2UUGC

Escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Replication, hydrolase
total genus 16
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2uugC00
4LYLB 1UUGB 1LQGC 1UGIA 1LQMB 2J8XB 1UGHI 1EUIC 2UGIA 2ZHXB 2UUGC 1UDII
chains in the Genus database with same CATH superfamily
2CW9A 4H3UA 2UX0A 3K63A 3G6E3 1S723 3DGOA 1W00A 1JZOA 2IY2A 3MHEA 5DREA 1Z1SA 4KT3B 2F56A 2H0GA 3PYJA 2P09A 4N6MA 1DMQA 2GU1A 4CJNA 2F86B 1NJI4 1Y4KA 1JNQA 4FR9A 1LNHA 1TIJA 1MWSA 3PS8A 2Z76A 5FGOA 1AV4A 5IF6A 1AQZA 1X1YA 3FH1A 2CK3H 3EN1B 2P05A 3V92A 2K0MA 3JUNA 1YJN3 1GMPA 4GL6A 3FLJA 4L7KA 4EV2A 1OCVA 3J7Yd 4OVMA 2R41A 1RMSA 3NHXA 1UUVB 2AAEA 3GSPA 4K1VA 3LTDA 4EYCA 1G96A 1JB4A 3UL5A 1HYFA 4HM4B 1CQSA 1FZUA 1JB2A 1Q40A 3D5IA 5KP1A 4J5KA 1Q7Y4 3QRDA 2XEPA 1LOWA 1B20A 4R1KA 3UJMA 4R4KA 3KSED 5CK6A 1NNVA 1Q9EA 1TRPA 2Z7AA 3RGRA 1K9M4 5HGRA 2YX9A 1V57A 5FW5A 3X41A 1DETA 1OGZA 5EQLA 2OQEC 1I2GA 2CFWA 1RN4A 3WMDA 1UDII 5IEOA 3T8NA 3EBYA 2D1WA 1BSBA 1W6GA 1IVUA 2CX0A 1BIRA 1NO3A 2CX1A 5IG5A 3CCJ3 1KSIA 1K8A4 5M1AA 2W56B 1G02A 4JF8A 2W03A 1Q42A 2WGQA 3NQYA 4L8PA 4XBXA 5IENA 5BVBA 3CCE3 2OTL3 1RGEA 3CD63 1BRNL 3X3YA 3BLZA 3X42A 3EQQB 1NU3A 1RTUA 2YFLB 3JUPA 1TU5A 1VQ83 4CCVA 2QIYA 2ZA4A 2BT3A 3GWRA 3LTBA 4HM8B 1BRGA 3PCRA 1KD14 1IU7A 1YVSA 3CC43 3WR2A 4GSPA 4XBYA 2OOVA 1B2MA 1A2KA 1VQN3 2KF5A 1B2UA 2OWPA 1N5PA 1LVNA 1ROAA 3SX1A 2UUGC 2WOHA 5G1KA 2BMRB 1BNRA 4OK0A 3ER7A 2FXTA 4FMAA 1TTOA 4KFFA 3GZYB 3LTCA 3D3LA 4RNYA 4WP5A 3VSYA 5AYSC 1B2ZA 2IMJA 2RNTA 5LC7A 2OQEA 1M1XB 1OPYA 1JKGB 3MWZA 3N9HA 3X3XA 5AYRB 2LQVA 4RBNA 1RNBA 1NWWA 3B7CA 1STDA 5AIFA 3G16A 3MKIA 3IJEB 2CWVA 4IPBA 4XDVA 2HMKB 4O2HA 3OXAA 5KP3A 1AR0A 1BRJA 5KP4A 2GU3A 3JUOA 3EC9A 4O8SA 1ZGXA 2O9UX 4FMBA 2YFJB 3TDGA 4AEQA 2RCDA 2XGNA 3GZRA 1BSEA 2RSXA 3ZFZA 1RGHA 1V58A 2IA7A 1ULJB 4N3VA 4FMDA 5M18A 3NV0A 2ZHXB 2KXGA 3AMOB 1X1WA 4KFDA 5ELJA 1I70A 2WO0A 1T3BA 2KAAA 3S29A 3SVAA 1YIT3 3ALAA 1CYVA 2KF6A 1A2VA 2F5WA 2Y74A 1IVWA 1M9GA 3B8LA 3DXOA 1IVVA 1FYSA 2L1SA 3I0YA 4OUQA 1RGGA 4H61A 1ULIB 4QWTA 5CLKA 3O8YA 1BRHA 4AKZA 1FW7A 2OTJ3 4LYLB 4LSOA 1RGKA 1DMNA 1W2ZA 3AHSA 1TRQA 3LXUX 3K5TA 1LOVA 2GSPA 3NXJA 5IEPA 1E97A 1B2SA 2CC3A 3LZAA 4N6LA 1VQM3 1BRSA 1YIJ3 1RSNA 5JPUA 1OHOA 1DMMA 1TFKA 4HOHA 2W9QA 2XFTA 3HK4A 1JJ22 1DVDA 7GSPA 1GY7A 1N8R4 2PZVA 3SXXA 1IYYA 1LXEA 4N6NB 1RN1A 5I97A 2B1XB 4BL2A 5JPPA 1TFOA 5TGNA 1LRAA 3Q3FA 3PZWA 5AI1A 1M1K4 3KSPA 1R4YA 1LOYA 1BNSA 1W5ZA 1N8QA 2KF3A 1I0VA 3CC23 3HX8A 1OH0A 4NREA 1EKMA 4HVNA 4N6TA 7RNTA 4HM1B 4HAAA 2A15A 1FGMA 1JV2B 1MWUA 1FGOA 1F8NA 4MMYB 3DUKA 1G0TA 1K41A 3DMCA 4K1UA 1OACA 7STDA 5IG3A 2K54A 2CFLA 2I9WA 4HM6B 3OX9A 3G713 5HOHA 3BU4A 4J8TA 5CF1A 3ROBA 1CYUA 1GOUA 2CH9A 1OF5A 1RNTA 2W0QA 3FKAA 3UB1A 4HM0B 1W2B2 2BHMA 3G0KA 1JN5A 1MOLA 1O7PB 1B2XA 1D6YA 4PEJA 3A76A 9RNTA 1GMRA 2JQ5A 2Q07A 3DGLA 3SEDA 1QAKA 2JDIH 4R9KA 3CCR3 1MWTA 1O7HB 1SARA 3D4AA 4I5QA 1C54A 1ISKA 1Q864 2YFIB 1BNIA 4RNZA 3S27A 3V98A 2GEXA 3GZXB 4NPBA 1GOVA 3DGYA 3WOFB 1GMQA 1YI23 4HM2B 3BB9A 3FCSB 1KWIA 3HIIA 3EJVA 3CME3 4RNTA 5RNTA 2E2VA 1W6YA 1BNGA 1ZX2A 3LTAA 2D42A 5BIRA 1OHSA 1RJOA 2C4BA 1BNFA 1IQYA 1RN7A 3S28A 2CFGA 4HM5B 1QALA 3DH2A 4FCMA 2XH9A 1O7NB 1FA3A 4FMCA 1JBTA 3EHCA 2Z77A 3LT9A 4GB5A 1I0XA 1I2FA 1Q824 1BRIA 3PCSA 5BXQA 2BU4A 2FNQA 3SYUA 1NB5I 3M8CA 1B21A 2Y73A 2HMJB 2OCTA 1R4CA 3D5GA 2ML6A 1BSCA 2WOFA 4K90B 4WYKB 4WWUC 1WNHA 5DRVA 1HZ1A 2UGIA 3D9RA 3STDA 3FG3A 3E99A 1L5GB 5G1LA 5IG4A 2SARA 4R9LA 1VQK3 1NB3I 1FGRA 4HYZA 3F14A 1IV7A 2W6JH 3AHWA 2CWTA 3EX9A 2CG0A 1SIIA 2W9PA 4I4KA 3FG4A 3I563 1UUGB 1BGSA 1BSDA 2XSOB 3EF8A 4TX4A 1B3SA 4L8OA 1RRLA 2W56A 4WFOA 3NM2A 3GRDA 1O7MB 2GBXB 4DKIA 3LT8A 4BU4A 1T2IA 4FCJA 1RCLA 4CPKA 1CEWI 3JUQA 1IT8A 3NBBA 4N6OB 1C7HA 1WMOA 1A90A 3T0UA 2XSHB 3BNCA 3FGYA 3CCL3 1YJ93 3CNMA 1RGCA 1UI7A 1ZS7A 1QVG2 1EA2A 3HIGA 2BMOB 2WGOA 3WOEB 1VQ93 5EEOA 3NM7A 8CHOA 3U1WA 2CKFB 2GXFA 3WA2X 4EW5A 3N54B 2W2CA 1J2BA 1WMPA 3VGNA 4XBTA 3KIIA 1OGXA 5M19A 2RBIA 4HZBB 1I2EA 1ASKA 3L0RA 5AIIA 3SOYA 1TJDA 1CH0A 1A2PA 2P0MA 3PXMA 1GY5A 1UUWB 2HMMB 1IK3A 1Q7HA 3H3HA 3DGMA 3JUMA 2O3OA 1SIHA 3BNEA 3S67A 3CXC2 3FF2A 3F7XA 3MSOA 1MWRA 3K9MC 1W4NA 2P0XA 2W04A 2MF7A 3FF0A 5ELUA 1YVBI 3X3ZA 1EEJA 1RGLA 2AADA 3KE7A 4ILFA 1UW1A 1JZDA 1BUQA 1GD3A 3EBTA 2IUJA 1SJWA 1M904 1IVXA 4N6V0 1BNEA 4MJDA 5CXOA 3KKGA 1VQ63 1QMAA 3AMOA 5EVHA 3CC73 3RGAA 2CFKA 1YJW3 1PFPA 3GZBA 4Q53A 3NBJA 2H0IA 1HKXA 2KF4A 2QGUA 1LQGC 2C10A 3KN4A 1U5OA 2ML5A 2HMOB 2F99A 3NBRA 4HZ9B 3UNLA 1OHPA 1UCJA 4IIAA 1O7GB 1IQ8A 3RNTA 1JBSA 2CWUA 1GOYA 8RNTA 4O3VA 4HKVB 1Q40B 4LGQA 1BSAA 1TP6A 6RNTA 2FGTA 4JRFA 4K61A 1GY6A 4R80A 1FGQA 3F9SA 1LQMB 1BRKA 4AKYA 3FG1A 5AIGA 3SOAA 1K734 3MG1A 1SPUA 2GEYA 4HBRA 3AGOA 2BO9B 4X2OA 1JB5A 1DYUA 3PGBA 5CF2A 1N9JA 3LOYA 4WHAA 3DY5A 2E2UA 4KVHA 4CDLA 1IT7A 4BIRA 1VQO3 3FSDA 4NHFA 3CPOA 4X2HA 3EB8A 5IW9A 3X40A 1RHLA 3OWUA 1ROVA 4BTWA 1K28A 2CHCA 5IERA 1N5HA 2MC8A 3DZLA 5A0OB 2GBWB 3ECFA 4ORLA 4HJLB 3CCV3 4EBGA 1O7WB 3GAXA 2XFSA 4XB5A 3BIRA 4RZMA 3F8HA 3Q90A 1A67A 2CFDA 4EC6A 2L4VA 3MYTA 1BOXA 3FZWA 4HM7B 2OOVC 1E3RA 5JBSA 3SLUA 1X1UA 3H51A 3S5CA 2V1LA 3CCU3 1I8VA 1YGEA 3OWYA 2QA43 3OWSA 1UCLA 1UI8A 4HM3B 3U97A 1UCIA 3MG2A 1VQQA 3RDEA 1N9EA 1VQP3 3D79A 1B27A 6STDA 2QEX3 2HMLB 1X1XA 2CG1A 3I553 5G2GA 2Z6BA 3DM8A 3IPTA 3G8ZA 4J9AA 1YHQ3 3AGNA 1DE3A 3HOHA 1STFI 1JRQA 1UGHI 1VZZA 1W02A 2IUKA 4MMXB 1VQ53 4ZM8A 4BL3A 2F5MA 1WQLB 1QVF2 2ZL8A 1MNLA 1BANA 4BTYA 1W01A 1RGFA 1YNVX 3V99A 1W6CA 3KCHA 3ZG5A 1WMNA 4XM4A 4O02B 2SBLA 1WTHA 1E3VA 1GD4A 5D82A 3B4OA 3CCM3 3OW22 1KQS2 1KC84 1I3FA 1OUNA 2HMNB 2HOHA 2BIRA 4MMZB 3WA3A 4N6UA 3URPA 4LMIA 1BU4A 2INXA 3K0ZA 4KFEA 2RFRA 2R4IA 2PNCA 3DGNA 2C11A 3LYGA 2K3DA 1FUSA 3NV0B 2IYJA 4EV5A 1JBRA 3MPHA 1GS3A 1RCKA 4G1MB 3CMA3 3NUVA 1RGAA 1RLSA 1YGWA 3IMAB 3F7SA 4FCZA 3CU3A 6GSPA 4WYKA 4KZ1A 3WDGB 1MGWA 3HZPA 3ZG0A 5BU4A 3N8BA 1RRHA 2F4YA 1FUWA 4STDA 3LH4A 1U8CB 1LOXA 2F98A 5LC6A 1HU9A 1ZO2A 1I3IA 1T2HA 2B24B 3WHOA 3WODG 4EXRA 5D81A 4IT7A 3JVCA 2STDA 2CIUA 2J8XB 1QAFA 4XDWA 2M7OA 3CCS3 1IV9A 1EUIC 1JKGA 1IDPA 4J5GA 3KZTA 1D6UA 2RGQA 1BVIA 5AIHA 1VQL3 4LEHA 3BNBA 3EE1A 1D6ZA 3LMLA 3EN8A 4MEIA 2E2TA 1EQKA 3CCQ3 2KCDA 5D83A 2XGLA 1W7CA 4U13A 3G4S3 1EG9B 1Q814 3UL6A 5AEWB 3CPW2 1RKYA 3F40A 1AY7A 1RDSA 1PY3A 3OV4A 5IG0A 2XF3A 3Q2PA 1UGIA 2ZDJA 2XR8B 4BTXA 3A5EA 1VQ73 4LZIA 3HI7A 1AVLA 1VQ43 1UCKA 1BUJA 3NQZA 5STDA 3NX0A 1PU4A 1SQWA 1GYBA 2BMQB 2XRXB 1TUHA 2H0HA 3Q1CA 1S5AA 5AEUB 1AVKA 3QK9A 3KFQC 2KRTA 3VF1A 1V74A 1US1A 1OF5B 1NDOB 2LYXA 5GSPA 3F8XA 3MG3A 1GSPA 1JN5B 1DVCA 3T8UA 1MGRA 1BAOA 1IQXA 3BNDA 4GHOA 2P38A 1QJGA 3CNXA 1FUTA 3B4PA 2BNGA 1FGTA 3K7CA 1T5YA 1PYLA 1LNIA 1BNJA
chains in the Genus database with same CATH topology
4LYLB 1UUGB 1LQGC 1UGIA 1LQMB 2J8XB 1UGHI 1EUIC 2UGIA 2ZHXB 2UUGC 1UDII
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LYL B;  1UUG B;  1LQG C;  1UGI A;  1LQM B;  2J8X B;  1UGH I;  1EUI C;  2UGI A;  2ZHX B;  2UUG C;  1UDI I; 
#chains in the Genus database with same CATH topology
 2CW9 A;  4H3U A;  2UX0 A;  3K63 A;  3G6E 3;  1S72 3;  3DGO A;  1W00 A;  1JZO A;  2IY2 A;  3MHE A;  5DRE A;  1Z1S A;  4KT3 B;  2F56 A;  2H0G A;  3PYJ A;  2P09 A;  4N6M A;  1DMQ A;  2GU1 A;  4CJN A;  2F86 B;  1NJI 4;  1Y4K A;  1JNQ A;  4FR9 A;  1LNH A;  1TIJ A;  1MWS A;  3PS8 A;  2Z76 A;  5FGO A;  1AV4 A;  5IF6 A;  1AQZ A;  1X1Y A;  3FH1 A;  2CK3 H;  3EN1 B;  2P05 A;  3V92 A;  2K0M A;  3JUN A;  1YJN 3;  1GMP A;  4GL6 A;  3FLJ A;  4L7K A;  4EV2 A;  1OCV A;  3J7Y d;  4OVM A;  2R41 A;  1RMS A;  3NHX A;  1UUV B;  2AAE A;  3GSP A;  4K1V A;  3LTD A;  4EYC A;  1G96 A;  1JB4 A;  3UL5 A;  1HYF A;  4HM4 B;  1CQS A;  1FZU A;  1JB2 A;  1Q40 A;  3D5I A;  5KP1 A;  4J5K A;  1Q7Y 4;  3QRD A;  2XEP A;  1LOW A;  1B20 A;  4R1K A;  3UJM A;  4R4K A;  3KSE D;  5CK6 A;  1NNV A;  1Q9E A;  1TRP A;  2Z7A A;  3RGR A;  1K9M 4;  5HGR A;  2YX9 A;  1V57 A;  5FW5 A;  3X41 A;  1DET A;  1OGZ A;  5EQL A;  2OQE C;  1I2G A;  2CFW A;  1RN4 A;  3WMD A;  1UDI I;  5IEO A;  3T8N A;  3EBY A;  2D1W A;  1BSB A;  1W6G A;  1IVU A;  2CX0 A;  1BIR A;  1NO3 A;  2CX1 A;  5IG5 A;  3CCJ 3;  1KSI A;  1K8A 4;  5M1A A;  2W56 B;  1G02 A;  4JF8 A;  2W03 A;  1Q42 A;  2WGQ A;  3NQY A;  4L8P A;  4XBX A;  5IEN A;  5BVB A;  3CCE 3;  2OTL 3;  1RGE A;  3CD6 3;  1BRN L;  3X3Y A;  3BLZ A;  3X42 A;  3EQQ B;  1NU3 A;  1RTU A;  2YFL B;  3JUP A;  1TU5 A;  1VQ8 3;  4CCV A;  2QIY A;  2ZA4 A;  2BT3 A;  3GWR A;  3LTB A;  4HM8 B;  1BRG A;  3PCR A;  1KD1 4;  1IU7 A;  1YVS A;  3CC4 3;  3WR2 A;  4GSP A;  4XBY A;  2OOV A;  1B2M A;  1A2K A;  1VQN 3;  2KF5 A;  1B2U A;  2OWP A;  1N5P A;  1LVN A;  1ROA A;  3SX1 A;  2UUG C;  2WOH A;  5G1K A;  2BMR B;  1BNR A;  4OK0 A;  3ER7 A;  2FXT A;  4FMA A;  1TTO A;  4KFF A;  3GZY B;  3LTC A;  3D3L A;  4RNY A;  4WP5 A;  3VSY A;  5AYS C;  1B2Z A;  2IMJ A;  2RNT A;  5LC7 A;  2OQE A;  1M1X B;  1OPY A;  1JKG B;  3MWZ A;  3N9H A;  3X3X A;  5AYR B;  2LQV A;  4RBN A;  1RNB A;  1NWW A;  3B7C A;  1STD A;  5AIF A;  3G16 A;  3MKI A;  3IJE B;  2CWV A;  4IPB A;  4XDV A;  2HMK B;  4O2H A;  3OXA A;  5KP3 A;  1AR0 A;  1BRJ A;  5KP4 A;  2GU3 A;  3JUO A;  3EC9 A;  4O8S A;  1ZGX A;  2O9U X;  4FMB A;  2YFJ B;  3TDG A;  4AEQ A;  2RCD A;  2XGN A;  3GZR A;  1BSE A;  2RSX A;  3ZFZ A;  1RGH A;  1V58 A;  2IA7 A;  1ULJ B;  4N3V A;  4FMD A;  5M18 A;  3NV0 A;  2ZHX B;  2KXG A;  3AMO B;  1X1W A;  4KFD A;  5ELJ A;  1I70 A;  2WO0 A;  1T3B A;  2KAA A;  3S29 A;  3SVA A;  1YIT 3;  3ALA A;  1CYV A;  2KF6 A;  1A2V A;  2F5W A;  2Y74 A;  1IVW A;  1M9G A;  3B8L A;  3DXO A;  1IVV A;  1FYS A;  2L1S A;  3I0Y A;  4OUQ A;  1RGG A;  4H61 A;  1ULI B;  4QWT A;  5CLK A;  3O8Y A;  1BRH A;  4AKZ A;  1FW7 A;  2OTJ 3;  4LYL B;  4LSO A;  1RGK A;  1DMN A;  1W2Z A;  3AHS A;  1TRQ A;  3LXU X;  3K5T A;  1LOV A;  2GSP A;  3NXJ A;  5IEP A;  1E97 A;  1B2S A;  2CC3 A;  3LZA A;  4N6L A;  1VQM 3;  1BRS A;  1YIJ 3;  1RSN A;  5JPU A;  1OHO A;  1DMM A;  1TFK A;  4HOH A;  2W9Q A;  2XFT A;  3HK4 A;  1JJ2 2;  1DVD A;  7GSP A;  1GY7 A;  1N8R 4;  2PZV A;  3SXX A;  1IYY A;  1LXE A;  4N6N B;  1RN1 A;  5I97 A;  2B1X B;  4BL2 A;  5JPP A;  1TFO A;  5TGN A;  1LRA A;  3Q3F A;  3PZW A;  5AI1 A;  1M1K 4;  3KSP A;  1R4Y A;  1LOY A;  1BNS A;  1W5Z A;  1N8Q A;  2KF3 A;  1I0V A;  3CC2 3;  3HX8 A;  1OH0 A;  4NRE A;  1EKM A;  4HVN A;  4N6T A;  7RNT A;  4HM1 B;  4HAA A;  2A15 A;  1FGM A;  1JV2 B;  1MWU A;  1FGO A;  1F8N A;  4MMY B;  3DUK A;  1G0T A;  1K41 A;  3DMC A;  4K1U A;  1OAC A;  7STD A;  5IG3 A;  2K54 A;  2CFL A;  2I9W A;  4HM6 B;  3OX9 A;  3G71 3;  5HOH A;  3BU4 A;  4J8T A;  5CF1 A;  3ROB A;  1CYU A;  1GOU A;  2CH9 A;  1OF5 A;  1RNT A;  2W0Q A;  3FKA A;  3UB1 A;  4HM0 B;  1W2B 2;  2BHM A;  3G0K A;  1JN5 A;  1MOL A;  1O7P B;  1B2X A;  1D6Y A;  4PEJ A;  3A76 A;  9RNT A;  1GMR A;  2JQ5 A;  2Q07 A;  3DGL A;  3SED A;  1QAK A;  2JDI H;  4R9K A;  3CCR 3;  1MWT A;  1O7H B;  1SAR A;  3D4A A;  4I5Q A;  1C54 A;  1ISK A;  1Q86 4;  2YFI B;  1BNI A;  4RNZ A;  3S27 A;  3V98 A;  2GEX A;  3GZX B;  4NPB A;  1GOV A;  3DGY A;  3WOF B;  1GMQ A;  1YI2 3;  4HM2 B;  3BB9 A;  3FCS B;  1KWI A;  3HII A;  3EJV A;  3CME 3;  4RNT A;  5RNT A;  2E2V A;  1W6Y A;  1BNG A;  1ZX2 A;  3LTA A;  2D42 A;  5BIR A;  1OHS A;  1RJO A;  2C4B A;  1BNF A;  1IQY A;  1RN7 A;  3S28 A;  2CFG A;  4HM5 B;  1QAL A;  3DH2 A;  4FCM A;  2XH9 A;  1O7N B;  1FA3 A;  4FMC A;  1JBT A;  3EHC A;  2Z77 A;  3LT9 A;  4GB5 A;  1I0X A;  1I2F A;  1Q82 4;  1BRI A;  3PCS A;  5BXQ A;  2BU4 A;  2FNQ A;  3SYU A;  1NB5 I;  3M8C A;  1B21 A;  2Y73 A;  2HMJ B;  2OCT A;  1R4C A;  3D5G A;  2ML6 A;  1BSC A;  2WOF A;  4K90 B;  4WYK B;  4WWU C;  1WNH A;  5DRV A;  1HZ1 A;  2UGI A;  3D9R A;  3STD A;  3FG3 A;  3E99 A;  1L5G B;  5G1L A;  5IG4 A;  2SAR A;  4R9L A;  1VQK 3;  1NB3 I;  1FGR A;  4HYZ A;  3F14 A;  1IV7 A;  2W6J H;  3AHW A;  2CWT A;  3EX9 A;  2CG0 A;  1SII A;  2W9P A;  4I4K A;  3FG4 A;  3I56 3;  1UUG B;  1BGS A;  1BSD A;  2XSO B;  3EF8 A;  4TX4 A;  1B3S A;  4L8O A;  1RRL A;  2W56 A;  4WFO A;  3NM2 A;  3GRD A;  1O7M B;  2GBX B;  4DKI A;  3LT8 A;  4BU4 A;  1T2I A;  4FCJ A;  1RCL A;  4CPK A;  1CEW I;  3JUQ A;  1IT8 A;  3NBB A;  4N6O B;  1C7H A;  1WMO A;  1A90 A;  3T0U A;  2XSH B;  3BNC A;  3FGY A;  3CCL 3;  1YJ9 3;  3CNM A;  1RGC A;  1UI7 A;  1ZS7 A;  1QVG 2;  1EA2 A;  3HIG A;  2BMO B;  2WGO A;  3WOE B;  1VQ9 3;  5EEO A;  3NM7 A;  8CHO A;  3U1W A;  2CKF B;  2GXF A;  3WA2 X;  4EW5 A;  3N54 B;  2W2C A;  1J2B A;  1WMP A;  3VGN A;  4XBT A;  3KII A;  1OGX A;  5M19 A;  2RBI A;  4HZB B;  1I2E A;  1ASK A;  3L0R A;  5AII A;  3SOY A;  1TJD A;  1CH0 A;  1A2P A;  2P0M A;  3PXM A;  1GY5 A;  1UUW B;  2HMM B;  1IK3 A;  1Q7H A;  3H3H A;  3DGM A;  3JUM A;  2O3O A;  1SIH A;  3BNE A;  3S67 A;  3CXC 2;  3FF2 A;  3F7X A;  3MSO A;  1MWR A;  3K9M C;  1W4N A;  2P0X A;  2W04 A;  2MF7 A;  3FF0 A;  5ELU A;  1YVB I;  3X3Z A;  1EEJ A;  1RGL A;  2AAD A;  3KE7 A;  4ILF A;  1UW1 A;  1JZD A;  1BUQ A;  1GD3 A;  3EBT A;  2IUJ A;  1SJW A;  1M90 4;  1IVX A;  4N6V 0;  1BNE A;  4MJD A;  5CXO A;  3KKG A;  1VQ6 3;  1QMA A;  3AMO A;  5EVH A;  3CC7 3;  3RGA A;  2CFK A;  1YJW 3;  1PFP A;  3GZB A;  4Q53 A;  3NBJ A;  2H0I A;  1HKX A;  2KF4 A;  2QGU A;  1LQG C;  2C10 A;  3KN4 A;  1U5O A;  2ML5 A;  2HMO B;  2F99 A;  3NBR A;  4HZ9 B;  3UNL A;  1OHP A;  1UCJ A;  4IIA A;  1O7G B;  1IQ8 A;  3RNT A;  1JBS A;  2CWU A;  1GOY A;  8RNT A;  4O3V A;  4HKV B;  1Q40 B;  4LGQ A;  1BSA A;  1TP6 A;  6RNT A;  2FGT A;  4JRF A;  4K61 A;  1GY6 A;  4R80 A;  1FGQ A;  3F9S A;  1LQM B;  1BRK A;  4AKY A;  3FG1 A;  5AIG A;  3SOA A;  1K73 4;  3MG1 A;  1SPU A;  2GEY A;  4HBR A;  3AGO A;  2BO9 B;  4X2O A;  1JB5 A;  1DYU A;  3PGB A;  5CF2 A;  1N9J A;  3LOY A;  4WHA A;  3DY5 A;  2E2U A;  4KVH A;  4CDL A;  1IT7 A;  4BIR A;  1VQO 3;  3FSD A;  4NHF A;  3CPO A;  4X2H A;  3EB8 A;  5IW9 A;  3X40 A;  1RHL A;  3OWU A;  1ROV A;  4BTW A;  1K28 A;  2CHC A;  5IER A;  1N5H A;  2MC8 A;  3DZL A;  5A0O B;  2GBW B;  3ECF A;  4ORL A;  4HJL B;  3CCV 3;  4EBG A;  1O7W B;  3GAX A;  2XFS A;  4XB5 A;  3BIR A;  4RZM A;  3F8H A;  3Q90 A;  1A67 A;  2CFD A;  4EC6 A;  2L4V A;  3MYT A;  1BOX A;  3FZW A;  4HM7 B;  2OOV C;  1E3R A;  5JBS A;  3SLU A;  1X1U A;  3H51 A;  3S5C A;  2V1L A;  3CCU 3;  1I8V A;  1YGE A;  3OWY A;  2QA4 3;  3OWS A;  1UCL A;  1UI8 A;  4HM3 B;  3U97 A;  1UCI A;  3MG2 A;  1VQQ A;  3RDE A;  1N9E A;  1VQP 3;  3D79 A;  1B27 A;  6STD A;  2QEX 3;  2HML B;  1X1X A;  2CG1 A;  3I55 3;  5G2G A;  2Z6B A;  3DM8 A;  3IPT A;  3G8Z A;  4J9A A;  1YHQ 3;  3AGN A;  1DE3 A;  3HOH A;  1STF I;  1JRQ A;  1UGH I;  1VZZ A;  1W02 A;  2IUK A;  4MMX B;  1VQ5 3;  4ZM8 A;  4BL3 A;  2F5M A;  1WQL B;  1QVF 2;  2ZL8 A;  1MNL A;  1BAN A;  4BTY A;  1W01 A;  1RGF A;  1YNV X;  3V99 A;  1W6C A;  3KCH A;  3ZG5 A;  1WMN A;  4XM4 A;  4O02 B;  2SBL A;  1WTH A;  1E3V A;  1GD4 A;  5D82 A;  3B4O A;  3CCM 3;  3OW2 2;  1KQS 2;  1KC8 4;  1I3F A;  1OUN A;  2HMN B;  2HOH A;  2BIR A;  4MMZ B;  3WA3 A;  4N6U A;  3URP A;  4LMI A;  1BU4 A;  2INX A;  3K0Z A;  4KFE A;  2RFR A;  2R4I A;  2PNC A;  3DGN A;  2C11 A;  3LYG A;  2K3D A;  1FUS A;  3NV0 B;  2IYJ A;  4EV5 A;  1JBR A;  3MPH A;  1GS3 A;  1RCK A;  4G1M B;  3CMA 3;  3NUV A;  1RGA A;  1RLS A;  1YGW A;  3IMA B;  3F7S A;  4FCZ A;  3CU3 A;  6GSP A;  4WYK A;  4KZ1 A;  3WDG B;  1MGW A;  3HZP A;  3ZG0 A;  5BU4 A;  3N8B A;  1RRH A;  2F4Y A;  1FUW A;  4STD A;  3LH4 A;  1U8C B;  1LOX A;  2F98 A;  5LC6 A;  1HU9 A;  1ZO2 A;  1I3I A;  1T2H A;  2B24 B;  3WHO A;  3WOD G;  4EXR A;  5D81 A;  4IT7 A;  3JVC A;  2STD A;  2CIU A;  2J8X B;  1QAF A;  4XDW A;  2M7O A;  3CCS 3;  1IV9 A;  1EUI C;  1JKG A;  1IDP A;  4J5G A;  3KZT A;  1D6U A;  2RGQ A;  1BVI A;  5AIH A;  1VQL 3;  4LEH A;  3BNB A;  3EE1 A;  1D6Z A;  3LML A;  3EN8 A;  4MEI A;  2E2T A;  1EQK A;  3CCQ 3;  2KCD A;  5D83 A;  2XGL A;  1W7C A;  4U13 A;  3G4S 3;  1EG9 B;  1Q81 4;  3UL6 A;  5AEW B;  3CPW 2;  1RKY A;  3F40 A;  1AY7 A;  1RDS A;  1PY3 A;  3OV4 A;  5IG0 A;  2XF3 A;  3Q2P A;  1UGI A;  2ZDJ A;  2XR8 B;  4BTX A;  3A5E A;  1VQ7 3;  4LZI A;  3HI7 A;  1AVL A;  1VQ4 3;  1UCK A;  1BUJ A;  3NQZ A;  5STD A;  3NX0 A;  1PU4 A;  1SQW A;  1GYB A;  2BMQ B;  2XRX B;  1TUH A;  2H0H A;  3Q1C A;  1S5A A;  5AEU B;  1AVK A;  3QK9 A;  3KFQ C;  2KRT A;  3VF1 A;  1V74 A;  1US1 A;  1OF5 B;  1NDO B;  2LYX A;  5GSP A;  3F8X A;  3MG3 A;  1GSP A;  1JN5 B;  1DVC A;  3T8U A;  1MGR A;  1BAO A;  1IQX A;  3BND A;  4GHO A;  2P38 A;  1QJG A;  3CNX A;  1FUT A;  3B4P A;  2BNG A;  1FGT A;  3K7C A;  1T5Y A;  1PYL A;  1LNI A;  1BNJ A; 
#chains in the Genus database with same CATH homology
 4LYL B;  1UUG B;  1LQG C;  1UGI A;  1LQM B;  2J8X B;  1UGH I;  1EUI C;  2UGI A;  2ZHX B;  2UUG C;  1UDI I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...