A;  1BIR A;  1D6Z A;  2BMR B;  5G1L A;  5KP1 A;  3GZB A;  1B2S A;  2UUG C;  3BB9 A;  1UI7 A;  1O7G B;  1BSE A;  3CME 3;  3WOD G;  1IV7 A;  1IVW A;  1WMO A;  3V99 A;  1BNJ A;  3D4A A;  4KT3 B;  4KFF A;  2AAD A;  2Z7A A;  1UI8 A;  1RJO A;  5IF6 A;  2I9W A;  1BGS A;  1JZD A;  3ROB A;  3DGY A;  4HM4 B;  1JB5 A;  3G71 3;  1GMQ A;  2W56 B;  3UNL A;  2OTJ 3;  1CH0 A;  2CFG A;  1W2Z A;  1STD A;  2RSX A;  3NBJ A;  4L7K A;  3S29 A;  1RLS A;  3F14 A;  1ROA A;  3HZP A;  1I70 A;  5AIH A;  1RKY A;  3NHX A;  2ZDJ A;  2QIY A;  2CG0 A;  4K1U A;  2LQV A;  1Q81 4;  1O7M B;  1NO3 A;  2OQE C;  1UGI A;  1IK3 A;  4BTY A;  3VSY A;  2GBW B;  1LNH A;  1A2P A;  2P05 A;  3MWZ A;  4EBG A;  1YJ9 3;  4L8O A;  1B20 A;  2W9P A;  2KF4 A;  1NWW A;  1TIJ A;  1VQ4 3;  1ASK A;  1O7W B;  4MJD A;  1CEW I;  1TRP A;  2GXF A;  2PZV A;  1BUJ A;  1UCI A;  1FGQ A;  2XF3 A;  3K5T A;  1MWT A;  4J9A A;  4LSO A;  5D82 A;  3EE1 A;  3X40 A;  2BMQ B;  1QAF A;  1B2Z A;  1LOW A;  3E99 A;  3T8N A;  1OH0 A;  5AIG A;  2E2U A;  4KFE A;  1MGR A;  1B27 A;  2BT3 A;  2WOF A;  4HVN A;  1B2U A;  4FR9 A;  4OVM A;  3K9M C;  2GBX B;  4RZM A;  1RGG A;  5JPU A;  3MG1 A;  1QAK A;  3FF2 A;  1BOX A;  3CCU 3;  2IYJ A;  1RGA A;  3EHC A;  1ZS7 A;  3RGR A;  4FMD A;  3F9S A;  1A2K A;  3CC4 3;  1ISK A;  1Q42 A;  1RHL A;  2XRX B;  1JNQ A;  3EQQ B;  3KZT A;  1J2B A;  4XBX A;  1YJN 3;  1VQK 3;  3ZFZ A;  3PS8 A;  3MHE A;  3BND A;  1EG9 B;  3G0K A;  5M18 A;  5AYS C;  4KZ1 A;  1K8A 4;  1RRL A;  2CK3 H;  2K54 A;  2ML6 A;  2CHC A;  3BLZ A;  2XR8 B;  1PFP A;  1O7N B;  3EJV A;  5BXQ A;  6STD A;  1ROV A;  1SJW A;  2YX9 A;  3SLU A;  3L0R A;  4H3U A;  1B2M A;  8RNT A;  2L4V A;  3SED A;  1YVB I;  4CJN A;  3S5C A;  1CYV A;  1HU9 A;  8CHO A;  3JUP A;  1I3F A;  2MC8 A;  5M19 A;  1RMS A;  1UDI I;  3UB1 A;  1EA2 A;  1FUT A;  2YFJ B;  3X42 A;  5AII A;  3FG3 A;  3DGM A;  3WOF B;  1E3V A;  3NUV A;  1FA3 A;  1BNE A;  5D81 A;  2B24 B;  1BRG A;  1I0V A; 
#chains in the Genus database with same CATH homology
 5IEN A;  3G6E 3;  3Q90 A;  3CC2 3;  5CF1 A;  1LOX A;  3FGY A;  3EX9 A;  4N6L A;  2CFD A;  1K73 4;  3KFQ C;  3LTB A;  3JUM A;  2CH9 A;  3CNX A;  4X2H A;  2OOV A;  1A2V A;  1WQL B;  3EN1 B;  5FGO A;  1W5Z A;  2BO9 B;  2FGT A;  3Q2P A;  3DMC A;  2HMN B;  3V92 A;  3MSO A;  5FW5 A;  3GAX A;  1JN5 A;  3FG1 A;  3WMD A;  3MPH A;  3K63 A;  2MF7 A;  1BUQ A;  3OV4 A;  3FKA A;  4XBT A;  1VQL 3;  5AI1 A;  4BTW A;  4X2O A;  3LML A;  1JB4 A;  4LZI A;  2Y74 A;  2KRT A;  7STD A;  4FMB A;  1QVF 2;  4HKV B;  3GZR A;  4HYZ A;  3AMO A;  3WA2 X;  1JJ2 2;  1YI2 3;  2W0Q A;  1K9M 4;  3A76 A;  1Z1S A;  3S67 A;  4ZM8 A;  5AEU B;  2FNQ A;  1U8C B;  3DXO A;  3PGB A;  3CCR 3;  2GEY A;  3NV0 B;  1W4N A;  3IPT A;  3NX0 A;  1WNH A;  3DUK A;  3OW2 2;  1AR0 A;  1IQX A;  3FSD A;  1ULJ B;  4EYC A;  3LTD A;  1OGZ A;  3NM7 A;  2HMJ B;  4ORL A;  1S72 3;  4AKZ A;  1NJI 4;  1A90 A;  4CCV A;  1S5A A;  2D42 A;  4EXR A;  4RNY A;  1GY7 A;  1M1X B;  3RDE A;  1PU4 A;  3ALA A;  4AKY A;  4QWT A;  1U5O A;  1TP6 A;  2P09 A;  2GEX A;  1VQN 3;  2WOH A;  3N8B A;  1VQM 3;  3M8C A;  1DMQ A;  3D3L A;  3VF1 A;  1OHP A;  4OK0 A;  1YIT 3;  4XDW A;  3FG4 A;  5IW9 A;  3LH4 A;  2IUJ A;  1N9J A;  3H3H A;  4G1M B;  4Q53 A;  4O8S A;  3EBY A;  3CD6 3;  3BNC A;  1IDP A;  1V74 A;  2WO0 A;  3U97 A;  5KP4 A;  3NBR A;  4PEJ A;  3HII A;  3F8H A;  1IVV A;  1K41 A;  2QEX 3;  1Q86 4;  4RBN A;  1GS3 A;  3X3X A;  3HK4 A;  3QK9 A;  1SQW A;  3JUO A;  3KKG A;  1MNL A;  1N9E A;  4MMX B;  1E97 A;  3I56 3;  1FGR A;  2FXT A;  4LGQ A;  2BMO B;  4HZ9 B;  4HM7 B;  2B1X B;  2CFK A;  5G2G A;  4J8T A;  4L8P A;  1F8N A;  1OGX A;  4HM1 B;  1W2B 2;  1STF I;  1W6Y A;  2YFI B;  2F98 A;  5TGN A;  3G4S 3;  2QA4 3;  3SX1 A;  1G96 A;  5AEW B;  1VQP 3;  5EEO A;  4N6M A;  4O2H A;  2P0X A;  2W2C A;  1K28 A;  4N6O B;  1WTH A;  3F40 A;  3H51 A;  1IVX A;  2E2V A;  3MYT A;  5IER A;  3JUQ A;  2HMO B;  2RFR A;  4H61 A;  3K7C A;  2Z77 A;  1TFO A;  3DZL A;  2XGN A;  3CC7 3;  1DMN A;  1IT8 A;  3FLJ A;  2CWV A;  4MMY B;  3EB8 A;  3HI7 A;  4FCM A;  3GWR A;  2OTL 3;  1FGM A;  1LXE A;  2CFL A;  4MEI A;  1AVL A;  5A0O B;  2P38 A;  3G16 A;  3F8X A;  2SBL A;  3NV0 A;  4TX4 A;  1N8R 4;  3IJE B;  3PCS A;  4STD A;  1WMP A;  3EBT A;  3B8L A;  3CNM A;  2RGQ A;  4EV2 A;  3JVC A;  4WP5 A;  4WYK A;  5IG3 A;  1Q40 B;  1KWI A;  4GB5 A;  4FCJ A;  2ML5 A;  1OPY A;  2OOV C;  1JN5 B;  3I55 3;  3X3Z A;  1SII A;  5CLK A;  1GD3 A;  2RCD A;  3VGN A;  1M90 4;  2XSH B;  1FGT A;  1QAL A;  1QJG A;  1QMA A;  1Q40 A;  1AV4 A;  3LXU X;  3V98 A;  1VQO 3;  4HM6 B;  2V1L A;  5IEO A;  2CG1 A;  3ER7 A;  3QRD A;  2XGL A;  1T5Y A;  1IV9 A;  2A15 A;  5DRV A;  1OUN A;  1E3R A;  2C11 A;  1VQ5 3;  1YHQ 3;  3MG3 A;  3G8Z A;  5LC7 A;  3CMA 3;  1EQK A;  1OHO A;  1W6C A;  2F86 B;  3NXJ A;  3CCJ 3;  4WHA A;  4IPB A;  3T8U A;  3B7C A;  1JRQ A;  2UX0 A;  3DGN A;  4NRE A;  3FF0 A;  3KSP A;  3CCE 3;  1TUH A;  2CWU A;  3U1W A;  3CCV 3;  1WMN A;  3WOE B;  4N3V A;  3B4P A;  4CDL A;  4HM0 B;  4R1K A;  1JKG A;  1N5P A;  3F7X A;  4IT7 A;  2O9U X;  1A67 A;  1D6U A;  3WDG B;  2KCD A;  3O8Y A;  4RNZ A;  2W04 A;  3DM8 A;  1W02 A;  4N6T A;  2CKF B;  1GD4 A;  1C7H A;  3HIG A;  4FCZ A;  1ULI B;  2IMJ A;  2QGU A;  4EC6 A;  1AVK A;  4XBY A;  3CCL 3;  4LEH A;  5ELJ A;  1OAC A;  2KXG A;  2Q07 A;  1L5G B;  1YIJ 3;  3K0Z A;  3J7Y d;  3OXA A;  2Z76 A;  2XFS A;  4KFD A;  4XM4 A;  4WFO A;  2STD A;  4HBR A;  2BNG A;  2W56 A;  2R4I A;  4HM5 B;  1UUV B;  4HJL B;  1NB5 I;  1QVG 2;  3FCS B;  3GZX B;  3HX8 A;  3CXC 2;  1W01 A;  2WGQ A;  2XH9 A;  2F99 A;  1N8Q A;  2O3O A;  2OQE A;  3LOY A;  1GY5 A;  1Q7Y 4;  2GU3 A;  4N6U A;  3DY5 A;  5CF2 A;  5AYR B;  4I4K A;  1DVD A;  4JF8 A;  3T0U A;  1M1K 4;  4R9K A;  2W9Q A;  4XDV A;  1KC8 4;  3FH1 A;  1CYU A;  1RN7 A;  3KSE D;  5LC6 A;  5BVB A;  1OHS A;  1TFK A;  4HM2 B;  5JBS A;  4U13 A;  1GYB A;  4K90 B;  1FUW A;  2E2T A;  1CQS A;  5HGR A;  4FMC A;  3KE7 A;  2WGO A;  3N9H A;  1VZZ A;  5IEP A;  5KP3 A;  1ZO2 A;  3F7S A;  3B4O A;  3CU3 A;  1EKM A;  1Y4K A;  4IIA A;  1ZX2 A;  3OWS A;  1RRH A;  1UUW B;  1O7H B;  3KN4 A;  3UL6 A;  3CCM 3;  4R4K A;  4O02 B;  5IG4 A;  5EQL A;  2W6J H;  1YGE A;  4N6N B;  3PXM A;  5I97 A;  4JRF A;  2CFW A;  1IQY A;  4WWU C;  5CK6 A;  2BHM A;  2Z6B A;  2YFL B;  3BNB A;  2P0M A;  2XEP A;  4FMA A;  4O3V A;  2INX A;  5IG0 A;  3NM2 A;  1R4C A;  1TU5 A;  3LTA A;  3EF8 A;  1W7C A;  3UL5 A;  3OX9 A;  1OF5 B;  1IVU A;  3OWY A;  4R9L A;  1NB3 I;  2W03 A;  3EN8 A;  1W00 A;  2M7O A;  4HM3 B;  4BTX A;  2ZL8 A;  1KQS 2;  3PYJ A;  3WA3 A;  1KSI A;  1UW1 A;  3LT9 A;  3RGA A;  1VQ6 3;  5STD A;  3CPW 2;  1NU3 A;  3SOY A;  3TDG A;  2OCT A;  2XFT A;  3JUN A;  3MKI A;  1MOL A;  3SXX A;  3KII A;  2HML B;  3EC9 A;  4WYK B;  1VQ9 3;  1DMM A;  4K1V A;  2CC3 A;  2XSO B;  4N6V 0;  2CW9 A;  3CPO A;  1KD1 4;  4NHF A;  3UJM A;  3S27 A;  3CCS 3;  1OCV A;  4K61 A;  4XB5 A;  1IU7 A;  2K0M A;  4HM8 B;  1N5H A;  3DGO A;  3LYG A;  5ELU A;  4KVH A;  1D6Y A;  1SPU A;  3GZY B;  3PZW A;  3NQY A;  3LTC A;  4EV5 A;  5AIF A;  3CCQ 3;  1IT7 A;  3D9R A;  1NDO B;  5CXO A;  3SVA A;  1HKX A;  1O7P B;  3MG2 A;  5D83 A;  4LMI A;  3OWU A;  3GRD A;  3N54 B;  3X3Y A;  4HZB B;  2CIU A;  2OWP A;  3PCR A;  1Q82 4;  1FGO A;  3IMA B;  3LZA A;  3FZW A;  1LVN A;  2JDI H;  1US1 A;  2HMM B;  4GL6 A;  2CWT A;  1JB2 A;  1JV2 B;  1IQ8 A;  2IA7 A;  1M9G A;  2LYX A;  4R80 A;  2IUK A;  1YJW 3;  1W6G A;  3Q1C A;  2GU1 A;  2HMK B;  2Y73 A;  3NQZ A;  2JQ5 A;  1DVC A;  5DRE A;  1OF5 A;  3AMO B;  3NBB A;  4MMZ B;  3S28 A;  3STD A;  1JKG B;  1VQ8 3;  1VQ7 3;  3ECF A;  1SIH A;  3LT8 A;  5EVH A;  5JPP A;  1GY6 A;  3DGL A;  2D1W A;  3SOA A;  3I0Y A;  4OUQ A;  5IG5 A;  1DYU A;  2C10 A;  4AEQ A;  1D6Z A;  5KP1 A;  2BMR B;  3GZB A;  3BB9 A;  1UI7 A;  1O7G B;  3CME 3;  3WOD G;  1IV7 A;  1IVW A;  1WMO A;  3V99 A;  4KFF A;  2Z7A A;  1UI8 A;  1RJO A;  5IF6 A;  2I9W A;  3ROB A;  3G71 3;  4HM4 B;  1JB5 A;  2W56 B;  3UNL A;  2OTJ 3;  4L7K A;  2CFG A;  1W2Z A;  1STD A;  2RSX A;  2B24 B;  3NBJ A;  3S29 A;  3F14 A;  1ROA A;  3HZP A;  5AIH A;  1RKY A;  3NHX A;  2ZDJ A;  2QIY A;  2CG0 A;  4K1U A;  2LQV A;  1Q81 4;  1O7M B;  1NO3 A;  2OQE C;  1IK3 A;  4BTY A;  3VSY A;  2GBW B;  1LNH A;  2P05 A;  3MWZ A;  1YJ9 3;  4EBG A;  4L8O A;  2W9P A;  1NWW A;  1TIJ A;  1VQ4 3;  1ASK A;  1O7W B;  4MJD A;  1CEW I;  2GXF A;  2PZV A;  1FGQ A;  2XF3 A;  3K5T A;  4J9A A;  4LSO A;  5D82 A;  3EE1 A;  3X40 A;  2BMQ B;  1QAF A;  3E99 A;  3T8N A;  1OH0 A;  5AIG A;  2E2U A;  4KFE A;  2BT3 A;  2WOF A;  4HVN A;  4FR9 A;  4OVM A;  3K9M C;  2GBX B;  4RZM A;  5JPU A;  3MG1 A;  1QAK A;  3FF2 A;  3CCU 3;  3EHC A;  3RGR A;  4FMD A;  3F9S A;  1A2K A;  3CC4 3;  1ISK A;  1Q42 A;  2XRX B;  1JNQ A;  3EQQ B;  3KZT A;  1J2B A;  4XBX A;  1YJN 3;  1VQK 3;  3PS8 A;  3MHE A;  3BND A;  1EG9 B;  3G0K A;  5AYS C;  4KZ1 A;  1K8A 4;  1RRL A;  2CK3 H;  2K54 A;  2ML6 A;  2CHC A;  3BLZ A;  2XR8 B;  1PFP A;  1O7N B;  3EJV A;  5BXQ A;  6STD A;  1ROV A;  1SJW A;  2YX9 A;  3SLU A;  3L0R A;  4H3U A;  2L4V A;  3SED A;  1YVB I;  3S5C A;  1CYV A;  1HU9 A;  8CHO A;  3JUP A;  2MC8 A;  3UB1 A;  1EA2 A;  2YFJ B;  3X42 A;  5AII A;  3FG3 A;  3DGM A;  3WOF B;  1E3V A;  3NUV A;  1FA3 A;  5D81 A;  3BNE A;  2PNC A;  3X41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...