2UUGC

Escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Replication, hydrolase
molecule keywords URACIL-DNA GLYCOSYLASE
total genus 16
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2uugC00
2UUGC 1UGHI 1UUGB 2J8XB 1UGIA 1LQMB 2UGIA 2ZHXB 1UDII 4LYLB 1EUIC 1LQGC
chains in the Genus database with same CATH superfamily
1BNJA 2W9QA 3NBJA 5CF2A 1YIJ3 1VQ43 2KAAA 2Z76A 4K1UA 5STDA 4H61A 4BL2A 1YNVX 4MMZB 1YI23 1AY7A 1IU7A 2CFWA 5TGNA 1RRHA 1UGHI 1HZ1A 2RFRA 2OQEC 2IY2A 3B8LA 3BLZA 3DUKA 4KVHA 3AHSA 3RDEA 3CD63 4EBGA 2YFIB 2HMMB 2HOHA 1E97A 1RGCA 3IMAB 3PYJA 2AADA 4EC6A 1AR0A 1WTHA 3IPTA 1Q40A 1M1XB 1GMRA 3M8CA 3FG1A 2CWTA 3LXUX 5ELUA 3UL6A 2R4IA 1BGSA 2Z6BA 4XBXA 1SARA 1A90A 3D3LA 3EF8A 4J5GA 1RN7A 3DMCA 4RBNA 4NPBA 2E2VA 4K90B 1IVVA 4N6TA 3SOYA 1A2PA 1UCIA 2CFLA 2XGNA 1LQMB 5G1LA 4CJNA 2ZHXB 4FMAA 2KRTA 4R4KA 2KCDA 1ROVA 1VQ73 2FNQA 5CXOA 1I8VA 2UUGC 3OXAA 5CLKA 1LXEA 4FMBA 1QVF2 1OPYA 4KT3B 4FMDA 2CK3H 3JUPA 1LOWA 3BB9A 3JUMA 3I553 1X1XA 4PEJA 1I3IA 2H0GA 3MG1A 4BTXA 2MC8A 3KE7A 3OWUA 3G6E3 3CCE3 1M904 3BNDA 1B2UA 3LT8A 3NM7A 3NHXA 3HZPA 3GZBA 1T2HA 3MWZA 3F7SA 4MEIA 3QK9A 5HGRA 2FXTA 5JBSA 1TP6A 3BNBA 1SIHA 2WGOA 4Q53A 1NB3I 1BU4A 2XR8B 1BNFA 1BIRA 1B2ZA 1GY6A 2SARA 3KZTA 3VF1A 3VSYA 3CC23 1Q7Y4 1RGHA 3WOEB 4GHOA 3K0ZA 1X1YA 3AGNA 3PGBA 1Q7HA 2JDIH 2XFTA 8CHOA 3AMOA 1GMQA 1Q814 1KD14 2ML5A 4BTWA 3EHCA 1VQ53 2D1WA 4O2HA 3UJMA 1O7WB 2YX9A 1UDII 3D5IA 4XDVA 3D9RA 1Y4KA 2B1XB 3CPOA 3F14A 2KF4A 3H51A 3X40A 3FGYA 2XFSA 3JUOA 1FUWA 2HMNB 1J2BA 3DH2A 5DRVA 2JQ5A 1L5GB 3PS8A 2RSXA 5AIFA 2B24B 1BOXA 2XRXB 4ZM8A 2E2TA 1RRLA 1Z1SA 3DY5A 3K9MC 4HYZA 1BRSA 4IT7A 2F99A 3FKAA 1KWIA 1JZDA 1RCLA 1QVG2 3AGOA 1GSPA 3OX9A 5BXQA 3CCS3 1SPUA 4WWUC 1BUJA 5M19A 1N8R4 1NWWA 2HMJB 1QAKA 1RGAA 3DGNA 1O7GB 2W03A 3G4S3 1IQ8A 1G96A 1U8CB 1JN5A 2YFJB 4O8SA 3SX1A 4EXRA 5CF1A 4OVMA 4N6MA 1SJWA 1ZO2A 4H3UA 5AIHA 2CG0A 4WYKA 3HI7A 5EVHA 2D42A 4R80A 5JPPA 2P09A 4I4KA 4N6NB 1OHSA 2CIUA 2W56B 9RNTA 2H0IA 3DGOA 1FYSA 5DREA 1HYFA 5D83A 1BSEA 1N5HA 3NBRA 4HM3B 4N6UA 5ELJA 4HOHA 2STDA 3V92A 1VQK3 3G0KA 3FCSB 1CYUA 1MNLA 5BIRA 1F8NA 1BRKA 1STFI 3HX8A 1JJ22 3CCQ3 3FF2A 2W6JH 4NREA 1B2MA 3PXMA 4CPKA 1I70A 2CKFB 5AI1A 3CC73 2RCDA 2Z7AA 3S28A 1IV7A 4N3VA 3WA2X 3F9SA 2GU3A 3AHWA 5M18A 1W00A 5AYSC 1K8A4 3GSPA 1O7NB 2UGIA 1OCVA 2XF3A 1DVCA 2W2CA 1VQQA 5CK6A 2P0MA 1EA2A 2ML6A 5HOHA 3OW22 1ISKA 3UB1A 1LOYA 3RGRA 1GOVA 1UCKA 1E3RA 1ZX2A 4L8OA 3DZLA 1JB5A 3EB8A 3ZFZA 3B4PA 1MWTA 1CH0A 1UI7A 3MYTA 2PNCA 3S5CA 2FGTA 1UUWB 3ECFA 1BNSA 3B7CA 4STDA 2QA43 2ZL8A 3KN4A 1G0TA 4KZ1A 1BANA 2IMJA 3LT9A 3UNLA 4J9AA 7STDA 2F86B 4EV5A 2C11A 3NV0B 1FGRA 3ROBA 3NUVA 3CCU3 5AEWB 1W02A 3SVAA 1N5PA 1W2B2 3VGNA 2R41A 3A5EA 4KFFA 5IG0A 5LC6A 1EUIC 1BNGA 1LNIA 1MGRA 1BNEA 4I5QA 1W4NA 3HOHA 5EEOA 4OK0A 1AVKA 1GYBA 2OWPA 2KXGA 3A76A 3D4AA 1VZZA 1IQXA 2F98A 4OUQA 1JKGB 3ALAA 2INXA 1V57A 2LYXA 3DXOA 1IYYA 3V99A 2HMKB 5AIGA 1TRQA 3KIIA 4HM5B 5JPUA 3PCSA 4EYCA 3KKGA 1AQZA 4JRFA 4DKIA 1BAOA 1TU5A 2BO9B 1FW7A 1JZOA 3NXJA 1V74A 3F40A 3SOAA 5IF6A 3WOFB 3WR2A 4RNTA 1OGZA 3D5GA 3JUQA 4HAAA 4HM1B 1VQL3 5AEUB 1QAFA 1YJN3 1LQGC 1RGLA 3BU4A 1S5AA 1UUGB 2CHCA 2CX1A 1K28A 3MSOA 3NQYA 1I2FA 1JV2B 1SIIA 3LYGA 2IUJA 1RN4A 1SQWA 1STDA 1RNBA 1W6CA 3NV0A 1ASKA 4WHAA 1OHPA 4HZ9B 4LSOA 1GD3A 4JF8A 3T8UA 2ZA4A 4RZMA 2RGQA 1G02A 2KF3A 4LZIA 1RJOA 1N9EA 3EX9A 3X3YA 3MKIA 5RNTA 1IQYA 2IA7A 3SXXA 1I0VA 1BUQA 4WFOA 3NQZA 3DGLA 1YIT3 1MWRA 1IT7A 1TUHA 3DM8A 1Q9EA 1V58A 2Y73A 1FGOA 1VQO3 3GZYB 2OTL3 2QIYA 1DVDA 3LTDA 1JN5B 3KSPA 2WGQA 3EN1B 3LOYA 1UUVB 1EKMA 6RNTA 5KP3A 3K5TA 4L8PA 1O7PB 1RKYA 1BRHA 1CYVA 2SBLA 3H3HA 1DETA 5IG3A 1B27A 1LRAA 1R4YA 2O9UX 3PZWA 1TFKA 4BU4A 5AIIA 1JBSA 2K54A 5D81A 1C7HA 3X41A 1QJGA 3CME3 5G2GA 2BMRB 2XEPA 1IT8A 3NBBA 5IEOA 2W04A 1IVWA 1NB5I 1BSCA 1RGGA 1RN1A 3ER7A 4N6V0 3CCV3 1RCKA 3GRDA 1KSIA 5AYRB 2QEX3 4LYLB 1NNVA 2GSPA 3U1WA 2C4BA 1UI8A 1K41A 1FGMA 1NU3A 1WMPA 3FG3A 1FUTA 1DE3A 1Q40B 3CPW2 1RNTA 4FCJA 4HM6B 1W2ZA 2LQVA 1BNRA 1W6GA 3MHEA 4ORLA 5M1AA 1QMAA 4XBYA 4BL3A 1YHQ3 1DMMA 1WQLB 1O7MB 4RNZA 1OF5B 2A15A 3CNMA 1W7CA 2GEYA 2HMLB 1DMQA 1ULJB 2CWUA 5EQLA 3CNXA 1BRJA 3EJVA 3CCL3 4FR9A 1K9M4 3F7XA 3JVCA 1T5YA 4HM4B 1VQ63 3AMOB 2W0QA 4WP5A 3HIGA 1N9JA 4HM8B 3WA3A 1YVBI 5IEPA 4FMCA 1EG9B 4HKVB 3IJEB 4BTYA 1MGWA 1DMNA 1X1UA 1Q42A 3K63A 1MOLA 4O02B 1ZGXA 1M9GA 1IDPA 1UW1A 1S723 1R4CA 3D79A 4HZBB 1OHOA 1B21A 1FUSA 1OH0A 3I563 2BNGA 2I9WA 3ZG0A 1NDOB 2AAEA 3QRDA 2V1LA 2XSHB 1PYLA 1I2GA 1KC84 3KSED 2L1SA 1AVLA 1PFPA 2ZDJA 2BHMA 1VQP3 3RNTA 1PU4A 1RHLA 3SEDA 1BNIA 3WHOA 3GAXA 2GEXA 3OV4A 2P0XA 1X1WA 3T0UA 1D6UA 2CG1A 5I97A 7GSPA 1JKGA 5IW9A 3BIRA 1O7HB 1ROAA 3ZG5A 4XB5A 4HM0B 3FG4A 1OF5A 4LGQA 4J8TA 1NJI4 2WOHA 5D82A 4HJLB 5GSPA 1EEJA 1W01A 2CFGA 2CFDA 2Q07A 1BRNL 2L4VA 5IERA 3CMA3 1RLSA 1YJW3 3BNCA 2MF7A 1C54A 4XM4A 1LNHA 1U5OA 2BU4A 2BT3A 3KFQC 1LOVA 2OOVA 7RNTA 1JRQA 1D6YA 1TIJA 1US1A 3E99A 3MG3A 4R9KA 1GY5A 1EQKA 2CC3A 2P38A 1FA3A 1TFOA 2CFKA 3NX0A 5IG5A 3KCHA 1GS3A 3EC9A 3DGYA 3WODG 4EV2A 1RDSA 4IIAA 1UGIA 3CCM3 3F8HA 4QWTA 3FLJA 3LTCA 1T3BA 4HBRA 2GBWB 3N8BA 1W6YA 1IVXA 3EN8A 3FH1A 1YGEA 2M7OA 2PZVA 3G8ZA 2GU1A 3CCJ3 3N54B 1W5ZA 4R1KA 3S27A 1E3VA 1QALA 3Q90A 1BRGA 4L7KA 4AKZA 1GOYA 3CXC2 3LZAA 1HKXA 2BIRA 3J7Yd 6GSPA 2O3OA 3Q3FA 1JBRA 1B2SA 2XSOB 1OGXA 1UCJA 5LC7A 3LTBA 2IUKA 5IG4A 3G713 1RTUA 1MWSA 4HVNA 1HU9A 2QGUA 2Y74A 3GWRA 1FGQA 1YGWA 1LOXA 3EBTA 1WMNA 3GZXB 4N6OB 4X2HA 3CC43 1D6ZA 5FGOA 8RNTA 4K61A 3SLUA 1BSBA 1FZUA 1ULIB 1OUNA 2GBXB 1IK3A 3N9HA 5KP4A 4GB5A 4CDLA 3X3XA 2OTJ3 3Q1CA 4ILFA 1CQSA 1GY7A 1LVNA 3X42A 1IVUA 1RGFA 1YVSA 2W9PA 3L0RA 2F56A 1I3FA 1VQ83 4MMXB 4KFEA 1CEWI 2OOVC 2F5WA 5G1KA 4X2OA 1M1K4 3HIIA 4CCVA 1K734 5IENA 2Z77A 1TRPA 1YJ93 2K0MA 3EQQB 1AV4A 3LTAA 3S67A 1B20A 1A2VA 4K1VA 2HMOB 1BSAA 3BNEA 3FZWA 3T8NA 1RGKA 1TJDA 2GXFA 2H0HA 1B2XA 2P05A 3LMLA 1MWUA 5BVBA 1UCLA 4G1MB 3Q2PA 3EBYA 1IV9A 1FGTA 3LH4A 3X3ZA 3OWSA 3JUNA 4U13A 1GMPA 3B4OA 2CH9A 2BMOB 4HM7B 1VQ93 1DYUA 3MPHA 4TX4A 1VQM3 2OCTA 1I0XA 2F5MA 4WYKB 2KF5A 1GOUA 2RBIA 3V98A 1KQS2 2WOFA 4RNYA 2CW9A 2J8XB 2W56A 1WMOA 5BU4A 2WO0A 3NM2A 3FF0A 2XH9A 3K7CA 2YFLB 3O8YA 4FCZA 4KFDA 1Q864 2IYJA 3WDGB 6STDA 1ZS7A 4BIRA 2RNTA 1Q824 4N6LA 1NO3A 4LMIA 1B3SA 2UX0A 4EW5A 1JNQA 3URPA 3MG2A 4AKYA 1RSNA 4GL6A 4NHFA 4MJDA 4J5KA 2C10A 1JB4A 2K3DA 1WNHA 3FSDA 4XBTA 2E2UA 3CCR3 4MMYB 4IPBA 4O3VA 3OWYA 4FCMA 1RGEA 1BSDA 2OQEA 3S29A 3U97A 4GSPA 3TDGA 4LEHA 1OACA 1A67A 1I2EA 2CX0A 1N8QA 3SYUA 3PCRA 3GZRA 3G16A 1PY3A 3UL5A 5KP1A 1RMSA 4AEQA 1VQN3 3HK4A 1T2IA 1TTOA 1JBTA 4XDWA 2BMQB 4HM2B 3I0YA 3DGMA 3STDA 1JB2A 1BVIA 2F4YA 1GD4A 2KF6A 2XGLA 3F8XA 3EE1A 5FW5A 3WMDA 3CU3A 1A2KA 5A0OB 4R9LA 2CWVA 1BRIA 3RGAA
chains in the Genus database with same CATH topology
2UUGC 1UGHI 1UUGB 2J8XB 1UGIA 1LQMB 2UGIA 2ZHXB 1UDII 4LYLB 1EUIC 1LQGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUG C;  1UGH I;  1UUG B;  2J8X B;  1UGI A;  1LQM B;  2UGI A;  2ZHX B;  1UDI I;  4LYL B;  1EUI C;  1LQG C; 
#chains in the Genus database with same CATH topology
 1BNJ A;  2W9Q A;  3NBJ A;  5CF2 A;  1YIJ 3;  1VQ4 3;  2KAA A;  2Z76 A;  4K1U A;  5STD A;  4H61 A;  4BL2 A;  1YNV X;  4MMZ B;  1YI2 3;  1AY7 A;  1IU7 A;  2CFW A;  5TGN A;  1RRH A;  1UGH I;  1HZ1 A;  2RFR A;  2OQE C;  2IY2 A;  3B8L A;  3BLZ A;  3DUK A;  4KVH A;  3AHS A;  3RDE A;  3CD6 3;  4EBG A;  2YFI B;  2HMM B;  2HOH A;  1E97 A;  1RGC A;  3IMA B;  3PYJ A;  2AAD A;  4EC6 A;  1AR0 A;  1WTH A;  3IPT A;  1Q40 A;  1M1X B;  1GMR A;  3M8C A;  3FG1 A;  2CWT A;  3LXU X;  5ELU A;  3UL6 A;  2R4I A;  1BGS A;  2Z6B A;  4XBX A;  1SAR A;  1A90 A;  3D3L A;  3EF8 A;  4J5G A;  1RN7 A;  3DMC A;  4RBN A;  4NPB A;  2E2V A;  4K90 B;  1IVV A;  4N6T A;  3SOY A;  1A2P A;  1UCI A;  2CFL A;  2XGN A;  1LQM B;  5G1L A;  4CJN A;  2ZHX B;  4FMA A;  2KRT A;  4R4K A;  2KCD A;  1ROV A;  1VQ7 3;  2FNQ A;  5CXO A;  1I8V A;  2UUG C;  3OXA A;  5CLK A;  1LXE A;  4FMB A;  1QVF 2;  1OPY A;  4KT3 B;  4FMD A;  2CK3 H;  3JUP A;  1LOW A;  3BB9 A;  3JUM A;  3I55 3;  1X1X A;  4PEJ A;  1I3I A;  2H0G A;  3MG1 A;  4BTX A;  2MC8 A;  3KE7 A;  3OWU A;  3G6E 3;  3CCE 3;  1M90 4;  3BND A;  1B2U A;  3LT8 A;  3NM7 A;  3NHX A;  3HZP A;  3GZB A;  1T2H A;  3MWZ A;  3F7S A;  4MEI A;  3QK9 A;  5HGR A;  2FXT A;  5JBS A;  1TP6 A;  3BNB A;  1SIH A;  2WGO A;  4Q53 A;  1NB3 I;  1BU4 A;  2XR8 B;  1BNF A;  1BIR A;  1B2Z A;  1GY6 A;  2SAR A;  3KZT A;  3VF1 A;  3VSY A;  3CC2 3;  1Q7Y 4;  1RGH A;  3WOE B;  4GHO A;  3K0Z A;  1X1Y A;  3AGN A;  3PGB A;  1Q7H A;  2JDI H;  2XFT A;  8CHO A;  3AMO A;  1GMQ A;  1Q81 4;  1KD1 4;  2ML5 A;  4BTW A;  3EHC A;  1VQ5 3;  2D1W A;  4O2H A;  3UJM A;  1O7W B;  2YX9 A;  1UDI I;  3D5I A;  4XDV A;  3D9R A;  1Y4K A;  2B1X B;  3CPO A;  3F14 A;  2KF4 A;  3H51 A;  3X40 A;  3FGY A;  2XFS A;  3JUO A;  1FUW A;  2HMN B;  1J2B A;  3DH2 A;  5DRV A;  2JQ5 A;  1L5G B;  3PS8 A;  2RSX A;  5AIF A;  2B24 B;  1BOX A;  2XRX B;  4ZM8 A;  2E2T A;  1RRL A;  1Z1S A;  3DY5 A;  3K9M C;  4HYZ A;  1BRS A;  4IT7 A;  2F99 A;  3FKA A;  1KWI A;  1JZD A;  1RCL A;  1QVG 2;  3AGO A;  1GSP A;  3OX9 A;  5BXQ A;  3CCS 3;  1SPU A;  4WWU C;  1BUJ A;  5M19 A;  1N8R 4;  1NWW A;  2HMJ B;  1QAK A;  1RGA A;  3DGN A;  1O7G B;  2W03 A;  3G4S 3;  1IQ8 A;  1G96 A;  1U8C B;  1JN5 A;  2YFJ B;  4O8S A;  3SX1 A;  4EXR A;  5CF1 A;  4OVM A;  4N6M A;  1SJW A;  1ZO2 A;  4H3U A;  5AIH A;  2CG0 A;  4WYK A;  3HI7 A;  5EVH A;  2D42 A;  4R80 A;  5JPP A;  2P09 A;  4I4K A;  4N6N B;  1OHS A;  2CIU A;  2W56 B;  9RNT A;  2H0I A;  3DGO A;  1FYS A;  5DRE A;  1HYF A;  5D83 A;  1BSE A;  1N5H A;  3NBR A;  4HM3 B;  4N6U A;  5ELJ A;  4HOH A;  2STD A;  3V92 A;  1VQK 3;  3G0K A;  3FCS B;  1CYU A;  1MNL A;  5BIR A;  1F8N A;  1BRK A;  1STF I;  3HX8 A;  1JJ2 2;  3CCQ 3;  3FF2 A;  2W6J H;  4NRE A;  1B2M A;  3PXM A;  4CPK A;  1I70 A;  2CKF B;  5AI1 A;  3CC7 3;  2RCD A;  2Z7A A;  3S28 A;  1IV7 A;  4N3V A;  3WA2 X;  3F9S A;  2GU3 A;  3AHW A;  5M18 A;  1W00 A;  5AYS C;  1K8A 4;  3GSP A;  1O7N B;  2UGI A;  1OCV A;  2XF3 A;  1DVC A;  2W2C A;  1VQQ A;  5CK6 A;  2P0M A;  1EA2 A;  2ML6 A;  5HOH A;  3OW2 2;  1ISK A;  3UB1 A;  1LOY A;  3RGR A;  1GOV A;  1UCK A;  1E3R A;  1ZX2 A;  4L8O A;  3DZL A;  1JB5 A;  3EB8 A;  3ZFZ A;  3B4P A;  1MWT A;  1CH0 A;  1UI7 A;  3MYT A;  2PNC A;  3S5C A;  2FGT A;  1UUW B;  3ECF A;  1BNS A;  3B7C A;  4STD A;  2QA4 3;  2ZL8 A;  3KN4 A;  1G0T A;  4KZ1 A;  1BAN A;  2IMJ A;  3LT9 A;  3UNL A;  4J9A A;  7STD A;  2F86 B;  4EV5 A;  2C11 A;  3NV0 B;  1FGR A;  3ROB A;  3NUV A;  3CCU 3;  5AEW B;  1W02 A;  3SVA A;  1N5P A;  1W2B 2;  3VGN A;  2R41 A;  3A5E A;  4KFF A;  5IG0 A;  5LC6 A;  1EUI C;  1BNG A;  1LNI A;  1MGR A;  1BNE A;  4I5Q A;  1W4N A;  3HOH A;  5EEO A;  4OK0 A;  1AVK A;  1GYB A;  2OWP A;  2KXG A;  3A76 A;  3D4A A;  1VZZ A;  1IQX A;  2F98 A;  4OUQ A;  1JKG B;  3ALA A;  2INX A;  1V57 A;  2LYX A;  3DXO A;  1IYY A;  3V99 A;  2HMK B;  5AIG A;  1TRQ A;  3KII A;  4HM5 B;  5JPU A;  3PCS A;  4EYC A;  3KKG A;  1AQZ A;  4JRF A;  4DKI A;  1BAO A;  1TU5 A;  2BO9 B;  1FW7 A;  1JZO A;  3NXJ A;  1V74 A;  3F40 A;  3SOA A;  5IF6 A;  3WOF B;  3WR2 A;  4RNT A;  1OGZ A;  3D5G A;  3JUQ A;  4HAA A;  4HM1 B;  1VQL 3;  5AEU B;  1QAF A;  1YJN 3;  1LQG C;  1RGL A;  3BU4 A;  1S5A A;  1UUG B;  2CHC A;  2CX1 A;  1K28 A;  3MSO A;  3NQY A;  1I2F A;  1JV2 B;  1SII A;  3LYG A;  2IUJ A;  1RN4 A;  1SQW A;  1STD A;  1RNB A;  1W6C A;  3NV0 A;  1ASK A;  4WHA A;  1OHP A;  4HZ9 B;  4LSO A;  1GD3 A;  4JF8 A;  3T8U A;  2ZA4 A;  4RZM A;  2RGQ A;  1G02 A;  2KF3 A;  4LZI A;  1RJO A;  1N9E A;  3EX9 A;  3X3Y A;  3MKI A;  5RNT A;  1IQY A;  2IA7 A;  3SXX A;  1I0V A;  1BUQ A;  4WFO A;  3NQZ A;  3DGL A;  1YIT 3;  1MWR A;  1IT7 A;  1TUH A;  3DM8 A;  1Q9E A;  1V58 A;  2Y73 A;  1FGO A;  1VQO 3;  3GZY B;  2OTL 3;  2QIY A;  1DVD A;  3LTD A;  1JN5 B;  3KSP A;  2WGQ A;  3EN1 B;  3LOY A;  1UUV B;  1EKM A;  6RNT A;  5KP3 A;  3K5T A;  4L8P A;  1O7P B;  1RKY A;  1BRH A;  1CYV A;  2SBL A;  3H3H A;  1DET A;  5IG3 A;  1B27 A;  1LRA A;  1R4Y A;  2O9U X;  3PZW A;  1TFK A;  4BU4 A;  5AII A;  1JBS A;  2K54 A;  5D81 A;  1C7H A;  3X41 A;  1QJG A;  3CME 3;  5G2G A;  2BMR B;  2XEP A;  1IT8 A;  3NBB A;  5IEO A;  2W04 A;  1IVW A;  1NB5 I;  1BSC A;  1RGG A;  1RN1 A;  3ER7 A;  4N6V 0;  3CCV 3;  1RCK A;  3GRD A;  1KSI A;  5AYR B;  2QEX 3;  4LYL B;  1NNV A;  2GSP A;  3U1W A;  2C4B A;  1UI8 A;  1K41 A;  1FGM A;  1NU3 A;  1WMP A;  3FG3 A;  1FUT A;  1DE3 A;  1Q40 B;  3CPW 2;  1RNT A;  4FCJ A;  4HM6 B;  1W2Z A;  2LQV A;  1BNR A;  1W6G A;  3MHE A;  4ORL A;  5M1A A;  1QMA A;  4XBY A;  4BL3 A;  1YHQ 3;  1DMM A;  1WQL B;  1O7M B;  4RNZ A;  1OF5 B;  2A15 A;  3CNM A;  1W7C A;  2GEY A;  2HML B;  1DMQ A;  1ULJ B;  2CWU A;  5EQL A;  3CNX A;  1BRJ A;  3EJV A;  3CCL 3;  4FR9 A;  1K9M 4;  3F7X A;  3JVC A;  1T5Y A;  4HM4 B;  1VQ6 3;  3AMO B;  2W0Q A;  4WP5 A;  3HIG A;  1N9J A;  4HM8 B;  3WA3 A;  1YVB I;  5IEP A;  4FMC A;  1EG9 B;  4HKV B;  3IJE B;  4BTY A;  1MGW A;  1DMN A;  1X1U A;  1Q42 A;  3K63 A;  1MOL A;  4O02 B;  1ZGX A;  1M9G A;  1IDP A;  1UW1 A;  1S72 3;  1R4C A;  3D79 A;  4HZB B;  1OHO A;  1B21 A;  1FUS A;  1OH0 A;  3I56 3;  2BNG A;  2I9W A;  3ZG0 A;  1NDO B;  2AAE A;  3QRD A;  2V1L A;  2XSH B;  1PYL A;  1I2G A;  1KC8 4;  3KSE D;  2L1S A;  1AVL A;  1PFP A;  2ZDJ A;  2BHM A;  1VQP 3;  3RNT A;  1PU4 A;  1RHL A;  3SED A;  1BNI A;  3WHO A;  3GAX A;  2GEX A;  3OV4 A;  2P0X A;  1X1W A;  3T0U A;  1D6U A;  2CG1 A;  5I97 A;  7GSP A;  1JKG A;  5IW9 A;  3BIR A;  1O7H B;  1ROA A;  3ZG5 A;  4XB5 A;  4HM0 B;  3FG4 A;  1OF5 A;  4LGQ A;  4J8T A;  1NJI 4;  2WOH A;  5D82 A;  4HJL B;  5GSP A;  1EEJ A;  1W01 A;  2CFG A;  2CFD A;  2Q07 A;  1BRN L;  2L4V A;  5IER A;  3CMA 3;  1RLS A;  1YJW 3;  3BNC A;  2MF7 A;  1C54 A;  4XM4 A;  1LNH A;  1U5O A;  2BU4 A;  2BT3 A;  3KFQ C;  1LOV A;  2OOV A;  7RNT A;  1JRQ A;  1D6Y A;  1TIJ A;  1US1 A;  3E99 A;  3MG3 A;  4R9K A;  1GY5 A;  1EQK A;  2CC3 A;  2P38 A;  1FA3 A;  1TFO A;  2CFK A;  3NX0 A;  5IG5 A;  3KCH A;  1GS3 A;  3EC9 A;  3DGY A;  3WOD G;  4EV2 A;  1RDS A;  4IIA A;  1UGI A;  3CCM 3;  3F8H A;  4QWT A;  3FLJ A;  3LTC A;  1T3B A;  4HBR A;  2GBW B;  3N8B A;  1W6Y A;  1IVX A;  3EN8 A;  3FH1 A;  1YGE A;  2M7O A;  2PZV A;  3G8Z A;  2GU1 A;  3CCJ 3;  3N54 B;  1W5Z A;  4R1K A;  3S27 A;  1E3V A;  1QAL A;  3Q90 A;  1BRG A;  4L7K A;  4AKZ A;  1GOY A;  3CXC 2;  3LZA A;  1HKX A;  2BIR A;  3J7Y d;  6GSP A;  2O3O A;  3Q3F A;  1JBR A;  1B2S A;  2XSO B;  1OGX A;  1UCJ A;  5LC7 A;  3LTB A;  2IUK A;  5IG4 A;  3G71 3;  1RTU A;  1MWS A;  4HVN A;  1HU9 A;  2QGU A;  2Y74 A;  3GWR A;  1FGQ A;  1YGW A;  1LOX A;  3EBT A;  1WMN A;  3GZX B;  4N6O B;  4X2H A;  3CC4 3;  1D6Z A;  5FGO A;  8RNT A;  4K61 A;  3SLU A;  1BSB A;  1FZU A;  1ULI B;  1OUN A;  2GBX B;  1IK3 A;  3N9H A;  5KP4 A;  4GB5 A;  4CDL A;  3X3X A;  2OTJ 3;  3Q1C A;  4ILF A;  1CQS A;  1GY7 A;  1LVN A;  3X42 A;  1IVU A;  1RGF A;  1YVS A;  2W9P A;  3L0R A;  2F56 A;  1I3F A;  1VQ8 3;  4MMX B;  4KFE A;  1CEW I;  2OOV C;  2F5W A;  5G1K A;  4X2O A;  1M1K 4;  3HII A;  4CCV A;  1K73 4;  5IEN A;  2Z77 A;  1TRP A;  1YJ9 3;  2K0M A;  3EQQ B;  1AV4 A;  3LTA A;  3S67 A;  1B20 A;  1A2V A;  4K1V A;  2HMO B;  1BSA A;  3BNE A;  3FZW A;  3T8N A;  1RGK A;  1TJD A;  2GXF A;  2H0H A;  1B2X A;  2P05 A;  3LML A;  1MWU A;  5BVB A;  1UCL A;  4G1M B;  3Q2P A;  3EBY A;  1IV9 A;  1FGT A;  3LH4 A;  3X3Z A;  3OWS A;  3JUN A;  4U13 A;  1GMP A;  3B4O A;  2CH9 A;  2BMO B;  4HM7 B;  1VQ9 3;  1DYU A;  3MPH A;  4TX4 A;  1VQM 3;  2OCT A;  1I0X A;  2F5M A;  4WYK B;  2KF5 A;  1GOU A;  2RBI A;  3V98 A;  1KQS 2;  2WOF A;  4RNY A;  2CW9 A;  2J8X B;  2W56 A;  1WMO A;  5BU4 A;  2WO0 A;  3NM2 A;  3FF0 A;  2XH9 A;  3K7C A;  2YFL B;  3O8Y A;  4FCZ A;  4KFD A;  1Q86 4;  2IYJ A;  3WDG B;  6STD A;  1ZS7 A;  4BIR A;  2RNT A;  1Q82 4;  4N6L A;  1NO3 A;  4LMI A;  1B3S A;  2UX0 A;  4EW5 A;  1JNQ A;  3URP A;  3MG2 A;  4AKY A;  1RSN A;  4GL6 A;  4NHF A;  4MJD A;  4J5K A;  2C10 A;  1JB4 A;  2K3D A;  1WNH A;  3FSD A;  4XBT A;  2E2U A;  3CCR 3;  4MMY B;  4IPB A;  4O3V A;  3OWY A;  4FCM A;  1RGE A;  1BSD A;  2OQE A;  3S29 A;  3U97 A;  4GSP A;  3TDG A;  4LEH A;  1OAC A;  1A67 A;  1I2E A;  2CX0 A;  1N8Q A;  3SYU A;  3PCR A;  3GZR A;  3G16 A;  1PY3 A;  3UL5 A;  5KP1 A;  1RMS A;  4AEQ A;  1VQN 3;  3HK4 A;  1T2I A;  1TTO A;  1JBT A;  4XDW A;  2BMQ B;  4HM2 B;  3I0Y A;  3DGM A;  3STD A;  1JB2 A;  1BVI A;  2F4Y A;  1GD4 A;  2KF6 A;  2XGL A;  3F8X A;  3EE1 A;  5FW5 A;  3WMD A;  3CU3 A;  1A2K A;  5A0O B;  4R9L A;  2CWV A;  1BRI A;  3RGA A; 
#chains in the Genus database with same CATH homology
 2UUG C;  1UGH I;  1UUG B;  2J8X B;  1UGI A;  1LQM B;  2UGI A;  2ZHX B;  1UDI I;  4LYL B;  1EUI C;  1LQG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...