2PZVA

Crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound phenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Testing Electrostatic complementarity in Enzyme Catalysis: Hydrogen Bonding in the Ketosteroid Isomerase Oxyanion Hole
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 32
structure length 123
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2pzvA00
3SEDA 4J9AA 4L7KA 4IIAA 6STDA 4HM2B 3JUQA 3EJVA 1O7HB 1WQLB 3CPOA 2RCDA 5DREA 1JB5A 1GY7A 3B4OA 2GBWB 1OF5A 4FCMA 3GRDA 4LMIA 3GZBA 2B24B 4STDA 2HMNB 2IMJA 5IG3A 3FH1A 3EBYA 4ORLA 2OWPA 5CF2A 1DMMA 3CNXA 1Q40A 4HKVB 1O7NB 4HZ9B 3A76A 4HM8B 4LEHA 1OHSA 4L8PA 3ECFA 1HKXA 1JB2A 1OPYA 3D9RA 3MYTA 3FZWA 4HJLB 2Z77A 2Z7AA 1OHOA 4WWUC 1IDPA 5HGRA 3JUMA 3B8LA 2BMQB 4L8OA 4K1VA 2B1XB 1NWWA 4I4KA 4HM6B 4XM4A 3OWUA 2BMRB 3RGRA 4X2HA 3KZTA 4CDLA 1JKGA 3BLZA 2W2CA 1QMAA 2PZVA 3DUKA 2A15A 5AEUB 4LGQA 5DRVA 3MG3A 5IENA 1STDA 1OF5B 4FCJA 4XBXA 3I0YA 1UUVB 2CKFB 3FLJA 3F14A 1QJGA 3EC9A 3JUPA 3OWYA 1Q40B 2GBXB 3EN8A 3MG2A 3VGNA 3OWSA 4R9KA 2CHCA 4K1UA 4Q53A 2STDA 5D81A 2UX0A 2INXA 4PEJA 5IG4A 2F86B 4WYKA 4HM3B 3F8HA 3KE7A 7STDA 4OUQA 3E99A 2RGQA 4HM0B 3F9SA 3NHXA 5JPUA 3BB9A 1GS3A 5JPPA 2R4IA 2QGUA 1ZX2A 3CU3A 3ROBA 5FW5A 3NUVA 2F98A 5IEOA 3T8UA 1JKGB 3GZYB 1C7HA 3UNLA 2BNGA 4R9LA 5IF6A 3WMDA 2K54A 1S5AA 2QIYA 1AR0A 3LZAA 1E3RA 3OX9A 1K41A 1ULJB 3EN1B 5AIHA 2JQ5A 4XBYA 4N3VA 4KVHA 5IEPA 5AEWB 4HM7B 5KP1A 3MSOA 3HX8A 3EQQB 2XSOB 4HZBB 1O7MB 2I9WA 3MHEA 1VZZA 1E97A 3CNMA 2RFRA 5AIIA 4WYKB 3OXAA 2HMOB 5CLKA 3RGAA 4XB5A 1ISKA 1JN5A 1DMQA 3DXOA 3EHCA 3B4PA 3NV0A 4J8TA 3EF8A 1GY6A 4HM4B 5KP3A 3K0ZA 3FF0A 1U5OA 2GEYA 3NXJA 3G0KA 2YFJB 3DMCA 3NM2A 3DM8A 3H3HA 3IPTA 3GWRA 5D83A 5IG5A 1ZO2A 3EX9A 3MKIA 3Q90A 3HK4A 5G2GA 4HM1B 4MJDA 1O7PB 3FKAA 2XSHB 1Q42A 3M8CA 3JUNA 3SOAA 2GXFA 1W01A 2YFLB 3B7CA 3SOYA 1O7GB 4OVMA 5AIFA 4RZMA 3VSYA 3LYGA 1OHPA 1O7WB 3F40A 4HM5B 3UJMA 2HMLB 3EBTA 1CQSA 1Z1SA 5AI1A 3FSDA 3JUOA 3FGYA 4GB5A 1OCVA 1OUNA 3F8XA 3MG1A 3DZLA 3STDA 5EVHA 2YFIB 1GY5A 1JN5B 3GZRA 3KKGA 3NV0B 3H51A 4H3UA 1TUHA 2XRXB 5TGNA 3NBRA 5STDA 3G16A 4XDWA 3OV4A 1EG9B 3GZXB 1BUQA 2GEXA 1E3VA 1W02A 1A2KA 3ER7A 1OH0A 1UUWB 2HMJB 5IG0A 2Z76A 5KP4A 1OGZA 5IERA 1W00A 2HMKB 8CHOA 3F7XA 5D82A 4WP5A 2HMMB 2F99A 4U13A 3S5CA 5CK6A 3T8NA 3F7SA 2XR8B 3HZPA 1EA2A 5CF1A 4R1KA 1JB4A 1GYBA 3KSPA 2BMOB 1NU3A 1OGXA 4HVNA 1TP6A 4X2OA 1NDOB 1SJWA 5CXOA 5BVBA 3FF2A 3K7CA 5BXQA 4XDVA 5AIGA 1DMNA 1W6YA 1ASKA 4XBTA 3G8ZA 1ULIB
chains in the Genus database with same CATH superfamily
3SEDA 6RNTA 4J9AA 4L7KA 1ROVA 4IIAA 4JF8A 4EXRA 1RGEA 6STDA 2OQEC 5IW9A 4HM2B 3JUQA 1G02A 3PYJA 3TDGA 3CCV3 2W9PA 3FG4A 3PCRA 9RNTA 3EJVA 1F8NA 4O8SA 1O7HB 1IV9A 1WQLB 1VQ83 1D6ZA 1RCKA 1M1K4 3CPOA 1FUWA 1RN1A 3CCE3 3ZG5A 2HOHA 3FCSB 2RCDA 3O8YA 1JB5A 1GY7A 2C10A 5DREA 4AKYA 3B4OA 1I2EA 5EQLA 3VF1A 3CCR3 2GBWB 2H0HA 1OF5A 2WOHA 4FCMA 3GRDA 3A5EA 3KN4A 3PCSA 1GMRA 1W6GA 3SX1A 1W2B2 4LMIA 2C11A 4BTYA 3GZBA 2B24B 1GOUA 4STDA 1A2PA 2HMNB 2IMJA 1B2MA 5IG3A 1I3FA 3BNCA 3GAXA 5HOHA 3FH1A 1Q814 1Q7HA 3ALAA 3EBYA 4IT7A 4N6LA 4ORLA 2CFWA 2OWPA 5CF2A 1DMMA 2CG0A 3CNXA 2ZHXB 3BNBA 1Q40A 4HKVB 1M9GA 3D3LA 5JBSA 1PU4A 1JZOA 1LQGC 1O7NB 4HZ9B 3X3YA 1NO3A 3X3XA 1KC84 1K28A 2WGOA 5LC7A 2KCDA 3A76A 1VQQA 1NJI4 4HM8B 4LEHA 1OHSA 4L8PA 3ECFA 3DGOA 4LSOA 2RSXA 4I5QA 7RNTA 5BU4A 1B2UA 1HKXA 1IU7A 1I0XA 1JV2B 1RSNA 1IQXA 4RNTA 3CC43 4BL3A 2KXGA 3BNEA 2XEPA 4BIRA 1YIJ3 1FGRA 1BRGA 1OACA 1JB2A 1OPYA 3D9RA 1V57A 3CXC2 3MYTA 3FZWA 4HJLB 2Z77A 1IVXA 2Z7AA 1OHOA 1BRIA 4WWUC 4WFOA 1IDPA 2KF3A 4GHOA 4BU4A 1IK3A 1LQMB 5HGRA 3KFQC 3JUMA 2CH9A 3HOHA 3QRDA 3B8LA 3K9MC 2BMQB 2FXTA 3AGNA 4L8OA 4K1VA 1B21A 2B1XB 5G1LA 1NWWA 4MMYB 1ZGXA 1GMQA 4I4KA 3RNTA 6GSPA 1Y4KA 4HM6B 1FUSA 3OWUA 4XM4A 4LYLB 1N5HA 2BMRB 2F5MA 3RGRA 4HOHA 4J5KA 4X2HA 3WOEB 1UI7A 1AQZA 1AY7A 1RDSA 2KF6A 2W9QA 3KZTA 2FGTA 3FG1A 3L0RA 3MWZA 1GSPA 1I70A 2SARA 3SYUA 2CFLA 3CMA3 4O02B 3UB1A 1FGOA 1JKGA 1PY3A 2P0XA 3NQZA 3BLZA 2W2CA 5EEOA 3KSED 1QMAA 2PZVA 3DUKA 4FMAA 1SIHA 2A15A 5AEUB 1VQL3 1SARA 3K63A 4LGQA 5DRVA 3NQYA 4MMXB 3T0UA 3MG3A 1YI23 5IENA 1STDA 3WHOA 1GD3A 1RLSA 1KQS2 1IVUA 1VQO3 2OTL3 1M1XB 4KT3B 1B27A 1OF5B 4FCJA 4XBXA 2CWTA 2BU4A 3I0YA 1UUVB 1MNLA 1LVNA 1T2IA 2CKFB 3FLJA 3F14A 4ILFA 3G6E3 1G96A 2FNQA 3D79A 3Q2PA 1TTOA 1RNBA 1QJGA 3EC9A 2V1LA 2L4VA 3JUPA 3OWYA 1Q40B 2GBXB 1YJW3 1YVBI 3EN8A 3MG2A 3VGNA 3MPHA 1MOLA 2OTJ3 3OWSA 1DE3A 4R9KA 1STFI 2CHCA 4K1UA 4Q53A 1I0VA 1DETA 4CDLA 2STDA 1MGWA 5G1KA 3CC73 5D81A 1VQ63 2M7OA 2Y73A 1JBRA 1U8CB 2UX0A 2INXA 4PEJA 1EUIC 5IG4A 2F86B 2ML5A 2QA43 4WYKA 4N6NB 3NBBA 4K90B 1W5ZA 5AYRB 4HM3B 1I3IA 1PYLA 3NX0A 4MMZB 2CG1A 3F8HA 3KE7A 7STDA 2CWUA 2D42A 4OUQA 3SLUA 1EQKA 1MWRA 3E99A 2RGQA 4HM0B 1VQ53 2GU3A 2XGLA 3F9SA 3NHXA 2W56A 3U97A 2KF4A 1K9M4 2RNTA 1UCKA 3X42A 2CFDA 4DKIA 5JPUA 3BB9A 1GS3A 1W4NA 2Q07A 1BNSA 4NPBA 4EC6A 1LNHA 1R4YA 3KCHA 2CFGA 5JPPA 2R4IA 1UGHI 2QGUA 4NREA 3WDGB 1TRPA 2O9UX 1B2SA 3S67A 1ZX2A 3SXXA 2ZL8A 3CU3A 1V74A 2KAAA 1LRAA 1NB3I 2MF7A 3ROBA 3SVAA 1AVLA 2K3DA 4FMBA 2P09A 4O2HA 5FW5A 1IVWA 3NUVA 2OOVC 3NM7A 4HAAA 3CCL3 1CH0A 2F98A 5IEOA 3T8UA 1QVF2 2O3OA 1JKGB 1GOYA 3LTBA 4CCVA 2F5WA 3GZYB 3WA3A 1YGEA 2ZA4A 1GMPA 2OCTA 4WHAA 1FUTA 1JZDA 3HIIA 1T3BA 1LOXA 2XFTA 1C7HA 3LTAA 3UNLA 2OQEA 2BNGA 3NBJA 1BSEA 4R9LA 5IF6A 5BIRA 2BO9B 1J2BA 3AMOA 3WMDA 1FYSA 4BTXA 1N8QA 2K54A 1S5AA 2QIYA 4MEIA 3WR2A 1BRSA 1AR0A 1B20A 1RGFA 2LYXA 1YIT3 5I97A 3LZAA 1DVCA 1A90A 3J7Yd 1E3RA 1LNIA 4N6V0 1JNQA 5ELJA 1JBSA 2XFSA 1GOVA 1I2FA 1RGLA 3OX9A 1BIRA 4TX4A 1YJN3 2CWVA 1K41A 1RGHA 1ULJB 3EN1B 2BT3A 3AHSA 3PXMA 1Q864 5AIHA 2JQ5A 1UCIA 1IT7A 4XBYA 3Q1CA 3X40A 4N3VA 1BRKA 2C4BA 4KVHA 5M19A 1N8R4 4CPKA 4AEQA 4OK0A 1BNFA 5IEPA 5AEWB 4HM7B 5KP1A 3RDEA 3CCQ3 3MSOA 3HX8A 3EQQB 1Q7Y4 2XSOB 1IT8A 1RJOA 1WMPA 8RNTA 4HZBB 1O7MB 2CFKA 1SIIA 5FGOA 2UGIA 3IMAB 2I9WA 3MHEA 1UW1A 1VZZA 1E97A 3CNMA 1MWTA 1NNVA 2RFRA 5AIIA 3S29A 2P0MA 3D5GA 3EB8A 1BGSA 1BVIA 4KFEA 4WYKB 3OXAA 1CEWI 3HIGA 1KD14 2HMOB 4J5GA 1UGIA 4IPBA 5CLKA 1RGAA 1RNTA 4GSPA 4KFDA 3CME3 3RGAA 2JDIH 4XB5A 1ISKA 1WMOA 1W6CA 1JN5A 2J8XB 1DMQA 2AADA 3LXUX 2W56B 3DXOA 3EHCA 3B4PA 3NV0A 3V99A 4EW5A 4J8TA 1VQK3 1YJ93 2GU1A 3EF8A 1GY6A 2W03A 4EV5A 3S28A 5A0OB 2LQVA 4HM4B 2IUKA 1T5YA 1BRHA 1CYVA 4GL6A 1WTHA 5KP3A 3K0ZA 1C54A 3FF0A 1U5OA 1YNVX 2GEYA 1MWUA 3NXJA 1IQ8A 3G0KA 4RNYA 2YFJB 1VQM3 3DMCA 3NM2A 3DM8A 3H3HA 3IPTA 3GWRA 5D83A 3U1WA 5IG5A 1ZO2A 1WNHA 1W2ZA 2CX1A 3EX9A 1RGKA 1TIJA 1BAOA 1Q9EA 3MKIA 3Q90A 4NHFA 3V92A 3IJEB 3HK4A 2P05A 1RTUA 1UI8A 5G2GA 2Y74A 3LTDA 4HM1B 1NB5I 5AYSC 1D6YA 2ML6A 1RKYA 3AMOB 1RCLA 1UDII 4MJDA 3WA2X 1O7PB 3UL5A 1TRQA 3FKAA 2XSHB 1RN4A 1JBTA 1I2GA 1T2HA 1Q42A 2IY2A 3N8BA 5GSPA 2MC8A 3I563 3LH4A 1UCJA 1JJ22 4G1MB 3EE1A 3OW22 3G713 1ZS7A 4KZ1A 4EYCA 3M8CA 4EBGA 1B2ZA 3CCS3 3JUNA 1HU9A 2F4YA 1BU4A 2P38A 5M1AA 3SOAA 2GXFA 1W01A 2YFLB 3B7CA 3DGLA 4H61A 2BIRA 3SOYA 4EV2A 3CC23 3V98A 1KSIA 1O7GB 2WO0A 5ELUA 4N6UA 4OVMA 4QWTA 1I8VA 3N9HA 5AIFA 1Q824 4RZMA 3VSYA 3LYGA 1RRLA 1OHPA 2IYJA 1BSBA 1L5GB 1K734 1BUJA 1O7WB 3K5TA 3F40A 4HM5B 1R4CA 1BANA 3UJMA 2HMLB 1BNIA 1BSAA 3D4AA 3EBTA 1FW7A 1WMNA 1Z1SA 1CQSA 1BOXA 5AI1A 3DGYA 3FSDA 3JUOA 4K61A 1ROAA 3PZWA 3FGYA 4GB5A 1DYUA 1VQ93 3LT9A 4CJNA 1BSCA 1OCVA 1OUNA 3JVCA 5LC6A 2E2UA 2WGQA 2XF3A 1BRJA 1AVKA 1GD4A 3F8XA 3KIIA 3DZLA 3MG1A 2AAEA 3STDA 5EVHA 3G4S3 2YFIB 1GY5A 1JN5B 3GZRA 4R4KA 4HBRA 2UUGC 3WODG 1BRNL 1TFKA 3KKGA 1RMSA 2CK3H 2KRTA 3NV0B 4BL2A 3H51A 1B2XA 1TUHA 4H3UA 2XRXB 5TGNA 1VQN3 3NBRA 5STDA 1QVG2 1HZ1A 1YGWA 3G16A 3PS8A 1FGMA 1X1WA 1DVDA 2YX9A 1FGTA 3PGBA 3QK9A 1KWIA 1MWSA 4XDWA 3CCM3 2BHMA 1EKMA 3OV4A 1K8A4 1EG9B 4RBNA 3BNDA 3LTCA 3GZXB 3CPW2 1BUQA 1TJDA 1UCLA 1N9EA 1BNEA 1PFPA 2RBIA 2W0QA 2Z6BA 1X1YA 3LMLA 4FMDA 2GEXA 3DY5A 1E3VA 1W02A 5RNTA 1LXEA 7GSPA 4N6OB 1A2KA 1RRHA 2XGNA 4O3VA 2QEX3 3ER7A 1MGRA 1W7CA 4RNZA 1LOYA 1OH0A 1UUWB 2HMJB 5IG0A 2OOVA 1VQ43 2Z76A 4FCZA 5KP4A 1HYFA 1OGZA 1QALA 1JRQA 1QAKA 1LOVA 5IERA 1BNJA 1W00A 2WOFA 1YHQ3 2HMKB 3AGOA 3WOFB 8CHOA 2GSPA 3F7XA 5D82A 1FGQA 1FA3A 3I553 4KFFA 2HMMB 4LZIA 2F56A 4WP5A 1QAFA 2F99A 5M18A 2W04A 4U13A 1AV4A 1IV7A 3S5CA 2CX0A 3S27A 2W6JH 2IA7A 2H0IA 2K0MA 2L1SA 2R41A 1FZUA 4N6TA 5CK6A 3T8NA 2CW9A 3F7SA 3GSPA 3HI7A 3AHWA 4R80A 3URPA 1D6UA 1B3SA 3ZG0A 2XR8B 1IQYA 1G0TA 1RHLA 1UUGB 3HZPA 3N54B 3Q3FA 2CC3A 1RGGA 3CD63 1S723 4HYZA 3FG3A 1EA2A 3BU4A 5CF1A 1N5PA 1LOWA 2CIUA 1A2VA 3LT8A 4R1KA 4AKZA 1TU5A 1JB4A 3DGNA 1RN7A 1GYBA 1X1XA 3KSPA 2H0GA 2BMOB 3CCJ3 1VQ73 1X1UA 1N9JA 4ZM8A 1BSDA 1NU3A 3X41A 1OGXA 2E2TA 1IVVA 3UL6A 1YVSA 4HVNA 3LOYA 1TP6A 3D5IA 2KF5A 4X2OA 1NDOB 3ZFZA 1SPUA 2IUJA 2E2VA 2D1WA 1BNGA 1SJWA 2SBLA 5CXOA 3X3ZA 5BVBA 1TFOA 1A67A 1SQWA 3FF2A 3K7CA 5BXQA 3BIRA 3DH2A 1EEJA 4XDVA 2ZDJA 1DMNA 5AIGA 1BNRA 4FMCA 1IYYA 1W6YA 1ASKA 4JRFA 3DGMA 1RGCA 1V58A 4BTWA 4XBTA 1VQP3 4N6MA 1US1A 1CYUA 3CCU3 1M904 3G8ZA 1ULIB 4FR9A 2PNCA 2XH9A
chains in the Genus database with same CATH topology
3SEDA 4J9AA 4L7KA 1ROVA 4IIAA 4JF8A 4EXRA 6STDA 5IW9A 2OQEC 4HM2B 3JUQA 3PYJA 3TDGA 3CCV3 2W9PA 3FG4A 3PCRA 3EJVA 1F8NA 4O8SA 1O7HB 1IV9A 1WQLB 1VQ83 1D6ZA 1M1K4 3CPOA 1FUWA 3CCE3 3FCSB 2RCDA 3O8YA 1JB5A 1GY7A 2C10A 5DREA 4AKYA 3B4OA 5EQLA 3VF1A 3CCR3 2GBWB 1OF5A 2WOHA 4FCMA 3GRDA 3PCSA 3KN4A 1W2B2 1W6GA 3SX1A 4LMIA 2C11A 4BTYA 3GZBA 2B24B 4STDA 2HMNB 2IMJA 5IG3A 3BNCA 3GAXA 3FH1A 1Q814 4IT7A 3ALAA 3EBYA 4N6LA 4ORLA 2CFWA 2OWPA 5CF2A 1DMMA 2CG0A 3CNXA 3BNBA 1Q40A 4HKVB 1M9GA 3D3LA 5JBSA 1PU4A 1O7NB 4HZ9B 3X3YA 1NO3A 3X3XA 1KC84 1K28A 2WGOA 5LC7A 2KCDA 3A76A 1NJI4 4HM8B 4LEHA 1OHSA 4L8PA 3ECFA 3DGOA 4LSOA 2RSXA 1HKXA 1IU7A 3CC43 1JV2B 1IQXA 2KXGA 3BNEA 2XEPA 1YIJ3 1FGRA 1OACA 1JB2A 1OPYA 3D9RA 3CXC2 3MYTA 3FZWA 4HJLB 2Z77A 1IVXA 2Z7AA 1OHOA 4WWUC 1IK3A 4WFOA 1IDPA 5HGRA 3KFQC 3JUMA 2CH9A 3QRDA 3B8LA 3K9MC 2BMQB 2FXTA 4L8OA 4K1VA 2B1XB 1NWWA 4MMYB 4I4KA 1Y4KA 4HM6B 4XM4A 3OWUA 1N5HA 2BMRB 3RGRA 4X2HA 3WOEB 1UI7A 2W9QA 3KZTA 3MWZA 2FGTA 3FG1A 3L0RA 4CDLA 3CMA3 1FA3A 2CFLA 4O02B 3UB1A 1FGOA 1JKGA 2P0XA 3NQZA 3BLZA 2W2CA 5EEOA 3KSED 1QMAA 2PZVA 3DUKA 4FMAA 1SIHA 2A15A 5AEUB 1VQL3 3K63A 4LGQA 5DRVA 3NQYA 4MMXB 3T0UA 3MG3A 1YI23 5IENA 1STDA 1KQS2 1GD3A 2OTL3 1IVUA 1VQO3 1M1XB 1OF5B 4FCJA 4XBXA 2CWTA 3I0YA 1UUVB 1MNLA 1LVNA 2CKFB 3FLJA 3F14A 3G6E3 1G96A 2FNQA 3Q2PA 1QJGA 3EC9A 2V1LA 2L4VA 3JUPA 3OWYA 1Q40B 2GBXB 1YJW3 1YVBI 3EN8A 3MG2A 3VGNA 3MPHA 1MOLA 2OTJ3 3OWSA 4R9KA 1STFI 2CHCA 4K1UA 4Q53A 2STDA 3CC73 5D81A 1VQ63 2M7OA 2Y73A 1U8CB 2UX0A 2INXA 4PEJA 5IG4A 2F86B 2ML5A 2QA43 4WYKA 4N6NB 3NBBA 4K90B 1W5ZA 5AYRB 4HM3B 3NX0A 4MMZB 2CG1A 3F8HA 3KE7A 7STDA 2CWUA 2D42A 4OUQA 3SLUA 1EQKA 3E99A 2RGQA 4HM0B 1VQ53 2GU3A 2XGLA 3F9SA 3NHXA 2W56A 3U97A 1K9M4 3X42A 2CFDA 5JPUA 3BB9A 1GS3A 1W4NA 2Q07A 4EC6A 1LNHA 2CFGA 5JPPA 2R4IA 2QGUA 4NREA 3WDGB 2O9UX 3S67A 1ZX2A 3SXXA 2ZL8A 3CU3A 1V74A 1NB3I 2MF7A 3ROBA 3SVAA 1AVLA 4FMBA 2P09A 4O2HA 5FW5A 1IVWA 3NUVA 2OOVC 3NM7A 3CCL3 2F98A 5IEOA 3T8UA 1QVF2 2O3OA 1JKGB 4CCVA 3LTBA 3WA3A 3GZYB 1YGEA 2OCTA 4WHAA 3HIIA 2XFTA 1LOXA 3LTAA 1C7HA 3UNLA 2OQEA 2BNGA 3NBJA 4R9LA 5IF6A 2BO9B 1J2BA 3AMOA 3WMDA 4BTXA 1N8QA 2K54A 1S5AA 2QIYA 4MEIA 1AR0A 2LYXA 1YIT3 5I97A 3LZAA 1DVCA 1A90A 3J7Yd 1E3RA 4N6V0 1JNQA 5ELJA 2XFSA 3OX9A 4TX4A 1YJN3 2CWVA 1K41A 1ULJB 3EN1B 2BT3A 3PXMA 1Q864 5AIHA 2JQ5A 1IT7A 4XBYA 3Q1CA 3X40A 4N3VA 4KVHA 1N8R4 4AEQA 4OK0A 5IEPA 5AEWB 4HM7B 5KP1A 3RDEA 3CCQ3 3MSOA 3HX8A 3EQQB 1Q7Y4 2XSOB 1IT8A 1RJOA 1WMPA 4HZBB 1O7MB 2CFKA 1SIIA 5FGOA 3IMAB 2I9WA 3MHEA 1UW1A 1VZZA 1E97A 3CNMA 2RFRA 5AIIA 3S29A 2P0MA 3EB8A 4KFEA 4WYKB 3OXAA 1CEWI 3HIGA 1KD14 2HMOB 4IPBA 5CLKA 4KFDA 3CME3 3RGAA 2JDIH 4XB5A 1ISKA 1WMOA 1W6CA 1JN5A 1DMQA 3LXUX 2W56B 3DXOA 3EHCA 3B4PA 3NV0A 3V99A 4J8TA 1VQK3 1YJ93 2GU1A 3EF8A 1GY6A 2W03A 4EV5A 3S28A 5A0OB 2LQVA 4HM4B 2IUKA 1T5YA 1CYVA 4GL6A 1WTHA 5KP3A 3K0ZA 3FF0A 1U5OA 2GEYA 3NXJA 1IQ8A 3G0KA 4RNYA 2YFJB 1VQM3 3DMCA 3NM2A 3DM8A 3H3HA 3IPTA 3GWRA 5D83A 3U1WA 5IG5A 1ZO2A 1WNHA 1W2ZA 3EX9A 1TIJA 3MKIA 3Q90A 4NHFA 3V92A 3IJEB 3HK4A 2P05A 1UI8A 5G2GA 2Y74A 3LTDA 4HM1B 1NB5I 5AYSC 1D6YA 2ML6A 1RKYA 3AMOB 4MJDA 3WA2X 1O7PB 3UL5A 3FKAA 2XSHB 1Q42A 3N8BA 2MC8A 3I563 3LH4A 1JJ22 4G1MB 3EE1A 3OW22 3G713 4KZ1A 4EYCA 3M8CA 4EBGA 3CCS3 3JUNA 1HU9A 2P38A 3SOAA 2GXFA 1W01A 2YFLB 3B7CA 3DGLA 4H61A 3SOYA 4EV2A 3CC23 3V98A 1KSIA 1O7GB 2WO0A 5ELUA 4N6UA 4OVMA 4QWTA 3N9HA 5AIFA 1Q824 4RZMA 3VSYA 3LYGA 1RRLA 1OHPA 1L5GB 1K734 1O7WB 3K5TA 3F40A 4HM5B 1R4CA 3UJMA 2HMLB 3EBTA 1WMNA 1Z1SA 1CQSA 5AI1A 3FSDA 3JUOA 4K61A 1ROAA 3PZWA 3FGYA 4GB5A 1DYUA 1VQ93 3LT9A 1OCVA 5LC6A 1OUNA 3JVCA 2E2UA 2WGQA 2XF3A 3F8XA 1AVKA 1GD4A 3MG1A 3KIIA 3DZLA 3STDA 5EVHA 3G4S3 2YFIB 1GY5A 1JN5B 3GZRA 4R4KA 4HBRA 3WODG 1TFKA 3KKGA 2CK3H 2KRTA 3NV0B 3H51A 4H3UA 1TUHA 2XRXB 5TGNA 1VQN3 3NBRA 5STDA 1QVG2 3G16A 3PS8A 1FGMA 1DVDA 2YX9A 1FGTA 3PGBA 3QK9A 1KWIA 4XDWA 3CCM3 2BHMA 1EKMA 3OV4A 1K8A4 1EG9B 4RBNA 3BNDA 3LTCA 3GZXB 3CPW2 1BUQA 1N9EA 1PFPA 2W0QA 2Z6BA 3LMLA 4FMDA 2GEXA 3DY5A 1E3VA 1W02A 1LXEA 4N6OB 1A2KA 1RRHA 2XGNA 4O3VA 2QEX3 3ER7A 1W7CA 4RNZA 1OH0A 1UUWB 2HMJB 5IG0A 2OOVA 1VQ43 2Z76A 4FCZA 5KP4A 1OGZA 1QALA 1JRQA 1QAKA 5IERA 2WOFA 1W00A 1YHQ3 2HMKB 3WOFB 8CHOA 3F7XA 5D82A 1FGQA 3I553 4KFFA 2HMMB 4LZIA 4WP5A 1QAFA 2F99A 2W04A 4U13A 1AV4A 1IV7A 3S5CA 3S27A 2W6JH 2IA7A 2K0MA 4N6TA 5CK6A 3T8NA 2CW9A 3F7SA 3HI7A 4R80A 1D6UA 2XR8B 1IQYA 3HZPA 3N54B 2CC3A 3CD63 1S723 4HYZA 3FG3A 1EA2A 5CF1A 1N5PA 2CIUA 3LT8A 1A2VA 4R1KA 4AKZA 1TU5A 1JB4A 3DGNA 1RN7A 1GYBA 3KSPA 2BMOB 3CCJ3 1VQ73 1N9JA 4ZM8A 1NU3A 3X41A 1OGXA 2E2TA 1IVVA 3UL6A 4HVNA 3LOYA 1TP6A 4X2OA 1NDOB 1SPUA 2IUJA 2E2VA 2D1WA 1SJWA 2SBLA 5CXOA 3X3ZA 5BVBA 1TFOA 1A67A 1SQWA 3FF2A 3K7CA 5BXQA 4XDVA 5AIGA 2ZDJA 1DMNA 4FMCA 1W6YA 1ASKA 4JRFA 3DGMA 4BTWA 4XBTA 1VQP3 4N6MA 1US1A 1CYUA 3CCU3 1M904 3G8ZA 1ULIB 4FR9A 2PNCA 2XH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SED A;  4J9A A;  4L7K A;  4IIA A;  6STD A;  4HM2 B;  3JUQ A;  3EJV A;  1O7H B;  1WQL B;  3CPO A;  2RCD A;  5DRE A;  1JB5 A;  1GY7 A;  3B4O A;  2GBW B;  1OF5 A;  4FCM A;  3GRD A;  4LMI A;  3GZB A;  2B24 B;  4STD A;  2HMN B;  2IMJ A;  5IG3 A;  3FH1 A;  3EBY A;  4ORL A;  2OWP A;  5CF2 A;  1DMM A;  3CNX A;  1Q40 A;  4HKV B;  1O7N B;  4HZ9 B;  3A76 A;  4HM8 B;  4LEH A;  1OHS A;  4L8P A;  3ECF A;  1HKX A;  1JB2 A;  1OPY A;  3D9R A;  3MYT A;  3FZW A;  4HJL B;  2Z77 A;  2Z7A A;  1OHO A;  4WWU C;  1IDP A;  5HGR A;  3JUM A;  3B8L A;  2BMQ B;  4L8O A;  4K1V A;  2B1X B;  1NWW A;  4I4K A;  4HM6 B;  4XM4 A;  3OWU A;  2BMR B;  3RGR A;  4X2H A;  3KZT A;  4CDL A;  1JKG A;  3BLZ A;  2W2C A;  1QMA A;  2PZV A;  3DUK A;  2A15 A;  5AEU B;  4LGQ A;  5DRV A;  3MG3 A;  5IEN A;  1STD A;  1OF5 B;  4FCJ A;  4XBX A;  3I0Y A;  1UUV B;  2CKF B;  3FLJ A;  3F14 A;  1QJG A;  3EC9 A;  3JUP A;  3OWY A;  1Q40 B;  2GBX B;  3EN8 A;  3MG2 A;  3VGN A;  3OWS A;  4R9K A;  2CHC A;  4K1U A;  4Q53 A;  2STD A;  5D81 A;  2UX0 A;  2INX A;  4PEJ A;  5IG4 A;  2F86 B;  4WYK A;  4HM3 B;  3F8H A;  3KE7 A;  7STD A;  4OUQ A;  3E99 A;  2RGQ A;  4HM0 B;  3F9S A;  3NHX A;  5JPU A;  3BB9 A;  1GS3 A;  5JPP A;  2R4I A;  2QGU A;  1ZX2 A;  3CU3 A;  3ROB A;  5FW5 A;  3NUV A;  2F98 A;  5IEO A;  3T8U A;  1JKG B;  3GZY B;  1C7H A;  3UNL A;  2BNG A;  4R9L A;  5IF6 A;  3WMD A;  2K54 A;  1S5A A;  2QIY A;  1AR0 A;  3LZA A;  1E3R A;  3OX9 A;  1K41 A;  1ULJ B;  3EN1 B;  5AIH A;  2JQ5 A;  4XBY A;  4N3V A;  4KVH A;  5IEP A;  5AEW B;  4HM7 B;  5KP1 A;  3MSO A;  3HX8 A;  3EQQ B;  2XSO B;  4HZB B;  1O7M B;  2I9W A;  3MHE A;  1VZZ A;  1E97 A;  3CNM A;  2RFR A;  5AII A;  4WYK B;  3OXA A;  2HMO B;  5CLK A;  3RGA A;  4XB5 A;  1ISK A;  1JN5 A;  1DMQ A;  3DXO A;  3EHC A;  3B4P A;  3NV0 A;  4J8T A;  3EF8 A;  1GY6 A;  4HM4 B;  5KP3 A;  3K0Z A;  3FF0 A;  1U5O A;  2GEY A;  3NXJ A;  3G0K A;  2YFJ B;  3DMC A;  3NM2 A;  3DM8 A;  3H3H A;  3IPT A;  3GWR A;  5D83 A;  5IG5 A;  1ZO2 A;  3EX9 A;  3MKI A;  3Q90 A;  3HK4 A;  5G2G A;  4HM1 B;  4MJD A;  1O7P B;  3FKA A;  2XSH B;  1Q42 A;  3M8C A;  3JUN A;  3SOA A;  2GXF A;  1W01 A;  2YFL B;  3B7C A;  3SOY A;  1O7G B;  4OVM A;  5AIF A;  4RZM A;  3VSY A;  3LYG A;  1OHP A;  1O7W B;  3F40 A;  4HM5 B;  3UJM A;  2HML B;  3EBT A;  1CQS A;  1Z1S A;  5AI1 A;  3FSD A;  3JUO A;  3FGY A;  4GB5 A;  1OCV A;  1OUN A;  3F8X A;  3MG1 A;  3DZL A;  3STD A;  5EVH A;  2YFI B;  1GY5 A;  1JN5 B;  3GZR A;  3KKG A;  3NV0 B;  3H51 A;  4H3U A;  1TUH A;  2XRX B;  5TGN A;  3NBR A;  5STD A;  3G16 A;  4XDW A;  3OV4 A;  1EG9 B;  3GZX B;  1BUQ A;  2GEX A;  1E3V A;  1W02 A;  1A2K A;  3ER7 A;  1OH0 A;  1UUW B;  2HMJ B;  5IG0 A;  2Z76 A;  5KP4 A;  1OGZ A;  5IER A;  1W00 A;  2HMK B;  8CHO A;  3F7X A;  5D82 A;  4WP5 A;  2HMM B;  2F99 A;  4U13 A;  3S5C A;  5CK6 A;  3T8N A;  3F7S A;  2XR8 B;  3HZP A;  1EA2 A;  5CF1 A;  4R1K A;  1JB4 A;  1GYB A;  3KSP A;  2BMO B;  1NU3 A;  1OGX A;  4HVN A;  1TP6 A;  4X2O A;  1NDO B;  1SJW A;  5CXO A;  5BVB A;  3FF2 A;  3K7C A;  5BXQ A;  4XDV A;  5AIG A;  1DMN A;  1W6Y A;  1ASK A;  4XBT A;  3G8Z A;  1ULI B; 
#chains in the Genus database with same CATH topology
 3SED A;  6RNT A;  4J9A A;  4L7K A;  1ROV A;  4IIA A;  4JF8 A;  4EXR A;  1RGE A;  6STD A;  2OQE C;  5IW9 A;  4HM2 B;  3JUQ A;  1G02 A;  3PYJ A;  3TDG A;  3CCV 3;  2W9P A;  3FG4 A;  3PCR A;  9RNT A;  3EJV A;  1F8N A;  4O8S A;  1O7H B;  1IV9 A;  1WQL B;  1VQ8 3;  1D6Z A;  1RCK A;  1M1K 4;  3CPO A;  1FUW A;  1RN1 A;  3CCE 3;  3ZG5 A;  2HOH A;  3FCS B;  2RCD A;  3O8Y A;  1JB5 A;  1GY7 A;  2C10 A;  5DRE A;  4AKY A;  3B4O A;  1I2E A;  5EQL A;  3VF1 A;  3CCR 3;  2GBW B;  2H0H A;  1OF5 A;  2WOH A;  4FCM A;  3GRD A;  3A5E A;  3KN4 A;  3PCS A;  1GMR A;  1W6G A;  3SX1 A;  1W2B 2;  4LMI A;  2C11 A;  4BTY A;  3GZB A;  2B24 B;  1GOU A;  4STD A;  1A2P A;  2HMN B;  2IMJ A;  1B2M A;  5IG3 A;  1I3F A;  3BNC A;  3GAX A;  5HOH A;  3FH1 A;  1Q81 4;  1Q7H A;  3ALA A;  3EBY A;  4IT7 A;  4N6L A;  4ORL A;  2CFW A;  2OWP A;  5CF2 A;  1DMM A;  2CG0 A;  3CNX A;  2ZHX B;  3BNB A;  1Q40 A;  4HKV B;  1M9G A;  3D3L A;  5JBS A;  1PU4 A;  1JZO A;  1LQG C;  1O7N B;  4HZ9 B;  3X3Y A;  1NO3 A;  3X3X A;  1KC8 4;  1K28 A;  2WGO A;  5LC7 A;  2KCD A;  3A76 A;  1VQQ A;  1NJI 4;  4HM8 B;  4LEH A;  1OHS A;  4L8P A;  3ECF A;  3DGO A;  4LSO A;  2RSX A;  4I5Q A;  7RNT A;  5BU4 A;  1B2U A;  1HKX A;  1IU7 A;  1I0X A;  1JV2 B;  1RSN A;  1IQX A;  4RNT A;  3CC4 3;  4BL3 A;  2KXG A;  3BNE A;  2XEP A;  4BIR A;  1YIJ 3;  1FGR A;  1BRG A;  1OAC A;  1JB2 A;  1OPY A;  3D9R A;  1V57 A;  3CXC 2;  3MYT A;  3FZW A;  4HJL B;  2Z77 A;  1IVX A;  2Z7A A;  1OHO A;  1BRI A;  4WWU C;  4WFO A;  1IDP A;  2KF3 A;  4GHO A;  4BU4 A;  1IK3 A;  1LQM B;  5HGR A;  3KFQ C;  3JUM A;  2CH9 A;  3HOH A;  3QRD A;  3B8L A;  3K9M C;  2BMQ B;  2FXT A;  3AGN A;  4L8O A;  4K1V A;  1B21 A;  2B1X B;  5G1L A;  1NWW A;  4MMY B;  1ZGX A;  1GMQ A;  4I4K A;  3RNT A;  6GSP A;  1Y4K A;  4HM6 B;  1FUS A;  3OWU A;  4XM4 A;  4LYL B;  1N5H A;  2BMR B;  2F5M A;  3RGR A;  4HOH A;  4J5K A;  4X2H A;  3WOE B;  1UI7 A;  1AQZ A;  1AY7 A;  1RDS A;  2KF6 A;  2W9Q A;  3KZT A;  2FGT A;  3FG1 A;  3L0R A;  3MWZ A;  1GSP A;  1I70 A;  2SAR A;  3SYU A;  2CFL A;  3CMA 3;  4O02 B;  3UB1 A;  1FGO A;  1JKG A;  1PY3 A;  2P0X A;  3NQZ A;  3BLZ A;  2W2C A;  5EEO A;  3KSE D;  1QMA A;  2PZV A;  3DUK A;  4FMA A;  1SIH A;  2A15 A;  5AEU B;  1VQL 3;  1SAR A;  3K63 A;  4LGQ A;  5DRV A;  3NQY A;  4MMX B;  3T0U A;  3MG3 A;  1YI2 3;  5IEN A;  1STD A;  3WHO A;  1GD3 A;  1RLS A;  1KQS 2;  1IVU A;  1VQO 3;  2OTL 3;  1M1X B;  4KT3 B;  1B27 A;  1OF5 B;  4FCJ A;  4XBX A;  2CWT A;  2BU4 A;  3I0Y A;  1UUV B;  1MNL A;  1LVN A;  1T2I A;  2CKF B;  3FLJ A;  3F14 A;  4ILF A;  3G6E 3;  1G96 A;  2FNQ A;  3D79 A;  3Q2P A;  1TTO A;  1RNB A;  1QJG A;  3EC9 A;  2V1L A;  2L4V A;  3JUP A;  3OWY A;  1Q40 B;  2GBX B;  1YJW 3;  1YVB I;  3EN8 A;  3MG2 A;  3VGN A;  3MPH A;  1MOL A;  2OTJ 3;  3OWS A;  1DE3 A;  4R9K A;  1STF I;  2CHC A;  4K1U A;  4Q53 A;  1I0V A;  1DET A;  4CDL A;  2STD A;  1MGW A;  5G1K A;  3CC7 3;  5D81 A;  1VQ6 3;  2M7O A;  2Y73 A;  1JBR A;  1U8C B;  2UX0 A;  2INX A;  4PEJ A;  1EUI C;  5IG4 A;  2F86 B;  2ML5 A;  2QA4 3;  4WYK A;  4N6N B;  3NBB A;  4K90 B;  1W5Z A;  5AYR B;  4HM3 B;  1I3I A;  1PYL A;  3NX0 A;  4MMZ B;  2CG1 A;  3F8H A;  3KE7 A;  7STD A;  2CWU A;  2D42 A;  4OUQ A;  3SLU A;  1EQK A;  1MWR A;  3E99 A;  2RGQ A;  4HM0 B;  1VQ5 3;  2GU3 A;  2XGL A;  3F9S A;  3NHX A;  2W56 A;  3U97 A;  2KF4 A;  1K9M 4;  2RNT A;  1UCK A;  3X42 A;  2CFD A;  4DKI A;  5JPU A;  3BB9 A;  1GS3 A;  1W4N A;  2Q07 A;  1BNS A;  4NPB A;  4EC6 A;  1LNH A;  1R4Y A;  3KCH A;  2CFG A;  5JPP A;  2R4I A;  1UGH I;  2QGU A;  4NRE A;  3WDG B;  1TRP A;  2O9U X;  1B2S A;  3S67 A;  1ZX2 A;  3SXX A;  2ZL8 A;  3CU3 A;  1V74 A;  2KAA A;  1LRA A;  1NB3 I;  2MF7 A;  3ROB A;  3SVA A;  1AVL A;  2K3D A;  4FMB A;  2P09 A;  4O2H A;  5FW5 A;  1IVW A;  3NUV A;  2OOV C;  3NM7 A;  4HAA A;  3CCL 3;  1CH0 A;  2F98 A;  5IEO A;  3T8U A;  1QVF 2;  2O3O A;  1JKG B;  1GOY A;  3LTB A;  4CCV A;  2F5W A;  3GZY B;  3WA3 A;  1YGE A;  2ZA4 A;  1GMP A;  2OCT A;  4WHA A;  1FUT A;  1JZD A;  3HII A;  1T3B A;  1LOX A;  2XFT A;  1C7H A;  3LTA A;  3UNL A;  2OQE A;  2BNG A;  3NBJ A;  1BSE A;  4R9L A;  5IF6 A;  5BIR A;  2BO9 B;  1J2B A;  3AMO A;  3WMD A;  1FYS A;  4BTX A;  1N8Q A;  2K54 A;  1S5A A;  2QIY A;  4MEI A;  3WR2 A;  1BRS A;  1AR0 A;  1B20 A;  1RGF A;  2LYX A;  1YIT 3;  5I97 A;  3LZA A;  1DVC A;  1A90 A;  3J7Y d;  1E3R A;  1LNI A;  4N6V 0;  1JNQ A;  5ELJ A;  1JBS A;  2XFS A;  1GOV A;  1I2F A;  1RGL A;  3OX9 A;  1BIR A;  4TX4 A;  1YJN 3;  2CWV A;  1K41 A;  1RGH A;  1ULJ B;  3EN1 B;  2BT3 A;  3AHS A;  3PXM A;  1Q86 4;  5AIH A;  2JQ5 A;  1UCI A;  1IT7 A;  4XBY A;  3Q1C A;  3X40 A;  4N3V A;  1BRK A;  2C4B A;  4KVH A;  5M19 A;  1N8R 4;  4CPK A;  4AEQ A;  4OK0 A;  1BNF A;  5IEP A;  5AEW B;  4HM7 B;  5KP1 A;  3RDE A;  3CCQ 3;  3MSO A;  3HX8 A;  3EQQ B;  1Q7Y 4;  2XSO B;  1IT8 A;  1RJO A;  1WMP A;  8RNT A;  4HZB B;  1O7M B;  2CFK A;  1SII A;  5FGO A;  2UGI A;  3IMA B;  2I9W A;  3MHE A;  1UW1 A;  1VZZ A;  1E97 A;  3CNM A;  1MWT A;  1NNV A;  2RFR A;  5AII A;  3S29 A;  2P0M A;  3D5G A;  3EB8 A;  1BGS A;  1BVI A;  4KFE A;  4WYK B;  3OXA A;  1CEW I;  3HIG A;  1KD1 4;  2HMO B;  4J5G A;  1UGI A;  4IPB A;  5CLK A;  1RGA A;  1RNT A;  4GSP A;  4KFD A;  3CME 3;  3RGA A;  2JDI H;  4XB5 A;  1ISK A;  1WMO A;  1W6C A;  1JN5 A;  2J8X B;  1DMQ A;  2AAD A;  3LXU X;  2W56 B;  3DXO A;  3EHC A;  3B4P A;  3NV0 A;  3V99 A;  4EW5 A;  4J8T A;  1VQK 3;  1YJ9 3;  2GU1 A;  3EF8 A;  1GY6 A;  2W03 A;  4EV5 A;  3S28 A;  5A0O B;  2LQV A;  4HM4 B;  2IUK A;  1T5Y A;  1BRH A;  1CYV A;  4GL6 A;  1WTH A;  5KP3 A;  3K0Z A;  1C54 A;  3FF0 A;  1U5O A;  1YNV X;  2GEY A;  1MWU A;  3NXJ A;  1IQ8 A;  3G0K A;  4RNY A;  2YFJ B;  1VQM 3;  3DMC A;  3NM2 A;  3DM8 A;  3H3H A;  3IPT A;  3GWR A;  5D83 A;  3U1W A;  5IG5 A;  1ZO2 A;  1WNH A;  1W2Z A;  2CX1 A;  3EX9 A;  1RGK A;  1TIJ A;  1BAO A;  1Q9E A;  3MKI A;  3Q90 A;  4NHF A;  3V92 A;  3IJE B;  3HK4 A;  2P05 A;  1RTU A;  1UI8 A;  5G2G A;  2Y74 A;  3LTD A;  4HM1 B;  1NB5 I;  5AYS C;  1D6Y A;  2ML6 A;  1RKY A;  3AMO B;  1RCL A;  1UDI I;  4MJD A;  3WA2 X;  1O7P B;  3UL5 A;  1TRQ A;  3FKA A;  2XSH B;  1RN4 A;  1JBT A;  1I2G A;  1T2H A;  1Q42 A;  2IY2 A;  3N8B A;  5GSP A;  2MC8 A;  3I56 3;  3LH4 A;  1UCJ A;  1JJ2 2;  4G1M B;  3EE1 A;  3OW2 2;  3G71 3;  1ZS7 A;  4KZ1 A;  4EYC A;  3M8C A;  4EBG A;  1B2Z A;  3CCS 3;  3JUN A;  1HU9 A;  2F4Y A;  1BU4 A;  2P38 A;  5M1A A;  3SOA A;  2GXF A;  1W01 A;  2YFL B;  3B7C A;  3DGL A;  4H61 A;  2BIR A;  3SOY A;  4EV2 A;  3CC2 3;  3V98 A;  1KSI A;  1O7G B;  2WO0 A;  5ELU A;  4N6U A;  4OVM A;  4QWT A;  1I8V A;  3N9H A;  5AIF A;  1Q82 4;  4RZM A;  3VSY A;  3LYG A;  1RRL A;  1OHP A;  2IYJ A;  1BSB A;  1L5G B;  1K73 4;  1BUJ A;  1O7W B;  3K5T A;  3F40 A;  4HM5 B;  1R4C A;  1BAN A;  3UJM A;  2HML B;  1BNI A;  1BSA A;  3D4A A;  3EBT A;  1FW7 A;  1WMN A;  1Z1S A;  1CQS A;  1BOX A;  5AI1 A;  3DGY A;  3FSD A;  3JUO A;  4K61 A;  1ROA A;  3PZW A;  3FGY A;  4GB5 A;  1DYU A;  1VQ9 3;  3LT9 A;  4CJN A;  1BSC A;  1OCV A;  1OUN A;  3JVC A;  5LC6 A;  2E2U A;  2WGQ A;  2XF3 A;  1BRJ A;  1AVK A;  1GD4 A;  3F8X A;  3KII A;  3DZL A;  3MG1 A;  2AAE A;  3STD A;  5EVH A;  3G4S 3;  2YFI B;  1GY5 A;  1JN5 B;  3GZR A;  4R4K A;  4HBR A;  2UUG C;  3WOD G;  1BRN L;  1TFK A;  3KKG A;  1RMS A;  2CK3 H;  2KRT A;  3NV0 B;  4BL2 A;  3H51 A;  1B2X A;  1TUH A;  4H3U A;  2XRX B;  5TGN A;  1VQN 3;  3NBR A;  5STD A;  1QVG 2;  1HZ1 A;  1YGW A;  3G16 A;  3PS8 A;  1FGM A;  1X1W A;  1DVD A;  2YX9 A;  1FGT A;  3PGB A;  3QK9 A;  1KWI A;  1MWS A;  4XDW A;  3CCM 3;  2BHM A;  1EKM A;  3OV4 A;  1K8A 4;  1EG9 B;  4RBN A;  3BND A;  3LTC A;  3GZX B;  3CPW 2;  1BUQ A;  1TJD A;  1UCL A;  1N9E A;  1BNE A;  1PFP A;  2RBI A;  2W0Q A;  2Z6B A;  1X1Y A;  3LML A;  4FMD A;  2GEX A;  3DY5 A;  1E3V A;  1W02 A;  5RNT A;  1LXE A;  7GSP A;  4N6O B;  1A2K A;  1RRH A;  2XGN A;  4O3V A;  2QEX 3;  3ER7 A;  1MGR A;  1W7C A;  4RNZ A;  1LOY A;  1OH0 A;  1UUW B;  2HMJ B;  5IG0 A;  2OOV A;  1VQ4 3;  2Z76 A;  4FCZ A;  5KP4 A;  1HYF A;  1OGZ A;  1QAL A;  1JRQ A;  1QAK A;  1LOV A;  5IER A;  1BNJ A;  1W00 A;  2WOF A;  1YHQ 3;  2HMK B;  3AGO A;  3WOF B;  8CHO A;  2GSP A;  3F7X A;  5D82 A;  1FGQ A;  1FA3 A;  3I55 3;  4KFF A;  2HMM B;  4LZI A;  2F56 A;  4WP5 A;  1QAF A;  2F99 A;  5M18 A;  2W04 A;  4U13 A;  1AV4 A;  1IV7 A;  3S5C A;  2CX0 A;  3S27 A;  2W6J H;  2IA7 A;  2H0I A;  2K0M A;  2L1S A;  2R41 A;  1FZU A;  4N6T A;  5CK6 A;  3T8N A;  2CW9 A;  3F7S A;  3GSP A;  3HI7 A;  3AHW A;  4R80 A;  3URP A;  1D6U A;  1B3S A;  3ZG0 A;  2XR8 B;  1IQY A;  1G0T A;  1RHL A;  1UUG B;  3HZP A;  3N54 B;  3Q3F A;  2CC3 A;  1RGG A;  3CD6 3;  1S72 3;  4HYZ A;  3FG3 A;  1EA2 A;  3BU4 A;  5CF1 A;  1N5P A;  1LOW A;  2CIU A;  1A2V A;  3LT8 A;  4R1K A;  4AKZ A;  1TU5 A;  1JB4 A;  3DGN A;  1RN7 A;  1GYB A;  1X1X A;  3KSP A;  2H0G A;  2BMO B;  3CCJ 3;  1VQ7 3;  1X1U A;  1N9J A;  4ZM8 A;  1BSD A;  1NU3 A;  3X41 A;  1OGX A;  2E2T A;  1IVV A;  3UL6 A;  1YVS A;  4HVN A;  3LOY A;  1TP6 A;  3D5I A;  2KF5 A;  4X2O A;  1NDO B;  3ZFZ A;  1SPU A;  2IUJ A;  2E2V A;  2D1W A;  1BNG A;  1SJW A;  2SBL A;  5CXO A;  3X3Z A;  5BVB A;  1TFO A;  1A67 A;  1SQW A;  3FF2 A;  3K7C A;  5BXQ A;  3BIR A;  3DH2 A;  1EEJ A;  4XDV A;  2ZDJ A;  1DMN A;  5AIG A;  1BNR A;  4FMC A;  1IYY A;  1W6Y A;  1ASK A;  4JRF A;  3DGM A;  1RGC A;  1V58 A;  4BTW A;  4XBT A;  1VQP 3;  4N6M A;  1US1 A;  1CYU A;  3CCU 3;  1M90 4;  3G8Z A;  1ULI B;  4FR9 A;  2PNC A;  2XH9 A; 
#chains in the Genus database with same CATH homology
 3SED A;  4J9A A;  4L7K A;  1ROV A;  4IIA A;  4JF8 A;  4EXR A;  6STD A;  5IW9 A;  2OQE C;  4HM2 B;  3JUQ A;  3PYJ A;  3TDG A;  3CCV 3;  2W9P A;  3FG4 A;  3PCR A;  3EJV A;  1F8N A;  4O8S A;  1O7H B;  1IV9 A;  1WQL B;  1VQ8 3;  1D6Z A;  1M1K 4;  3CPO A;  1FUW A;  3CCE 3;  3FCS B;  2RCD A;  3O8Y A;  1JB5 A;  1GY7 A;  2C10 A;  5DRE A;  4AKY A;  3B4O A;  5EQL A;  3VF1 A;  3CCR 3;  2GBW B;  1OF5 A;  2WOH A;  4FCM A;  3GRD A;  3PCS A;  3KN4 A;  1W2B 2;  1W6G A;  3SX1 A;  4LMI A;  2C11 A;  4BTY A;  3GZB A;  2B24 B;  4STD A;  2HMN B;  2IMJ A;  5IG3 A;  3BNC A;  3GAX A;  3FH1 A;  1Q81 4;  4IT7 A;  3ALA A;  3EBY A;  4N6L A;  4ORL A;  2CFW A;  2OWP A;  5CF2 A;  1DMM A;  2CG0 A;  3CNX A;  3BNB A;  1Q40 A;  4HKV B;  1M9G A;  3D3L A;  5JBS A;  1PU4 A;  1O7N B;  4HZ9 B;  3X3Y A;  1NO3 A;  3X3X A;  1KC8 4;  1K28 A;  2WGO A;  5LC7 A;  2KCD A;  3A76 A;  1NJI 4;  4HM8 B;  4LEH A;  1OHS A;  4L8P A;  3ECF A;  3DGO A;  4LSO A;  2RSX A;  1HKX A;  1IU7 A;  3CC4 3;  1JV2 B;  1IQX A;  2KXG A;  3BNE A;  2XEP A;  1YIJ 3;  1FGR A;  1OAC A;  1JB2 A;  1OPY A;  3D9R A;  3CXC 2;  3MYT A;  3FZW A;  4HJL B;  2Z77 A;  1IVX A;  2Z7A A;  1OHO A;  4WWU C;  1IK3 A;  4WFO A;  1IDP A;  5HGR A;  3KFQ C;  3JUM A;  2CH9 A;  3QRD A;  3B8L A;  3K9M C;  2BMQ B;  2FXT A;  4L8O A;  4K1V A;  2B1X B;  1NWW A;  4MMY B;  4I4K A;  1Y4K A;  4HM6 B;  4XM4 A;  3OWU A;  1N5H A;  2BMR B;  3RGR A;  4X2H A;  3WOE B;  1UI7 A;  2W9Q A;  3KZT A;  3MWZ A;  2FGT A;  3FG1 A;  3L0R A;  4CDL A;  3CMA 3;  1FA3 A;  2CFL A;  4O02 B;  3UB1 A;  1FGO A;  1JKG A;  2P0X A;  3NQZ A;  3BLZ A;  2W2C A;  5EEO A;  3KSE D;  1QMA A;  2PZV A;  3DUK A;  4FMA A;  1SIH A;  2A15 A;  5AEU B;  1VQL 3;  3K63 A;  4LGQ A;  5DRV A;  3NQY A;  4MMX B;  3T0U A;  3MG3 A;  1YI2 3;  5IEN A;  1STD A;  1KQS 2;  1GD3 A;  2OTL 3;  1IVU A;  1VQO 3;  1M1X B;  1OF5 B;  4FCJ A;  4XBX A;  2CWT A;  3I0Y A;  1UUV B;  1MNL A;  1LVN A;  2CKF B;  3FLJ A;  3F14 A;  3G6E 3;  1G96 A;  2FNQ A;  3Q2P A;  1QJG A;  3EC9 A;  2V1L A;  2L4V A;  3JUP A;  3OWY A;  1Q40 B;  2GBX B;  1YJW 3;  1YVB I;  3EN8 A;  3MG2 A;  3VGN A;  3MPH A;  1MOL A;  2OTJ 3;  3OWS A;  4R9K A;  1STF I;  2CHC A;  4K1U A;  4Q53 A;  2STD A;  3CC7 3;  5D81 A;  1VQ6 3;  2M7O A;  2Y73 A;  1U8C B;  2UX0 A;  2INX A;  4PEJ A;  5IG4 A;  2F86 B;  2ML5 A;  2QA4 3;  4WYK A;  4N6N B;  3NBB A;  4K90 B;  1W5Z A;  5AYR B;  4HM3 B;  3NX0 A;  4MMZ B;  2CG1 A;  3F8H A;  3KE7 A;  7STD A;  2CWU A;  2D42 A;  4OUQ A;  3SLU A;  1EQK A;  3E99 A;  2RGQ A;  4HM0 B;  1VQ5 3;  2GU3 A;  2XGL A;  3F9S A;  3NHX A;  2W56 A;  3U97 A;  1K9M 4;  3X42 A;  2CFD A;  5JPU A;  3BB9 A;  1GS3 A;  1W4N A;  2Q07 A;  4EC6 A;  1LNH A;  2CFG A;  5JPP A;  2R4I A;  2QGU A;  4NRE A;  3WDG B;  2O9U X;  3S67 A;  1ZX2 A;  3SXX A;  2ZL8 A;  3CU3 A;  1V74 A;  1NB3 I;  2MF7 A;  3ROB A;  3SVA A;  1AVL A;  4FMB A;  2P09 A;  4O2H A;  5FW5 A;  1IVW A;  3NUV A;  2OOV C;  3NM7 A;  3CCL 3;  2F98 A;  5IEO A;  3T8U A;  1QVF 2;  2O3O A;  1JKG B;  4CCV A;  3LTB A;  3WA3 A;  3GZY B;  1YGE A;  2OCT A;  4WHA A;  3HII A;  2XFT A;  1LOX A;  3LTA A;  1C7H A;  3UNL A;  2OQE A;  2BNG A;  3NBJ A;  4R9L A;  5IF6 A;  2BO9 B;  1J2B A;  3AMO A;  3WMD A;  4BTX A;  1N8Q A;  2K54 A;  1S5A A;  2QIY A;  4MEI A;  1AR0 A;  2LYX A;  1YIT 3;  5I97 A;  3LZA A;  1DVC A;  1A90 A;  3J7Y d;  1E3R A;  4N6V 0;  1JNQ A;  5ELJ A;  2XFS A;  3OX9 A;  4TX4 A;  1YJN 3;  2CWV A;  1K41 A;  1ULJ B;  3EN1 B;  2BT3 A;  3PXM A;  1Q86 4;  5AIH A;  2JQ5 A;  1IT7 A;  4XBY A;  3Q1C A;  3X40 A;  4N3V A;  4KVH A;  1N8R 4;  4AEQ A;  4OK0 A;  5IEP A;  5AEW B;  4HM7 B;  5KP1 A;  3RDE A;  3CCQ 3;  3MSO A;  3HX8 A;  3EQQ B;  1Q7Y 4;  2XSO B;  1IT8 A;  1RJO A;  1WMP A;  4HZB B;  1O7M B;  2CFK A;  1SII A;  5FGO A;  3IMA B;  2I9W A;  3MHE A;  1UW1 A;  1VZZ A;  1E97 A;  3CNM A;  2RFR A;  5AII A;  3S29 A;  2P0M A;  3EB8 A;  4KFE A;  4WYK B;  3OXA A;  1CEW I;  3HIG A;  1KD1 4;  2HMO B;  4IPB A;  5CLK A;  4KFD A;  3CME 3;  3RGA A;  2JDI H;  4XB5 A;  1ISK A;  1WMO A;  1W6C A;  1JN5 A;  1DMQ A;  3LXU X;  2W56 B;  3DXO A;  3EHC A;  3B4P A;  3NV0 A;  3V99 A;  4J8T A;  1VQK 3;  1YJ9 3;  2GU1 A;  3EF8 A;  1GY6 A;  2W03 A;  4EV5 A;  3S28 A;  5A0O B;  2LQV A;  4HM4 B;  2IUK A;  1T5Y A;  1CYV A;  4GL6 A;  1WTH A;  5KP3 A;  3K0Z A;  3FF0 A;  1U5O A;  2GEY A;  3NXJ A;  1IQ8 A;  3G0K A;  4RNY A;  2YFJ B;  1VQM 3;  3DMC A;  3NM2 A;  3DM8 A;  3H3H A;  3IPT A;  3GWR A;  5D83 A;  3U1W A;  5IG5 A;  1ZO2 A;  1WNH A;  1W2Z A;  3EX9 A;  1TIJ A;  3MKI A;  3Q90 A;  4NHF A;  3V92 A;  3IJE B;  3HK4 A;  2P05 A;  1UI8 A;  5G2G A;  2Y74 A;  3LTD A;  4HM1 B;  1NB5 I;  5AYS C;  1D6Y A;  2ML6 A;  1RKY A;  3AMO B;  4MJD A;  3WA2 X;  1O7P B;  3UL5 A;  3FKA A;  2XSH B;  1Q42 A;  3N8B A;  2MC8 A;  3I56 3;  3LH4 A;  1JJ2 2;  4G1M B;  3EE1 A;  3OW2 2;  3G71 3;  4KZ1 A;  4EYC A;  3M8C A;  4EBG A;  3CCS 3;  3JUN A;  1HU9 A;  2P38 A;  3SOA A;  2GXF A;  1W01 A;  2YFL B;  3B7C A;  3DGL A;  4H61 A;  3SOY A;  4EV2 A;  3CC2 3;  3V98 A;  1KSI A;  1O7G B;  2WO0 A;  5ELU A;  4N6U A;  4OVM A;  4QWT A;  3N9H A;  5AIF A;  1Q82 4;  4RZM A;  3VSY A;  3LYG A;  1RRL A;  1OHP A;  1L5G B;  1K73 4;  1O7W B;  3K5T A;  3F40 A;  4HM5 B;  1R4C A;  3UJM A;  2HML B;  3EBT A;  1WMN A;  1Z1S A;  1CQS A;  5AI1 A;  3FSD A;  3JUO A;  4K61 A;  1ROA A;  3PZW A;  3FGY A;  4GB5 A;  1DYU A;  1VQ9 3;  3LT9 A;  1OCV A;  5LC6 A;  1OUN A;  3JVC A;  2E2U A;  2WGQ A;  2XF3 A;  3F8X A;  1AVK A;  1GD4 A;  3MG1 A;  3KII A;  3DZL A;  3STD A;  5EVH A;  3G4S 3;  2YFI B;  1GY5 A;  1JN5 B;  3GZR A;  4R4K A;  4HBR A;  3WOD G;  1TFK A;  3KKG A;  2CK3 H;  2KRT A;  3NV0 B;  3H51 A;  4H3U A;  1TUH A;  2XRX B;  5TGN A;  1VQN 3;  3NBR A;  5STD A;  1QVG 2;  3G16 A;  3PS8 A;  1FGM A;  1DVD A;  2YX9 A;  1FGT A;  3PGB A;  3QK9 A;  1KWI A;  4XDW A;  3CCM 3;  2BHM A;  1EKM A;  3OV4 A;  1K8A 4;  1EG9 B;  4RBN A;  3BND A;  3LTC A;  3GZX B;  3CPW 2;  1BUQ A;  1N9E A;  1PFP A;  2W0Q A;  2Z6B A;  3LML A;  4FMD A;  2GEX A;  3DY5 A;  1E3V A;  1W02 A;  1LXE A;  4N6O B;  1A2K A;  1RRH A;  2XGN A;  4O3V A;  2QEX 3;  3ER7 A;  1W7C A;  4RNZ A;  1OH0 A;  1UUW B;  2HMJ B;  5IG0 A;  2OOV A;  1VQ4 3;  2Z76 A;  4FCZ A;  5KP4 A;  1OGZ A;  1QAL A;  1JRQ A;  1QAK A;  5IER A;  2WOF A;  1W00 A;  1YHQ 3;  2HMK B;  3WOF B;  8CHO A;  3F7X A;  5D82 A;  1FGQ A;  3I55 3;  4KFF A;  2HMM B;  4LZI A;  4WP5 A;  1QAF A;  2F99 A;  2W04 A;  4U13 A;  1AV4 A;  1IV7 A;  3S5C A;  3S27 A;  2W6J H;  2IA7 A;  2K0M A;  4N6T A;  5CK6 A;  3T8N A;  2CW9 A;  3F7S A;  3HI7 A;  4R80 A;  1D6U A;  2XR8 B;  1IQY A;  3HZP A;  3N54 B;  2CC3 A;  3CD6 3;  1S72 3;  4HYZ A;  3FG3 A;  1EA2 A;  5CF1 A;  1N5P A;  2CIU A;  3LT8 A;  1A2V A;  4R1K A;  4AKZ A;  1TU5 A;  1JB4 A;  3DGN A;  1RN7 A;  1GYB A;  3KSP A;  2BMO B;  3CCJ 3;  1VQ7 3;  1N9J A;  4ZM8 A;  1NU3 A;  3X41 A;  1OGX A;  2E2T A;  1IVV A;  3UL6 A;  4HVN A;  3LOY A;  1TP6 A;  4X2O A;  1NDO B;  1SPU A;  2IUJ A;  2E2V A;  2D1W A;  1SJW A;  2SBL A;  5CXO A;  3X3Z A;  5BVB A;  1TFO A;  1A67 A;  1SQW A;  3FF2 A;  3K7C A;  5BXQ A;  4XDV A;  5AIG A;  2ZDJ A;  1DMN A;  4FMC A;  1W6Y A;  1ASK A;  4JRF A;  3DGM A;  4BTW A;  4XBT A;  1VQP 3;  4N6M A;  1US1 A;  1CYU A;  3CCU 3;  1M90 4;  3G8Z A;  1ULI B;  4FR9 A;  2PNC A;  2XH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...