2PZVA

Crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound phenol
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Testing Electrostatic complementarity in Enzyme Catalysis: Hydrogen Bonding in the Ketosteroid Isomerase Oxyanion Hole
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 32
structure length 123
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2pzvA00
3FF2A 7STDA 2GEXA 1O7NB 5AI1A 1AR0A 5KP3A 3EHCA 3MKIA 3T8NA 5JPPA 1S5AA 4XBTA 3OXAA 4HZ9B 2GBWB 4OVMA 1NDOB 5CXOA 1OGZA 5DREA 1OHOA 1DMNA 3FF0A 3FZWA 4LEHA 3UNLA 4K1VA 1O7MB 2BMRB 2XSOB 1O7HB 2Z7AA 1Z1SA 2F99A 4WWUC 4WYKB 1NWWA 4XBXA 5IG5A 2I9WA 3MHEA 4R9LA 3JUPA 1C7HA 5IG4A 2JQ5A 3EF8A 1Q42A 3K7CA 3KZTA 4L7KA 4U13A 3EN8A 4HVNA 4XDWA 1EA2A 1ASKA 1TUHA 1OCVA 1W01A 3WMDA 3LZAA 3JUOA 4HM4B 3NM2A 4LMIA 1OF5A 3DXOA 5STDA 2BMOB 1E97A 4HM0B 2CKFB 1ISKA 1DMQA 2HMKB 2OWPA 4OUQA 1JKGB 8CHOA 3MSOA 3CNXA 3HZPA 4HM2B 1STDA 3FKAA 2STDA 2IMJA 3JUNA 3EJVA 3SOYA 2QIYA 1JB5A 3MG3A 4IIAA 3EBTA 1ULIB 1EG9B 2Z77A 1WQLB 1ZO2A 1Q40A 1O7GB 2XR8B 3I0YA 1OH0A 2R4IA 4WYKA 3DMCA 3NV0A 5CK6A 5D81A 3SEDA 3STDA 1IDPA 2Z76A 3FLJA 1DMMA 3F8HA 3VGNA 5IG0A 1OPYA 4HZBB 2YFIB 2B24B 3VSYA 5CF1A 1JB4A 1W6YA 2RGQA 3M8CA 3ECFA 2K54A 4HM8B 3E99A 5G2GA 3G0KA 3G16A 4N3VA 3F9SA 4HJLB 5IENA 3MG1A 3GWRA 4XM4A 3H3HA 5AIIA 3EX9A 3G8ZA 2CHCA 2BNGA 2GXFA 2W2CA 3JUMA 4HM6B 5TGNA 3ER7A 5KP4A 4X2OA 1UUVB 3OV4A 3NXJA 1NU3A 4HKVB 3GZYB 1GYBA 4K1UA 1E3VA 1JN5B 3F14A 1BUQA 1OUNA 2YFLB 3CPOA 3F7XA 1GY5A 1W00A 1JKGA 2XSHB 4WP5A 3UJMA 3OX9A 2INXA 3NUVA 3OWSA 4Q53A 1GY6A 4STDA 5AEUB 3BLZA 2F86B 1QMAA 3OWYA 5AEWB 4FCMA 1GY7A 1HKXA 1O7WB 1U5OA 3K0ZA 5DRVA 1E3RA 4R1KA 3Q90A 1VZZA 3EN1B 4R9KA 4RZMA 5BXQA 3GZBA 4ORLA 3SOAA 3EBYA 3GRDA 1ULJB 2GBXB 5AIFA 4XDVA 5IEOA 5KP1A 2XRXB 3MYTA 4XB5A 3DM8A 4HM3B 5AIGA 1K41A 2HMJB 3CNMA 3F40A 2PZVA 3MG2A 4X2HA 1A2KA 3IPTA 3BB9A 1TP6A 1JB2A 3GZRA 3HX8A 3JUQA 3KE7A 4GB5A 4HM5B 3B8LA 4KVHA 4PEJA 5AIHA 2UX0A 1W02A 3OWUA 3T8UA 4CDLA 1GS3A 5HGRA 1UUWB 3HK4A 1O7PB 1OHPA 3KKGA 6STDA 2HMLB 3DUKA 2BMQB 4L8PA 1JN5A 3H51A 2GEYA 1OGXA 2QGUA 3F7SA 3EQQB 4XBYA 4MJDA 2F98A 1SJWA 2HMMB 4HM1B 2YFJB 5CLKA 5EVHA 3ROBA 3NBRA 3RGRA 1ZX2A 3B4PA 5IEPA 3F8XA 5CF2A 3EC9A 2HMNB 5D82A 5D83A 3B7CA 4I4KA 4LGQA 2RFRA 3FSDA 3GZXB 3DZLA 3S5CA 5JPUA 3NHXA 4HM7B 4J9AA 5BVBA 1QJGA 2A15A 4FCJA 1OHSA 2B1XB 5FW5A 3FH1A 5IG3A 5IF6A 1CQSA 3KSPA 4J8TA 4L8OA 1OF5B 4H3UA 2RCDA 3A76A 3FGYA 1Q40B 3D9RA 3B4OA 3NV0B 5IERA 3CU3A 3LYGA 3RGAA 2HMOB
chains in the Genus database with same CATH superfamily
4AKZA 2L1SA 1IV7A 1SQWA 2KAAA 2P05A 1LNHA 3MKIA 2LQVA 5AYRB 3PXMA 3N54B 4XBTA 4EYCA 2GBWB 3G713 1BIRA 1FZUA 1OGZA 1R4CA 3CCR3 2BO9B 1FUWA 1IVWA 2O9UX 4JRFA 3KN4A 1O7HB 4K1VA 1BVIA 2F99A 5IG5A 3NQYA 1W7CA 1L5GB 3MHEA 3U97A 2CW9A 3JUPA 3V99A 3CCV3 2JQ5A 1GD3A 3K7CA 4L7KA 3KZTA 4HVNA 3S67A 1RNBA 1OCVA 3BNCA 1A67A 1FUTA 3DGLA 1D6ZA 3NM2A 1OF5A 3DXOA 1LOYA 1SIIA 2CKFB 4N6NB 1DMQA 2HMKB 1MWTA 2OWPA 1MWSA 4N6UA 4OUQA 3G6E3 3CD63 4DKIA 2CX1A 1NJI4 3JUNA 2RNTA 3FG4A 4KZ1A 3U1WA 1BRGA 1K8A4 1YJN3 1Q40A 1O7GB 2XR8B 4WYKA 1OH0A 2R4IA 3CCL3 1K734 3NV0A 1GOVA 5CK6A 2OQEA 3SEDA 1DE3A 2W03A 2Z76A 1BNJA 3VGNA 5IG0A 4HZBB 3VSYA 5CF1A 1A2VA 1VQ43 4IT7A 3BNEA 3I563 2K54A 1KSIA 3AHWA 5G2GA 2D42A 4N3VA 1IU7A 1T2IA 5IW9A 2ZHXB 4HYZA 5AIIA 3G8ZA 2CHCA 2GXFA 4HM6B 2KF4A 3ER7A 1UUVB 2BIRA 1VQM3 3NXJA 2OTJ3 1BRSA 1GYBA 1LOWA 2E2UA 4EV5A 1BUQA 3X3ZA 1FGMA 1OUNA 3CPOA 1W00A 3UB1A 2XSHB 4WP5A 2QEX3 3L0RA 1S723 3AMOB 3OWSA 2XFSA 4FMBA 5AEWB 1RNTA 1M9GA 1HKXA 1U5OA 1G96A 2W9QA 2AADA 1CEWI 3Q3FA 1E3RA 2L4VA 4R1KA 1VZZA 5BXQA 3CCJ3 2OTL3 1TFKA 6RNTA 2CWVA 1RCKA 1IVUA 3LTBA 1DVCA 1ROAA 4RNYA 2W56A 1Y4KA 1BU4A 1I0VA 2H0HA 3CNMA 4X2HA 1A2KA 3IPTA 4EW5A 3GZRA 1JB2A 3HX8A 4KVHA 4GB5A 1KC84 4PEJA 2XGLA 3B8LA 3S29A 4O2HA 4CDLA 4LYLB 2KCDA 4BL3A 3CCU3 1GS3A 3KKGA 1U8CB 1JN5A 1I0XA 1MGWA 1OGXA 2D1WA 2GEYA 6GSPA 2IUJA 4LSOA 1FW7A 2F98A 1AV4A 1IQXA 3X42A 3CPW2 2Q07A 1Q824 1VQ83 1ZX2A 3B4PA 1RGGA 1YNVX 1N5PA 1LXEA 5IEPA 1FGOA 1RGEA 1IT8A 1W6CA 1IVXA 5CF2A 1Q7Y4 2CG0A 1I2EA 2RFRA 3WDGB 1LNIA 5JPUA 3NHXA 2JDIH 1LOXA 1BRJA 1QJGA 1I3IA 1W4NA 3GSPA 1LRAA 4J5GA 3KFQC 1B2UA 8RNTA 3D9RA 1C54A 2FXTA 2KRTA 3DGNA 3RGAA 2HMOB 3FF2A 7STDA 1JJ22 1J2BA 5AI1A 3T8NA 5JPPA 3OXAA 4HZ9B 3EE1A 1BRHA 1GOYA 1NDOB 4BIRA 1DMNA 4LEHA 2Z7AA 1Q814 1RMSA 1Z1SA 4WWUC 1RDSA 2WOHA 3BU4A 3UL6A 1C7HA 1N9EA 5I97A 3EN8A 4MEIA 1ASKA 4O02B 3LTAA 1FYSA 1ROVA 3LTCA 4HM4B 5G1KA 1BRNL 1G02A 1ISKA 5STDA 2BMOB 1N5HA 4HM0B 2UUGC 1SPUA 3D4AA 3LH4A 3X41A 3KCHA 1WMNA 3MSOA 1EKMA 3QK9A 3DY5A 1STFI 1RGHA 2STDA 3V98A 2IMJA 3DGOA 3AGNA 3DH2A 1JB5A 5LC6A 2F5MA 4MMYB 2OQEC 1G0TA 1WQLB 1ZO2A 2PNCA 3HI7A 1QALA 1BAOA 3DMCA 2FNQA 3FLJA 2BHMA 3D3LA 1RN1A 1JZDA 1OPYA 1FGRA 2YFIB 1JBRA 2KF6A 2E2TA 1QVG2 1MGRA 1TU5A 1JV2B 1GD4A 5IENA 1MOLA 5FGOA 4IPBA 4XM4A 1RLSA 1VQ63 1RJOA 2ZL8A 3EX9A 5TGNA 2BNGA 4GHOA 1Q9EA 1Q7HA 2FGTA 2WGQA 3KIIA 3OV4A 4HKVB 9RNTA 3GZYB 4K1UA 1JN5B 1HZ1A 4EC6A 1RN7A 4I5QA 1WMOA 1SIHA 2O3OA 1YI23 1BSEA 1I70A 2CH9A 3ZG0A 1GY5A 4OK0A 3OX9A 1US1A 1D6YA 4Q53A 3BLZA 3UL5A 2F86B 3IJEB 3OWYA 1DETA 1EEJA 1BNIA 3LTDA 5DRVA 3A5EA 1JBTA 1PYLA 1IYYA 1WTHA 1FGQA 1I2GA 2P0MA 3GZBA 3S27A 3PS8A 3SOAA 1RGCA 2HOHA 3EBYA 1IQ8A 1YHQ3 4BTWA 4XDVA 5IEOA 3MYTA 4XB5A 3DM8A 4HM3B 1T3BA 5AIGA 1ZS7A 1K41A 2Y74A 3JVCA 3MG2A 4WHAA 1K28A 4HM5B 1TP6A 2CIUA 3JUQA 3Q1CA 4GL6A 2UX0A 1YJ93 1MWRA 2YX9A 3WR2A 1FA3A 1RKYA 3DUKA 2BMQB 1VQK3 1N9JA 1UI7A 3H51A 1NNVA 3OW22 1YIT3 1K9M4 3DGYA 4BU4A 5GSPA 3K63A 5CLKA 5EVHA 1VQL3 3LT8A 1SARA 2F5WA 7RNTA 2C4BA 1UCIA 3F8XA 4CPKA 1VQO3 1V58A 4HBRA 1MWUA 5M1AA 1RGAA 4I4KA 1T2HA 3RDEA 3GZXB 3D5GA 3S5CA 3WA2X 3CCM3 3S28A 3SLUA 4EXRA 1OACA 5AYSC 2KXGA 5FW5A 5IF6A 4KFDA 1NB3I 4N6LA 4H61A 4H3UA 4CJNA 1B2ZA 1Q40B 1YGWA 2IA7A 3B4OA 3NBBA 2CFKA 3WOFB 2XGNA 2RSXA 2UGIA 4FMAA 1NB5I 1RSNA 1AR0A 3EHCA 3ALAA 1S5AA 4KFFA 4OVMA 5DREA 3SYUA 5A0OB 1OHOA 3UNLA 2BMRB 2XSOB 4WFOA 1BRIA 2I9WA 4R9LA 4LZIA 1YVSA 4XDWA 1EA2A 1TUHA 1VQ53 1W01A 1TRPA 1RCLA 2CFDA 3JUOA 4G1MB 1JNQA 4LMIA 1LQMB 3FCSB 3AHSA 1EUIC 2E2VA 3N8BA 4FMDA 4AKYA 2SARA 3HIIA 1JBSA 4HM2B 4BTXA 5JBSA 1STDA 4MMXB 2KF5A 4ILFA 3BIRA 2XH9A 2CWUA 3EJVA 3N9HA 3SOYA 1V57A 2CFLA 2XF3A 1RRHA 3MG3A 3MPHA 4IIAA 1BNEA 2CFWA 1A90A 1TIJA 1EG9B 1UCLA 2Z77A 3I0YA 1TTOA 2R41A 3STDA 5D81A 2W04A 2AAEA 1DMMA 3F8HA 1GMRA 4O8SA 3CMA3 2W6JH 1B2MA 2B24B 2K3DA 1JB4A 2RBIA 3LXUX 1HU9A 2WO0A 3LT9A 3CCS3 3ECFA 3E99A 4NPBA 1W5ZA 1Q864 3G4S3 3FG1A 2C10A 3F9SA 1T5YA 2WOFA 3MG1A 3H3HA 4QWTA 3X3XA 2W2CA 4FMCA 4K61A 1DYUA 2LYXA 4X2OA 1BNFA 3I553 2BT3A 1E3VA 2W0QA 3PGBA 4HOHA 4MMZB 2GSPA 3O8YA 1BUJA 1JKGA 3J7Yd 2CK3H 2INXA 1M904 1GY6A 1TJDA 4STDA 1QMAA 1ZGXA 1UI8A 4FCMA 3D5IA 1O7WB 4K90B 3Q90A 4R9KA 2ZDJA 1LQGC 4RNTA 1VQN3 5BIRA 3GRDA 5AIFA 1X1XA 1I2FA 2CFGA 3NX0A 3NM7A 2HMJB 4NREA 3F40A 3NBJA 1M1K4 3SX1A 3FG3A 3D79A 3KE7A 3BNDA 1N8QA 1UUWB 4RNZA 2OCTA 1KWIA 2HMLB 4HAAA 1DVDA 4KT3B 4R4KA 3EB8A 3EQQB 4XBYA 4MJDA 2HMMB 1VQ93 3ROBA 1JRQA 3NBRA 3RGRA 1RGLA 1QAFA 3EC9A 2HMNB 1N8R4 1AVKA 4LGQA 2F56A 1GSPA 1WMPA 4ZM8A 2V1LA 5M19A 4FCJA 2H0IA 1OHSA 2B1XB 2XEPA 3HOHA 2QA43 4GSPA 1TFOA 1CQSA 3KSPA 3CC23 4J8TA 4L8OA 1HYFA 2RCDA 3K9MC 4N6TA 2MF7A 3CCE3 3Q2PA 5IERA 3CU3A 5CXOA 1RTUA 1BNGA 2GEXA 1GMQA 1O7NB 1JZOA 1FUSA 1WNHA 1BNSA 4N6MA 1IK3A 5G1LA 5KP3A 2ML6A 1A2PA 4O3VA 1BANA 5AEUB 1BSAA 1X1YA 2J8XB 3FF0A 3FZWA 1O7MB 1QAKA 1RGFA 1UGIA 1IT7A 1LOVA 1NWWA 4WYKB 4XBXA 2K0MA 3PCSA 5KP1A 5IG4A 3EF8A 4U13A 1Q42A 3CCQ3 1W2B2 3KSED 1VQQA 3WMDA 2P0XA 1GMPA 2M7OA 1B27A 2ML5A 3LZAA 1RRLA 1CYUA 1UGHI 3ZFZA 1E97A 1EQKA 1JKGB 1UCJA 1BRKA 3CNXA 3HZPA 1R4YA 2CC3A 5EQLA 3WA3A 3IMAB 3TDGA 3VF1A 3FKAA 3CXC2 5LC7A 2MC8A 1UUGB 3SVAA 1AQZA 1MNLA 4AEQA 2QIYA 3EBTA 3PYJA 2CWTA 1ULIB 1AVLA 4FR9A 4N6OB 3LOYA 1M1XB 2IYJA 1IDPA 3ZG5A 4KFEA 2OOVC 1D6UA 3NQZA 4J5KA 5BU4A 1W6YA 2RGQA 3M8CA 2IY2A 3AMOA 3PCRA 2P09A 1B2SA 3AGOA 4HM8B 5HOHA 3CC43 3G0KA 2W56B 3G16A 1W2ZA 4HJLB 1GOUA 3GWRA 3URPA 1BSBA 1LVNA 2IUKA 2CG1A 3CME3 3JUMA 5KP4A 1KQS2 1BGSA 1PY3A 3WOEB 3K5TA 1TRQA 1NU3A 7GSPA 3F14A 1X1WA 1I3FA 2YFLB 3F7XA 3UJMA 1QVF2 1YIJ3 3X3YA 3NUVA 1BSCA 1UCKA 5EEOA 1V74A 1AY7A 1UDII 2WGOA 1GY7A 1B20A 1I8VA 3GAXA 3K0ZA 2P38A 5RNTA 5M18A 2C11A 3EN1B 1F8NA 3DGMA 4RZMA 4BL2A 2GU3A 4ORLA 4TX4A 1YJW3 4EV2A 1ULJB 2GBXB 1NO3A 4NHFA 1BNRA 2XRXB 4R80A 1YGEA 3HIGA 3QRDA 1UW1A 2PZVA 1RHLA 3MWZA 8CHOA 1YVBI 2Z6BA 2H0GA 3BB9A 3LMLA 5AIHA 3T8UA 3WHOA 1PU4A 3OWUA 1W02A 2GU1A 1B2XA 1CYVA 5HGRA 1B3SA 3HK4A 1O7PB 1OHPA 1BOXA 2KF3A 6STDA 3X40A 5ELUA 2OOVA 4CCVA 1IQYA 4L8PA 2QGUA 3F7SA 1RGKA 1IV9A 1BSDA 2XFTA 1PFPA 1SJWA 4HM1B 1X1UA 2YFJB 1CH0A 1VQP3 3WODG 2F4YA 1KD14 1W6GA 1FGTA 1B21A 2Y73A 4N6V0 5D82A 5D83A 3B7CA 2W9PA 2ZA4A 4BTYA 3FSDA 3CC73 3DZLA 4EBGA 4J9AA 2CX0A 4HM7B 5BVBA 2A15A 1RN4A 2BU4A 5ELJA 3BNBA 3FH1A 5IG3A 1VQ73 4JF8A 3V92A 4RBNA 1OF5B 3SXXA 3RNTA 3A76A 3FGYA 3PZWA 4FCZA 1IVVA 3T0UA 3NV0B 2SBLA 3LYGA
chains in the Genus database with same CATH topology
4AKZA 1IV7A 1SQWA 2P05A 1LNHA 3MKIA 2LQVA 5AYRB 3PXMA 3N54B 4XBTA 4EYCA 2GBWB 3G713 1OGZA 1R4CA 3CCR3 2BO9B 1FUWA 1IVWA 2O9UX 4JRFA 3KN4A 1O7HB 4K1VA 2F99A 5IG5A 3NQYA 1W7CA 1L5GB 3MHEA 3U97A 2CW9A 3JUPA 3V99A 3CCV3 2JQ5A 1GD3A 3K7CA 4L7KA 3KZTA 4HVNA 3S67A 1OCVA 3BNCA 1A67A 3DGLA 1D6ZA 3NM2A 1OF5A 3DXOA 1SIIA 2CKFB 4N6NB 4N6UA 1DMQA 2HMKB 2OWPA 4OUQA 3G6E3 3CD63 3JUNA 3FG4A 4KZ1A 3U1WA 1K8A4 1YJN3 1Q40A 1O7GB 2XR8B 4WYKA 1OH0A 2R4IA 3CCL3 1K734 3NV0A 5CK6A 2OQEA 3SEDA 2W03A 2Z76A 3VGNA 5IG0A 4HZBB 3VSYA 5CF1A 1A2VA 1VQ43 4IT7A 3BNEA 3I563 2K54A 1KSIA 5G2GA 2D42A 4N3VA 1IU7A 5IW9A 4HYZA 5AIIA 3G8ZA 2CHCA 2GXFA 4HM6B 3ER7A 1UUVB 1VQM3 3NXJA 2OTJ3 1GYBA 1BUQA 2E2UA 4EV5A 3X3ZA 1FGMA 1OUNA 3CPOA 1W00A 3UB1A 2XSHB 4WP5A 2QEX3 3L0RA 1S723 3AMOB 3OWSA 2XFSA 4FMBA 5AEWB 1M9GA 1HKXA 1U5OA 1G96A 2W9QA 1CEWI 1E3RA 2L4VA 4R1KA 1VZZA 5BXQA 3CCJ3 2OTL3 1TFKA 2CWVA 1IVUA 3LTBA 1DVCA 1ROAA 4RNYA 2W56A 1Y4KA 3CNMA 4X2HA 1KC84 1A2KA 3IPTA 3GZRA 1JB2A 3HX8A 4KVHA 4GB5A 4PEJA 2XGLA 3B8LA 3S29A 4O2HA 4CDLA 2KCDA 3CCU3 1GS3A 3KKGA 1U8CB 1JN5A 2D1WA 1OGXA 2GEYA 2IUJA 4LSOA 2F98A 1AV4A 1IQXA 3X42A 3CPW2 2Q07A 1Q824 1VQ83 1ZX2A 3B4PA 5IEPA 1N5PA 1LXEA 1NJI4 1FGOA 1W6CA 1IT8A 5CF2A 1IVXA 1Q7Y4 2CG0A 2RFRA 3WDGB 5JPUA 3NHXA 2JDIH 1LOXA 1QJGA 1W4NA 3KFQC 3D9RA 2FXTA 2KRTA 3DGNA 3RGAA 2HMOB 3FF2A 7STDA 1JJ22 1J2BA 5AI1A 3T8NA 5JPPA 3OXAA 4HZ9B 3EE1A 1NDOB 1DMNA 4LEHA 2Z7AA 1Q814 1Z1SA 4WWUC 2WOHA 3UL6A 1C7HA 1N9EA 5I97A 3EN8A 4MEIA 1ASKA 4O02B 3LTAA 1ROVA 3LTCA 4HM4B 1ISKA 5STDA 2BMOB 1N5HA 4HM0B 1SPUA 3LH4A 3X41A 1WMNA 3MSOA 1EKMA 3QK9A 3DY5A 1STFI 2STDA 3V98A 2IMJA 3DGOA 1JB5A 5LC6A 4MMYB 2OQEC 1WQLB 1ZO2A 2PNCA 3HI7A 1QALA 3DMCA 2FNQA 3FLJA 2BHMA 3D3LA 1OPYA 1FGRA 2YFIB 2E2TA 1QVG2 1TU5A 1JV2B 1GD4A 5IENA 1MOLA 5FGOA 4IPBA 4XM4A 1VQ63 1RJOA 2ZL8A 3EX9A 5TGNA 2BNGA 2FGTA 2WGQA 3KIIA 3OV4A 4HKVB 3GZYB 4K1UA 1JN5B 4EC6A 1RN7A 1YI23 1WMOA 1SIHA 2O3OA 2CH9A 1GY5A 4OK0A 3OX9A 1US1A 1D6YA 4Q53A 3BLZA 3UL5A 2F86B 3IJEB 3OWYA 3LTDA 5DRVA 1WTHA 1FGQA 2P0MA 3GZBA 3S27A 3PS8A 3SOAA 3EBYA 1IQ8A 1YHQ3 4BTWA 4XDVA 5IEOA 3MYTA 4XB5A 3DM8A 4HM3B 5AIGA 1K41A 3JVCA 2Y74A 3MG2A 4WHAA 1K28A 4HM5B 1TP6A 2CIUA 3JUQA 3Q1CA 4GL6A 2UX0A 1YJ93 2YX9A 1FA3A 1RKYA 3DUKA 2BMQB 1VQK3 1N9JA 1UI7A 3H51A 3OW22 1YIT3 1K9M4 3K63A 5CLKA 5EVHA 1VQL3 3LT8A 3F8XA 1VQO3 4HBRA 4I4KA 3RDEA 3GZXB 3S5CA 3CCM3 3WA2X 3S28A 3SLUA 4EXRA 1OACA 5AYSC 2KXGA 5FW5A 5IF6A 4KFDA 1NB3I 4N6LA 4H61A 4H3UA 1Q40B 3B4OA 2IA7A 3NBBA 2CFKA 3WOFB 2XGNA 2RSXA 4FMAA 1NB5I 1AR0A 3EHCA 3ALAA 1S5AA 4KFFA 4OVMA 5DREA 5A0OB 1OHOA 3UNLA 2BMRB 2XSOB 4WFOA 2I9WA 4R9LA 4LZIA 4XDWA 1EA2A 1TUHA 1VQ53 1W01A 2CFDA 3JUOA 4G1MB 1JNQA 4LMIA 3FCSB 2E2VA 3N8BA 4FMDA 4AKYA 3HIIA 4HM2B 4BTXA 5JBSA 1STDA 4MMXB 2XH9A 2CWUA 3EJVA 3N9HA 3SOYA 2CFLA 2XF3A 1RRHA 3MG3A 3MPHA 4IIAA 2CFWA 1A90A 1TIJA 1EG9B 2Z77A 3I0YA 3STDA 5D81A 2W04A 1DMMA 3F8HA 4O8SA 3CMA3 2W6JH 2B24B 1JB4A 3LXUX 1HU9A 2WO0A 3LT9A 3CCS3 3ECFA 3E99A 1W5ZA 1Q864 3G4S3 3FG1A 2C10A 3F9SA 1T5YA 2WOFA 3MG1A 3H3HA 4QWTA 3X3XA 2W2CA 4FMCA 4K61A 1DYUA 2LYXA 4X2OA 3I553 2BT3A 1E3VA 2W0QA 3PGBA 4MMZB 3O8YA 1JKGA 3J7Yd 2CK3H 2INXA 1M904 1GY6A 4STDA 1QMAA 1UI8A 4FCMA 1O7WB 4K90B 3Q90A 4R9KA 2ZDJA 1VQN3 3GRDA 5AIFA 2CFGA 3NX0A 3NM7A 2HMJB 4NREA 3F40A 3NBJA 1M1K4 3SX1A 3FG3A 3KE7A 3BNDA 1N8QA 1UUWB 4RNZA 2OCTA 1KWIA 2HMLB 1DVDA 4R4KA 3EB8A 3EQQB 4XBYA 4MJDA 2HMMB 1VQ93 3ROBA 1JRQA 3NBRA 3RGRA 1QAFA 3EC9A 2HMNB 1N8R4 1AVKA 4LGQA 1WMPA 4ZM8A 2V1LA 4FCJA 2XEPA 1OHSA 2B1XB 2QA43 1TFOA 1CQSA 3KSPA 3CC23 4J8TA 4L8OA 2RCDA 3K9MC 4N6TA 2MF7A 3CCE3 3Q2PA 5IERA 3CU3A 5CXOA 2GEXA 1O7NB 1WNHA 1IK3A 4N6MA 5KP3A 2ML6A 4O3VA 5AEUB 3FF0A 3FZWA 1O7MB 1QAKA 4WYKB 1IT7A 1NWWA 4XBXA 2K0MA 3PCSA 5KP1A 5IG4A 3EF8A 4U13A 1Q42A 3CCQ3 1W2B2 3KSED 3WMDA 2P0XA 2M7OA 3LZAA 2ML5A 1RRLA 1CYUA 1E97A 1EQKA 1JKGB 3CNXA 3HZPA 5EQLA 2CC3A 3WA3A 3IMAB 3TDGA 3VF1A 3FKAA 3CXC2 5LC7A 2MC8A 3SVAA 1MNLA 4AEQA 2QIYA 3EBTA 3PYJA 2CWTA 1ULIB 1AVLA 4FR9A 4N6OB 3LOYA 1M1XB 1IDPA 4KFEA 2OOVC 1D6UA 3NQZA 1W6YA 2RGQA 3M8CA 3AMOA 3PCRA 2P09A 4HM8B 3CC43 3G0KA 2W56B 3G16A 1W2ZA 4HJLB 3GWRA 1LVNA 2CG1A 2IUKA 3CME3 3JUMA 5KP4A 1KQS2 3WOEB 3K5TA 1NU3A 3F14A 2YFLB 3F7XA 3UJMA 1QVF2 1YIJ3 3X3YA 3NUVA 5EEOA 1V74A 2WGOA 1GY7A 3GAXA 3K0ZA 2P38A 2C11A 3EN1B 1F8NA 3DGMA 4RZMA 2GU3A 4ORLA 4TX4A 1YJW3 4EV2A 1ULJB 2GBXB 1NO3A 4NHFA 2XRXB 4R80A 1YGEA 3HIGA 3QRDA 1UW1A 2PZVA 8CHOA 3MWZA 1YVBI 2Z6BA 3BB9A 3LMLA 5AIHA 3T8UA 1PU4A 3OWUA 1W02A 2GU1A 1CYVA 5HGRA 3HK4A 1O7PB 1OHPA 6STDA 3X40A 5ELUA 2OOVA 4CCVA 1IQYA 4L8PA 2QGUA 3F7SA 1IV9A 2XFTA 1PFPA 1SJWA 4HM1B 2YFJB 1VQP3 3WODG 1KD14 1W6GA 1FGTA 2Y73A 4N6V0 4BTYA 5D82A 5D83A 3B7CA 2W9PA 3CC73 3FSDA 3DZLA 4EBGA 4J9AA 4HM7B 5BVBA 2A15A 5ELJA 3BNBA 3FH1A 5IG3A 1VQ73 4JF8A 3V92A 4RBNA 1OF5B 3SXXA 3A76A 3FGYA 3PZWA 4FCZA 1IVVA 3T0UA 3NV0B 2SBLA 3LYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF2 A;  7STD A;  2GEX A;  1O7N B;  5AI1 A;  1AR0 A;  5KP3 A;  3EHC A;  3MKI A;  3T8N A;  5JPP A;  1S5A A;  4XBT A;  3OXA A;  4HZ9 B;  2GBW B;  4OVM A;  1NDO B;  5CXO A;  1OGZ A;  5DRE A;  1OHO A;  1DMN A;  3FF0 A;  3FZW A;  4LEH A;  3UNL A;  4K1V A;  1O7M B;  2BMR B;  2XSO B;  1O7H B;  2Z7A A;  1Z1S A;  2F99 A;  4WWU C;  4WYK B;  1NWW A;  4XBX A;  5IG5 A;  2I9W A;  3MHE A;  4R9L A;  3JUP A;  1C7H A;  5IG4 A;  2JQ5 A;  3EF8 A;  1Q42 A;  3K7C A;  3KZT A;  4L7K A;  4U13 A;  3EN8 A;  4HVN A;  4XDW A;  1EA2 A;  1ASK A;  1TUH A;  1OCV A;  1W01 A;  3WMD A;  3LZA A;  3JUO A;  4HM4 B;  3NM2 A;  4LMI A;  1OF5 A;  3DXO A;  5STD A;  2BMO B;  1E97 A;  4HM0 B;  2CKF B;  1ISK A;  1DMQ A;  2HMK B;  2OWP A;  4OUQ A;  1JKG B;  8CHO A;  3MSO A;  3CNX A;  3HZP A;  4HM2 B;  1STD A;  3FKA A;  2STD A;  2IMJ A;  3JUN A;  3EJV A;  3SOY A;  2QIY A;  1JB5 A;  3MG3 A;  4IIA A;  3EBT A;  1ULI B;  1EG9 B;  2Z77 A;  1WQL B;  1ZO2 A;  1Q40 A;  1O7G B;  2XR8 B;  3I0Y A;  1OH0 A;  2R4I A;  4WYK A;  3DMC A;  3NV0 A;  5CK6 A;  5D81 A;  3SED A;  3STD A;  1IDP A;  2Z76 A;  3FLJ A;  1DMM A;  3F8H A;  3VGN A;  5IG0 A;  1OPY A;  4HZB B;  2YFI B;  2B24 B;  3VSY A;  5CF1 A;  1JB4 A;  1W6Y A;  2RGQ A;  3M8C A;  3ECF A;  2K54 A;  4HM8 B;  3E99 A;  5G2G A;  3G0K A;  3G16 A;  4N3V A;  3F9S A;  4HJL B;  5IEN A;  3MG1 A;  3GWR A;  4XM4 A;  3H3H A;  5AII A;  3EX9 A;  3G8Z A;  2CHC A;  2BNG A;  2GXF A;  2W2C A;  3JUM A;  4HM6 B;  5TGN A;  3ER7 A;  5KP4 A;  4X2O A;  1UUV B;  3OV4 A;  3NXJ A;  1NU3 A;  4HKV B;  3GZY B;  1GYB A;  4K1U A;  1E3V A;  1JN5 B;  3F14 A;  1BUQ A;  1OUN A;  2YFL B;  3CPO A;  3F7X A;  1GY5 A;  1W00 A;  1JKG A;  2XSH B;  4WP5 A;  3UJM A;  3OX9 A;  2INX A;  3NUV A;  3OWS A;  4Q53 A;  1GY6 A;  4STD A;  5AEU B;  3BLZ A;  2F86 B;  1QMA A;  3OWY A;  5AEW B;  4FCM A;  1GY7 A;  1HKX A;  1O7W B;  1U5O A;  3K0Z A;  5DRV A;  1E3R A;  4R1K A;  3Q90 A;  1VZZ A;  3EN1 B;  4R9K A;  4RZM A;  5BXQ A;  3GZB A;  4ORL A;  3SOA A;  3EBY A;  3GRD A;  1ULJ B;  2GBX B;  5AIF A;  4XDV A;  5IEO A;  5KP1 A;  2XRX B;  3MYT A;  4XB5 A;  3DM8 A;  4HM3 B;  5AIG A;  1K41 A;  2HMJ B;  3CNM A;  3F40 A;  2PZV A;  3MG2 A;  4X2H A;  1A2K A;  3IPT A;  3BB9 A;  1TP6 A;  1JB2 A;  3GZR A;  3HX8 A;  3JUQ A;  3KE7 A;  4GB5 A;  4HM5 B;  3B8L A;  4KVH A;  4PEJ A;  5AIH A;  2UX0 A;  1W02 A;  3OWU A;  3T8U A;  4CDL A;  1GS3 A;  5HGR A;  1UUW B;  3HK4 A;  1O7P B;  1OHP A;  3KKG A;  6STD A;  2HML B;  3DUK A;  2BMQ B;  4L8P A;  1JN5 A;  3H51 A;  2GEY A;  1OGX A;  2QGU A;  3F7S A;  3EQQ B;  4XBY A;  4MJD A;  2F98 A;  1SJW A;  2HMM B;  4HM1 B;  2YFJ B;  5CLK A;  5EVH A;  3ROB A;  3NBR A;  3RGR A;  1ZX2 A;  3B4P A;  5IEP A;  3F8X A;  5CF2 A;  3EC9 A;  2HMN B;  5D82 A;  5D83 A;  3B7C A;  4I4K A;  4LGQ A;  2RFR A;  3FSD A;  3GZX B;  3DZL A;  3S5C A;  5JPU A;  3NHX A;  4HM7 B;  4J9A A;  5BVB A;  1QJG A;  2A15 A;  4FCJ A;  1OHS A;  2B1X B;  5FW5 A;  3FH1 A;  5IG3 A;  5IF6 A;  1CQS A;  3KSP A;  4J8T A;  4L8O A;  1OF5 B;  4H3U A;  2RCD A;  3A76 A;  3FGY A;  1Q40 B;  3D9R A;  3B4O A;  3NV0 B;  5IER A;  3CU3 A;  3LYG A;  3RGA A;  2HMO B; 
#chains in the Genus database with same CATH topology
 4AKZ A;  2L1S A;  1IV7 A;  1SQW A;  2KAA A;  2P05 A;  1LNH A;  3MKI A;  2LQV A;  5AYR B;  3PXM A;  3N54 B;  4XBT A;  4EYC A;  2GBW B;  3G71 3;  1BIR A;  1FZU A;  1OGZ A;  1R4C A;  3CCR 3;  2BO9 B;  1FUW A;  1IVW A;  2O9U X;  4JRF A;  3KN4 A;  1O7H B;  4K1V A;  1BVI A;  2F99 A;  5IG5 A;  3NQY A;  1W7C A;  1L5G B;  3MHE A;  3U97 A;  2CW9 A;  3JUP A;  3V99 A;  3CCV 3;  2JQ5 A;  1GD3 A;  3K7C A;  4L7K A;  3KZT A;  4HVN A;  3S67 A;  1RNB A;  1OCV A;  3BNC A;  1A67 A;  1FUT A;  3DGL A;  1D6Z A;  3NM2 A;  1OF5 A;  3DXO A;  1LOY A;  1SII A;  2CKF B;  4N6N B;  1DMQ A;  2HMK B;  1MWT A;  2OWP A;  1MWS A;  4N6U A;  4OUQ A;  3G6E 3;  3CD6 3;  4DKI A;  2CX1 A;  1NJI 4;  3JUN A;  2RNT A;  3FG4 A;  4KZ1 A;  3U1W A;  1BRG A;  1K8A 4;  1YJN 3;  1Q40 A;  1O7G B;  2XR8 B;  4WYK A;  1OH0 A;  2R4I A;  3CCL 3;  1K73 4;  3NV0 A;  1GOV A;  5CK6 A;  2OQE A;  3SED A;  1DE3 A;  2W03 A;  2Z76 A;  1BNJ A;  3VGN A;  5IG0 A;  4HZB B;  3VSY A;  5CF1 A;  1A2V A;  1VQ4 3;  4IT7 A;  3BNE A;  3I56 3;  2K54 A;  1KSI A;  3AHW A;  5G2G A;  2D42 A;  4N3V A;  1IU7 A;  1T2I A;  5IW9 A;  2ZHX B;  4HYZ A;  5AII A;  3G8Z A;  2CHC A;  2GXF A;  4HM6 B;  2KF4 A;  3ER7 A;  1UUV B;  2BIR A;  1VQM 3;  3NXJ A;  2OTJ 3;  1BRS A;  1GYB A;  1LOW A;  2E2U A;  4EV5 A;  1BUQ A;  3X3Z A;  1FGM A;  1OUN A;  3CPO A;  1W00 A;  3UB1 A;  2XSH B;  4WP5 A;  2QEX 3;  3L0R A;  1S72 3;  3AMO B;  3OWS A;  2XFS A;  4FMB A;  5AEW B;  1RNT A;  1M9G A;  1HKX A;  1U5O A;  1G96 A;  2W9Q A;  2AAD A;  1CEW I;  3Q3F A;  1E3R A;  2L4V A;  4R1K A;  1VZZ A;  5BXQ A;  3CCJ 3;  2OTL 3;  1TFK A;  6RNT A;  2CWV A;  1RCK A;  1IVU A;  3LTB A;  1DVC A;  1ROA A;  4RNY A;  2W56 A;  1Y4K A;  1BU4 A;  1I0V A;  2H0H A;  3CNM A;  4X2H A;  1A2K A;  3IPT A;  4EW5 A;  3GZR A;  1JB2 A;  3HX8 A;  4KVH A;  4GB5 A;  1KC8 4;  4PEJ A;  2XGL A;  3B8L A;  3S29 A;  4O2H A;  4CDL A;  4LYL B;  2KCD A;  4BL3 A;  3CCU 3;  1GS3 A;  3KKG A;  1U8C B;  1JN5 A;  1I0X A;  1MGW A;  1OGX A;  2D1W A;  2GEY A;  6GSP A;  2IUJ A;  4LSO A;  1FW7 A;  2F98 A;  1AV4 A;  1IQX A;  3X42 A;  3CPW 2;  2Q07 A;  1Q82 4;  1VQ8 3;  1ZX2 A;  3B4P A;  1RGG A;  1YNV X;  1N5P A;  1LXE A;  5IEP A;  1FGO A;  1RGE A;  1IT8 A;  1W6C A;  1IVX A;  5CF2 A;  1Q7Y 4;  2CG0 A;  1I2E A;  2RFR A;  3WDG B;  1LNI A;  5JPU A;  3NHX A;  2JDI H;  1LOX A;  1BRJ A;  1QJG A;  1I3I A;  1W4N A;  3GSP A;  1LRA A;  4J5G A;  3KFQ C;  1B2U A;  8RNT A;  3D9R A;  1C54 A;  2FXT A;  2KRT A;  3DGN A;  3RGA A;  2HMO B;  3FF2 A;  7STD A;  1JJ2 2;  1J2B A;  5AI1 A;  3T8N A;  5JPP A;  3OXA A;  4HZ9 B;  3EE1 A;  1BRH A;  1GOY A;  1NDO B;  4BIR A;  1DMN A;  4LEH A;  2Z7A A;  1Q81 4;  1RMS A;  1Z1S A;  4WWU C;  1RDS A;  2WOH A;  3BU4 A;  3UL6 A;  1C7H A;  1N9E A;  5I97 A;  3EN8 A;  4MEI A;  1ASK A;  4O02 B;  3LTA A;  1FYS A;  1ROV A;  3LTC A;  4HM4 B;  5G1K A;  1BRN L;  1G02 A;  1ISK A;  5STD A;  2BMO B;  1N5H A;  4HM0 B;  2UUG C;  1SPU A;  3D4A A;  3LH4 A;  3X41 A;  3KCH A;  1WMN A;  3MSO A;  1EKM A;  3QK9 A;  3DY5 A;  1STF I;  1RGH A;  2STD A;  3V98 A;  2IMJ A;  3DGO A;  3AGN A;  3DH2 A;  1JB5 A;  5LC6 A;  2F5M A;  4MMY B;  2OQE C;  1G0T A;  1WQL B;  1ZO2 A;  2PNC A;  3HI7 A;  1QAL A;  1BAO A;  3DMC A;  2FNQ A;  3FLJ A;  2BHM A;  3D3L A;  1RN1 A;  1JZD A;  1OPY A;  1FGR A;  2YFI B;  1JBR A;  2KF6 A;  2E2T A;  1QVG 2;  1MGR A;  1TU5 A;  1JV2 B;  1GD4 A;  5IEN A;  1MOL A;  5FGO A;  4IPB A;  4XM4 A;  1RLS A;  1VQ6 3;  1RJO A;  2ZL8 A;  3EX9 A;  5TGN A;  2BNG A;  4GHO A;  1Q9E A;  1Q7H A;  2FGT A;  2WGQ A;  3KII A;  3OV4 A;  4HKV B;  9RNT A;  3GZY B;  4K1U A;  1JN5 B;  1HZ1 A;  4EC6 A;  1RN7 A;  4I5Q A;  1WMO A;  1SIH A;  2O3O A;  1YI2 3;  1BSE A;  1I70 A;  2CH9 A;  3ZG0 A;  1GY5 A;  4OK0 A;  3OX9 A;  1US1 A;  1D6Y A;  4Q53 A;  3BLZ A;  3UL5 A;  2F86 B;  3IJE B;  3OWY A;  1DET A;  1EEJ A;  1BNI A;  3LTD A;  5DRV A;  3A5E A;  1JBT A;  1PYL A;  1IYY A;  1WTH A;  1FGQ A;  1I2G A;  2P0M A;  3GZB A;  3S27 A;  3PS8 A;  3SOA A;  1RGC A;  2HOH A;  3EBY A;  1IQ8 A;  1YHQ 3;  4BTW A;  4XDV A;  5IEO A;  3MYT A;  4XB5 A;  3DM8 A;  4HM3 B;  1T3B A;  5AIG A;  1ZS7 A;  1K41 A;  2Y74 A;  3JVC A;  3MG2 A;  4WHA A;  1K28 A;  4HM5 B;  1TP6 A;  2CIU A;  3JUQ A;  3Q1C A;  4GL6 A;  2UX0 A;  1YJ9 3;  1MWR A;  2YX9 A;  3WR2 A;  1FA3 A;  1RKY A;  3DUK A;  2BMQ B;  1VQK 3;  1N9J A;  1UI7 A;  3H51 A;  1NNV A;  3OW2 2;  1YIT 3;  1K9M 4;  3DGY A;  4BU4 A;  5GSP A;  3K63 A;  5CLK A;  5EVH A;  1VQL 3;  3LT8 A;  1SAR A;  2F5W A;  7RNT A;  2C4B A;  1UCI A;  3F8X A;  4CPK A;  1VQO 3;  1V58 A;  4HBR A;  1MWU A;  5M1A A;  1RGA A;  4I4K A;  1T2H A;  3RDE A;  3GZX B;  3D5G A;  3S5C A;  3WA2 X;  3CCM 3;  3S28 A;  3SLU A;  4EXR A;  1OAC A;  5AYS C;  2KXG A;  5FW5 A;  5IF6 A;  4KFD A;  1NB3 I;  4N6L A;  4H61 A;  4H3U A;  4CJN A;  1B2Z A;  1Q40 B;  1YGW A;  2IA7 A;  3B4O A;  3NBB A;  2CFK A;  3WOF B;  2XGN A;  2RSX A;  2UGI A;  4FMA A;  1NB5 I;  1RSN A;  1AR0 A;  3EHC A;  3ALA A;  1S5A A;  4KFF A;  4OVM A;  5DRE A;  3SYU A;  5A0O B;  1OHO A;  3UNL A;  2BMR B;  2XSO B;  4WFO A;  1BRI A;  2I9W A;  4R9L A;  4LZI A;  1YVS A;  4XDW A;  1EA2 A;  1TUH A;  1VQ5 3;  1W01 A;  1TRP A;  1RCL A;  2CFD A;  3JUO A;  4G1M B;  1JNQ A;  4LMI A;  1LQM B;  3FCS B;  3AHS A;  1EUI C;  2E2V A;  3N8B A;  4FMD A;  4AKY A;  2SAR A;  3HII A;  1JBS A;  4HM2 B;  4BTX A;  5JBS A;  1STD A;  4MMX B;  2KF5 A;  4ILF A;  3BIR A;  2XH9 A;  2CWU A;  3EJV A;  3N9H A;  3SOY A;  1V57 A;  2CFL A;  2XF3 A;  1RRH A;  3MG3 A;  3MPH A;  4IIA A;  1BNE A;  2CFW A;  1A90 A;  1TIJ A;  1EG9 B;  1UCL A;  2Z77 A;  3I0Y A;  1TTO A;  2R41 A;  3STD A;  5D81 A;  2W04 A;  2AAE A;  1DMM A;  3F8H A;  1GMR A;  4O8S A;  3CMA 3;  2W6J H;  1B2M A;  2B24 B;  2K3D A;  1JB4 A;  2RBI A;  3LXU X;  1HU9 A;  2WO0 A;  3LT9 A;  3CCS 3;  3ECF A;  3E99 A;  4NPB A;  1W5Z A;  1Q86 4;  3G4S 3;  3FG1 A;  2C10 A;  3F9S A;  1T5Y A;  2WOF A;  3MG1 A;  3H3H A;  4QWT A;  3X3X A;  2W2C A;  4FMC A;  4K61 A;  1DYU A;  2LYX A;  4X2O A;  1BNF A;  3I55 3;  2BT3 A;  1E3V A;  2W0Q A;  3PGB A;  4HOH A;  4MMZ B;  2GSP A;  3O8Y A;  1BUJ A;  1JKG A;  3J7Y d;  2CK3 H;  2INX A;  1M90 4;  1GY6 A;  1TJD A;  4STD A;  1QMA A;  1ZGX A;  1UI8 A;  4FCM A;  3D5I A;  1O7W B;  4K90 B;  3Q90 A;  4R9K A;  2ZDJ A;  1LQG C;  4RNT A;  1VQN 3;  5BIR A;  3GRD A;  5AIF A;  1X1X A;  1I2F A;  2CFG A;  3NX0 A;  3NM7 A;  2HMJ B;  4NRE A;  3F40 A;  3NBJ A;  1M1K 4;  3SX1 A;  3FG3 A;  3D79 A;  3KE7 A;  3BND A;  1N8Q A;  1UUW B;  4RNZ A;  2OCT A;  1KWI A;  2HML B;  4HAA A;  1DVD A;  4KT3 B;  4R4K A;  3EB8 A;  3EQQ B;  4XBY A;  4MJD A;  2HMM B;  1VQ9 3;  3ROB A;  1JRQ A;  3NBR A;  3RGR A;  1RGL A;  1QAF A;  3EC9 A;  2HMN B;  1N8R 4;  1AVK A;  4LGQ A;  2F56 A;  1GSP A;  1WMP A;  4ZM8 A;  2V1L A;  5M19 A;  4FCJ A;  2H0I A;  1OHS A;  2B1X B;  2XEP A;  3HOH A;  2QA4 3;  4GSP A;  1TFO A;  1CQS A;  3KSP A;  3CC2 3;  4J8T A;  4L8O A;  1HYF A;  2RCD A;  3K9M C;  4N6T A;  2MF7 A;  3CCE 3;  3Q2P A;  5IER A;  3CU3 A;  5CXO A;  1RTU A;  1BNG A;  2GEX A;  1GMQ A;  1O7N B;  1JZO A;  1FUS A;  1WNH A;  1BNS A;  4N6M A;  1IK3 A;  5G1L A;  5KP3 A;  2ML6 A;  1A2P A;  4O3V A;  1BAN A;  5AEU B;  1BSA A;  1X1Y A;  2J8X B;  3FF0 A;  3FZW A;  1O7M B;  1QAK A;  1RGF A;  1UGI A;  1IT7 A;  1LOV A;  1NWW A;  4WYK B;  4XBX A;  2K0M A;  3PCS A;  5KP1 A;  5IG4 A;  3EF8 A;  4U13 A;  1Q42 A;  3CCQ 3;  1W2B 2;  3KSE D;  1VQQ A;  3WMD A;  2P0X A;  1GMP A;  2M7O A;  1B27 A;  2ML5 A;  3LZA A;  1RRL A;  1CYU A;  1UGH I;  3ZFZ A;  1E97 A;  1EQK A;  1JKG B;  1UCJ A;  1BRK A;  3CNX A;  3HZP A;  1R4Y A;  2CC3 A;  5EQL A;  3WA3 A;  3IMA B;  3TDG A;  3VF1 A;  3FKA A;  3CXC 2;  5LC7 A;  2MC8 A;  1UUG B;  3SVA A;  1AQZ A;  1MNL A;  4AEQ A;  2QIY A;  3EBT A;  3PYJ A;  2CWT A;  1ULI B;  1AVL A;  4FR9 A;  4N6O B;  3LOY A;  1M1X B;  2IYJ A;  1IDP A;  3ZG5 A;  4KFE A;  2OOV C;  1D6U A;  3NQZ A;  4J5K A;  5BU4 A;  1W6Y A;  2RGQ A;  3M8C A;  2IY2 A;  3AMO A;  3PCR A;  2P09 A;  1B2S A;  3AGO A;  4HM8 B;  5HOH A;  3CC4 3;  3G0K A;  2W56 B;  3G16 A;  1W2Z A;  4HJL B;  1GOU A;  3GWR A;  3URP A;  1BSB A;  1LVN A;  2IUK A;  2CG1 A;  3CME 3;  3JUM A;  5KP4 A;  1KQS 2;  1BGS A;  1PY3 A;  3WOE B;  3K5T A;  1TRQ A;  1NU3 A;  7GSP A;  3F14 A;  1X1W A;  1I3F A;  2YFL B;  3F7X A;  3UJM A;  1QVF 2;  1YIJ 3;  3X3Y A;  3NUV A;  1BSC A;  1UCK A;  5EEO A;  1V74 A;  1AY7 A;  1UDI I;  2WGO A;  1GY7 A;  1B20 A;  1I8V A;  3GAX A;  3K0Z A;  2P38 A;  5RNT A;  5M18 A;  2C11 A;  3EN1 B;  1F8N A;  3DGM A;  4RZM A;  4BL2 A;  2GU3 A;  4ORL A;  4TX4 A;  1YJW 3;  4EV2 A;  1ULJ B;  2GBX B;  1NO3 A;  4NHF A;  1BNR A;  2XRX B;  4R80 A;  1YGE A;  3HIG A;  3QRD A;  1UW1 A;  2PZV A;  1RHL A;  3MWZ A;  8CHO A;  1YVB I;  2Z6B A;  2H0G A;  3BB9 A;  3LML A;  5AIH A;  3T8U A;  3WHO A;  1PU4 A;  3OWU A;  1W02 A;  2GU1 A;  1B2X A;  1CYV A;  5HGR A;  1B3S A;  3HK4 A;  1O7P B;  1OHP A;  1BOX A;  2KF3 A;  6STD A;  3X40 A;  5ELU A;  2OOV A;  4CCV A;  1IQY A;  4L8P A;  2QGU A;  3F7S A;  1RGK A;  1IV9 A;  1BSD A;  2XFT A;  1PFP A;  1SJW A;  4HM1 B;  1X1U A;  2YFJ B;  1CH0 A;  1VQP 3;  3WOD G;  2F4Y A;  1KD1 4;  1W6G A;  1FGT A;  1B21 A;  2Y73 A;  4N6V 0;  5D82 A;  5D83 A;  3B7C A;  2W9P A;  2ZA4 A;  4BTY A;  3FSD A;  3CC7 3;  3DZL A;  4EBG A;  4J9A A;  2CX0 A;  4HM7 B;  5BVB A;  2A15 A;  1RN4 A;  2BU4 A;  5ELJ A;  3BNB A;  3FH1 A;  5IG3 A;  1VQ7 3;  4JF8 A;  3V92 A;  4RBN A;  1OF5 B;  3SXX A;  3RNT A;  3A76 A;  3FGY A;  3PZW A;  4FCZ A;  1IVV A;  3T0U A;  3NV0 B;  2SBL A;  3LYG A; 
#chains in the Genus database with same CATH homology
 4AKZ A;  1IV7 A;  1SQW A;  2P05 A;  1LNH A;  3MKI A;  2LQV A;  5AYR B;  3PXM A;  3N54 B;  4XBT A;  4EYC A;  2GBW B;  3G71 3;  1OGZ A;  1R4C A;  3CCR 3;  2BO9 B;  1FUW A;  1IVW A;  2O9U X;  4JRF A;  3KN4 A;  1O7H B;  4K1V A;  2F99 A;  5IG5 A;  3NQY A;  1W7C A;  1L5G B;  3MHE A;  3U97 A;  2CW9 A;  3JUP A;  3V99 A;  3CCV 3;  2JQ5 A;  1GD3 A;  3K7C A;  4L7K A;  3KZT A;  4HVN A;  3S67 A;  1OCV A;  3BNC A;  1A67 A;  3DGL A;  1D6Z A;  3NM2 A;  1OF5 A;  3DXO A;  1SII A;  2CKF B;  4N6N B;  4N6U A;  1DMQ A;  2HMK B;  2OWP A;  4OUQ A;  3G6E 3;  3CD6 3;  3JUN A;  3FG4 A;  4KZ1 A;  3U1W A;  1K8A 4;  1YJN 3;  1Q40 A;  1O7G B;  2XR8 B;  4WYK A;  1OH0 A;  2R4I A;  3CCL 3;  1K73 4;  3NV0 A;  5CK6 A;  2OQE A;  3SED A;  2W03 A;  2Z76 A;  3VGN A;  5IG0 A;  4HZB B;  3VSY A;  5CF1 A;  1A2V A;  1VQ4 3;  4IT7 A;  3BNE A;  3I56 3;  2K54 A;  1KSI A;  5G2G A;  2D42 A;  4N3V A;  1IU7 A;  5IW9 A;  4HYZ A;  5AII A;  3G8Z A;  2CHC A;  2GXF A;  4HM6 B;  3ER7 A;  1UUV B;  1VQM 3;  3NXJ A;  2OTJ 3;  1GYB A;  1BUQ A;  2E2U A;  4EV5 A;  3X3Z A;  1FGM A;  1OUN A;  3CPO A;  1W00 A;  3UB1 A;  2XSH B;  4WP5 A;  2QEX 3;  3L0R A;  1S72 3;  3AMO B;  3OWS A;  2XFS A;  4FMB A;  5AEW B;  1M9G A;  1HKX A;  1U5O A;  1G96 A;  2W9Q A;  1CEW I;  1E3R A;  2L4V A;  4R1K A;  1VZZ A;  5BXQ A;  3CCJ 3;  2OTL 3;  1TFK A;  2CWV A;  1IVU A;  3LTB A;  1DVC A;  1ROA A;  4RNY A;  2W56 A;  1Y4K A;  3CNM A;  4X2H A;  1KC8 4;  1A2K A;  3IPT A;  3GZR A;  1JB2 A;  3HX8 A;  4KVH A;  4GB5 A;  4PEJ A;  2XGL A;  3B8L A;  3S29 A;  4O2H A;  4CDL A;  2KCD A;  3CCU 3;  1GS3 A;  3KKG A;  1U8C B;  1JN5 A;  2D1W A;  1OGX A;  2GEY A;  2IUJ A;  4LSO A;  2F98 A;  1AV4 A;  1IQX A;  3X42 A;  3CPW 2;  2Q07 A;  1Q82 4;  1VQ8 3;  1ZX2 A;  3B4P A;  5IEP A;  1N5P A;  1LXE A;  1NJI 4;  1FGO A;  1W6C A;  1IT8 A;  5CF2 A;  1IVX A;  1Q7Y 4;  2CG0 A;  2RFR A;  3WDG B;  5JPU A;  3NHX A;  2JDI H;  1LOX A;  1QJG A;  1W4N A;  3KFQ C;  3D9R A;  2FXT A;  2KRT A;  3DGN A;  3RGA A;  2HMO B;  3FF2 A;  7STD A;  1JJ2 2;  1J2B A;  5AI1 A;  3T8N A;  5JPP A;  3OXA A;  4HZ9 B;  3EE1 A;  1NDO B;  1DMN A;  4LEH A;  2Z7A A;  1Q81 4;  1Z1S A;  4WWU C;  2WOH A;  3UL6 A;  1C7H A;  1N9E A;  5I97 A;  3EN8 A;  4MEI A;  1ASK A;  4O02 B;  3LTA A;  1ROV A;  3LTC A;  4HM4 B;  1ISK A;  5STD A;  2BMO B;  1N5H A;  4HM0 B;  1SPU A;  3LH4 A;  3X41 A;  1WMN A;  3MSO A;  1EKM A;  3QK9 A;  3DY5 A;  1STF I;  2STD A;  3V98 A;  2IMJ A;  3DGO A;  1JB5 A;  5LC6 A;  4MMY B;  2OQE C;  1WQL B;  1ZO2 A;  2PNC A;  3HI7 A;  1QAL A;  3DMC A;  2FNQ A;  3FLJ A;  2BHM A;  3D3L A;  1OPY A;  1FGR A;  2YFI B;  2E2T A;  1QVG 2;  1TU5 A;  1JV2 B;  1GD4 A;  5IEN A;  1MOL A;  5FGO A;  4IPB A;  4XM4 A;  1VQ6 3;  1RJO A;  2ZL8 A;  3EX9 A;  5TGN A;  2BNG A;  2FGT A;  2WGQ A;  3KII A;  3OV4 A;  4HKV B;  3GZY B;  4K1U A;  1JN5 B;  4EC6 A;  1RN7 A;  1YI2 3;  1WMO A;  1SIH A;  2O3O A;  2CH9 A;  1GY5 A;  4OK0 A;  3OX9 A;  1US1 A;  1D6Y A;  4Q53 A;  3BLZ A;  3UL5 A;  2F86 B;  3IJE B;  3OWY A;  3LTD A;  5DRV A;  1WTH A;  1FGQ A;  2P0M A;  3GZB A;  3S27 A;  3PS8 A;  3SOA A;  3EBY A;  1IQ8 A;  1YHQ 3;  4BTW A;  4XDV A;  5IEO A;  3MYT A;  4XB5 A;  3DM8 A;  4HM3 B;  5AIG A;  1K41 A;  3JVC A;  2Y74 A;  3MG2 A;  4WHA A;  1K28 A;  4HM5 B;  1TP6 A;  2CIU A;  3JUQ A;  3Q1C A;  4GL6 A;  2UX0 A;  1YJ9 3;  2YX9 A;  1FA3 A;  1RKY A;  3DUK A;  2BMQ B;  1VQK 3;  1N9J A;  1UI7 A;  3H51 A;  3OW2 2;  1YIT 3;  1K9M 4;  3K63 A;  5CLK A;  5EVH A;  1VQL 3;  3LT8 A;  3F8X A;  1VQO 3;  4HBR A;  4I4K A;  3RDE A;  3GZX B;  3S5C A;  3CCM 3;  3WA2 X;  3S28 A;  3SLU A;  4EXR A;  1OAC A;  5AYS C;  2KXG A;  5FW5 A;  5IF6 A;  4KFD A;  1NB3 I;  4N6L A;  4H61 A;  4H3U A;  1Q40 B;  3B4O A;  2IA7 A;  3NBB A;  2CFK A;  3WOF B;  2XGN A;  2RSX A;  4FMA A;  1NB5 I;  1AR0 A;  3EHC A;  3ALA A;  1S5A A;  4KFF A;  4OVM A;  5DRE A;  5A0O B;  1OHO A;  3UNL A;  2BMR B;  2XSO B;  4WFO A;  2I9W A;  4R9L A;  4LZI A;  4XDW A;  1EA2 A;  1TUH A;  1VQ5 3;  1W01 A;  2CFD A;  3JUO A;  4G1M B;  1JNQ A;  4LMI A;  3FCS B;  2E2V A;  3N8B A;  4FMD A;  4AKY A;  3HII A;  4HM2 B;  4BTX A;  5JBS A;  1STD A;  4MMX B;  2XH9 A;  2CWU A;  3EJV A;  3N9H A;  3SOY A;  2CFL A;  2XF3 A;  1RRH A;  3MG3 A;  3MPH A;  4IIA A;  2CFW A;  1A90 A;  1TIJ A;  1EG9 B;  2Z77 A;  3I0Y A;  3STD A;  5D81 A;  2W04 A;  1DMM A;  3F8H A;  4O8S A;  3CMA 3;  2W6J H;  2B24 B;  1JB4 A;  3LXU X;  1HU9 A;  2WO0 A;  3LT9 A;  3CCS 3;  3ECF A;  3E99 A;  1W5Z A;  1Q86 4;  3G4S 3;  3FG1 A;  2C10 A;  3F9S A;  1T5Y A;  2WOF A;  3MG1 A;  3H3H A;  4QWT A;  3X3X A;  2W2C A;  4FMC A;  4K61 A;  1DYU A;  2LYX A;  4X2O A;  3I55 3;  2BT3 A;  1E3V A;  2W0Q A;  3PGB A;  4MMZ B;  3O8Y A;  1JKG A;  3J7Y d;  2CK3 H;  2INX A;  1M90 4;  1GY6 A;  4STD A;  1QMA A;  1UI8 A;  4FCM A;  1O7W B;  4K90 B;  3Q90 A;  4R9K A;  2ZDJ A;  1VQN 3;  3GRD A;  5AIF A;  2CFG A;  3NX0 A;  3NM7 A;  2HMJ B;  4NRE A;  3F40 A;  3NBJ A;  1M1K 4;  3SX1 A;  3FG3 A;  3KE7 A;  3BND A;  1N8Q A;  1UUW B;  4RNZ A;  2OCT A;  1KWI A;  2HML B;  1DVD A;  4R4K A;  3EB8 A;  3EQQ B;  4XBY A;  4MJD A;  2HMM B;  1VQ9 3;  3ROB A;  1JRQ A;  3NBR A;  3RGR A;  1QAF A;  3EC9 A;  2HMN B;  1N8R 4;  1AVK A;  4LGQ A;  1WMP A;  4ZM8 A;  2V1L A;  4FCJ A;  2XEP A;  1OHS A;  2B1X B;  2QA4 3;  1TFO A;  1CQS A;  3KSP A;  3CC2 3;  4J8T A;  4L8O A;  2RCD A;  3K9M C;  4N6T A;  2MF7 A;  3CCE 3;  3Q2P A;  5IER A;  3CU3 A;  5CXO A;  2GEX A;  1O7N B;  1WNH A;  1IK3 A;  4N6M A;  5KP3 A;  2ML6 A;  4O3V A;  5AEU B;  3FF0 A;  3FZW A;  1O7M B;  1QAK A;  4WYK B;  1IT7 A;  1NWW A;  4XBX A;  2K0M A;  3PCS A;  5KP1 A;  5IG4 A;  3EF8 A;  4U13 A;  1Q42 A;  3CCQ 3;  1W2B 2;  3KSE D;  3WMD A;  2P0X A;  2M7O A;  3LZA A;  2ML5 A;  1RRL A;  1CYU A;  1E97 A;  1EQK A;  1JKG B;  3CNX A;  3HZP A;  5EQL A;  2CC3 A;  3WA3 A;  3IMA B;  3TDG A;  3VF1 A;  3FKA A;  3CXC 2;  5LC7 A;  2MC8 A;  3SVA A;  1MNL A;  4AEQ A;  2QIY A;  3EBT A;  3PYJ A;  2CWT A;  1ULI B;  1AVL A;  4FR9 A;  4N6O B;  3LOY A;  1M1X B;  1IDP A;  4KFE A;  2OOV C;  1D6U A;  3NQZ A;  1W6Y A;  2RGQ A;  3M8C A;  3AMO A;  3PCR A;  2P09 A;  4HM8 B;  3CC4 3;  3G0K A;  2W56 B;  3G16 A;  1W2Z A;  4HJL B;  3GWR A;  1LVN A;  2CG1 A;  2IUK A;  3CME 3;  3JUM A;  5KP4 A;  1KQS 2;  3WOE B;  3K5T A;  1NU3 A;  3F14 A;  2YFL B;  3F7X A;  3UJM A;  1QVF 2;  1YIJ 3;  3X3Y A;  3NUV A;  5EEO A;  1V74 A;  2WGO A;  1GY7 A;  3GAX A;  3K0Z A;  2P38 A;  2C11 A;  3EN1 B;  1F8N A;  3DGM A;  4RZM A;  2GU3 A;  4ORL A;  4TX4 A;  1YJW 3;  4EV2 A;  1ULJ B;  2GBX B;  1NO3 A;  4NHF A;  2XRX B;  4R80 A;  1YGE A;  3HIG A;  3QRD A;  1UW1 A;  2PZV A;  8CHO A;  3MWZ A;  1YVB I;  2Z6B A;  3BB9 A;  3LML A;  5AIH A;  3T8U A;  1PU4 A;  3OWU A;  1W02 A;  2GU1 A;  1CYV A;  5HGR A;  3HK4 A;  1O7P B;  1OHP A;  6STD A;  3X40 A;  5ELU A;  2OOV A;  4CCV A;  1IQY A;  4L8P A;  2QGU A;  3F7S A;  1IV9 A;  2XFT A;  1PFP A;  1SJW A;  4HM1 B;  2YFJ B;  1VQP 3;  3WOD G;  1KD1 4;  1W6G A;  1FGT A;  2Y73 A;  4N6V 0;  4BTY A;  5D82 A;  5D83 A;  3B7C A;  2W9P A;  3CC7 3;  3FSD A;  3DZL A;  4EBG A;  4J9A A;  4HM7 B;  5BVB A;  2A15 A;  5ELJ A;  3BNB A;  3FH1 A;  5IG3 A;  1VQ7 3;  4JF8 A;  3V92 A;  4RBN A;  1OF5 B;  3SXX A;  3A76 A;  3FGY A;  3PZW A;  4FCZ A;  1IVV A;  3T0U A;  3NV0 B;  2SBL A;  3LYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...