2PZVA

Crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound phenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Testing Electrostatic complementarity in Enzyme Catalysis: Hydrogen Bonding in the Ketosteroid Isomerase Oxyanion Hole
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 32
structure length 123
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2pzvA00
1Z1SA 3A76A 2STDA 5BXQA 1OH0A 5IENA 4HM2B 1BUQA 3FSDA 2BMRB 2IMJA 2YFLB 1ULJB 2YFJB 1W6YA 4STDA 1QMAA 4WYKB 3JUPA 4ORLA 1Q40A 4U13A 3RGRA 4XB5A 2BMQB 2CHCA 1AR0A 2W2CA 3B7CA 4HVNA 2GEXA 2HMOB 2B1XB 4R9LA 5JPPA 3NHXA 1NDOB 2UX0A 2HMNB 3D9RA 1GYBA 4X2HA 3DXOA 3K0ZA 3NM2A 4HM7B 4LEHA 1JB2A 4Q53A 3FKAA 3EQQB 5IG3A 2A15A 3H51A 3UNLA 4LGQA 3NUVA 1ZO2A 3FH1A 2GBWB 3EN8A 4I4KA 3CNXA 3OXAA 3T8UA 3CPOA 3T8NA 4HM3B 2F98A 3DUKA 3KKGA 3MYTA 2GXFA 2R4IA 3ER7A 3EX9A 3STDA 1Q42A 1OHOA 2HMKB 3VGNA 1NU3A 2XSHB 2Z76A 5IG4A 1EG9B 1O7WB 1ISKA 3F8HA 3KSPA 3OV4A 4HM8B 2INXA 3NXJA 4HZBB 4XBXA 3NV0B 3EHCA 2F86B 2F99A 3GZRA 3CU3A 3F40A 1TP6A 3K7CA 4IIAA 5CK6A 3M8CA 2Z77A 5AIIA 5IG5A 2I9WA 2YFIB 3GZXB 1O7HB 5AEWB 3F7SA 3GRDA 3HK4A 1WQLB 4R1KA 4PEJA 3FZWA 1ZX2A 1JKGB 3FGYA 3SEDA 4HM5B 3B8LA 5DRVA 4HM1B 3ROBA 5D82A 3MG1A 5AIFA 5STDA 1OF5B 3LYGA 1ULIB 3HX8A 3SOYA 4GB5A 4CDLA 2JQ5A 3KE7A 4N3VA 2CKFB 4RZMA 2RGQA 3EC9A 5CF2A 1JN5A 3MSOA 3JUQA 3FLJA 1O7NB 4KVHA 4H3UA 1CQSA 1OHSA 3S5CA 3HZPA 3KZTA 1NWWA 3GWRA 3F9SA 1OPYA 4HKVB 2QIYA 1EA2A 4R9KA 1O7PB 3MG2A 3G16A 1ASKA 3GZYB 4K1VA 3MG3A 3OWSA 4XDWA 4J8TA 1DMNA 5CLKA 5HGRA 3JUNA 3GZBA 4FCJA 3NV0A 3EN1B 3F7XA 5G2GA 5IF6A 3DMCA 3H3HA 3RGAA 8CHOA 4WWUC 5KP1A 1W02A 2RFRA 4XDVA 3B4OA 3EJVA 1U5OA 2HMMB 3DM8A 1OGZA 1JKGA 1TUHA 3IPTA 3ECFA 1GY7A 5AI1A 4FCMA 2B24B 1OGXA 5EVHA 4OVMA 2XR8B 2XRXB 5D81A 5KP4A 1E3VA 4LMIA 3OWYA 4L8OA 4WP5A 1S5AA 5AIGA 1SJWA 3FF2A 5IEPA 1OF5A 3MKIA 4HM0B 3Q90A 4XBTA 4L8PA 2RCDA 4HM4B 1JN5B 4HM6B 4OUQA 3DZLA 3EBYA 1GY6A 5CXOA 5KP3A 3MHEA 3FF0A 1O7MB 3E99A 3G8ZA 1DMMA 2BMOB 3F14A 7STDA 5CF1A 3BB9A 4WYKA 2BNGA 4MJDA 1UUVB 2K54A 3JUMA 3VSYA 1Q40B 3JUOA 1HKXA 4XM4A 5DREA 5AEUB 3UJMA 2HMLB 1STDA 3NBRA 1E97A 5JPUA 5BVBA 5D83A 1W01A 3B4PA 1GY5A 2HMJB 3F8XA 1UUWB 1IDPA 3CNMA 2Z7AA 1DMQA 5AIHA 3OX9A 3OWUA 4J9AA 1GS3A 4HJLB 4HZ9B 5IEOA 3BLZA 2QGUA 1OHPA 4XBYA 5IERA 6STDA 1VZZA 3I0YA 5FW5A 1OUNA 1W00A 2GEYA 1C7HA 2OWPA 3SOAA 1QJGA 1E3RA 1K41A 3EF8A 3EBTA 2XSOB 4K1UA 3G0KA 5TGNA 1JB5A 1A2KA 1JB4A 3LZAA 5IG0A 1O7GB 2GBXB 4X2OA 1OCVA 3WMDA 4L7KA 2PZVA
chains in the Genus database with same CATH superfamily
1LOYA 1MWUA 3X3ZA 5BXQA 1OH0A 2IY2A 1FGTA 5RNTA 4KT3B 1G96A 1UGHI 2IMJA 2KF5A 4RNYA 2C10A 2YFJB 1AV4A 1BNJA 2CX1A 1B27A 4ORLA 1W6GA 1TFKA 1WMOA 2BMQB 2F56A 2BO9B 2ML6A 3KFQC 1BRJA 1NB3I 2HMOB 4HVNA 3S29A 2CIUA 2PZVA 3D9RA 1LQGC 1GYBA 1BRKA 3K0ZA 4HM7B 4LEHA 2P05A 1B2XA 4N6V0 3IMAB 5EQLA 1IQ8A 3FKAA 1Y4KA 1VQ73 3FG1A 3HIGA 3URPA 2P0XA 3H51A 1FGOA 3UNLA 3LTAA 4I4KA 2CFDA 1SIIA 4BTWA 4HM3B 3I563 1M9GA 1Q824 3DUKA 2MC8A 1B2MA 1VQL3 3STDA 3ER7A 1I0VA 3KSED 2OCTA 2GSPA 1NU3A 2H0GA 4N6LA 2L4VA 2HOHA 5IG4A 1O7WB 2XGNA 3NQZA 4HM8B 2OQEA 4TX4A 1BGSA 1GSPA 2E2TA 3NV0B 3EHCA 4DKIA 5IG5A 5AIIA 3M8CA 2J8XB 3F7SA 3DGLA 3GRDA 1WQLB 4R1KA 3N9HA 1ZX2A 1JKGB 3FGYA 1RKYA 3SEDA 1MWSA 1IVUA 3K63A 1T2HA 4CCVA 5DRVA 1W5ZA 2BIRA 3FCSB 2ML5A 4FMBA 2P09A 3IJEB 1ULIB 3HX8A 3LYGA 2C4BA 4CDLA 4N3VA 1BNSA 2CKFB 3EC9A 3LT9A 3JUQA 1BNFA 2KF3A 5LC6A 3HZPA 3S5CA 3GWRA 4R4KA 1OPYA 4HKVB 2QIYA 1EA2A 4MEIA 3MG2A 5ELJA 2K0MA 1YIT3 1ASKA 1FUSA 1OACA 1W7CA 3GZYB 3DGNA 3MG3A 4XDWA 2BU4A 1U8CB 2L1SA 2C11A 2OQEC 5CLKA 3PYJA 3NV0A 4N6OB 5G2GA 3X41A 3DMCA 4N6UA 3LTBA 3GAXA 3V92A 1WNHA 1KSIA 3PXMA 3EJVA 4XDVA 3DM8A 3LTCA 1MWRA 2D1WA 5EVHA 1GMRA 1RDSA 1RTUA 2W0QA 1E3VA 4L8OA 1N5HA 2IYJA 4WP5A 4BTXA 1SJWA 1RN1A 1IT8A 1RSNA 1IK3A 2WGOA 4HM4B 1X1YA 2AADA 1JN5B 3EBYA 2F4YA 2D42A 1O7MB 3MHEA 2WOFA 4EV2A 1IVXA 3CCV3 3CD63 1FZUA 3NBBA 4FCZA 4MJDA 1VQK3 1G0TA 1Q40B 1HKXA 3JUOA 5AEUB 3L0RA 1YJW3 3NBRA 5D83A 1VQ43 3WODG 1ZGXA 4J5GA 2HMJB 3F8XA 1LNHA 1IDPA 1UUWB 4O2HA 1DMQA 1MWTA 1JBRA 3OX9A 3OWUA 5IEOA 1PFPA 2QGUA 2UGIA 4RNZA 3I0YA 5FW5A 3G713 3SOAA 1E3RA 1D6YA 1AVLA 1RN7A 1W2ZA 1BRSA 1L5GB 2XSOB 5TGNA 5IG0A 1A2VA 1TIJA 1UDII 2KRTA 3RDEA 1DVDA 1WMPA 1GOVA 2FXTA 4XB5A 2K3DA 1ZS7A 3AHWA 4ZM8A 1K28A 4WYKB 1B2SA 1GMPA 1RGKA 3K9MC 3LMLA 3UJMA 1KC84 1I2GA 3BNBA 4MMYB 1N5PA 4XBTA 1FGRA 4R9LA 2ZHXB 1S723 1QVF2 3NHXA 1NDOB 1IQXA 3N8BA 3DXOA 3TDGA 4HBRA 1J2BA 3S67A 1NNVA 3BNCA 3EQQB 1FUWA 4LGQA 3NUVA 1HZ1A 3DGMA 1RGEA 2F5MA 3CNXA 3OXAA 1LOXA 3CPOA 3T8UA 3ALAA 1YJN3 1BRIA 3MYTA 2GXFA 2R4IA 3EX9A 2HMKB 3WR2A 3VGNA 1RMSA 2Z76A 1EKMA 1MOLA 4HZBB 2CFLA 1EEJA 4GL6A 1LRAA 3D3LA 3JVCA 3CU3A 1RNTA 1TP6A 2UUGC 3DH2A 4BTYA 2YFIB 3GZXB 5AEWB 1LOWA 1LQMB 1RRHA 1AQZA 1JV2B 5G1LA 4HM1B 2KF6A 3CCL3 1V57A 3SLUA 1HU9A 5AIFA 4BL3A 4I5QA 3LT8A 2W56B 4WHAA 1BAOA 4KVHA 1O7NB 4H3UA 1ROVA 3RNTA 1NO3A 1Q7HA 1VQO3 1M904 3G16A 3CPW2 1BANA 1B20A 1WMNA 1IV7A 1I2FA 3Q2PA 3X40A 1V74A 3JUNA 1BSEA 3V98A 4N6NB 2OOVC 4NPBA 3EN1B 3F7XA 4RNTA 1YHQ3 5IF6A 1VQN3 1GD4A 1HYFA 2E2VA 1QAKA 5BU4A 3QK9A 4WWUC 2IA7A 2RFRA 3B4OA 1U5OA 2HMMB 1PYLA 1JKGA 1TUHA 1GY7A 3PGBA 2CG1A 2XRXB 5KP4A 1X1WA 3OWYA 1LVNA 5M1AA 5IEPA 3MKIA 2W56A 2JDIH 2CH9A 1KQS2 1BSDA 3I553 2YX9A 3E99A 3S28A 5G1KA 4LZIA 2RSXA 2BNGA 2K54A 1SIHA 2HMLB 1Q814 3CMA3 3HOHA 1E97A 4KFEA 2LQVA 4EC6A 3BU4A 3N54B 6GSPA 3CNMA 2Z7AA 4FMCA 2W9PA 4N6TA 2W04A 1FGMA 4HZ9B 1IVWA 4XBYA 1DE3A 1IVVA 1VZZA 2KF4A 3D5GA 3FG4A 5EEOA 1X1UA 1JZDA 2CFKA 4AKYA 1QJGA 2SARA 3KCHA 1UCIA 3GSPA 3CC23 3G4S3 1W6CA 1RJOA 3LZAA 2CWTA 1O7GB 2GBXB 1VQ53 1VQ83 4MMXB 8CHOA 3SX1A 1CEWI 1R4CA 1Q9EA 3LH4A 1Z1SA 1EQKA 2STDA 5IENA 3S27A 1BU4A 1BUQA 1C54A 3FSDA 2BMRB 1N8R4 1ULJB 1N9EA 1BNEA 1W6YA 1QMAA 3CCU3 4U13A 1Q40A 3K5TA 5A0OB 1W2B2 1N8QA 2CHCA 2W2CA 2H0HA 2B1XB 4J5KA 2UX0A 4OK0A 3V99A 4X2HA 3NM2A 3PS8A 1JB2A 1A2PA 2XFTA 3NX0A 1JZOA 4Q53A 4EXRA 5IG3A 1YVSA 2AAEA 2PNCA 1ZO2A 4G1MB 3D79A 4O8SA 3CCE3 4QWTA 1PU4A 1IV9A 3T8NA 2CG0A 1MGWA 3KKGA 2CK3H 4BU4A 3SXXA 1OHOA 2Q07A 2XSHB 1FA3A 1SQWA 2XEPA 3F8HA 2R41A 3A5EA 2KAAA 1RRLA 1VQ63 2XF3A 3CCQ3 1UI8A 3GZRA 1ISKA 4IIAA 1I2EA 2W6JH 4EV5A 2FNQA 4HOHA 2I9WA 3WA3A 1B21A 1O7HB 1TTOA 3HI7A 1BIRA 3U1WA 1A67A 1GD3A 4PEJA 1PY3A 3X42A 1ROAA 2F5WA 4HM5B 3B8LA 1YVBI 1CH0A 2KCDA 1QALA 1US1A 3MG1A 3NQYA 4N6MA 1OF5B 1TJDA 1IT7A 1M1K4 1IU7A 1YNVX 2RGQA 4WFOA 1JBSA 2ZL8A 3MSOA 2Y73A 1OHSA 5BIRA 1NB5I 3BIRA 3KZTA 5M18A 1RGCA 1SARA 3LTDA 1UCKA 1KD14 4K1VA 1YI23 3QRDA 3KIIA 1TU5A 1BOXA 4J8TA 1DMNA 1UGIA 3X3XA 4GSPA 5HGRA 4BL2A 1VQQA 4FCJA 3DGOA 4AKZA 2ZA4A 4LSOA 4KFFA 3WA2X 9RNTA 1BVIA 1DVCA 1YIJ3 4BIRA 1GOYA 5KP1A 1W02A 1I0XA 1OGZA 3IPTA 2OOVA 5ELUA 5AI1A 1VQM3 2B24B 3PCRA 2BHMA 2CC3A 4OVMA 1UUGB 5D81A 8RNTA 3AHSA 1S5AA 3FF2A 2IUKA 3HIIA 4H61A 2XFSA 1M1XB 3ZG5A 4OUQA 3MPHA 3BNDA 3DZLA 1GY6A 4HAAA 4NREA 3CCR3 1NJI4 2GU3A 3G8ZA 3DGYA 1DMMA 1D6ZA 7STDA 5CF1A 1SPUA 3BB9A 1VQP3 1BNIA 1IQYA 3AMOB 1T5YA 1STDA 1RGAA 3EB8A 1LNIA 1JBTA 1GY5A 2FGTA 2O9UX 4FMDA 5FGOA 3D4AA 3ZG0A 1BNGA 1RLSA 2CFGA 4HJLB 4J9AA 1QAFA 1OHPA 3FG3A 6STDA 1BSCA 1BSBA 5IERA 1W00A 2GEYA 1RCLA 2OWPA 1LOVA 2CW9A 3DY5A 3AGNA 1FGQA 3UL5A 3EBTA 1D6UA 3G0KA 4K1UA 3WOFB 1JB5A 2SBLA 4KFDA 4EBGA 3G6E3 3WMDA 1OCVA 3Q1CA 2XGLA 3Q90A 1YGWA 2WO0A 3CC43 3A76A 4HM2B 3UL6A 1BRNL 1T2IA 2YFLB 1Q7Y4 1RGFA 4STDA 3JUPA 3RGRA 3AMOA 3B7CA 1AR0A 3U97A 3SYUA 2GEXA 5JPPA 2H0IA 2HMNB 1F8NA 1RHLA 2LYXA 5IW9A 1AVKA 1AY7A 2A15A 1TFOA 1GMQA 1V58A 2GBWB 2MF7A 3FH1A 3EN8A 3Q3FA 4O3VA 3J7Yd 2QA43 1B2ZA 1K734 2F98A 1B2UA 1YJ93 1BUJA 3D5IA 2CX0A 3NM7A 1MNLA 1RNBA 1Q42A 2CWUA 5AYRB 7GSPA 4KZ1A 1EG9B 3KSPA 3OV4A 3LXUX 2P38A 1N9JA 2INXA 3NXJA 4JRFA 4XBXA 3T0UA 3WDGB 1CYUA 2Y74A 1STFI 2M7OA 2ZDJA 4ILFA 2F86B 2F99A 3UB1A 3K7CA 3F40A 5CK6A 3VSYA 3WHOA 5HOHA 2Z77A 4K90B 3NBJA 1I8VA 1VQ93 3HK4A 1RN4A 1BNRA 1I3FA 1R4YA 3FZWA 4LYLB 1A90A 1JRQA 3CCS3 1MGRA 4RBNA 4FMAA 4JF8A 5JBSA 1DYUA 3PZWA 3ROBA 5D82A 5AYSC 5STDA 3OW22 1K9M4 4AEQA 1DETA 1GOUA 3SOYA 3ZFZA 4GB5A 2GU1A 4K61A 2JQ5A 3KE7A 1YGEA 2E2UA 4RZMA 5CF2A 1JN5A 4EYCA 1KWIA 1G02A 3FLJA 1BRHA 1CQSA 1FUTA 1FW7A 1NWWA 3CCJ3 1UCLA 3F9SA 4R9KA 1O7PB 1RCKA 1TRPA 3OWSA 1QVG2 4CJNA 1I3IA 3GZBA 2V1LA 3LOYA 2QEX3 5LC7A 3H3HA 2RNTA 1LXEA 2KXGA 3RGAA 1K8A4 3WOEB 6RNTA 1TRQA 3KN4A 2CFWA 3VF1A 2W9QA 3ECFA 1UW1A 1JJ22 4FCMA 1JNQA 1OGXA 2XR8B 2IUJA 3CME3 4LMIA 3BNEA 1T3BA 5AIGA 1CYVA 1OF5A 1EUIC 4HM0B 4O02B 4MMZB 3SVAA 4L8PA 2RCDA 2BT3A 4HM6B 5CXOA 4NHFA 1B3SA 2O3OA 2Z6BA 3FF0A 5KP3A 3O8YA 2BMOB 3F14A 4FR9A 2WOHA 4IPBA 4WYKA 1UCJA 3PCSA 5I97A 1UUVB 2XH9A 3JUMA 2OTL3 1RGHA 4IT7A 4XM4A 5DREA 3CCM3 1Q864 5JPUA 3EE1A 2WGQA 7RNTA 5BVBA 1W01A 3B4PA 1IYYA 1BRGA 5AIHA 2RBIA 5GSPA 1BSAA 3CC73 2OTJ3 4CPKA 1GS3A 2W03A 1RGLA 4R80A 4EW5A 3BLZA 1RGGA 1OUNA 1I70A 3AGOA 1C7HA 1X1XA 1K41A 1UI7A 1W4NA 3EF8A 4HYZA 4GHOA 3CXC2 2P0MA 1WTHA 3MWZA 1A2KA 1JB4A 4X2OA 3X3YA 1FYSA 4L7KA 2CWVA 5M19A
chains in the Genus database with same CATH topology
3X3ZA 5BXQA 1OH0A 1FGTA 1G96A 2IMJA 4RNYA 2C10A 2YFJB 1AV4A 4ORLA 1W6GA 1TFKA 1WMOA 2BMQB 2ML6A 2BO9B 3KFQC 4XB5A 4HVNA 1NB3I 2HMOB 2CG1A 3S29A 2CIUA 3D9RA 1GYBA 3K0ZA 4HM7B 4LEHA 2P05A 4N6V0 3IMAB 5EQLA 1IQ8A 3FKAA 1Y4KA 1VQ73 3FG1A 3HIGA 2P0XA 3H51A 1FGOA 3UNLA 3LTAA 4I4KA 2CFDA 1SIIA 4BTWA 4HM3B 3I563 1M9GA 1Q824 3DUKA 2MC8A 1VQL3 3STDA 3ER7A 3KSED 2OCTA 1NU3A 4N6LA 2L4VA 5IG4A 1O7WB 2XGNA 3NQZA 4HM8B 2OQEA 4TX4A 2E2TA 3NV0B 3EHCA 5IG5A 5AIIA 3M8CA 3F7SA 3DGLA 3GRDA 1WQLB 4R1KA 3N9HA 1ZX2A 1JKGB 3FGYA 1RKYA 3SEDA 1IVUA 3K63A 4CCVA 5DRVA 1W5ZA 3FCSB 2ML5A 4FMBA 2P09A 3IJEB 1ULIB 3HX8A 3LYGA 4CDLA 4N3VA 2CKFB 3EC9A 3LT9A 3JUQA 5LC6A 3HZPA 3S5CA 3GWRA 4R4KA 1OPYA 4HKVB 2QIYA 1EA2A 4MEIA 3MG2A 5ELJA 2K0MA 1YIT3 1ASKA 3GZYB 1OACA 1W7CA 3MG3A 3DGNA 4XDWA 1U8CB 5CLKA 2C11A 2OQEC 3PYJA 3NV0A 4N6OB 5G2GA 3X41A 3DMCA 4N6UA 3LTBA 2CWVA 3GAXA 3V92A 1WNHA 1KSIA 3PXMA 3EJVA 4XDVA 3DM8A 3LTCA 2D1WA 5EVHA 2W0QA 1E3VA 4L8OA 1N5HA 4WP5A 4BTXA 1SJWA 1IT8A 1IK3A 2WGOA 4HM4B 1JN5B 3EBYA 3MHEA 2D42A 1O7MB 2WOFA 4EV2A 1IVXA 3CCV3 3CD63 3NBBA 4MJDA 4FCZA 1VQK3 1Q40B 3JUOA 1HKXA 5AEUB 3L0RA 1YJW3 3NBRA 5D83A 1VQ43 3WODG 2HMJB 3F8XA 1LNHA 1IDPA 1UUWB 4O2HA 1DMQA 3OX9A 3OWUA 5IEOA 1PFPA 2QGUA 4RNZA 3I0YA 5FW5A 3G713 3SOAA 1E3RA 1D6YA 1AVLA 1RN7A 1W2ZA 1L5GB 2XSOB 5TGNA 5IG0A 1A2VA 1TIJA 2KRTA 3RDEA 1DVDA 1WMPA 2FXTA 4ZM8A 1K28A 4WYKB 3UJMA 1KC84 3K9MC 3LMLA 3BNBA 4MMYB 1N5PA 4XBTA 1FGRA 4R9LA 1S723 1QVF2 3NHXA 1NDOB 1IQXA 3N8BA 3DXOA 3TDGA 4HBRA 1J2BA 3S67A 3BNCA 3EQQB 1FUWA 4LGQA 3NUVA 3DGMA 3CNXA 3OXAA 1LOXA 3CPOA 3T8UA 3ALAA 1YJN3 3MYTA 2GXFA 2R4IA 3EX9A 2HMKB 3VGNA 2Z76A 1EKMA 1MOLA 4HZBB 2CFLA 4GL6A 3D3LA 3JVCA 3CU3A 1TP6A 4BTYA 2YFIB 3GZXB 5AEWB 1RRHA 1JV2B 4HM1B 3CCL3 3SLUA 1HU9A 5AIFA 3LT8A 2W56B 4WHAA 4KVHA 1O7NB 4H3UA 1ROVA 1NO3A 1VQO3 1M904 3G16A 3CPW2 1WMNA 1IV7A 3Q2PA 3X40A 1V74A 3JUNA 3V98A 4N6NB 2OOVC 1VQN3 3EN1B 3F7XA 1YHQ3 5IF6A 1GD4A 2E2VA 1QAKA 3QK9A 4WWUC 2IA7A 2RFRA 3B4OA 1U5OA 2HMMB 1JKGA 1TUHA 1GY7A 3PGBA 2XRXB 5KP4A 3OWYA 1LVNA 5IEPA 3MKIA 2W56A 2JDIH 2CH9A 1KQS2 3I553 2YX9A 3E99A 3S28A 4LZIA 2RSXA 2BNGA 2K54A 1SIHA 2HMLB 1Q814 3CMA3 1E97A 4KFEA 2LQVA 4EC6A 3N54B 3CNMA 2Z7AA 4FMCA 2W9PA 4N6TA 2W04A 1FGMA 4HZ9B 1IVWA 4XBYA 1IVVA 1VZZA 3FG4A 5EEOA 2CFKA 4AKYA 1QJGA 3CC23 3G4S3 1W6CA 1RJOA 3LZAA 2CWTA 1O7GB 2GBXB 1VQ53 1VQ83 4MMXB 8CHOA 3SX1A 1CEWI 1R4CA 3LH4A 1EQKA 1Z1SA 2STDA 5IENA 3S27A 1BUQA 3FSDA 2BMRB 1N8R4 1ULJB 1N9EA 1W6YA 1QMAA 3CCU3 4U13A 1Q40A 3K5TA 5A0OB 1W2B2 1N8QA 2CHCA 2W2CA 2B1XB 2UX0A 4OK0A 3V99A 4X2HA 3NM2A 3PS8A 1JB2A 2XFTA 3NX0A 4Q53A 4EXRA 5IG3A 2PNCA 1ZO2A 4G1MB 3CCE3 4O8SA 4QWTA 1PU4A 1IV9A 3T8NA 2CG0A 3KKGA 2CK3H 3SXXA 1OHOA 2Q07A 2XSHB 1FA3A 1SQWA 2XEPA 3F8HA 1RRLA 1VQ63 2XF3A 3CCQ3 1UI8A 3GZRA 1ISKA 4IIAA 4EV5A 2W6JH 2FNQA 3WA3A 2I9WA 1O7HB 3HI7A 3U1WA 1A67A 1GD3A 4PEJA 3X42A 1ROAA 4HM5B 3B8LA 1YVBI 2KCDA 1QALA 1US1A 3MG1A 3NQYA 4N6MA 1OF5B 1IT7A 1M1K4 1IU7A 4WFOA 2RGQA 2ZL8A 3MSOA 2Y73A 1OHSA 1NB5I 3KZTA 3LTDA 1KD14 4K1VA 1YI23 3QRDA 3KIIA 1TU5A 4J8TA 1DMNA 3X3XA 5HGRA 4FCJA 3DGOA 4AKZA 4LSOA 4KFFA 3WA2X 1DVCA 1YIJ3 5KP1A 1W02A 1OGZA 3IPTA 2OOVA 5ELUA 5AI1A 1VQM3 2B24B 3PCRA 2BHMA 2CC3A 4OVMA 5D81A 1S5AA 3FF2A 2IUKA 3HIIA 4H61A 2XFSA 1M1XB 4OUQA 3MPHA 3BNDA 3DZLA 1GY6A 4NREA 3CCR3 1NJI4 2GU3A 3G8ZA 1DMMA 1D6ZA 7STDA 5CF1A 1SPUA 3BB9A 1VQP3 1IQYA 3AMOB 1T5YA 1STDA 3EB8A 1GY5A 2FGTA 2O9UX 4FMDA 5FGOA 2CFGA 4J9AA 4HJLB 1QAFA 1OHPA 3FG3A 6STDA 5IERA 1W00A 2GEYA 2OWPA 2CW9A 3DY5A 3UL5A 1FGQA 3EBTA 1D6UA 3G0KA 4K1UA 3WOFB 1JB5A 2SBLA 4KFDA 4EBGA 3G6E3 3WMDA 1OCVA 3Q1CA 2XGLA 3Q90A 2WO0A 3CC43 3A76A 4HM2B 3UL6A 2YFLB 1Q7Y4 4STDA 3JUPA 3RGRA 3AMOA 3B7CA 1AR0A 3U97A 2GEXA 5JPPA 2HMNB 1F8NA 5IW9A 2LYXA 1AVKA 2A15A 1TFOA 4O3VA 3FH1A 2GBWB 2MF7A 3J7Yd 3EN8A 2QA43 1K734 2F98A 1YJ93 3NM7A 1MNLA 1Q42A 2CWUA 5AYRB 4KZ1A 1EG9B 3KSPA 3OV4A 3LXUX 2P38A 1N9JA 2INXA 3NXJA 4JRFA 4XBXA 3T0UA 3WDGB 1CYUA 2Y74A 1STFI 2M7OA 2ZDJA 2F86B 2F99A 3UB1A 3K7CA 3F40A 5CK6A 3VSYA 2Z77A 4K90B 3NBJA 1VQ93 3HK4A 3FZWA 1A90A 1JRQA 3CCS3 4RBNA 4FMAA 4JF8A 5JBSA 1DYUA 3PZWA 3ROBA 5D82A 5AYSC 5STDA 3OW22 1K9M4 4AEQA 3SOYA 4GB5A 2GU1A 4K61A 2JQ5A 3KE7A 1YGEA 2E2UA 4RZMA 5CF2A 1JN5A 4EYCA 1KWIA 3FLJA 1CQSA 1NWWA 3CCJ3 3F9SA 4R9KA 1O7PB 3OWSA 1QVG2 3GZBA 2V1LA 3LOYA 2QEX3 5LC7A 3H3HA 1LXEA 2KXGA 3RGAA 1K8A4 3WOEB 3KN4A 2CFWA 3VF1A 2W9QA 3ECFA 1UW1A 1JJ22 4FCMA 1JNQA 1OGXA 2XR8B 2IUJA 3CME3 4LMIA 3BNEA 5AIGA 1CYVA 1OF5A 4HM0B 4O02B 4MMZB 3SVAA 4L8PA 2RCDA 2BT3A 4HM6B 5CXOA 4NHFA 5KP3A 2O3OA 2Z6BA 3FF0A 3O8YA 2BMOB 3F14A 4FR9A 2WOHA 4IPBA 4WYKA 5I97A 3PCSA 2OTL3 1UUVB 2XH9A 3JUMA 4XM4A 4IT7A 5DREA 3CCM3 1Q864 5JPUA 3EE1A 2WGQA 5BVBA 1W01A 3B4PA 5AIHA 3CC73 2OTJ3 1GS3A 2W03A 4R80A 3BLZA 1OUNA 1C7HA 1K41A 1UI7A 1W4NA 3EF8A 4HYZA 3CXC2 2P0MA 1WTHA 3MWZA 1A2KA 1JB4A 4X2OA 3X3YA 4L7KA 2PZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1S A;  3A76 A;  2STD A;  5BXQ A;  1OH0 A;  5IEN A;  4HM2 B;  1BUQ A;  3FSD A;  2BMR B;  2IMJ A;  2YFL B;  1ULJ B;  2YFJ B;  1W6Y A;  4STD A;  1QMA A;  4WYK B;  3JUP A;  4ORL A;  1Q40 A;  4U13 A;  3RGR A;  4XB5 A;  2BMQ B;  2CHC A;  1AR0 A;  2W2C A;  3B7C A;  4HVN A;  2GEX A;  2HMO B;  2B1X B;  4R9L A;  5JPP A;  3NHX A;  1NDO B;  2UX0 A;  2HMN B;  3D9R A;  1GYB A;  4X2H A;  3DXO A;  3K0Z A;  3NM2 A;  4HM7 B;  4LEH A;  1JB2 A;  4Q53 A;  3FKA A;  3EQQ B;  5IG3 A;  2A15 A;  3H51 A;  3UNL A;  4LGQ A;  3NUV A;  1ZO2 A;  3FH1 A;  2GBW B;  3EN8 A;  4I4K A;  3CNX A;  3OXA A;  3T8U A;  3CPO A;  3T8N A;  4HM3 B;  2F98 A;  3DUK A;  3KKG A;  3MYT A;  2GXF A;  2R4I A;  3ER7 A;  3EX9 A;  3STD A;  1Q42 A;  1OHO A;  2HMK B;  3VGN A;  1NU3 A;  2XSH B;  2Z76 A;  5IG4 A;  1EG9 B;  1O7W B;  1ISK A;  3F8H A;  3KSP A;  3OV4 A;  4HM8 B;  2INX A;  3NXJ A;  4HZB B;  4XBX A;  3NV0 B;  3EHC A;  2F86 B;  2F99 A;  3GZR A;  3CU3 A;  3F40 A;  1TP6 A;  3K7C A;  4IIA A;  5CK6 A;  3M8C A;  2Z77 A;  5AII A;  5IG5 A;  2I9W A;  2YFI B;  3GZX B;  1O7H B;  5AEW B;  3F7S A;  3GRD A;  3HK4 A;  1WQL B;  4R1K A;  4PEJ A;  3FZW A;  1ZX2 A;  1JKG B;  3FGY A;  3SED A;  4HM5 B;  3B8L A;  5DRV A;  4HM1 B;  3ROB A;  5D82 A;  3MG1 A;  5AIF A;  5STD A;  1OF5 B;  3LYG A;  1ULI B;  3HX8 A;  3SOY A;  4GB5 A;  4CDL A;  2JQ5 A;  3KE7 A;  4N3V A;  2CKF B;  4RZM A;  2RGQ A;  3EC9 A;  5CF2 A;  1JN5 A;  3MSO A;  3JUQ A;  3FLJ A;  1O7N B;  4KVH A;  4H3U A;  1CQS A;  1OHS A;  3S5C A;  3HZP A;  3KZT A;  1NWW A;  3GWR A;  3F9S A;  1OPY A;  4HKV B;  2QIY A;  1EA2 A;  4R9K A;  1O7P B;  3MG2 A;  3G16 A;  1ASK A;  3GZY B;  4K1V A;  3MG3 A;  3OWS A;  4XDW A;  4J8T A;  1DMN A;  5CLK A;  5HGR A;  3JUN A;  3GZB A;  4FCJ A;  3NV0 A;  3EN1 B;  3F7X A;  5G2G A;  5IF6 A;  3DMC A;  3H3H A;  3RGA A;  8CHO A;  4WWU C;  5KP1 A;  1W02 A;  2RFR A;  4XDV A;  3B4O A;  3EJV A;  1U5O A;  2HMM B;  3DM8 A;  1OGZ A;  1JKG A;  1TUH A;  3IPT A;  3ECF A;  1GY7 A;  5AI1 A;  4FCM A;  2B24 B;  1OGX A;  5EVH A;  4OVM A;  2XR8 B;  2XRX B;  5D81 A;  5KP4 A;  1E3V A;  4LMI A;  3OWY A;  4L8O A;  4WP5 A;  1S5A A;  5AIG A;  1SJW A;  3FF2 A;  5IEP A;  1OF5 A;  3MKI A;  4HM0 B;  3Q90 A;  4XBT A;  4L8P A;  2RCD A;  4HM4 B;  1JN5 B;  4HM6 B;  4OUQ A;  3DZL A;  3EBY A;  1GY6 A;  5CXO A;  5KP3 A;  3MHE A;  3FF0 A;  1O7M B;  3E99 A;  3G8Z A;  1DMM A;  2BMO B;  3F14 A;  7STD A;  5CF1 A;  3BB9 A;  4WYK A;  2BNG A;  4MJD A;  1UUV B;  2K54 A;  3JUM A;  3VSY A;  1Q40 B;  3JUO A;  1HKX A;  4XM4 A;  5DRE A;  5AEU B;  3UJM A;  2HML B;  1STD A;  3NBR A;  1E97 A;  5JPU A;  5BVB A;  5D83 A;  1W01 A;  3B4P A;  1GY5 A;  2HMJ B;  3F8X A;  1UUW B;  1IDP A;  3CNM A;  2Z7A A;  1DMQ A;  5AIH A;  3OX9 A;  3OWU A;  4J9A A;  1GS3 A;  4HJL B;  4HZ9 B;  5IEO A;  3BLZ A;  2QGU A;  1OHP A;  4XBY A;  5IER A;  6STD A;  1VZZ A;  3I0Y A;  5FW5 A;  1OUN A;  1W00 A;  2GEY A;  1C7H A;  2OWP A;  3SOA A;  1QJG A;  1E3R A;  1K41 A;  3EF8 A;  3EBT A;  2XSO B;  4K1U A;  3G0K A;  5TGN A;  1JB5 A;  1A2K A;  1JB4 A;  3LZA A;  5IG0 A;  1O7G B;  2GBX B;  4X2O A;  1OCV A;  3WMD A;  4L7K A;  2PZV A; 
#chains in the Genus database with same CATH topology
 1LOY A;  1MWU A;  3X3Z A;  5BXQ A;  1OH0 A;  2IY2 A;  1FGT A;  5RNT A;  4KT3 B;  1G96 A;  1UGH I;  2IMJ A;  2KF5 A;  4RNY A;  2C10 A;  2YFJ B;  1AV4 A;  1BNJ A;  2CX1 A;  1B27 A;  4ORL A;  1W6G A;  1TFK A;  1WMO A;  2BMQ B;  2F56 A;  2BO9 B;  2ML6 A;  3KFQ C;  1BRJ A;  1NB3 I;  2HMO B;  4HVN A;  3S29 A;  2CIU A;  2PZV A;  3D9R A;  1LQG C;  1GYB A;  1BRK A;  3K0Z A;  4HM7 B;  4LEH A;  2P05 A;  1B2X A;  4N6V 0;  3IMA B;  5EQL A;  1IQ8 A;  3FKA A;  1Y4K A;  1VQ7 3;  3FG1 A;  3HIG A;  3URP A;  2P0X A;  3H51 A;  1FGO A;  3UNL A;  3LTA A;  4I4K A;  2CFD A;  1SII A;  4BTW A;  4HM3 B;  3I56 3;  1M9G A;  1Q82 4;  3DUK A;  2MC8 A;  1B2M A;  1VQL 3;  3STD A;  3ER7 A;  1I0V A;  3KSE D;  2OCT A;  2GSP A;  1NU3 A;  2H0G A;  4N6L A;  2L4V A;  2HOH A;  5IG4 A;  1O7W B;  2XGN A;  3NQZ A;  4HM8 B;  2OQE A;  4TX4 A;  1BGS A;  1GSP A;  2E2T A;  3NV0 B;  3EHC A;  4DKI A;  5IG5 A;  5AII A;  3M8C A;  2J8X B;  3F7S A;  3DGL A;  3GRD A;  1WQL B;  4R1K A;  3N9H A;  1ZX2 A;  1JKG B;  3FGY A;  1RKY A;  3SED A;  1MWS A;  1IVU A;  3K63 A;  1T2H A;  4CCV A;  5DRV A;  1W5Z A;  2BIR A;  3FCS B;  2ML5 A;  4FMB A;  2P09 A;  3IJE B;  1ULI B;  3HX8 A;  3LYG A;  2C4B A;  4CDL A;  4N3V A;  1BNS A;  2CKF B;  3EC9 A;  3LT9 A;  3JUQ A;  1BNF A;  2KF3 A;  5LC6 A;  3HZP A;  3S5C A;  3GWR A;  4R4K A;  1OPY A;  4HKV B;  2QIY A;  1EA2 A;  4MEI A;  3MG2 A;  5ELJ A;  2K0M A;  1YIT 3;  1ASK A;  1FUS A;  1OAC A;  1W7C A;  3GZY B;  3DGN A;  3MG3 A;  4XDW A;  2BU4 A;  1U8C B;  2L1S A;  2C11 A;  2OQE C;  5CLK A;  3PYJ A;  3NV0 A;  4N6O B;  5G2G A;  3X41 A;  3DMC A;  4N6U A;  3LTB A;  3GAX A;  3V92 A;  1WNH A;  1KSI A;  3PXM A;  3EJV A;  4XDV A;  3DM8 A;  3LTC A;  1MWR A;  2D1W A;  5EVH A;  1GMR A;  1RDS A;  1RTU A;  2W0Q A;  1E3V A;  4L8O A;  1N5H A;  2IYJ A;  4WP5 A;  4BTX A;  1SJW A;  1RN1 A;  1IT8 A;  1RSN A;  1IK3 A;  2WGO A;  4HM4 B;  1X1Y A;  2AAD A;  1JN5 B;  3EBY A;  2F4Y A;  2D42 A;  1O7M B;  3MHE A;  2WOF A;  4EV2 A;  1IVX A;  3CCV 3;  3CD6 3;  1FZU A;  3NBB A;  4FCZ A;  4MJD A;  1VQK 3;  1G0T A;  1Q40 B;  1HKX A;  3JUO A;  5AEU B;  3L0R A;  1YJW 3;  3NBR A;  5D83 A;  1VQ4 3;  3WOD G;  1ZGX A;  4J5G A;  2HMJ B;  3F8X A;  1LNH A;  1IDP A;  1UUW B;  4O2H A;  1DMQ A;  1MWT A;  1JBR A;  3OX9 A;  3OWU A;  5IEO A;  1PFP A;  2QGU A;  2UGI A;  4RNZ A;  3I0Y A;  5FW5 A;  3G71 3;  3SOA A;  1E3R A;  1D6Y A;  1AVL A;  1RN7 A;  1W2Z A;  1BRS A;  1L5G B;  2XSO B;  5TGN A;  5IG0 A;  1A2V A;  1TIJ A;  1UDI I;  2KRT A;  3RDE A;  1DVD A;  1WMP A;  1GOV A;  2FXT A;  4XB5 A;  2K3D A;  1ZS7 A;  3AHW A;  4ZM8 A;  1K28 A;  4WYK B;  1B2S A;  1GMP A;  1RGK A;  3K9M C;  3LML A;  3UJM A;  1KC8 4;  1I2G A;  3BNB A;  4MMY B;  1N5P A;  4XBT A;  1FGR A;  4R9L A;  2ZHX B;  1S72 3;  1QVF 2;  3NHX A;  1NDO B;  1IQX A;  3N8B A;  3DXO A;  3TDG A;  4HBR A;  1J2B A;  3S67 A;  1NNV A;  3BNC A;  3EQQ B;  1FUW A;  4LGQ A;  3NUV A;  1HZ1 A;  3DGM A;  1RGE A;  2F5M A;  3CNX A;  3OXA A;  1LOX A;  3CPO A;  3T8U A;  3ALA A;  1YJN 3;  1BRI A;  3MYT A;  2GXF A;  2R4I A;  3EX9 A;  2HMK B;  3WR2 A;  3VGN A;  1RMS A;  2Z76 A;  1EKM A;  1MOL A;  4HZB B;  2CFL A;  1EEJ A;  4GL6 A;  1LRA A;  3D3L A;  3JVC A;  3CU3 A;  1RNT A;  1TP6 A;  2UUG C;  3DH2 A;  4BTY A;  2YFI B;  3GZX B;  5AEW B;  1LOW A;  1LQM B;  1RRH A;  1AQZ A;  1JV2 B;  5G1L A;  4HM1 B;  2KF6 A;  3CCL 3;  1V57 A;  3SLU A;  1HU9 A;  5AIF A;  4BL3 A;  4I5Q A;  3LT8 A;  2W56 B;  4WHA A;  1BAO A;  4KVH A;  1O7N B;  4H3U A;  1ROV A;  3RNT A;  1NO3 A;  1Q7H A;  1VQO 3;  1M90 4;  3G16 A;  3CPW 2;  1BAN A;  1B20 A;  1WMN A;  1IV7 A;  1I2F A;  3Q2P A;  3X40 A;  1V74 A;  3JUN A;  1BSE A;  3V98 A;  4N6N B;  2OOV C;  4NPB A;  3EN1 B;  3F7X A;  4RNT A;  1YHQ 3;  5IF6 A;  1VQN 3;  1GD4 A;  1HYF A;  2E2V A;  1QAK A;  5BU4 A;  3QK9 A;  4WWU C;  2IA7 A;  2RFR A;  3B4O A;  1U5O A;  2HMM B;  1PYL A;  1JKG A;  1TUH A;  1GY7 A;  3PGB A;  2CG1 A;  2XRX B;  5KP4 A;  1X1W A;  3OWY A;  1LVN A;  5M1A A;  5IEP A;  3MKI A;  2W56 A;  2JDI H;  2CH9 A;  1KQS 2;  1BSD A;  3I55 3;  2YX9 A;  3E99 A;  3S28 A;  5G1K A;  4LZI A;  2RSX A;  2BNG A;  2K54 A;  1SIH A;  2HML B;  1Q81 4;  3CMA 3;  3HOH A;  1E97 A;  4KFE A;  2LQV A;  4EC6 A;  3BU4 A;  3N54 B;  6GSP A;  3CNM A;  2Z7A A;  4FMC A;  2W9P A;  4N6T A;  2W04 A;  1FGM A;  4HZ9 B;  1IVW A;  4XBY A;  1DE3 A;  1IVV A;  1VZZ A;  2KF4 A;  3D5G A;  3FG4 A;  5EEO A;  1X1U A;  1JZD A;  2CFK A;  4AKY A;  1QJG A;  2SAR A;  3KCH A;  1UCI A;  3GSP A;  3CC2 3;  3G4S 3;  1W6C A;  1RJO A;  3LZA A;  2CWT A;  1O7G B;  2GBX B;  1VQ5 3;  1VQ8 3;  4MMX B;  8CHO A;  3SX1 A;  1CEW I;  1R4C A;  1Q9E A;  3LH4 A;  1Z1S A;  1EQK A;  2STD A;  5IEN A;  3S27 A;  1BU4 A;  1BUQ A;  1C54 A;  3FSD A;  2BMR B;  1N8R 4;  1ULJ B;  1N9E A;  1BNE A;  1W6Y A;  1QMA A;  3CCU 3;  4U13 A;  1Q40 A;  3K5T A;  5A0O B;  1W2B 2;  1N8Q A;  2CHC A;  2W2C A;  2H0H A;  2B1X B;  4J5K A;  2UX0 A;  4OK0 A;  3V99 A;  4X2H A;  3NM2 A;  3PS8 A;  1JB2 A;  1A2P A;  2XFT A;  3NX0 A;  1JZO A;  4Q53 A;  4EXR A;  5IG3 A;  1YVS A;  2AAE A;  2PNC A;  1ZO2 A;  4G1M B;  3D79 A;  4O8S A;  3CCE 3;  4QWT A;  1PU4 A;  1IV9 A;  3T8N A;  2CG0 A;  1MGW A;  3KKG A;  2CK3 H;  4BU4 A;  3SXX A;  1OHO A;  2Q07 A;  2XSH B;  1FA3 A;  1SQW A;  2XEP A;  3F8H A;  2R41 A;  3A5E A;  2KAA A;  1RRL A;  1VQ6 3;  2XF3 A;  3CCQ 3;  1UI8 A;  3GZR A;  1ISK A;  4IIA A;  1I2E A;  2W6J H;  4EV5 A;  2FNQ A;  4HOH A;  2I9W A;  3WA3 A;  1B21 A;  1O7H B;  1TTO A;  3HI7 A;  1BIR A;  3U1W A;  1A67 A;  1GD3 A;  4PEJ A;  1PY3 A;  3X42 A;  1ROA A;  2F5W A;  4HM5 B;  3B8L A;  1YVB I;  1CH0 A;  2KCD A;  1QAL A;  1US1 A;  3MG1 A;  3NQY A;  4N6M A;  1OF5 B;  1TJD A;  1IT7 A;  1M1K 4;  1IU7 A;  1YNV X;  2RGQ A;  4WFO A;  1JBS A;  2ZL8 A;  3MSO A;  2Y73 A;  1OHS A;  5BIR A;  1NB5 I;  3BIR A;  3KZT A;  5M18 A;  1RGC A;  1SAR A;  3LTD A;  1UCK A;  1KD1 4;  4K1V A;  1YI2 3;  3QRD A;  3KII A;  1TU5 A;  1BOX A;  4J8T A;  1DMN A;  1UGI A;  3X3X A;  4GSP A;  5HGR A;  4BL2 A;  1VQQ A;  4FCJ A;  3DGO A;  4AKZ A;  2ZA4 A;  4LSO A;  4KFF A;  3WA2 X;  9RNT A;  1BVI A;  1DVC A;  1YIJ 3;  4BIR A;  1GOY A;  5KP1 A;  1W02 A;  1I0X A;  1OGZ A;  3IPT A;  2OOV A;  5ELU A;  5AI1 A;  1VQM 3;  2B24 B;  3PCR A;  2BHM A;  2CC3 A;  4OVM A;  1UUG B;  5D81 A;  8RNT A;  3AHS A;  1S5A A;  3FF2 A;  2IUK A;  3HII A;  4H61 A;  2XFS A;  1M1X B;  3ZG5 A;  4OUQ A;  3MPH A;  3BND A;  3DZL A;  1GY6 A;  4HAA A;  4NRE A;  3CCR 3;  1NJI 4;  2GU3 A;  3G8Z A;  3DGY A;  1DMM A;  1D6Z A;  7STD A;  5CF1 A;  1SPU A;  3BB9 A;  1VQP 3;  1BNI A;  1IQY A;  3AMO B;  1T5Y A;  1STD A;  1RGA A;  3EB8 A;  1LNI A;  1JBT A;  1GY5 A;  2FGT A;  2O9U X;  4FMD A;  5FGO A;  3D4A A;  3ZG0 A;  1BNG A;  1RLS A;  2CFG A;  4HJL B;  4J9A A;  1QAF A;  1OHP A;  3FG3 A;  6STD A;  1BSC A;  1BSB A;  5IER A;  1W00 A;  2GEY A;  1RCL A;  2OWP A;  1LOV A;  2CW9 A;  3DY5 A;  3AGN A;  1FGQ A;  3UL5 A;  3EBT A;  1D6U A;  3G0K A;  4K1U A;  3WOF B;  1JB5 A;  2SBL A;  4KFD A;  4EBG A;  3G6E 3;  3WMD A;  1OCV A;  3Q1C A;  2XGL A;  3Q90 A;  1YGW A;  2WO0 A;  3CC4 3;  3A76 A;  4HM2 B;  3UL6 A;  1BRN L;  1T2I A;  2YFL B;  1Q7Y 4;  1RGF A;  4STD A;  3JUP A;  3RGR A;  3AMO A;  3B7C A;  1AR0 A;  3U97 A;  3SYU A;  2GEX A;  5JPP A;  2H0I A;  2HMN B;  1F8N A;  1RHL A;  2LYX A;  5IW9 A;  1AVK A;  1AY7 A;  2A15 A;  1TFO A;  1GMQ A;  1V58 A;  2GBW B;  2MF7 A;  3FH1 A;  3EN8 A;  3Q3F A;  4O3V A;  3J7Y d;  2QA4 3;  1B2Z A;  1K73 4;  2F98 A;  1B2U A;  1YJ9 3;  1BUJ A;  3D5I A;  2CX0 A;  3NM7 A;  1MNL A;  1RNB A;  1Q42 A;  2CWU A;  5AYR B;  7GSP A;  4KZ1 A;  1EG9 B;  3KSP A;  3OV4 A;  3LXU X;  2P38 A;  1N9J A;  2INX A;  3NXJ A;  4JRF A;  4XBX A;  3T0U A;  3WDG B;  1CYU A;  2Y74 A;  1STF I;  2M7O A;  2ZDJ A;  4ILF A;  2F86 B;  2F99 A;  3UB1 A;  3K7C A;  3F40 A;  5CK6 A;  3VSY A;  3WHO A;  5HOH A;  2Z77 A;  4K90 B;  3NBJ A;  1I8V A;  1VQ9 3;  3HK4 A;  1RN4 A;  1BNR A;  1I3F A;  1R4Y A;  3FZW A;  4LYL B;  1A90 A;  1JRQ A;  3CCS 3;  1MGR A;  4RBN A;  4FMA A;  4JF8 A;  5JBS A;  1DYU A;  3PZW A;  3ROB A;  5D82 A;  5AYS C;  5STD A;  3OW2 2;  1K9M 4;  4AEQ A;  1DET A;  1GOU A;  3SOY A;  3ZFZ A;  4GB5 A;  2GU1 A;  4K61 A;  2JQ5 A;  3KE7 A;  1YGE A;  2E2U A;  4RZM A;  5CF2 A;  1JN5 A;  4EYC A;  1KWI A;  1G02 A;  3FLJ A;  1BRH A;  1CQS A;  1FUT A;  1FW7 A;  1NWW A;  3CCJ 3;  1UCL A;  3F9S A;  4R9K A;  1O7P B;  1RCK A;  1TRP A;  3OWS A;  1QVG 2;  4CJN A;  1I3I A;  3GZB A;  2V1L A;  3LOY A;  2QEX 3;  5LC7 A;  3H3H A;  2RNT A;  1LXE A;  2KXG A;  3RGA A;  1K8A 4;  3WOE B;  6RNT A;  1TRQ A;  3KN4 A;  2CFW A;  3VF1 A;  2W9Q A;  3ECF A;  1UW1 A;  1JJ2 2;  4FCM A;  1JNQ A;  1OGX A;  2XR8 B;  2IUJ A;  3CME 3;  4LMI A;  3BNE A;  1T3B A;  5AIG A;  1CYV A;  1OF5 A;  1EUI C;  4HM0 B;  4O02 B;  4MMZ B;  3SVA A;  4L8P A;  2RCD A;  2BT3 A;  4HM6 B;  5CXO A;  4NHF A;  1B3S A;  2O3O A;  2Z6B A;  3FF0 A;  5KP3 A;  3O8Y A;  2BMO B;  3F14 A;  4FR9 A;  2WOH A;  4IPB A;  4WYK A;  1UCJ A;  3PCS A;  5I97 A;  1UUV B;  2XH9 A;  3JUM A;  2OTL 3;  1RGH A;  4IT7 A;  4XM4 A;  5DRE A;  3CCM 3;  1Q86 4;  5JPU A;  3EE1 A;  2WGQ A;  7RNT A;  5BVB A;  1W01 A;  3B4P A;  1IYY A;  1BRG A;  5AIH A;  2RBI A;  5GSP A;  1BSA A;  3CC7 3;  2OTJ 3;  4CPK A;  1GS3 A;  2W03 A;  1RGL A;  4R80 A;  4EW5 A;  3BLZ A;  1RGG A;  1OUN A;  1I70 A;  3AGO A;  1C7H A;  1X1X A;  1K41 A;  1UI7 A;  1W4N A;  3EF8 A;  4HYZ A;  4GHO A;  3CXC 2;  2P0M A;  1WTH A;  3MWZ A;  1A2K A;  1JB4 A;  4X2O A;  3X3Y A;  1FYS A;  4L7K A;  2CWV A;  5M19 A; 
#chains in the Genus database with same CATH homology
 3X3Z A;  5BXQ A;  1OH0 A;  1FGT A;  1G96 A;  2IMJ A;  4RNY A;  2C10 A;  2YFJ B;  1AV4 A;  4ORL A;  1W6G A;  1TFK A;  1WMO A;  2BMQ B;  2ML6 A;  2BO9 B;  3KFQ C;  4XB5 A;  4HVN A;  1NB3 I;  2HMO B;  2CG1 A;  3S29 A;  2CIU A;  3D9R A;  1GYB A;  3K0Z A;  4HM7 B;  4LEH A;  2P05 A;  4N6V 0;  3IMA B;  5EQL A;  1IQ8 A;  3FKA A;  1Y4K A;  1VQ7 3;  3FG1 A;  3HIG A;  2P0X A;  3H51 A;  1FGO A;  3UNL A;  3LTA A;  4I4K A;  2CFD A;  1SII A;  4BTW A;  4HM3 B;  3I56 3;  1M9G A;  1Q82 4;  3DUK A;  2MC8 A;  1VQL 3;  3STD A;  3ER7 A;  3KSE D;  2OCT A;  1NU3 A;  4N6L A;  2L4V A;  5IG4 A;  1O7W B;  2XGN A;  3NQZ A;  4HM8 B;  2OQE A;  4TX4 A;  2E2T A;  3NV0 B;  3EHC A;  5IG5 A;  5AII A;  3M8C A;  3F7S A;  3DGL A;  3GRD A;  1WQL B;  4R1K A;  3N9H A;  1ZX2 A;  1JKG B;  3FGY A;  1RKY A;  3SED A;  1IVU A;  3K63 A;  4CCV A;  5DRV A;  1W5Z A;  3FCS B;  2ML5 A;  4FMB A;  2P09 A;  3IJE B;  1ULI B;  3HX8 A;  3LYG A;  4CDL A;  4N3V A;  2CKF B;  3EC9 A;  3LT9 A;  3JUQ A;  5LC6 A;  3HZP A;  3S5C A;  3GWR A;  4R4K A;  1OPY A;  4HKV B;  2QIY A;  1EA2 A;  4MEI A;  3MG2 A;  5ELJ A;  2K0M A;  1YIT 3;  1ASK A;  3GZY B;  1OAC A;  1W7C A;  3MG3 A;  3DGN A;  4XDW A;  1U8C B;  5CLK A;  2C11 A;  2OQE C;  3PYJ A;  3NV0 A;  4N6O B;  5G2G A;  3X41 A;  3DMC A;  4N6U A;  3LTB A;  2CWV A;  3GAX A;  3V92 A;  1WNH A;  1KSI A;  3PXM A;  3EJV A;  4XDV A;  3DM8 A;  3LTC A;  2D1W A;  5EVH A;  2W0Q A;  1E3V A;  4L8O A;  1N5H A;  4WP5 A;  4BTX A;  1SJW A;  1IT8 A;  1IK3 A;  2WGO A;  4HM4 B;  1JN5 B;  3EBY A;  3MHE A;  2D42 A;  1O7M B;  2WOF A;  4EV2 A;  1IVX A;  3CCV 3;  3CD6 3;  3NBB A;  4MJD A;  4FCZ A;  1VQK 3;  1Q40 B;  3JUO A;  1HKX A;  5AEU B;  3L0R A;  1YJW 3;  3NBR A;  5D83 A;  1VQ4 3;  3WOD G;  2HMJ B;  3F8X A;  1LNH A;  1IDP A;  1UUW B;  4O2H A;  1DMQ A;  3OX9 A;  3OWU A;  5IEO A;  1PFP A;  2QGU A;  4RNZ A;  3I0Y A;  5FW5 A;  3G71 3;  3SOA A;  1E3R A;  1D6Y A;  1AVL A;  1RN7 A;  1W2Z A;  1L5G B;  2XSO B;  5TGN A;  5IG0 A;  1A2V A;  1TIJ A;  2KRT A;  3RDE A;  1DVD A;  1WMP A;  2FXT A;  4ZM8 A;  1K28 A;  4WYK B;  3UJM A;  1KC8 4;  3K9M C;  3LML A;  3BNB A;  4MMY B;  1N5P A;  4XBT A;  1FGR A;  4R9L A;  1S72 3;  1QVF 2;  3NHX A;  1NDO B;  1IQX A;  3N8B A;  3DXO A;  3TDG A;  4HBR A;  1J2B A;  3S67 A;  3BNC A;  3EQQ B;  1FUW A;  4LGQ A;  3NUV A;  3DGM A;  3CNX A;  3OXA A;  1LOX A;  3CPO A;  3T8U A;  3ALA A;  1YJN 3;  3MYT A;  2GXF A;  2R4I A;  3EX9 A;  2HMK B;  3VGN A;  2Z76 A;  1EKM A;  1MOL A;  4HZB B;  2CFL A;  4GL6 A;  3D3L A;  3JVC A;  3CU3 A;  1TP6 A;  4BTY A;  2YFI B;  3GZX B;  5AEW B;  1RRH A;  1JV2 B;  4HM1 B;  3CCL 3;  3SLU A;  1HU9 A;  5AIF A;  3LT8 A;  2W56 B;  4WHA A;  4KVH A;  1O7N B;  4H3U A;  1ROV A;  1NO3 A;  1VQO 3;  1M90 4;  3G16 A;  3CPW 2;  1WMN A;  1IV7 A;  3Q2P A;  3X40 A;  1V74 A;  3JUN A;  3V98 A;  4N6N B;  2OOV C;  1VQN 3;  3EN1 B;  3F7X A;  1YHQ 3;  5IF6 A;  1GD4 A;  2E2V A;  1QAK A;  3QK9 A;  4WWU C;  2IA7 A;  2RFR A;  3B4O A;  1U5O A;  2HMM B;  1JKG A;  1TUH A;  1GY7 A;  3PGB A;  2XRX B;  5KP4 A;  3OWY A;  1LVN A;  5IEP A;  3MKI A;  2W56 A;  2JDI H;  2CH9 A;  1KQS 2;  3I55 3;  2YX9 A;  3E99 A;  3S28 A;  4LZI A;  2RSX A;  2BNG A;  2K54 A;  1SIH A;  2HML B;  1Q81 4;  3CMA 3;  1E97 A;  4KFE A;  2LQV A;  4EC6 A;  3N54 B;  3CNM A;  2Z7A A;  4FMC A;  2W9P A;  4N6T A;  2W04 A;  1FGM A;  4HZ9 B;  1IVW A;  4XBY A;  1IVV A;  1VZZ A;  3FG4 A;  5EEO A;  2CFK A;  4AKY A;  1QJG A;  3CC2 3;  3G4S 3;  1W6C A;  1RJO A;  3LZA A;  2CWT A;  1O7G B;  2GBX B;  1VQ5 3;  1VQ8 3;  4MMX B;  8CHO A;  3SX1 A;  1CEW I;  1R4C A;  3LH4 A;  1EQK A;  1Z1S A;  2STD A;  5IEN A;  3S27 A;  1BUQ A;  3FSD A;  2BMR B;  1N8R 4;  1ULJ B;  1N9E A;  1W6Y A;  1QMA A;  3CCU 3;  4U13 A;  1Q40 A;  3K5T A;  5A0O B;  1W2B 2;  1N8Q A;  2CHC A;  2W2C A;  2B1X B;  2UX0 A;  4OK0 A;  3V99 A;  4X2H A;  3NM2 A;  3PS8 A;  1JB2 A;  2XFT A;  3NX0 A;  4Q53 A;  4EXR A;  5IG3 A;  2PNC A;  1ZO2 A;  4G1M B;  3CCE 3;  4O8S A;  4QWT A;  1PU4 A;  1IV9 A;  3T8N A;  2CG0 A;  3KKG A;  2CK3 H;  3SXX A;  1OHO A;  2Q07 A;  2XSH B;  1FA3 A;  1SQW A;  2XEP A;  3F8H A;  1RRL A;  1VQ6 3;  2XF3 A;  3CCQ 3;  1UI8 A;  3GZR A;  1ISK A;  4IIA A;  4EV5 A;  2W6J H;  2FNQ A;  3WA3 A;  2I9W A;  1O7H B;  3HI7 A;  3U1W A;  1A67 A;  1GD3 A;  4PEJ A;  3X42 A;  1ROA A;  4HM5 B;  3B8L A;  1YVB I;  2KCD A;  1QAL A;  1US1 A;  3MG1 A;  3NQY A;  4N6M A;  1OF5 B;  1IT7 A;  1M1K 4;  1IU7 A;  4WFO A;  2RGQ A;  2ZL8 A;  3MSO A;  2Y73 A;  1OHS A;  1NB5 I;  3KZT A;  3LTD A;  1KD1 4;  4K1V A;  1YI2 3;  3QRD A;  3KII A;  1TU5 A;  4J8T A;  1DMN A;  3X3X A;  5HGR A;  4FCJ A;  3DGO A;  4AKZ A;  4LSO A;  4KFF A;  3WA2 X;  1DVC A;  1YIJ 3;  5KP1 A;  1W02 A;  1OGZ A;  3IPT A;  2OOV A;  5ELU A;  5AI1 A;  1VQM 3;  2B24 B;  3PCR A;  2BHM A;  2CC3 A;  4OVM A;  5D81 A;  1S5A A;  3FF2 A;  2IUK A;  3HII A;  4H61 A;  2XFS A;  1M1X B;  4OUQ A;  3MPH A;  3BND A;  3DZL A;  1GY6 A;  4NRE A;  3CCR 3;  1NJI 4;  2GU3 A;  3G8Z A;  1DMM A;  1D6Z A;  7STD A;  5CF1 A;  1SPU A;  3BB9 A;  1VQP 3;  1IQY A;  3AMO B;  1T5Y A;  1STD A;  3EB8 A;  1GY5 A;  2FGT A;  2O9U X;  4FMD A;  5FGO A;  2CFG A;  4J9A A;  4HJL B;  1QAF A;  1OHP A;  3FG3 A;  6STD A;  5IER A;  1W00 A;  2GEY A;  2OWP A;  2CW9 A;  3DY5 A;  3UL5 A;  1FGQ A;  3EBT A;  1D6U A;  3G0K A;  4K1U A;  3WOF B;  1JB5 A;  2SBL A;  4KFD A;  4EBG A;  3G6E 3;  3WMD A;  1OCV A;  3Q1C A;  2XGL A;  3Q90 A;  2WO0 A;  3CC4 3;  3A76 A;  4HM2 B;  3UL6 A;  2YFL B;  1Q7Y 4;  4STD A;  3JUP A;  3RGR A;  3AMO A;  3B7C A;  1AR0 A;  3U97 A;  2GEX A;  5JPP A;  2HMN B;  1F8N A;  5IW9 A;  2LYX A;  1AVK A;  2A15 A;  1TFO A;  4O3V A;  3FH1 A;  2GBW B;  2MF7 A;  3J7Y d;  3EN8 A;  2QA4 3;  1K73 4;  2F98 A;  1YJ9 3;  3NM7 A;  1MNL A;  1Q42 A;  2CWU A;  5AYR B;  4KZ1 A;  1EG9 B;  3KSP A;  3OV4 A;  3LXU X;  2P38 A;  1N9J A;  2INX A;  3NXJ A;  4JRF A;  4XBX A;  3T0U A;  3WDG B;  1CYU A;  2Y74 A;  1STF I;  2M7O A;  2ZDJ A;  2F86 B;  2F99 A;  3UB1 A;  3K7C A;  3F40 A;  5CK6 A;  3VSY A;  2Z77 A;  4K90 B;  3NBJ A;  1VQ9 3;  3HK4 A;  3FZW A;  1A90 A;  1JRQ A;  3CCS 3;  4RBN A;  4FMA A;  4JF8 A;  5JBS A;  1DYU A;  3PZW A;  3ROB A;  5D82 A;  5AYS C;  5STD A;  3OW2 2;  1K9M 4;  4AEQ A;  3SOY A;  4GB5 A;  2GU1 A;  4K61 A;  2JQ5 A;  3KE7 A;  1YGE A;  2E2U A;  4RZM A;  5CF2 A;  1JN5 A;  4EYC A;  1KWI A;  3FLJ A;  1CQS A;  1NWW A;  3CCJ 3;  3F9S A;  4R9K A;  1O7P B;  3OWS A;  1QVG 2;  3GZB A;  2V1L A;  3LOY A;  2QEX 3;  5LC7 A;  3H3H A;  1LXE A;  2KXG A;  3RGA A;  1K8A 4;  3WOE B;  3KN4 A;  2CFW A;  3VF1 A;  2W9Q A;  3ECF A;  1UW1 A;  1JJ2 2;  4FCM A;  1JNQ A;  1OGX A;  2XR8 B;  2IUJ A;  3CME 3;  4LMI A;  3BNE A;  5AIG A;  1CYV A;  1OF5 A;  4HM0 B;  4O02 B;  4MMZ B;  3SVA A;  4L8P A;  2RCD A;  2BT3 A;  4HM6 B;  5CXO A;  4NHF A;  5KP3 A;  2O3O A;  2Z6B A;  3FF0 A;  3O8Y A;  2BMO B;  3F14 A;  4FR9 A;  2WOH A;  4IPB A;  4WYK A;  5I97 A;  3PCS A;  2OTL 3;  1UUV B;  2XH9 A;  3JUM A;  4XM4 A;  4IT7 A;  5DRE A;  3CCM 3;  1Q86 4;  5JPU A;  3EE1 A;  2WGQ A;  5BVB A;  1W01 A;  3B4P A;  5AIH A;  3CC7 3;  2OTJ 3;  1GS3 A;  2W03 A;  4R80 A;  3BLZ A;  1OUN A;  1C7H A;  1K41 A;  1UI7 A;  1W4N A;  3EF8 A;  4HYZ A;  3CXC 2;  2P0M A;  1WTH A;  3MWZ A;  1A2K A;  1JB4 A;  4X2O A;  3X3Y A;  4L7K A;  2PZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...