2UUGC

Escherichia coli uracil-dna glycosylase:inhibitor complex with h187d mutant udg and wild-type ugi
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication, hydrolase
molecule keywords URACIL-DNA GLYCOSYLASE
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Escherichia coli k12
total genus 16
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2uugC00
1UDII 1UGHI 1UGIA 2UGIA 1EUIC 2ZHXB 4LYLB 1UUGB 2J8XB 1LQGC 1LQMB 2UUGC
chains in the Genus database with same CATH superfamily
3WODG 3PYJA 1RN1A 3F14A 1JN5B 3MKIA 2L1SA 2HMLB 3ER7A 1RGCA 3IMAB 1FYSA 3Q90A 4R9KA 4LSOA 2KCDA 1Q7HA 1UDII 1I2FA 1BRJA 1I3FA 1STFI 1UCIA 3D5IA 1UUVB 1RNTA 3FG4A 5KP4A 4WP5A 1M1K4 3V92A 2O3OA 2C4BA 1GD3A 1UCLA 3EN8A 1YGEA 3NM2A 2A15A 1TRQA 1JNQA 3NBRA 3OW22 1OACA 1V57A 5KP3A 9RNTA 2GEYA 3FCSB 3HI7A 2C11A 3LH4A 5IG0A 1YIT3 2W2CA 2CX1A 3GWRA 1B20A 1JB5A 1GY5A 1NNVA 2MF7A 3AMOB 1I70A 3BLZA 3KIIA 1YI23 1WQLB 1MGRA 2F5MA 1DYUA 2XFTA 3EJVA 1UW1A 4RNYA 1CQSA 3CNMA 2GBWB 4KZ1A 3VSYA 3HOHA 3PCRA 1UCKA 1DMNA 3EBTA 3G6E3 1GY6A 2R4IA 1YIJ3 2BT3A 4WYKB 4EC6A 1FGMA 2H0IA 1K9M4 2ML5A 1WTHA 1EUIC 4OK0A 2F99A 3FKAA 1I0VA 4R80A 3X3ZA 2SBLA 1W01A 4MMXB 3EN1B 1VZZA 3EBYA 2KRTA 3MG2A 4O2HA 5JPPA 1NB3I 1TU5A 4EV5A 1BSCA 1T3BA 1Q40B 1JB4A 1LQGC 5AIGA 4HM1B 3NBJA 4LYLB 2CG0A 1AVLA 1AQZA 2CW9A 3IPTA 5D81A 1A2KA 2RFRA 4FMCA 4WWUC 3PS8A 1LOYA 1ZO2A 1FUWA 4ZM8A 1D6YA 2HOHA 2C10A 1MOLA 2P0XA 1UGIA 3CC73 1MNLA 3S5CA 1A2VA 1RLSA 1KC84 5TGNA 3K63A 3CCM3 2K54A 1IK3A 2CIUA 5BIRA 1AY7A 2UGIA 2W6JH 4R4KA 4FMBA 3JUOA 2KF3A 1QVF2 2Z76A 1PY3A 5IW9A 3GSPA 2BMQB 2IMJA 3Q2PA 2IA7A 3WMDA 3F40A 1O7GB 1W6YA 4HM6B 4XBTA 1OCVA 2F4YA 1BNGA 6RNTA 1YJ93 1GOVA 1W2B2 3GZXB 4J8TA 3LTDA 2ZL8A 4Q53A 5CXOA 2ZDJA 2W0QA 4X2OA 1QAFA 1OUNA 4MMZB 3BB9A 4CDLA 1RNBA 1EKMA 4R9LA 4BTWA 3CCV3 5CF2A 3N9HA 2RCDA 3ROBA 4N3VA 4HM8B 5EQLA 2CX0A 3DXOA 2LYXA 3DY5A 4LEHA 4PEJA 3T8NA 4J9AA 3G8ZA 2OQEC 2ZHXB 1J2BA 2XFSA 3FLJA 2XRXB 5M19A 6STDA 3DGYA 1OGZA 4GL6A 3EE1A 1AVKA 4NPBA 1UUWB 3RDEA 1LVNA 1YHQ3 2QGUA 1JJ22 2GBXB 2GSPA 1YJW3 1SPUA 3KSED 1W7CA 4OUQA 1NJI4 1N5PA 1RJOA 1B2XA 1GY7A 1OHSA 1EEJA 2ML6A 1US1A 2OTL3 1N9EA 1ULJB 3DM8A 4O02B 3NQZA 3H51A 4HM0B 1DETA 2KF5A 1DMQA 5G1KA 1BNEA 1JBSA 1BNRA 4L8OA 1IQXA 1IT8A 1SIIA 1RRLA 1TIJA 1X1WA 1B2ZA 2AAEA 3CNXA 3WDGB 1OF5A 2BO9B 3B4PA 5I97A 3X41A 3MHEA 1HZ1A 3CCR3 2QA43 1K41A 4XBYA 2STDA 2WOHA 4MEIA 3NV0A 1BRHA 1N5HA 1MGWA 2D42A 4CJNA 1JKGB 3NUVA 3T0UA 1ZGXA 3G713 2KAAA 3DH2A 1BRSA 5BVBA 5BU4A 3DMCA 3TDGA 5IEPA 3RGAA 1B3SA 3FG3A 1WNHA 5G2GA 4L7KA 3I563 3ALAA 1WMNA 5CF1A 1RSNA 3X42A 4BTYA 1B2MA 5A0OB 1I2GA 1V58A 3BU4A 3PZWA 1W2ZA 2W56B 1K734 5AIFA 1YJN3 1D6ZA 1YVBI 3LXUX 1YNVX 1FZUA 3U1WA 1FGQA 3GZRA 2V1LA 1C54A 4I5QA 5LC7A 2Q07A 2SARA 4KFFA 3FF2A 3CU3A 4HM4B 2H0HA 2W04A 3CD63 1WMOA 2CG1A 4TX4A 6GSPA 1W6CA 2KF4A 1BANA 3KKGA 4O3VA 5AIHA 1DVDA 1PYLA 2MC8A 3DGLA 1JBTA 1W6GA 2XF3A 8RNTA 3LTCA 1Q814 1RGHA 4XDVA 1BNFA 2XSOB 5LC6A 1TJDA 3X3XA 2LQVA 1RN7A 1GYBA 4N6V0 3U97A 3MWZA 4N6LA 1E97A 3LT8A 5AI1A 1RTUA 4NREA 4WFOA 3UNLA 2RNTA 4EYCA 1BNSA 1UCJA 4IT7A 2F98A 1UI7A 3JUMA 5BXQA 1TP6A 1W5ZA 1LNHA 1JN5A 3D79A 1ISKA 1FGRA 2F86B 3HX8A 3LTAA 1SQWA 1VQ53 3CMA3 3OV4A 1CYVA 3WA3A 2XSHB 1T2IA 1GS3A 3SYUA 5IG3A 2FNQA 1VQ73 1Z1SA 2RGQA 1FUTA 3QK9A 3VGNA 1VQP3 4KVHA 3WOFB 1NO3A 5IERA 1EA2A 3JUNA 3M8CA 1W4NA 1AV4A 1O7HB 3HK4A 2B1XB 5HOHA 1Q7Y4 1QMAA 3CC23 1T2HA 1WMPA 4BL3A 5KP1A 2Y73A 3JUQA 1BSDA 1RGKA 3JUPA 2XGNA 1VQ83 1STDA 2YX9A 1RDSA 1ULIB 4HBRA 5EVHA 3NX0A 4AKYA 1T5YA 4HM2B 1FGTA 4LZIA 1VQO3 1QALA 3KSPA 4AEQA 4XB5A 2ZA4A 3AMOA 3URPA 4EXRA 3CCE3 1BRKA 2CWTA 3UL6A 2W9QA 1NDOB 1BOXA 4X2HA 3WHOA 1GD4A 2PZVA 1LXEA 5AEWB 1OHPA 3WR2A 3N54B 5CLKA 1V74A 3DUKA 2OOVA 4GB5A 4N6TA 4O8SA 3SLUA 4CPKA 7RNTA 5AEUB 3I553 3LMLA 1IV7A 3GZBA 5ELJA 1HU9A 3SOAA 1JBRA 3FSDA 3MG1A 4WYKA 4WHAA 1NWWA 2YFLB 1RGEA 4RNZA 2F56A 1O7NB 1OHOA 1GSPA 2FGTA 1R4YA 3MYTA 5D82A 3H3HA 3BNDA 1KSIA 1S5AA 2HMKB 1BRGA 3FGYA 1Q40A 4N6OB 1MWRA 1RN4A 2UUGC 2CWUA 3CCU3 1GMRA 1VQ63 4N6MA 1LNIA 1RGLA 2Z7AA 1O7MB 1Q42A 3HIGA 3BNCA 2INXA 7STDA 3WOEB 2H0GA 3CXC2 2W03A 1BNJA 2O9UX 1IU7A 2KF6A 4GHOA 3LZAA 1BUQA 1B2UA 4FCZA 3CCL3 3F8HA 1TRPA 2CFDA 1DMMA 1YGWA 3LYGA 2AADA 3OWSA 7GSPA 1SJWA 4HYZA 1ZS7A 4L8PA 3X40A 4BU4A 3Q3FA 3Q1CA 3A5EA 3CPOA 3I0YA 1VQL3 3DZLA 5JBSA 4RNTA 2IYJA 1I0XA 3GZYB 1E3VA 4XDWA 1IVUA 1BUJA 4HOHA 1E3RA 2E2VA 3DGOA 3FH1A 3KZTA 3V99A 4HM5B 5JPUA 2XR8B 1SIHA 4IIAA 1ROVA 1VQK3 2RBIA 3KCHA 3NXJA 2P09A 3NHXA 3HIIA 5IG4A 2CKFB 2XH9A 1MWSA 1IV9A 3EC9A 3RNTA 3IJEB 3K0ZA 2CFGA 3JVCA 4FMAA 3N8BA 3VF1A 4DKIA 1B2SA 1LOWA 1I2EA 2WGQA 2CC3A 4HM7B 1KD14 3CCS3 4FR9A 2BU4A 2CFWA 2W9PA 3KN4A 4HJLB 4XBXA 4H3UA 3G4S3 1B21A 2KXGA 3LTBA 4LMIA 1ASKA 5IEOA 1TFOA 1IQYA 3D4AA 1BU4A 3V98A 1EQKA 3E99A 3G16A 1NB5I 3B4OA 1JZDA 1VQM3 1IVWA 3CME3 1JB2A 1TUHA 2WGOA 3PGBA 3T8UA 3S29A 2OWPA 3S27A 3GRDA 1DE3A 2P05A 1Q824 2GEXA 1IQ8A 3EQQB 3OXAA 3UJMA 4BL2A 3BNBA 4EBGA 2K0MA 4HVNA 3MPHA 3AHSA 5ELUA 3SXXA 1ROAA 1O7PB 1S723 2BMRB 3EF8A 1KQS2 4QWTA 4EW5A 1D6UA 1LRAA 3CC43 3X3YA 4JRFA 5EEOA 3D9RA 4HM3B 1SARA 2D1WA 1LOXA 2F5WA 4K1VA 1N9JA 1ZX2A 2CHCA 1G96A 2E2UA 3D3LA 4JF8A 1JKGA 1IVVA 3DGMA 4BTXA 1K8A4 2K3DA 2FXTA 2XGLA 2BHMA 2UX0A 3ECFA 5GSPA 2M7OA 1UI8A 4N6NB 1RMSA 4KFDA 1C7HA 4EV2A 2CWVA 3F7XA 3EB8A 4I4KA 1RCKA 3O8YA 3BIRA 1G02A 2HMOB 1I3IA 1MWUA 5G1LA 1BRIA 3OX9A 1RGGA 3F9SA 3NQYA 4OVMA 4U13A 2CFLA 4K61A 2IUJA 1DVCA 2W56A 1HYFA 1X1UA 4FMDA 3FZWA 1BRNL 1OGXA 3F7SA 3RGRA 1Q864 1OPYA 2GXFA 1BSBA 3F8XA 3FG1A 2WO0A 2HMMB 3LOYA 1UGHI 4MMYB 1HKXA 1NU3A 4J5GA 2Z77A 5M18A 5FW5A 3WA2X 4J5KA 1R4CA 3K9MC 1N8R4 3K5TA 1O7WB 3GAXA 5RNTA 3CPW2 1VQN3 1IT7A 5FGOA 3B7CA 1JV2B 2BMOB 4N6UA 4CCVA 1LOVA 1JRQA 5D83A 3FF0A 1BSAA 2PNCA 1Y4KA 1M1XB 3BNEA 5STDA 1TFKA 3OWUA 1X1YA 3OWYA 1RGAA 1L5GB 2BIRA 5DRVA 3MG3A 5AYSC 4G1MB 2R41A 3AGNA 1A2PA 2B24B 2OQEA 3ZG0A 3HZPA 1TTOA 1RGFA 1A67A 2CFKA 1QJGA 3NM7A 2E2TA 3PCSA 3SEDA 1JZOA 2RSXA 5IG5A 1CH0A 2WOFA 3CCJ3 2CH9A 5DREA 1W00A 3AHWA 1OF5B 5IENA 4MJDA 3MSOA 2JDIH 2JQ5A 2GU1A 4GSPA 1QAKA 1RHLA 1B27A 2L4VA 1BIRA 2P38A 1RRHA 1FA3A 1IDPA 2OOVC 2P0MA 5M1AA 3NV0B 1BAOA 4K1UA 5HGRA 1BVIA 1GOYA 4HAAA 1G0TA 1PU4A 1CEWI 1FGOA 3KE7A 5AIIA 1GMQA 4ILFA 2HMNB 1QVG2 2OTJ3 4HZBB 3SX1A 1BNIA 4STDA 4K90B 1GOUA 5AYRB 2GU3A 1W02A 1U5OA 2IUKA 8CHOA 1I8VA 4HZ9B 5CK6A 1X1XA 4NHFA 4RZMA 3SOYA 2YFIB 3EX9A 2QEX3 3KFQC 1RKYA 1M904 1A90A 1EG9B 1UUGB 3AGOA 3DGNA 1LQMB 1M9GA 3EHCA 4KT3B 4AKZA 3G0KA 1VQ93 3UL5A 2IY2A 1MWTA 3A76A 4HKVB 1GMPA 1OH0A 3STDA 3LT9A 4XM4A 1KWIA 4FCJA 4FCMA 1BSEA 2HMJB 2OCTA 4LGQA 3B8LA 1IVXA 1Q9EA 5IF6A 3UB1A 3J7Yd 3S28A 1RCLA 1AR0A 3S67A 2YFJB 1CYUA 1BGSA 2J8XB 1VQQA 1K28A 4R1KA 3SVAA 1IYYA 3CCQ3 2CK3H 1U8CB 3ZG5A 2I9WA 3PXMA 1YVSA 2BNGA 1N8QA 2QIYA 3NBBA 1VQ43 4BIRA 1FW7A 3K7CA 4ORLA 3L0RA 1PFPA 4RBNA 4H61A 3QRDA 2Z6BA 4KFEA 4IPBA 1FUSA 3D5GA 1F8NA 3ZFZA 2XEPA 2Y74A
chains in the Genus database with same CATH topology
1UDII 1UGHI 1UGIA 2UGIA 1EUIC 2ZHXB 4LYLB 1UUGB 2J8XB 1LQGC 1LQMB 2UUGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDI I;  1UGH I;  1UGI A;  2UGI A;  1EUI C;  2ZHX B;  4LYL B;  1UUG B;  2J8X B;  1LQG C;  1LQM B;  2UUG C; 
#chains in the Genus database with same CATH topology
 3WOD G;  3PYJ A;  1RN1 A;  3F14 A;  1JN5 B;  3MKI A;  2L1S A;  2HML B;  3ER7 A;  1RGC A;  3IMA B;  1FYS A;  3Q90 A;  4R9K A;  4LSO A;  2KCD A;  1Q7H A;  1UDI I;  1I2F A;  1BRJ A;  1I3F A;  1STF I;  1UCI A;  3D5I A;  1UUV B;  1RNT A;  3FG4 A;  5KP4 A;  4WP5 A;  1M1K 4;  3V92 A;  2O3O A;  2C4B A;  1GD3 A;  1UCL A;  3EN8 A;  1YGE A;  3NM2 A;  2A15 A;  1TRQ A;  1JNQ A;  3NBR A;  3OW2 2;  1OAC A;  1V57 A;  5KP3 A;  9RNT A;  2GEY A;  3FCS B;  3HI7 A;  2C11 A;  3LH4 A;  5IG0 A;  1YIT 3;  2W2C A;  2CX1 A;  3GWR A;  1B20 A;  1JB5 A;  1GY5 A;  1NNV A;  2MF7 A;  3AMO B;  1I70 A;  3BLZ A;  3KII A;  1YI2 3;  1WQL B;  1MGR A;  2F5M A;  1DYU A;  2XFT A;  3EJV A;  1UW1 A;  4RNY A;  1CQS A;  3CNM A;  2GBW B;  4KZ1 A;  3VSY A;  3HOH A;  3PCR A;  1UCK A;  1DMN A;  3EBT A;  3G6E 3;  1GY6 A;  2R4I A;  1YIJ 3;  2BT3 A;  4WYK B;  4EC6 A;  1FGM A;  2H0I A;  1K9M 4;  2ML5 A;  1WTH A;  1EUI C;  4OK0 A;  2F99 A;  3FKA A;  1I0V A;  4R80 A;  3X3Z A;  2SBL A;  1W01 A;  4MMX B;  3EN1 B;  1VZZ A;  3EBY A;  2KRT A;  3MG2 A;  4O2H A;  5JPP A;  1NB3 I;  1TU5 A;  4EV5 A;  1BSC A;  1T3B A;  1Q40 B;  1JB4 A;  1LQG C;  5AIG A;  4HM1 B;  3NBJ A;  4LYL B;  2CG0 A;  1AVL A;  1AQZ A;  2CW9 A;  3IPT A;  5D81 A;  1A2K A;  2RFR A;  4FMC A;  4WWU C;  3PS8 A;  1LOY A;  1ZO2 A;  1FUW A;  4ZM8 A;  1D6Y A;  2HOH A;  2C10 A;  1MOL A;  2P0X A;  1UGI A;  3CC7 3;  1MNL A;  3S5C A;  1A2V A;  1RLS A;  1KC8 4;  5TGN A;  3K63 A;  3CCM 3;  2K54 A;  1IK3 A;  2CIU A;  5BIR A;  1AY7 A;  2UGI A;  2W6J H;  4R4K A;  4FMB A;  3JUO A;  2KF3 A;  1QVF 2;  2Z76 A;  1PY3 A;  5IW9 A;  3GSP A;  2BMQ B;  2IMJ A;  3Q2P A;  2IA7 A;  3WMD A;  3F40 A;  1O7G B;  1W6Y A;  4HM6 B;  4XBT A;  1OCV A;  2F4Y A;  1BNG A;  6RNT A;  1YJ9 3;  1GOV A;  1W2B 2;  3GZX B;  4J8T A;  3LTD A;  2ZL8 A;  4Q53 A;  5CXO A;  2ZDJ A;  2W0Q A;  4X2O A;  1QAF A;  1OUN A;  4MMZ B;  3BB9 A;  4CDL A;  1RNB A;  1EKM A;  4R9L A;  4BTW A;  3CCV 3;  5CF2 A;  3N9H A;  2RCD A;  3ROB A;  4N3V A;  4HM8 B;  5EQL A;  2CX0 A;  3DXO A;  2LYX A;  3DY5 A;  4LEH A;  4PEJ A;  3T8N A;  4J9A A;  3G8Z A;  2OQE C;  2ZHX B;  1J2B A;  2XFS A;  3FLJ A;  2XRX B;  5M19 A;  6STD A;  3DGY A;  1OGZ A;  4GL6 A;  3EE1 A;  1AVK A;  4NPB A;  1UUW B;  3RDE A;  1LVN A;  1YHQ 3;  2QGU A;  1JJ2 2;  2GBX B;  2GSP A;  1YJW 3;  1SPU A;  3KSE D;  1W7C A;  4OUQ A;  1NJI 4;  1N5P A;  1RJO A;  1B2X A;  1GY7 A;  1OHS A;  1EEJ A;  2ML6 A;  1US1 A;  2OTL 3;  1N9E A;  1ULJ B;  3DM8 A;  4O02 B;  3NQZ A;  3H51 A;  4HM0 B;  1DET A;  2KF5 A;  1DMQ A;  5G1K A;  1BNE A;  1JBS A;  1BNR A;  4L8O A;  1IQX A;  1IT8 A;  1SII A;  1RRL A;  1TIJ A;  1X1W A;  1B2Z A;  2AAE A;  3CNX A;  3WDG B;  1OF5 A;  2BO9 B;  3B4P A;  5I97 A;  3X41 A;  3MHE A;  1HZ1 A;  3CCR 3;  2QA4 3;  1K41 A;  4XBY A;  2STD A;  2WOH A;  4MEI A;  3NV0 A;  1BRH A;  1N5H A;  1MGW A;  2D42 A;  4CJN A;  1JKG B;  3NUV A;  3T0U A;  1ZGX A;  3G71 3;  2KAA A;  3DH2 A;  1BRS A;  5BVB A;  5BU4 A;  3DMC A;  3TDG A;  5IEP A;  3RGA A;  1B3S A;  3FG3 A;  1WNH A;  5G2G A;  4L7K A;  3I56 3;  3ALA A;  1WMN A;  5CF1 A;  1RSN A;  3X42 A;  4BTY A;  1B2M A;  5A0O B;  1I2G A;  1V58 A;  3BU4 A;  3PZW A;  1W2Z A;  2W56 B;  1K73 4;  5AIF A;  1YJN 3;  1D6Z A;  1YVB I;  3LXU X;  1YNV X;  1FZU A;  3U1W A;  1FGQ A;  3GZR A;  2V1L A;  1C54 A;  4I5Q A;  5LC7 A;  2Q07 A;  2SAR A;  4KFF A;  3FF2 A;  3CU3 A;  4HM4 B;  2H0H A;  2W04 A;  3CD6 3;  1WMO A;  2CG1 A;  4TX4 A;  6GSP A;  1W6C A;  2KF4 A;  1BAN A;  3KKG A;  4O3V A;  5AIH A;  1DVD A;  1PYL A;  2MC8 A;  3DGL A;  1JBT A;  1W6G A;  2XF3 A;  8RNT A;  3LTC A;  1Q81 4;  1RGH A;  4XDV A;  1BNF A;  2XSO B;  5LC6 A;  1TJD A;  3X3X A;  2LQV A;  1RN7 A;  1GYB A;  4N6V 0;  3U97 A;  3MWZ A;  4N6L A;  1E97 A;  3LT8 A;  5AI1 A;  1RTU A;  4NRE A;  4WFO A;  3UNL A;  2RNT A;  4EYC A;  1BNS A;  1UCJ A;  4IT7 A;  2F98 A;  1UI7 A;  3JUM A;  5BXQ A;  1TP6 A;  1W5Z A;  1LNH A;  1JN5 A;  3D79 A;  1ISK A;  1FGR A;  2F86 B;  3HX8 A;  3LTA A;  1SQW A;  1VQ5 3;  3CMA 3;  3OV4 A;  1CYV A;  3WA3 A;  2XSH B;  1T2I A;  1GS3 A;  3SYU A;  5IG3 A;  2FNQ A;  1VQ7 3;  1Z1S A;  2RGQ A;  1FUT A;  3QK9 A;  3VGN A;  1VQP 3;  4KVH A;  3WOF B;  1NO3 A;  5IER A;  1EA2 A;  3JUN A;  3M8C A;  1W4N A;  1AV4 A;  1O7H B;  3HK4 A;  2B1X B;  5HOH A;  1Q7Y 4;  1QMA A;  3CC2 3;  1T2H A;  1WMP A;  4BL3 A;  5KP1 A;  2Y73 A;  3JUQ A;  1BSD A;  1RGK A;  3JUP A;  2XGN A;  1VQ8 3;  1STD A;  2YX9 A;  1RDS A;  1ULI B;  4HBR A;  5EVH A;  3NX0 A;  4AKY A;  1T5Y A;  4HM2 B;  1FGT A;  4LZI A;  1VQO 3;  1QAL A;  3KSP A;  4AEQ A;  4XB5 A;  2ZA4 A;  3AMO A;  3URP A;  4EXR A;  3CCE 3;  1BRK A;  2CWT A;  3UL6 A;  2W9Q A;  1NDO B;  1BOX A;  4X2H A;  3WHO A;  1GD4 A;  2PZV A;  1LXE A;  5AEW B;  1OHP A;  3WR2 A;  3N54 B;  5CLK A;  1V74 A;  3DUK A;  2OOV A;  4GB5 A;  4N6T A;  4O8S A;  3SLU A;  4CPK A;  7RNT A;  5AEU B;  3I55 3;  3LML A;  1IV7 A;  3GZB A;  5ELJ A;  1HU9 A;  3SOA A;  1JBR A;  3FSD A;  3MG1 A;  4WYK A;  4WHA A;  1NWW A;  2YFL B;  1RGE A;  4RNZ A;  2F56 A;  1O7N B;  1OHO A;  1GSP A;  2FGT A;  1R4Y A;  3MYT A;  5D82 A;  3H3H A;  3BND A;  1KSI A;  1S5A A;  2HMK B;  1BRG A;  3FGY A;  1Q40 A;  4N6O B;  1MWR A;  1RN4 A;  2UUG C;  2CWU A;  3CCU 3;  1GMR A;  1VQ6 3;  4N6M A;  1LNI A;  1RGL A;  2Z7A A;  1O7M B;  1Q42 A;  3HIG A;  3BNC A;  2INX A;  7STD A;  3WOE B;  2H0G A;  3CXC 2;  2W03 A;  1BNJ A;  2O9U X;  1IU7 A;  2KF6 A;  4GHO A;  3LZA A;  1BUQ A;  1B2U A;  4FCZ A;  3CCL 3;  3F8H A;  1TRP A;  2CFD A;  1DMM A;  1YGW A;  3LYG A;  2AAD A;  3OWS A;  7GSP A;  1SJW A;  4HYZ A;  1ZS7 A;  4L8P A;  3X40 A;  4BU4 A;  3Q3F A;  3Q1C A;  3A5E A;  3CPO A;  3I0Y A;  1VQL 3;  3DZL A;  5JBS A;  4RNT A;  2IYJ A;  1I0X A;  3GZY B;  1E3V A;  4XDW A;  1IVU A;  1BUJ A;  4HOH A;  1E3R A;  2E2V A;  3DGO A;  3FH1 A;  3KZT A;  3V99 A;  4HM5 B;  5JPU A;  2XR8 B;  1SIH A;  4IIA A;  1ROV A;  1VQK 3;  2RBI A;  3KCH A;  3NXJ A;  2P09 A;  3NHX A;  3HII A;  5IG4 A;  2CKF B;  2XH9 A;  1MWS A;  1IV9 A;  3EC9 A;  3RNT A;  3IJE B;  3K0Z A;  2CFG A;  3JVC A;  4FMA A;  3N8B A;  3VF1 A;  4DKI A;  1B2S A;  1LOW A;  1I2E A;  2WGQ A;  2CC3 A;  4HM7 B;  1KD1 4;  3CCS 3;  4FR9 A;  2BU4 A;  2CFW A;  2W9P A;  3KN4 A;  4HJL B;  4XBX A;  4H3U A;  3G4S 3;  1B21 A;  2KXG A;  3LTB A;  4LMI A;  1ASK A;  5IEO A;  1TFO A;  1IQY A;  3D4A A;  1BU4 A;  3V98 A;  1EQK A;  3E99 A;  3G16 A;  1NB5 I;  3B4O A;  1JZD A;  1VQM 3;  1IVW A;  3CME 3;  1JB2 A;  1TUH A;  2WGO A;  3PGB A;  3T8U A;  3S29 A;  2OWP A;  3S27 A;  3GRD A;  1DE3 A;  2P05 A;  1Q82 4;  2GEX A;  1IQ8 A;  3EQQ B;  3OXA A;  3UJM A;  4BL2 A;  3BNB A;  4EBG A;  2K0M A;  4HVN A;  3MPH A;  3AHS A;  5ELU A;  3SXX A;  1ROA A;  1O7P B;  1S72 3;  2BMR B;  3EF8 A;  1KQS 2;  4QWT A;  4EW5 A;  1D6U A;  1LRA A;  3CC4 3;  3X3Y A;  4JRF A;  5EEO A;  3D9R A;  4HM3 B;  1SAR A;  2D1W A;  1LOX A;  2F5W A;  4K1V A;  1N9J A;  1ZX2 A;  2CHC A;  1G96 A;  2E2U A;  3D3L A;  4JF8 A;  1JKG A;  1IVV A;  3DGM A;  4BTX A;  1K8A 4;  2K3D A;  2FXT A;  2XGL A;  2BHM A;  2UX0 A;  3ECF A;  5GSP A;  2M7O A;  1UI8 A;  4N6N B;  1RMS A;  4KFD A;  1C7H A;  4EV2 A;  2CWV A;  3F7X A;  3EB8 A;  4I4K A;  1RCK A;  3O8Y A;  3BIR A;  1G02 A;  2HMO B;  1I3I A;  1MWU A;  5G1L A;  1BRI A;  3OX9 A;  1RGG A;  3F9S A;  3NQY A;  4OVM A;  4U13 A;  2CFL A;  4K61 A;  2IUJ A;  1DVC A;  2W56 A;  1HYF A;  1X1U A;  4FMD A;  3FZW A;  1BRN L;  1OGX A;  3F7S A;  3RGR A;  1Q86 4;  1OPY A;  2GXF A;  1BSB A;  3F8X A;  3FG1 A;  2WO0 A;  2HMM B;  3LOY A;  1UGH I;  4MMY B;  1HKX A;  1NU3 A;  4J5G A;  2Z77 A;  5M18 A;  5FW5 A;  3WA2 X;  4J5K A;  1R4C A;  3K9M C;  1N8R 4;  3K5T A;  1O7W B;  3GAX A;  5RNT A;  3CPW 2;  1VQN 3;  1IT7 A;  5FGO A;  3B7C A;  1JV2 B;  2BMO B;  4N6U A;  4CCV A;  1LOV A;  1JRQ A;  5D83 A;  3FF0 A;  1BSA A;  2PNC A;  1Y4K A;  1M1X B;  3BNE A;  5STD A;  1TFK A;  3OWU A;  1X1Y A;  3OWY A;  1RGA A;  1L5G B;  2BIR A;  5DRV A;  3MG3 A;  5AYS C;  4G1M B;  2R41 A;  3AGN A;  1A2P A;  2B24 B;  2OQE A;  3ZG0 A;  3HZP A;  1TTO A;  1RGF A;  1A67 A;  2CFK A;  1QJG A;  3NM7 A;  2E2T A;  3PCS A;  3SED A;  1JZO A;  2RSX A;  5IG5 A;  1CH0 A;  2WOF A;  3CCJ 3;  2CH9 A;  5DRE A;  1W00 A;  3AHW A;  1OF5 B;  5IEN A;  4MJD A;  3MSO A;  2JDI H;  2JQ5 A;  2GU1 A;  4GSP A;  1QAK A;  1RHL A;  1B27 A;  2L4V A;  1BIR A;  2P38 A;  1RRH A;  1FA3 A;  1IDP A;  2OOV C;  2P0M A;  5M1A A;  3NV0 B;  1BAO A;  4K1U A;  5HGR A;  1BVI A;  1GOY A;  4HAA A;  1G0T A;  1PU4 A;  1CEW I;  1FGO A;  3KE7 A;  5AII A;  1GMQ A;  4ILF A;  2HMN B;  1QVG 2;  2OTJ 3;  4HZB B;  3SX1 A;  1BNI A;  4STD A;  4K90 B;  1GOU A;  5AYR B;  2GU3 A;  1W02 A;  1U5O A;  2IUK A;  8CHO A;  1I8V A;  4HZ9 B;  5CK6 A;  1X1X A;  4NHF A;  4RZM A;  3SOY A;  2YFI B;  3EX9 A;  2QEX 3;  3KFQ C;  1RKY A;  1M90 4;  1A90 A;  1EG9 B;  1UUG B;  3AGO A;  3DGN A;  1LQM B;  1M9G A;  3EHC A;  4KT3 B;  4AKZ A;  3G0K A;  1VQ9 3;  3UL5 A;  2IY2 A;  1MWT A;  3A76 A;  4HKV B;  1GMP A;  1OH0 A;  3STD A;  3LT9 A;  4XM4 A;  1KWI A;  4FCJ A;  4FCM A;  1BSE A;  2HMJ B;  2OCT A;  4LGQ A;  3B8L A;  1IVX A;  1Q9E A;  5IF6 A;  3UB1 A;  3J7Y d;  3S28 A;  1RCL A;  1AR0 A;  3S67 A;  2YFJ B;  1CYU A;  1BGS A;  2J8X B;  1VQQ A;  1K28 A;  4R1K A;  3SVA A;  1IYY A;  3CCQ 3;  2CK3 H;  1U8C B;  3ZG5 A;  2I9W A;  3PXM A;  1YVS A;  2BNG A;  1N8Q A;  2QIY A;  3NBB A;  1VQ4 3;  4BIR A;  1FW7 A;  3K7C A;  4ORL A;  3L0R A;  1PFP A;  4RBN A;  4H61 A;  3QRD A;  2Z6B A;  4KFE A;  4IPB A;  1FUS A;  3D5G A;  1F8N A;  3ZFZ A;  2XEP A;  2Y74 A; 
#chains in the Genus database with same CATH homology
 1UDI I;  1UGH I;  1UGI A;  2UGI A;  1EUI C;  2ZHX B;  4LYL B;  1UUG B;  2J8X B;  1LQG C;  1LQM B;  2UUG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...