2UUGC

Escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
b'NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Replication, hydrolase
total genus 16
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2uugC00
1UGHI 1LQGC 2UUGC 2ZHXB 4LYLB 1UGIA 2UGIA 1EUIC 1LQMB 1UDII 2J8XB 1UUGB
chains in the Genus database with same CATH superfamily
3H51A 3B4PA 4RNYA 1VZZA 3FGYA 3PYJA 4X2OA 3HK4A 1V58A 2C11A 1ROAA 2GU1A 2K54A 5AIHA 1JRQA 1BNGA 2HMMB 4CCVA 2QA43 2BMRB 2CX0A 3HI7A 4LYLB 1HYFA 1QAKA 2FGTA 3LTAA 3G4S3 2RFRA 2FXTA 1VQ53 1RGKA 3Q2PA 4HVNA 3CCM3 3STDA 1E97A 2O3OA 2YX9A 4OUQA 1C54A 1NDOB 1EUIC 1WMOA 2CWTA 5IEPA 1UCLA 1QVG2 2RGQA 1NWWA 1VQL3 1CYUA 3T8NA 1QJGA 4KVHA 3JVCA 1IT7A 2CFWA 3DY5A 3HOHA 3VSYA 3SYUA 2Y73A 1BSBA 2YFJB 1IQXA 2F4YA 3CC73 1MWSA 5AIIA 1ZO2A 1YIT3 1W01A 3F9SA 3JUMA 3AHWA 1OHOA 3EJVA 1VQO3 5G1KA 3DGYA 4RZMA 1JB2A 4FCJA 5A0OB 1BRHA 2CK3H 3FF2A 1O7NB 3NUVA 3CPOA 5EQLA 3BU4A 3WDGB 1IDPA 4O3VA 2BHMA 1G0TA 1MWUA 3NXJA 4HM2B 5KP3A 3V92A 1CEWI 1UI8A 3S27A 2LQVA 3CU3A 1ZGXA 3EHCA 4O8SA 3GAXA 2BO9B 4X2HA 1GS3A 1NNVA 7STDA 1LOVA 3DMCA 2IYJA 2CIUA 3FF0A 4HZ9B 4L8PA 1JKGB 2MF7A 3IMAB 1JZDA 4BTWA 3PZWA 1BU4A 1I2EA 1OACA 3D5IA 3LH4A 3GWRA 3MSOA 4OVMA 1DMMA 4R1KA 4KZ1A 5FGOA 5BU4A 4Q53A 1VQP3 1EQKA 1FGTA 4HM1B 2QIYA 1FUTA 2STDA 1OF5B 4PEJA 3SLUA 1OH0A 1I3FA 1YVBI 5AI1A 1VQ63 3CXC2 1DMNA 4J5KA 3DGLA 2K3DA 1C7HA 4RNZA 3EE1A 3X3XA 1I8VA 1OGZA 5EVHA 1I2GA 2XSHB 2WOHA 1W5ZA 3GZXB 3BLZA 1GY6A 2ZDJA 5IERA 1VQ73 2OOVC 1UCKA 1NO3A 4GL6A 1JKGA 5IF6A 2OOVA 1TU5A 3U1WA 3ALAA 1AQZA 3IPTA 3MG3A 1YI23 1CQSA 1U8CB 3CMA3 1MGRA 2C4BA 4QWTA 3F7SA 2E2VA 2OTL3 1YVSA 1OF5A 3I0YA 3TDGA 1X1WA 2SARA 4IPBA 1UDII 1RGFA 1O7MB 1GD4A 1T3BA 3MWZA 1DE3A 3G713 1M9GA 1MWTA 1ULJB 1JZOA 3DM8A 3LTCA 3ZG5A 3V99A 1E3RA 1TTOA 1W00A 5FW5A 3AHSA 5AIFA 3T0UA 4HKVB 4EW5A 5DREA 3UL6A 2I9WA 1F8NA 5CF1A 3MHEA 2AADA 2GEXA 2V1LA 1ISKA 1E3VA 1SPUA 3WMDA 5GSPA 1GMPA 1OPYA 3NQYA 2H0IA 4WWUC 3MG2A 4H61A 5JPPA 4BU4A 2P38A 3AGNA 3LT8A 3JUPA 2C10A 4G1MB 2CKFB 2IA7A 4EV5A 4AKZA 3FSDA 4N6MA 3LZAA 2KF6A 1ZX2A 3BNBA 4I5QA 1AVKA 5DRVA 1FW7A 3CCQ3 1T5YA 4BIRA 2P05A 3A76A 4FMCA 2WGOA 2WGQA 3AGOA 3EN8A 3F8HA 1VQ43 3CC43 2D42A 1Q864 4K1VA 2W6JH 4HOHA 1W6CA 4XDVA 1M904 1L5GB 3DGMA 2SBLA 5EEOA 4ILFA 3S5CA 4N6TA 4R4KA 3V98A 1IK3A 3S28A 2BT3A 3GRDA 4FMBA 4HM6B 1RGCA 2W04A 5IG3A 4J8TA 3MKIA 1JB4A 3D4AA 3GZBA 1RHLA 5M1AA 3T8UA 1BNJA 1A67A 1BVIA 1RMSA 3HX8A 1JN5A 1NU3A 2WO0A 3EBTA 1JV2B 3MG1A 1BNFA 4AEQA 1VQN3 2GXFA 1W4NA 2KXGA 4HAAA 3KN4A 1LQGC 3HIIA 2ML6A 3L0RA 2KF4A 1KC84 2P09A 2CFLA 2R41A 1AV4A 3NBRA 3NX0A 3I563 5AYSC 1IVWA 1FYSA 3N9HA 3OWYA 1BGSA 3WA2X 4CDLA 3KZTA 1GMQA 1KWIA 1BRIA 2GEYA 2F56A 2W56B 1IU7A 2Y74A 1ULIB 3KCHA 1LOWA 1STFI 2CC3A 5STDA 3J7Yd 3EN1B 3LXUX 3B7CA 2GBXB 2Q07A 1VQK3 2PNCA 1RSNA 1LOXA 1W6GA 1RRLA 1QMAA 2F98A 1W2ZA 3NBBA 1D6ZA 1GY7A 1BSCA 5I97A 1A2VA 1TP6A 1DVCA 1GD3A 4FR9A 4HM4B 4XDWA 1SJWA 4WP5A 2ZA4A 2E2UA 3QK9A 3ROBA 3AMOB 1EA2A 3SOAA 1K41A 1AVLA 1HZ1A 1PY3A 1GMRA 1LNIA 2R4IA 1MNLA 5IG0A 5AEWB 2OQEA 1LRAA 1SIHA 3HZPA 4EBGA 2XR8B 1IT8A 1BSDA 1Q40B 1JJ22 4WYKB 3ER7A 1MWRA 4XM4A 1B21A 3EX9A 3G8ZA 3CC23 1PYLA 3FG1A 2CHCA 1G02A 3PXMA 3X41A 4HYZA 1A2PA 2CFGA 4BTXA 1BIRA 3WOFB 3FZWA 1YJW3 5JPUA 1Q7Y4 1UUVB 3PS8A 4NHFA 3D5GA 4L8OA 2F86B 3K7CA 3UL5A 2RSXA 1BAOA 4K90B 4R80A 2HOHA 1BSEA 3ZG0A 4MEIA 1TUHA 3CCJ3 1ROVA 2K0MA 3D3LA 3S29A 3AMOA 1FZUA 4H3UA 1Q7HA 2OCTA 1DVDA 1Q814 1PFPA 5ELJA 2D1WA 1TRQA 2P0XA 3JUQA 3KSED 5D81A 4ORLA 1RGLA 1X1YA 4EYCA 1EEJA 4WYKA 1RDSA 4N6OB 3G16A 1OCVA 4GHOA 1UI7A 5LC7A 1V57A 2IUJA 1GOYA 3EF8A 2HMLB 4XBTA 1YJN3 1UCIA 2PZVA 1K734 3X3YA 9RNTA 1WTHA 3X40A 1K8A4 1BNIA 2B24B 3FKAA 3DGNA 4N6LA 5D83A 1RGEA 4FMAA 2A15A 1B2UA 4ZM8A 4EV2A 3CPW2 1R4CA 1RLSA 4WFOA 1BNRA 1RCKA 4BL2A 1DETA 2GBWB 5AYRB 3D79A 2BU4A 1RGGA 1QAFA 1RN7A 3DZLA 1JB5A 2CWVA 1K28A 2UX0A 4MMXB 4AKYA 2E2TA 4N6V0 1BRGA 5LC6A 2XF3A 3VGNA 1KSIA 3X42A 4CJNA 1BOXA 3Q1CA 1YGEA 2Z7AA 3FCSB 1TRPA 2L4VA 5BIRA 1VQ83 1IVUA 1PU4A 1N8R4 1N5PA 2W9PA 3K9MC 2BNGA 1EG9B 2MC8A 3KSPA 4GSPA 5AEUB 3BIRA 2XH9A 1N9EA 3JUNA 1CH0A 1YGWA 3SX1A 1O7HB 3F40A 1SARA 2CFKA 1GY5A 4FCMA 1U5OA 1Q9EA 2B1XB 3IJEB 5IEOA 3OV4A 4U13A 2OWPA 3FH1A 3D9RA 1CYVA 1DMQA 1A2KA 4NPBA 3K0ZA 5TGNA 3EC9A 2M7OA 3UJMA 3KFQC 2ML5A 3OWSA 1IQYA 2UGIA 2Z6BA 1IVXA 3F8XA 4EC6A 4HM5B 2W2CA 1VQ93 2CFDA 1GSPA 1W7CA 4LGQA 1QALA 8RNTA 5JBSA 1G96A 1UW1A 3DXOA 1NB5I 1VQQA 2O9UX 1TFKA 1T2HA 1FGRA 3CCS3 1B27A 2H0HA 1Q824 2HMJB 2FNQA 3NQZA 1LVNA 1N8QA 2CW9A 2HMKB 3ECFA 3Q90A 4IIAA 5G1LA 2F5MA 4DKIA 2QEX3 2XRXB 2IY2A 2KAAA 4HM3B 2GSPA 3WR2A 1LQMB 3RNTA 3LTDA 2BIRA 1D6UA 4MMYB 4R9KA 2Z77A 3ZFZA 1WMNA 1SQWA 1RN4A 2BMOB 3NV0B 4FMDA 1JBRA 1FGMA 2QGUA 3N8BA 4LSOA 1BNSA 3OWUA 1BSAA 4HJLB 1B20A 2AAEA 6RNTA 2HMNB 5CXOA 5CLKA 1O7WB 1X1XA 3CCU3 3G0KA 1BRJA 2XFTA 3JUOA 3LTBA 4XB5A 3VF1A 2HMOB 5RNTA 4XBYA 3NHXA 4MJDA 3CNXA 2W9QA 2OTJ3 1ASKA 4JRFA 1HU9A 1MOLA 3DUKA 1JBTA 1WMPA 4HM8B 4RNTA 1A90A 4L7KA 1IV9A 2XGLA 3CNMA 2KF3A 1FUSA 4STDA 2OQEC 2XEPA 3RDEA 3F7XA 5AIGA 1YJ93 4TX4A 3NV0A 5BXQA 3OX9A 3KIIA 4HZBB 5IG5A 2W56A 1Y4KA 4N6UA 5HGRA 2RCDA 3F14A 2J8XB 1IV7A 1BNEA 7GSPA 1X1UA 5HOHA 1IQ8A 4LZIA 5CK6A 8CHOA 1VQM3 3SXXA 1BRSA 2XSOB 1DYUA 4GB5A 4EXRA 3Q3FA 3DH2A 3PCSA 5IW9A 3CCL3 2F5WA 1I70A 2IMJA 3WHOA 2YFLB 1BUQA 1EKMA 1TIJA 1UUGB 1TJDA 4JF8A 5KP4A 1UGHI 3PGBA 2UUGC 1B2SA 2KRTA 1IVVA 1O7PB 4I4KA 1O7GB 1RGAA 1NJI4 1B2MA 1MGWA 1Q40A 4BL3A 2KCDA 2YFIB 1UGIA 3MPHA 4LEHA 3K5TA 1Q42A 3LOYA 4WHAA 2P0MA 3BNCA 4MMZB 1RRHA 1WNHA 5IG4A 2XFSA 3E99A 3LMLA 2CG0A 3EBYA 3H3HA 1US1A 3KKGA 4O2HA 4N3VA 1IYYA 1B3SA 3WOEB 2JDIH 3QRDA 1JNQA 1K9M4 1B2XA 1QVF2 3NM7A 4HBRA 4R9LA 3CCV3 2RBIA 5M19A 3G6E3 5IENA 1OUNA 1FA3A 1S723 2L1SA 3B4OA 3GZRA 4J9AA 3RGRA 4HM7B 3SOYA 1OGXA 3O8YA 1AY7A 1GYBA 1LXEA 1LNHA 1RJOA 6GSPA 3UNLA 1WQLB 4CPKA 3S67A 1B2ZA 3GZYB 4FCZA 1D6YA 2W03A 4J5GA 4K1UA 1RNBA 2INXA 4XBXA 1GOVA 1BRNL 1BUJA 2RNTA 1SIIA 4N6NB 2CG1A 1RKYA 3CD63 3MYTA 7RNTA 3SVAA 4NREA 5BVBA 3UB1A 1T2IA 3PCRA 5KP1A 3BB9A 2F99A 3OW22 2LYXA 1I0VA 1W6YA 3B8LA 3BNDA 1NB3I 1BRKA 2WOFA 3M8CA 3U97A 2JQ5A 1V74A 4HM0B 4BTYA 2GU3A 1Z1SA 1ZS7A 4LMIA 2CX1A 3URPA 3CCE3 3FG3A 1RNTA 2ZL8A 3NBJA 1STDA 1I3IA 2CWUA 3FLJA 4K61A 1W2B2 4KFDA 2W0QA 1M1XB 3SEDA 3LT9A 1YIJ3 1BANA 3A5EA 1YNVX 1OHPA 3BNEA 3I553 3KE7A 3CME3 2CH9A 1TFOA 2Z76A 3HIGA 5D82A 3N54B 4O02B 3X3ZA 3EQQB 1UCJA 3DGOA 1JN5B 3WODG 1KD14 1UUWB 3FG4A 4IT7A 2H0GA 3WA3A 3OXAA 4OK0A 5CF2A 1RGHA 1KQS2 5M18A 3CCR3 1JBSA 1S5AA 1J2BA 1FUWA 1FGOA 1GOUA 1N9JA 1W02A 2BMQB 2KF5A 3LYGA 4RBNA 1RTUA 1RN1A 1N5HA 1OHSA 4KFFA 5ELUA 1M1K4 3NM2A 5G2GA 3K63A 1AR0A 1I0XA 6STDA 1RCLA 2ZHXB 1FGQA 1I2FA 3GSPA 1YHQ3 2IUKA 2XGNA 4KT3B 1LOYA 1R4YA 1HKXA 4KFEA 3RGAA 3EB8A
chains in the Genus database with same CATH topology
1UGHI 1LQGC 2UUGC 2ZHXB 4LYLB 1UGIA 2UGIA 1EUIC 1LQMB 1UDII 2J8XB 1UUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGH I;  1LQG C;  2UUG C;  2ZHX B;  4LYL B;  1UGI A;  2UGI A;  1EUI C;  1LQM B;  1UDI I;  2J8X B;  1UUG B; 
#chains in the Genus database with same CATH topology
 3H51 A;  3B4P A;  4RNY A;  1VZZ A;  3FGY A;  3PYJ A;  4X2O A;  3HK4 A;  1V58 A;  2C11 A;  1ROA A;  2GU1 A;  2K54 A;  5AIH A;  1JRQ A;  1BNG A;  2HMM B;  4CCV A;  2QA4 3;  2BMR B;  2CX0 A;  3HI7 A;  4LYL B;  1HYF A;  1QAK A;  2FGT A;  3LTA A;  3G4S 3;  2RFR A;  2FXT A;  1VQ5 3;  1RGK A;  3Q2P A;  4HVN A;  3CCM 3;  3STD A;  1E97 A;  2O3O A;  2YX9 A;  4OUQ A;  1C54 A;  1NDO B;  1EUI C;  1WMO A;  2CWT A;  5IEP A;  1UCL A;  1QVG 2;  2RGQ A;  1NWW A;  1VQL 3;  1CYU A;  3T8N A;  1QJG A;  4KVH A;  3JVC A;  1IT7 A;  2CFW A;  3DY5 A;  3HOH A;  3VSY A;  3SYU A;  2Y73 A;  1BSB A;  2YFJ B;  1IQX A;  2F4Y A;  3CC7 3;  1MWS A;  5AII A;  1ZO2 A;  1YIT 3;  1W01 A;  3F9S A;  3JUM A;  3AHW A;  1OHO A;  3EJV A;  1VQO 3;  5G1K A;  3DGY A;  4RZM A;  1JB2 A;  4FCJ A;  5A0O B;  1BRH A;  2CK3 H;  3FF2 A;  1O7N B;  3NUV A;  3CPO A;  5EQL A;  3BU4 A;  3WDG B;  1IDP A;  4O3V A;  2BHM A;  1G0T A;  1MWU A;  3NXJ A;  4HM2 B;  5KP3 A;  3V92 A;  1CEW I;  1UI8 A;  3S27 A;  2LQV A;  3CU3 A;  1ZGX A;  3EHC A;  4O8S A;  3GAX A;  2BO9 B;  4X2H A;  1GS3 A;  1NNV A;  7STD A;  1LOV A;  3DMC A;  2IYJ A;  2CIU A;  3FF0 A;  4HZ9 B;  4L8P A;  1JKG B;  2MF7 A;  3IMA B;  1JZD A;  4BTW A;  3PZW A;  1BU4 A;  1I2E A;  1OAC A;  3D5I A;  3LH4 A;  3GWR A;  3MSO A;  4OVM A;  1DMM A;  4R1K A;  4KZ1 A;  5FGO A;  5BU4 A;  4Q53 A;  1VQP 3;  1EQK A;  1FGT A;  4HM1 B;  2QIY A;  1FUT A;  2STD A;  1OF5 B;  4PEJ A;  3SLU A;  1OH0 A;  1I3F A;  1YVB I;  5AI1 A;  1VQ6 3;  3CXC 2;  1DMN A;  4J5K A;  3DGL A;  2K3D A;  1C7H A;  4RNZ A;  3EE1 A;  3X3X A;  1I8V A;  1OGZ A;  5EVH A;  1I2G A;  2XSH B;  2WOH A;  1W5Z A;  3GZX B;  3BLZ A;  1GY6 A;  2ZDJ A;  5IER A;  1VQ7 3;  2OOV C;  1UCK A;  1NO3 A;  4GL6 A;  1JKG A;  5IF6 A;  2OOV A;  1TU5 A;  3U1W A;  3ALA A;  1AQZ A;  3IPT A;  3MG3 A;  1YI2 3;  1CQS A;  1U8C B;  3CMA 3;  1MGR A;  2C4B A;  4QWT A;  3F7S A;  2E2V A;  2OTL 3;  1YVS A;  1OF5 A;  3I0Y A;  3TDG A;  1X1W A;  2SAR A;  4IPB A;  1UDI I;  1RGF A;  1O7M B;  1GD4 A;  1T3B A;  3MWZ A;  1DE3 A;  3G71 3;  1M9G A;  1MWT A;  1ULJ B;  1JZO A;  3DM8 A;  3LTC A;  3ZG5 A;  3V99 A;  1E3R A;  1TTO A;  1W00 A;  5FW5 A;  3AHS A;  5AIF A;  3T0U A;  4HKV B;  4EW5 A;  5DRE A;  3UL6 A;  2I9W A;  1F8N A;  5CF1 A;  3MHE A;  2AAD A;  2GEX A;  2V1L A;  1ISK A;  1E3V A;  1SPU A;  3WMD A;  5GSP A;  1GMP A;  1OPY A;  3NQY A;  2H0I A;  4WWU C;  3MG2 A;  4H61 A;  5JPP A;  4BU4 A;  2P38 A;  3AGN A;  3LT8 A;  3JUP A;  2C10 A;  4G1M B;  2CKF B;  2IA7 A;  4EV5 A;  4AKZ A;  3FSD A;  4N6M A;  3LZA A;  2KF6 A;  1ZX2 A;  3BNB A;  4I5Q A;  1AVK A;  5DRV A;  1FW7 A;  3CCQ 3;  1T5Y A;  4BIR A;  2P05 A;  3A76 A;  4FMC A;  2WGO A;  2WGQ A;  3AGO A;  3EN8 A;  3F8H A;  1VQ4 3;  3CC4 3;  2D42 A;  1Q86 4;  4K1V A;  2W6J H;  4HOH A;  1W6C A;  4XDV A;  1M90 4;  1L5G B;  3DGM A;  2SBL A;  5EEO A;  4ILF A;  3S5C A;  4N6T A;  4R4K A;  3V98 A;  1IK3 A;  3S28 A;  2BT3 A;  3GRD A;  4FMB A;  4HM6 B;  1RGC A;  2W04 A;  5IG3 A;  4J8T A;  3MKI A;  1JB4 A;  3D4A A;  3GZB A;  1RHL A;  5M1A A;  3T8U A;  1BNJ A;  1A67 A;  1BVI A;  1RMS A;  3HX8 A;  1JN5 A;  1NU3 A;  2WO0 A;  3EBT A;  1JV2 B;  3MG1 A;  1BNF A;  4AEQ A;  1VQN 3;  2GXF A;  1W4N A;  2KXG A;  4HAA A;  3KN4 A;  1LQG C;  3HII A;  2ML6 A;  3L0R A;  2KF4 A;  1KC8 4;  2P09 A;  2CFL A;  2R41 A;  1AV4 A;  3NBR A;  3NX0 A;  3I56 3;  5AYS C;  1IVW A;  1FYS A;  3N9H A;  3OWY A;  1BGS A;  3WA2 X;  4CDL A;  3KZT A;  1GMQ A;  1KWI A;  1BRI A;  2GEY A;  2F56 A;  2W56 B;  1IU7 A;  2Y74 A;  1ULI B;  3KCH A;  1LOW A;  1STF I;  2CC3 A;  5STD A;  3J7Y d;  3EN1 B;  3LXU X;  3B7C A;  2GBX B;  2Q07 A;  1VQK 3;  2PNC A;  1RSN A;  1LOX A;  1W6G A;  1RRL A;  1QMA A;  2F98 A;  1W2Z A;  3NBB A;  1D6Z A;  1GY7 A;  1BSC A;  5I97 A;  1A2V A;  1TP6 A;  1DVC A;  1GD3 A;  4FR9 A;  4HM4 B;  4XDW A;  1SJW A;  4WP5 A;  2ZA4 A;  2E2U A;  3QK9 A;  3ROB A;  3AMO B;  1EA2 A;  3SOA A;  1K41 A;  1AVL A;  1HZ1 A;  1PY3 A;  1GMR A;  1LNI A;  2R4I A;  1MNL A;  5IG0 A;  5AEW B;  2OQE A;  1LRA A;  1SIH A;  3HZP A;  4EBG A;  2XR8 B;  1IT8 A;  1BSD A;  1Q40 B;  1JJ2 2;  4WYK B;  3ER7 A;  1MWR A;  4XM4 A;  1B21 A;  3EX9 A;  3G8Z A;  3CC2 3;  1PYL A;  3FG1 A;  2CHC A;  1G02 A;  3PXM A;  3X41 A;  4HYZ A;  1A2P A;  2CFG A;  4BTX A;  1BIR A;  3WOF B;  3FZW A;  1YJW 3;  5JPU A;  1Q7Y 4;  1UUV B;  3PS8 A;  4NHF A;  3D5G A;  4L8O A;  2F86 B;  3K7C A;  3UL5 A;  2RSX A;  1BAO A;  4K90 B;  4R80 A;  2HOH A;  1BSE A;  3ZG0 A;  4MEI A;  1TUH A;  3CCJ 3;  1ROV A;  2K0M A;  3D3L A;  3S29 A;  3AMO A;  1FZU A;  4H3U A;  1Q7H A;  2OCT A;  1DVD A;  1Q81 4;  1PFP A;  5ELJ A;  2D1W A;  1TRQ A;  2P0X A;  3JUQ A;  3KSE D;  5D81 A;  4ORL A;  1RGL A;  1X1Y A;  4EYC A;  1EEJ A;  4WYK A;  1RDS A;  4N6O B;  3G16 A;  1OCV A;  4GHO A;  1UI7 A;  5LC7 A;  1V57 A;  2IUJ A;  1GOY A;  3EF8 A;  2HML B;  4XBT A;  1YJN 3;  1UCI A;  2PZV A;  1K73 4;  3X3Y A;  9RNT A;  1WTH A;  3X40 A;  1K8A 4;  1BNI A;  2B24 B;  3FKA A;  3DGN A;  4N6L A;  5D83 A;  1RGE A;  4FMA A;  2A15 A;  1B2U A;  4ZM8 A;  4EV2 A;  3CPW 2;  1R4C A;  1RLS A;  4WFO A;  1BNR A;  1RCK A;  4BL2 A;  1DET A;  2GBW B;  5AYR B;  3D79 A;  2BU4 A;  1RGG A;  1QAF A;  1RN7 A;  3DZL A;  1JB5 A;  2CWV A;  1K28 A;  2UX0 A;  4MMX B;  4AKY A;  2E2T A;  4N6V 0;  1BRG A;  5LC6 A;  2XF3 A;  3VGN A;  1KSI A;  3X42 A;  4CJN A;  1BOX A;  3Q1C A;  1YGE A;  2Z7A A;  3FCS B;  1TRP A;  2L4V A;  5BIR A;  1VQ8 3;  1IVU A;  1PU4 A;  1N8R 4;  1N5P A;  2W9P A;  3K9M C;  2BNG A;  1EG9 B;  2MC8 A;  3KSP A;  4GSP A;  5AEU B;  3BIR A;  2XH9 A;  1N9E A;  3JUN A;  1CH0 A;  1YGW A;  3SX1 A;  1O7H B;  3F40 A;  1SAR A;  2CFK A;  1GY5 A;  4FCM A;  1U5O A;  1Q9E A;  2B1X B;  3IJE B;  5IEO A;  3OV4 A;  4U13 A;  2OWP A;  3FH1 A;  3D9R A;  1CYV A;  1DMQ A;  1A2K A;  4NPB A;  3K0Z A;  5TGN A;  3EC9 A;  2M7O A;  3UJM A;  3KFQ C;  2ML5 A;  3OWS A;  1IQY A;  2UGI A;  2Z6B A;  1IVX A;  3F8X A;  4EC6 A;  4HM5 B;  2W2C A;  1VQ9 3;  2CFD A;  1GSP A;  1W7C A;  4LGQ A;  1QAL A;  8RNT A;  5JBS A;  1G96 A;  1UW1 A;  3DXO A;  1NB5 I;  1VQQ A;  2O9U X;  1TFK A;  1T2H A;  1FGR A;  3CCS 3;  1B27 A;  2H0H A;  1Q82 4;  2HMJ B;  2FNQ A;  3NQZ A;  1LVN A;  1N8Q A;  2CW9 A;  2HMK B;  3ECF A;  3Q90 A;  4IIA A;  5G1L A;  2F5M A;  4DKI A;  2QEX 3;  2XRX B;  2IY2 A;  2KAA A;  4HM3 B;  2GSP A;  3WR2 A;  1LQM B;  3RNT A;  3LTD A;  2BIR A;  1D6U A;  4MMY B;  4R9K A;  2Z77 A;  3ZFZ A;  1WMN A;  1SQW A;  1RN4 A;  2BMO B;  3NV0 B;  4FMD A;  1JBR A;  1FGM A;  2QGU A;  3N8B A;  4LSO A;  1BNS A;  3OWU A;  1BSA A;  4HJL B;  1B20 A;  2AAE A;  6RNT A;  2HMN B;  5CXO A;  5CLK A;  1O7W B;  1X1X A;  3CCU 3;  3G0K A;  1BRJ A;  2XFT A;  3JUO A;  3LTB A;  4XB5 A;  3VF1 A;  2HMO B;  5RNT A;  4XBY A;  3NHX A;  4MJD A;  3CNX A;  2W9Q A;  2OTJ 3;  1ASK A;  4JRF A;  1HU9 A;  1MOL A;  3DUK A;  1JBT A;  1WMP A;  4HM8 B;  4RNT A;  1A90 A;  4L7K A;  1IV9 A;  2XGL A;  3CNM A;  2KF3 A;  1FUS A;  4STD A;  2OQE C;  2XEP A;  3RDE A;  3F7X A;  5AIG A;  1YJ9 3;  4TX4 A;  3NV0 A;  5BXQ A;  3OX9 A;  3KII A;  4HZB B;  5IG5 A;  2W56 A;  1Y4K A;  4N6U A;  5HGR A;  2RCD A;  3F14 A;  2J8X B;  1IV7 A;  1BNE A;  7GSP A;  1X1U A;  5HOH A;  1IQ8 A;  4LZI A;  5CK6 A;  8CHO A;  1VQM 3;  3SXX A;  1BRS A;  2XSO B;  1DYU A;  4GB5 A;  4EXR A;  3Q3F A;  3DH2 A;  3PCS A;  5IW9 A;  3CCL 3;  2F5W A;  1I70 A;  2IMJ A;  3WHO A;  2YFL B;  1BUQ A;  1EKM A;  1TIJ A;  1UUG B;  1TJD A;  4JF8 A;  5KP4 A;  1UGH I;  3PGB A;  2UUG C;  1B2S A;  2KRT A;  1IVV A;  1O7P B;  4I4K A;  1O7G B;  1RGA A;  1NJI 4;  1B2M A;  1MGW A;  1Q40 A;  4BL3 A;  2KCD A;  2YFI B;  1UGI A;  3MPH A;  4LEH A;  3K5T A;  1Q42 A;  3LOY A;  4WHA A;  2P0M A;  3BNC A;  4MMZ B;  1RRH A;  1WNH A;  5IG4 A;  2XFS A;  3E99 A;  3LML A;  2CG0 A;  3EBY A;  3H3H A;  1US1 A;  3KKG A;  4O2H A;  4N3V A;  1IYY A;  1B3S A;  3WOE B;  2JDI H;  3QRD A;  1JNQ A;  1K9M 4;  1B2X A;  1QVF 2;  3NM7 A;  4HBR A;  4R9L A;  3CCV 3;  2RBI A;  5M19 A;  3G6E 3;  5IEN A;  1OUN A;  1FA3 A;  1S72 3;  2L1S A;  3B4O A;  3GZR A;  4J9A A;  3RGR A;  4HM7 B;  3SOY A;  1OGX A;  3O8Y A;  1AY7 A;  1GYB A;  1LXE A;  1LNH A;  1RJO A;  6GSP A;  3UNL A;  1WQL B;  4CPK A;  3S67 A;  1B2Z A;  3GZY B;  4FCZ A;  1D6Y A;  2W03 A;  4J5G A;  4K1U A;  1RNB A;  2INX A;  4XBX A;  1GOV A;  1BRN L;  1BUJ A;  2RNT A;  1SII A;  4N6N B;  2CG1 A;  1RKY A;  3CD6 3;  3MYT A;  7RNT A;  3SVA A;  4NRE A;  5BVB A;  3UB1 A;  1T2I A;  3PCR A;  5KP1 A;  3BB9 A;  2F99 A;  3OW2 2;  2LYX A;  1I0V A;  1W6Y A;  3B8L A;  3BND A;  1NB3 I;  1BRK A;  2WOF A;  3M8C A;  3U97 A;  2JQ5 A;  1V74 A;  4HM0 B;  4BTY A;  2GU3 A;  1Z1S A;  1ZS7 A;  4LMI A;  2CX1 A;  3URP A;  3CCE 3;  3FG3 A;  1RNT A;  2ZL8 A;  3NBJ A;  1STD A;  1I3I A;  2CWU A;  3FLJ A;  4K61 A;  1W2B 2;  4KFD A;  2W0Q A;  1M1X B;  3SED A;  3LT9 A;  1YIJ 3;  1BAN A;  3A5E A;  1YNV X;  1OHP A;  3BNE A;  3I55 3;  3KE7 A;  3CME 3;  2CH9 A;  1TFO A;  2Z76 A;  3HIG A;  5D82 A;  3N54 B;  4O02 B;  3X3Z A;  3EQQ B;  1UCJ A;  3DGO A;  1JN5 B;  3WOD G;  1KD1 4;  1UUW B;  3FG4 A;  4IT7 A;  2H0G A;  3WA3 A;  3OXA A;  4OK0 A;  5CF2 A;  1RGH A;  1KQS 2;  5M18 A;  3CCR 3;  1JBS A;  1S5A A;  1J2B A;  1FUW A;  1FGO A;  1GOU A;  1N9J A;  1W02 A;  2BMQ B;  2KF5 A;  3LYG A;  4RBN A;  1RTU A;  1RN1 A;  1N5H A;  1OHS A;  4KFF A;  5ELU A;  1M1K 4;  3NM2 A;  5G2G A;  3K63 A;  1AR0 A;  1I0X A;  6STD A;  1RCL A;  2ZHX B;  1FGQ A;  1I2F A;  3GSP A;  1YHQ 3;  2IUK A;  2XGN A;  4KT3 B;  1LOY A;  1R4Y A;  1HKX A;  4KFE A;  3RGA A;  3EB8 A; 
#chains in the Genus database with same CATH homology
 1UGH I;  1LQG C;  2UUG C;  2ZHX B;  4LYL B;  1UGI A;  2UGI A;  1EUI C;  1LQM B;  1UDI I;  2J8X B;  1UUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...