4IT7A

Crystal structure of al-cpi
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
GGFSTKDVNDPKIQALAGKALQRINAASNDLFQQTIVKVISAKTQVVAGTNTVLELLIAPTSCRKNETSAGNCEAVSNGTKQICTVAIWEKPWENFEEITIKECKSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords CPI
publication title Structural Basis for the Immunomodulatory Function of Cysteine Protease Inhibitor from Human Roundworm Ascaris lumbricoides.
pubmed doi rcsb
source organism Ascaris lumbricoides
total genus 21
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4it7A00
4N6MA 1WNHA 5A0OB 4IT7A 4N6LA 1MNLA 5EQLA 5ELUA 3KFQC 3UL5A 1N9JA 2W9QA 1A90A 3PYJA 4TX4A 1YVBI 4ZM8A 1DVCA 3L0RA 1IV7A 5ELJA 1NB3I 1EQKA 3S67A 3GAXA 1R4CA 3MWZA 3IMAB 4LZIA 1PFPA 1GD3A 2CH9A 1G96A 1RN7A 1KWIA 1STFI 3PXMA 1GD4A 1A67A 4CCVA 1NB5I 1DVDA 1CEWI 4N6UA 4EYCA 4N6TA 2KXGA 1ROAA 1N5PA 3QRDA 3SVAA 4N6NB 2BO9B 3UL6A 4N6V0 1FA3A 1TIJA 3PS8A 1IV9A 1M9GA 5LC7A 1MOLA 3K9MC 5LC6A 3NX0A 3KSED 3Q2PA 1LXEA 1CYUA 1FUWA 2W9PA 1CYVA 1N5HA 3LH4A 2OCTA 2O9UX 4N6OB
chains in the Genus database with same CATH superfamily
1M1K4 3WMDA 1O7MB 2BIRA 3FGYA 3ROBA 4GHOA 4WHAA 5HGRA 1BNSA 5M18A 2RGQA 2F99A 1RHLA 2P0MA 2V1LA 3AHSA 3G8ZA 1MNLA 1VQN3 3GRDA 4XBYA 2KAAA 2UGIA 2IA7A 4R4KA 1FUTA 2HMMB 4HM5B 3OW22 3S27A 4N3VA 2C11A 1F8NA 3CXC2 1AQZA 4J5KA 1QAFA 3GZYB 2F56A 3D79A 1W5ZA 2BMOB 3CCJ3 2CFGA 3HIIA 3SOAA 1RGCA 4L8PA 2L1SA 2ZHXB 3WOEB 3DGYA 3G16A 2CFDA 4J9AA 2GEXA 1ZGXA 4FCMA 1I2EA 2Y73A 2GXFA 2YFIB 3BB9A 3NQYA 3LTCA 3NV0A 1MWSA 2RNTA 5CXOA 3S28A 1Z1SA 1NDOB 1FW7A 1VZZA 4EW5A 5IG4A 3LT9A 1VQO3 3B8LA 1DVCA 2FGTA 1IV7A 4MMXB 3CC23 1B2MA 1DMNA 5IEPA 1EQKA 1JBRA 2CFLA 1U8CB 1YJ93 1RGKA 1UI7A 2XF3A 1RGGA 3WA3A 4FCJA 1R4CA 1UGHI 1NNVA 5BIRA 1VQK3 1VQP3 3CCR3 4LZIA 3F7SA 1FGTA 2HMLB 3OWYA 2A15A 4HM1B 3DGOA 3X40A 1GOVA 2QGUA 3JUOA 3GWRA 3N54B 3ZG0A 1G96A 1FGMA 3DUKA 3HIGA 2HMNB 1PU4A 4EXRA 1IDPA 2F4YA 3PXMA 2HMOB 3LTBA 1BRKA 2IY2A 5KP3A 1BRSA 5CF2A 3CNXA 2CW9A 3A76A 3WR2A 1GY5A 2XGNA 4QWTA 3PGBA 2P05A 5AIFA 5DRVA 1IYYA 1BNEA 4AKZA 2IUKA 1QMAA 3NHXA 4U13A 5AIHA 3CCQ3 1YI23 3K63A 3H51A 4RNZA 1RN4A 1CEWI 1KC84 2XFTA 3FG4A 5D82A 1G02A 5IENA 3VSYA 1IQ8A 4EYCA 4HAAA 4N6TA 1OUNA 2KXGA 1ULIB 4BTYA 5TGNA 1BNGA 1RLSA 3OXAA 1K734 3MKIA 3T0UA 3KN4A 1X1WA 5AEWB 2K54A 1IVUA 3ER7A 2H0HA 1Q7HA 3HOHA 3NUVA 1DYUA 4HYZA 1TIJA 3PS8A 2OOVA 1W00A 5IG5A 1I3IA 2W0QA 1Q864 1G0TA 1K41A 2GU1A 3BIRA 1PY3A 3JVCA 1MOLA 1BSDA 1N8QA 2W56A 2ZA4A 3MG3A 3I553 1UCIA 3NX0A 3CC43 1A2VA 1BNIA 2BU4A 2CWTA 5M1AA 1LXEA 3SYUA 3V98A 5JBSA 1BSCA 1Q42A 3GZXB 1MGWA 3DM8A 1FUWA 4HOHA 3GZRA 2PNCA 4RNYA 1BSAA 3T8UA 3BNEA 4OK0A 2XR8B 3CMA3 3B4PA 1RJOA 2CFKA 5EEOA 3BLZA 4N6OB 2CC3A 4HM4B 2CWUA 1DE3A 1Q40A 2CIUA 1JBTA 1GOUA 3G713 1LOYA 4N6MA 1BUJA 5G1KA 2FXTA 2F5WA 2QIYA 4KZ1A 1V74A 1BU4A 2RSXA 5A0OB 1UUVB 4N6LA 2W03A 1RGAA 1TTOA 1IQXA 1RGHA 1QAKA 3RGRA 3DGNA 3U97A 3DY5A 1JB2A 4EV2A 2WOFA 1HU9A 3K0ZA 2OOVC 3SLUA 5ELUA 1IT7A 1MGRA 1T3BA 1B2UA 4L8OA 2WO0A 3H3HA 1VQ63 2HMJB 1DMMA 4HM6B 5JPUA 3OWUA 2Z76A 1LQGC 2KF6A 3DH2A 2H0IA 3CCM3 1V58A 7RNTA 3FG3A 1I2GA 1RDSA 3DGLA 1YIJ3 3BU4A 5AEUB 1QVG2 4BL2A 1W01A 4R80A 2W9QA 3SEDA 2GBWB 3CPOA 1OF5A 3LTDA 1A90A 3UNLA 4HZ9B 4CPKA 3SXXA 4GSPA 1ZX2A 3VGNA 4GB5A 1GY7A 3I0YA 1B2XA 1TRQA 3L0RA 1JN5A 1N9EA 1DMQA 3JUNA 4LEHA 3T8NA 5RNTA 1OCVA 3RNTA 1BNRA 1BRNL 1WMPA 4NPBA 2Q07A 3G4S3 1BAOA 3F7XA 5BVBA 2C10A 1GMQA 4AKYA 3IMAB 1X1XA 2L4VA 1BRGA 1MWRA 3JUMA 1BRJA 1JKGB 1STDA 2O3OA 4KT3B 1PFPA 1WQLB 1OH0A 3N8BA 2K0MA 3UB1A 1UUGB 3NBRA 2W56B 2CH9A 3D4AA 2P09A 1VQ73 3OWSA 1I3FA 4IIAA 4X2OA 4XBXA 1UUWB 3E99A 1BSEA 3OX9A 2K3DA 3ZG5A 1UCLA 1BVIA 4HVNA 2XEPA 3NXJA 2XSHB 1TUHA 2BMQB 1AVKA 1A2PA 3KZTA 3S5CA 4FMCA 2OTL3 1RSNA 1MWTA 3PCRA 3X3YA 5IG3A 1Q40B 1UGIA 1C54A 1QJGA 1IU7A 2LYXA 1Y4KA 4EC6A 1B20A 1DVDA 1YJN3 5IW9A 1GMPA 1PYLA 2WOHA 3DXOA 2IYJA 4N6UA 4WYKB 1X1UA 2M7OA 3WDGB 1GOYA 3SVAA 1US1A 1IT8A 1TFKA 2R41A 2E2TA 2XRXB 3WOFB 3RGAA 2SBLA 5CF1A 5BXQA 1NU3A 4JF8A 4Q53A 3STDA 1ASKA 3ZFZA 4BTXA 4KFFA 2CK3H 4N6V0 1LVNA 2CWVA 1GYBA 1FA3A 1ZS7A 1I0VA 3LOYA 1RGEA 1BUQA 3EB8A 1HZ1A 4KFDA 3I563 1GSPA 5IG0A 1E3RA 3Q1CA 1IVWA 4OVMA 2Z77A 4CJNA 1FYSA 1OPYA 2YX9A 3KSED 3CCV3 1I70A 2MC8A 1CYUA 3HX8A 5STDA 2I9WA 3NBJA 3S29A 2W9PA 1Q824 1RTUA 4NHFA 3X3XA 7STDA 3CCS3 1DETA 1N5HA 1LNHA 3CCL3 1SARA 3JUPA 4G1MB 1M904 3UJMA 1TJDA 4HKVB 1K8A4 3KKGA 6RNTA 3AMOA 1JN5B 1Q7Y4 3KCHA 2KF3A 1UCKA 2GEYA 3HI7A 4RBNA 4X2HA 2F86B 3V92A 4HBRA 3CD63 5JPPA 1E97A 2BHMA 1RN1A 2ML5A 1AR0A 5EVHA 3X42A 5D81A 1VQM3 1HYFA 3F9SA 2ZL8A 4EBGA 4J5GA 2SARA 4BL3A 3O8YA 1BANA 1KD14 3G0KA 3ECFA 3K5TA 4O2HA 2W04A 2QA43 3PCSA 3EC9A 5EQLA 1VQL3 6STDA 1N8R4 1YNVX 3NV0B 3KFQC 3BNCA 1TP6A 3EBYA 1Q814 3DGMA 1OHPA 3Q3FA 5KP1A 4K1VA 1AY7A 3UL5A 2CX1A 5IERA 4O8SA 3G6E3 4FMAA 1W7CA 5FGOA 1NO3A 3FZWA 3FF2A 1YGEA 4XM4A 8CHOA 1MWUA 1LOVA 3FCSB 3LT8A 3U1WA 3KE7A 1TRPA 3PYJA 2AADA 4TX4A 1YVBI 1JB4A 2BT3A 3AHWA 5AIGA 1BNFA 1FGOA 5IEOA 3URPA 4ZM8A 2BNGA 2C4BA 1LRAA 3NM7A 4FMDA 1ULJB 1NB3I 1EA2A 4GL6A 1D6YA 2D42A 1JZOA 1O7GB 2XH9A 5CK6A 2Z7AA 2E2UA 1JB5A 2Z6BA 3DZLA 3EF8A 1QALA 1IQYA 1VQ43 3CU3A 2YFJB 1YHQ3 1EKMA 4LYLB 2WGOA 3BNBA 1VQ93 3FLJA 1EG9B 1V57A 2KF5A 4IPBA 3EHCA 2P0XA 1B3SA 1BGSA 1O7NB 3KSPA 3V99A 2OTJ3 1D6UA 1RN7A 1U5OA 2UX0A 3MG2A 1KWIA 1YJW3 2IUJA 1STFI 2CKFB 1B2ZA 4CDLA 3LTAA 3Q90A 2LQVA 4STDA 1UCJA 3RDEA 8RNTA 1BRHA 1JBSA 1K9M4 1C7HA 3BNDA 3FSDA 3EX9A 4WWUC 5DREA 4XDVA 1RNTA 1NJI4 1A67A 3MG1A 4ORLA 3ALAA 1NB5I 3LYGA 2ZDJA 3LXUX 1SIIA 3LZAA 4JRFA 3OV4A 1RNBA 5G1LA 5AIIA 3QK9A 2F98A 3EJVA 4HM2B 3SOYA 1I8VA 5I97A 4AEQA 1BSBA 1M1XB 1N5PA 1ROAA 3X3ZA 1RGFA 1GY6A 1FGRA 2RFRA 5AI1A 1RMSA 3D5GA 2OQEA 1OHSA 2MF7A 1IK3A 1VQQA 4HJLB 4R9KA 2KF4A 4BIRA 4DKIA 1KSIA 6GSPA 1Q9EA 4KVHA 3FKAA 1IV9A 1JNQA 4H61A 1YIT3 3CPW2 2F5MA 4K90B 4MMYB 5AYSC 3CCE3 2PZVA 3K9MC 2R4IA 1W6CA 5GSPA 1WMOA 1YVSA 4ILFA 4K61A 5M19A 5IF6A 4L7KA 4MMZB 1RGLA 3EBTA 1RCLA 1W02A 3LMLA 2IMJA 2WGQA 3HK4A 1CYVA 4O02B 1KQS2 3LH4A 4LSOA 1ZO2A 2O9UX 2OCTA 4PEJA 1IVXA 3CCU3 2XGLA 4J8TA 2FNQA 1EEJA 2W2CA 2B1XB 4BU4A 1OHOA 3NQZA 3AGOA 4FMBA 1WNHA 1SQWA 5G2GA 3M8CA 5FW5A 4HZBB 2GBXB 1SJWA 1T2IA 1RRLA 1B2SA 3F8HA 1I0XA 1OACA 2JQ5A 4IT7A 2OQEC 4RZMA 4O3VA 1AVLA 1JRQA 3CC73 3X41A 1K28A 1NWWA 4HM0B 1SPUA 1OF5B 1T2HA 2RCDA 1UDII 2E2VA 3D9RA 2CG1A 4R9LA 3PZWA 1VQ83 1FGQA 1R4YA 1W6YA 1N9JA 1S5AA 1RRHA 3FG1A 3SX1A 4LGQA 1TFOA 3MHEA 2W6JH 4HM7B 4I5QA 2CFWA 1B21A 1GS3A 2OWPA 7GSPA 1FUSA 4MJDA 4R1KA 2GSPA 2JDIH 2J8XB 2XFSA 9RNTA 2ML6A 2BMRB 1GMRA 4XDWA 5ELJA 3CNMA 1W6GA 2HOHA 1W2ZA 1HKXA 3MYTA 4HM8B 1JZDA 2D1WA 3S67A 3HZPA 3F14A 3GAXA 3EN1B 3TDGA 3VF1A 1SIHA 3F8XA 2B24B 1W4NA 1E3VA 1LOXA 3MWZA 2KCDA 1RCKA 3B7CA 1O7WB 3NM2A 3WHOA 4NREA 1ROVA 1ISKA 1GD3A 1RKYA 1JJ22 1B27A 1OGZA 3GZBA 1S723 2INXA 2P38A 4BTWA 1L5GB 1LOWA 2QEX3 1O7HB 1BOXA 3K7CA 1UI8A 1LQMB 2CHCA 1I2FA 3IPTA 1TU5A 1JKGA 2CG0A 1BIRA 1GD4A 3NBBA 4K1UA 4WP5A 2AAEA 3N9HA 1BNJA 1BRIA 3FH1A 1CQSA 3KIIA 4CCVA 1WMNA 1AV4A 2HMKB 2Y74A 5BU4A 1YGWA 3GSPA 5KP4A 1J2BA 1WTHA 3IJEB 3WODG 1QVF2 1JV2B 3MPHA 3DMCA 2CX0A 1FZUA 3QRDA 4I4KA 3F40A 4XB5A 3D3LA 3EN8A 3FF0A 1LNIA 1X1YA 4WFOA 3MSOA 4N6NB 1A2KA 3EQQB 2XSOB 3EE1A 2KRTA 2BO9B 4FCZA 3UL6A 4EV5A 1OGXA 2STDA 4KFEA 1CH0A 4WYKA 4H3UA 5HOHA 1W2B2 3JUQA 4HM3B 1VQ53 1O7PB 4XBTA 3D5IA 1M9GA 4LMIA 1UW1A 5LC7A 3B4OA 3AGNA 4RNTA 5LC6A 3AMOB 3J7Yd 2UUGC 1IVVA 3Q2PA 3WA2X 5CLKA 4OUQA 5AYRB 1EUIC 1D6ZA 2GU3A 4FR9A 2H0GA 4MEIA 2RBIA 5D83A 3A5EA 1T5YA 3CME3 2YFLB
chains in the Genus database with same CATH topology
1M1K4 3WMDA 1O7MB 3FGYA 3ROBA 4WHAA 5HGRA 2RGQA 2F99A 2V1LA 2P0MA 3G8ZA 1MNLA 1VQN3 3GRDA 4XBYA 2IA7A 4R4KA 2HMMB 4HM5B 3OW22 3S27A 4N3VA 2C11A 1F8NA 3CXC2 1QAFA 3GZYB 1W5ZA 2BMOB 3CCJ3 2CFGA 3HIIA 3SOAA 4L8PA 3WOEB 3G16A 2CFDA 4J9AA 2GEXA 4FCMA 2Y73A 2GXFA 2YFIB 3BB9A 3NQYA 3LTCA 3NV0A 5CXOA 3S28A 1Z1SA 1NDOB 1VZZA 5IG4A 3LT9A 1VQO3 3B8LA 1DVCA 2FGTA 1IV7A 4MMXB 3CC23 1DMNA 5IEPA 1EQKA 2CFLA 1U8CB 1YJ93 1UI7A 2XF3A 3WA3A 4FCJA 1R4CA 1VQK3 1VQP3 3CCR3 4LZIA 3F7SA 1FGTA 2HMLB 3OWYA 2A15A 4HM1B 3DGOA 3X40A 2QGUA 3JUOA 3GWRA 3N54B 1G96A 1FGMA 3DUKA 3HIGA 2HMNB 1PU4A 4EXRA 1IDPA 3PXMA 2HMOB 3LTBA 5KP3A 5CF2A 3CNXA 2CW9A 3A76A 1GY5A 2XGNA 4QWTA 3PGBA 2P05A 5AIFA 5DRVA 4AKZA 2IUKA 1QMAA 3NHXA 4U13A 5AIHA 3CCQ3 1YI23 3K63A 3H51A 4RNZA 1KC84 1CEWI 2XFTA 3FG4A 5D82A 5IENA 3VSYA 1IQ8A 4EYCA 4N6TA 1OUNA 2KXGA 1ULIB 4BTYA 5TGNA 3OXAA 1K734 3MKIA 3T0UA 3KN4A 5AEWB 2K54A 1IVUA 3ER7A 3NUVA 2OOVA 4HYZA 1DYUA 5IG5A 1TIJA 3PS8A 1W00A 1Q864 2W0QA 1K41A 2GU1A 3JVCA 1MOLA 2W56A 1N8QA 3CC43 3I553 3MG3A 3NX0A 1A2VA 2CWTA 3V98A 1LXEA 5JBSA 1Q42A 3GZXB 3DM8A 1FUWA 3GZRA 2PNCA 4RNYA 3T8UA 3BNEA 4OK0A 2XR8B 3CMA3 3B4PA 1RJOA 2CFKA 5EEOA 3BLZA 4N6OB 2CC3A 4HM4B 2CWUA 1Q40A 2CIUA 3G713 4N6MA 2FXTA 2QIYA 4KZ1A 1V74A 2RSXA 5A0OB 1UUVB 4N6LA 2W03A 1IQXA 1QAKA 3RGRA 3DGNA 3U97A 3DY5A 1JB2A 4EV2A 2WOFA 1HU9A 3K0ZA 2OOVC 3SLUA 5ELUA 1IT7A 4L8OA 2WO0A 3H3HA 1VQ63 2HMJB 1DMMA 4HM6B 5JPUA 3OWUA 2Z76A 3CCM3 3FG3A 3DGLA 1YIJ3 5AEUB 1QVG2 1W01A 4R80A 2W9QA 3SEDA 2GBWB 3CPOA 1OF5A 3LTDA 1A90A 3UNLA 4HZ9B 3SXXA 1ZX2A 3VGNA 4GB5A 1GY7A 3I0YA 3T8NA 3L0RA 1JN5A 1N9EA 1DMQA 3JUNA 4LEHA 1OCVA 1WMPA 2Q07A 3G4S3 3F7XA 5BVBA 2C10A 4AKYA 3IMAB 2L4VA 3JUMA 1JKGB 1STDA 2O3OA 1PFPA 1WQLB 1OH0A 3N8BA 2K0MA 3UB1A 3NBRA 2W56B 2CH9A 2P09A 1VQ73 3OWSA 4IIAA 4X2OA 4XBXA 1UUWB 3E99A 3OX9A 4HVNA 2XEPA 3NXJA 2XSHB 1TUHA 2BMQB 1AVKA 3KZTA 3S5CA 4FMCA 2OTL3 3PCRA 3X3YA 5IG3A 1Q40B 1QJGA 1IU7A 2LYXA 1Y4KA 4EC6A 1DVDA 1YJN3 5IW9A 4N6UA 2WOHA 3DXOA 4WYKB 2M7OA 3WDGB 3SVAA 1US1A 1IT8A 1TFKA 2XRXB 2E2TA 3WOFB 3RGAA 2SBLA 5CF1A 5BXQA 1NU3A 4JF8A 4Q53A 3STDA 1ASKA 4BTXA 4KFFA 2CK3H 4N6V0 1LVNA 2CWVA 1GYBA 1FA3A 3LOYA 1BUQA 3EB8A 4KFDA 3I563 5IG0A 1E3RA 3Q1CA 1IVWA 4OVMA 2Z77A 3CCV3 1OPYA 2YX9A 3KSED 2MC8A 1CYUA 3HX8A 5STDA 2I9WA 3NBJA 3S29A 2W9PA 1Q824 4NHFA 3X3XA 7STDA 3CCS3 1N5HA 1LNHA 3CCL3 3JUPA 1M904 4G1MB 3UJMA 4HKVB 1K8A4 3KKGA 3AMOA 1JN5B 1Q7Y4 2GEYA 3HI7A 4RBNA 4X2HA 2F86B 3V92A 4HBRA 3CD63 5JPPA 1E97A 2BHMA 2ML5A 5EVHA 1AR0A 3X42A 1VQM3 5D81A 3F9SA 2ZL8A 4EBGA 3O8YA 1KD14 3G0KA 3ECFA 3K5TA 4O2HA 2W04A 2QA43 3PCSA 3EC9A 5EQLA 1VQL3 6STDA 1N8R4 3NV0B 3KFQC 3BNCA 1TP6A 3EBYA 1Q814 3DGMA 1OHPA 5KP1A 4K1VA 3UL5A 3G6E3 5IERA 4O8SA 4FMAA 1W7CA 5FGOA 1NO3A 3FZWA 3FF2A 1YGEA 4XM4A 8CHOA 3FCSB 3U1WA 3LT8A 3KE7A 3PYJA 4TX4A 1YVBI 1JB4A 2BT3A 5AIGA 5IEOA 1FGOA 4ZM8A 2BNGA 3NM7A 4FMDA 1ULJB 1NB3I 1EA2A 4GL6A 1D6YA 2D42A 2XH9A 1O7GB 5CK6A 2Z7AA 2E2UA 1JB5A 2Z6BA 3DZLA 3EF8A 1QALA 1IQYA 1VQ43 3CU3A 2YFJB 1YHQ3 1EKMA 2WGOA 3BNBA 1VQ93 3FLJA 1EG9B 4IPBA 3EHCA 2P0XA 3V99A 1O7NB 3KSPA 2OTJ3 1D6UA 1RN7A 1U5OA 2UX0A 3MG2A 1KWIA 1YJW3 2IUJA 1STFI 2CKFB 4CDLA 3LTAA 3Q90A 2LQVA 4STDA 3RDEA 1K9M4 1C7HA 3BNDA 3FSDA 3EX9A 4WWUC 5DREA 4XDVA 1NJI4 1A67A 3MG1A 4ORLA 3ALAA 1NB5I 3LYGA 2ZDJA 3LXUX 1SIIA 3LZAA 4JRFA 3OV4A 5AIIA 3QK9A 2F98A 3EJVA 4HM2B 3SOYA 5I97A 4AEQA 1M1XB 1N5PA 1ROAA 3X3ZA 1GY6A 1FGRA 2RFRA 5AI1A 2OQEA 1OHSA 2MF7A 1IK3A 4HJLB 4R9KA 1KSIA 4KVHA 3FKAA 1IV9A 1JNQA 4H61A 1YIT3 3CPW2 4K90B 4MMYB 5AYSC 3CCE3 2PZVA 3K9MC 2R4IA 1W6CA 1WMOA 4K61A 5IF6A 4L7KA 4MMZB 3EBTA 1W02A 3LMLA 2IMJA 2WGQA 3HK4A 1CYVA 4O02B 1KQS2 3LH4A 4LSOA 1ZO2A 2O9UX 2OCTA 4PEJA 1IVXA 3CCU3 2XGLA 4J8TA 2FNQA 2W2CA 2B1XB 1OHOA 3NQZA 4FMBA 1WNHA 1SQWA 5G2GA 3M8CA 5FW5A 4HZBB 2GBXB 1SJWA 1RRLA 3F8HA 4IT7A 1OACA 2JQ5A 2OQEC 4RZMA 4O3VA 1AVLA 1JRQA 3CC73 3X41A 1K28A 1NWWA 4HM0B 1SPUA 1OF5B 2RCDA 2E2VA 3D9RA 2CG1A 4R9LA 3PZWA 1VQ83 1FGQA 1W6YA 1N9JA 1S5AA 1RRHA 3FG1A 3SX1A 4LGQA 1TFOA 3MHEA 2W6JH 4HM7B 2CFWA 2OWPA 1GS3A 4MJDA 4R1KA 2JDIH 2XFSA 2ML6A 2BMRB 5ELJA 4XDWA 3CNMA 1W6GA 1W2ZA 1HKXA 3MYTA 4HM8B 2D1WA 3S67A 3HZPA 3F14A 3GAXA 3EN1B 3TDGA 3VF1A 1SIHA 3F8XA 2B24B 1W4NA 1E3VA 1LOXA 3MWZA 2KCDA 3B7CA 3NM2A 1O7WB 4NREA 1ROVA 1ISKA 1GD3A 1RKYA 1JJ22 1OGZA 3GZBA 1S723 2INXA 2P38A 4BTWA 1L5GB 2QEX3 1O7HB 3K7CA 1UI8A 2CHCA 3IPTA 1TU5A 1JKGA 2CG0A 1GD4A 3NBBA 4K1UA 4WP5A 3N9HA 3FH1A 1CQSA 3KIIA 4CCVA 1WMNA 1AV4A 2HMKB 2Y74A 5KP4A 1J2BA 1WTHA 3IJEB 3WODG 1QVF2 1JV2B 3MPHA 3DMCA 4I4KA 3QRDA 4XB5A 3F40A 3D3LA 3EN8A 3FF0A 4WFOA 3MSOA 4N6NB 1A2KA 3EQQB 2XSOB 3EE1A 2KRTA 2BO9B 4FCZA 3UL6A 4EV5A 1OGXA 2STDA 4KFEA 4WYKA 4H3UA 1W2B2 3JUQA 4HM3B 1VQ53 1O7PB 4XBTA 4LMIA 1M9GA 1UW1A 5LC7A 3B4OA 3J7Yd 5LC6A 3AMOB 1IVVA 3Q2PA 3WA2X 5CLKA 4OUQA 5AYRB 1D6ZA 2GU3A 4FR9A 4MEIA 5D83A 1T5YA 3CME3 2YFLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6M A;  1WNH A;  5A0O B;  4IT7 A;  4N6L A;  1MNL A;  5EQL A;  5ELU A;  3KFQ C;  3UL5 A;  1N9J A;  2W9Q A;  1A90 A;  3PYJ A;  4TX4 A;  1YVB I;  4ZM8 A;  1DVC A;  3L0R A;  1IV7 A;  5ELJ A;  1NB3 I;  1EQK A;  3S67 A;  3GAX A;  1R4C A;  3MWZ A;  3IMA B;  4LZI A;  1PFP A;  1GD3 A;  2CH9 A;  1G96 A;  1RN7 A;  1KWI A;  1STF I;  3PXM A;  1GD4 A;  1A67 A;  4CCV A;  1NB5 I;  1DVD A;  1CEW I;  4N6U A;  4EYC A;  4N6T A;  2KXG A;  1ROA A;  1N5P A;  3QRD A;  3SVA A;  4N6N B;  2BO9 B;  3UL6 A;  4N6V 0;  1FA3 A;  1TIJ A;  3PS8 A;  1IV9 A;  1M9G A;  5LC7 A;  1MOL A;  3K9M C;  5LC6 A;  3NX0 A;  3KSE D;  3Q2P A;  1LXE A;  1CYU A;  1FUW A;  2W9P A;  1CYV A;  1N5H A;  3LH4 A;  2OCT A;  2O9U X;  4N6O B; 
#chains in the Genus database with same CATH topology
 1M1K 4;  3WMD A;  1O7M B;  2BIR A;  3FGY A;  3ROB A;  4GHO A;  4WHA A;  5HGR A;  1BNS A;  5M18 A;  2RGQ A;  2F99 A;  1RHL A;  2P0M A;  2V1L A;  3AHS A;  3G8Z A;  1MNL A;  1VQN 3;  3GRD A;  4XBY A;  2KAA A;  2UGI A;  2IA7 A;  4R4K A;  1FUT A;  2HMM B;  4HM5 B;  3OW2 2;  3S27 A;  4N3V A;  2C11 A;  1F8N A;  3CXC 2;  1AQZ A;  4J5K A;  1QAF A;  3GZY B;  2F56 A;  3D79 A;  1W5Z A;  2BMO B;  3CCJ 3;  2CFG A;  3HII A;  3SOA A;  1RGC A;  4L8P A;  2L1S A;  2ZHX B;  3WOE B;  3DGY A;  3G16 A;  2CFD A;  4J9A A;  2GEX A;  1ZGX A;  4FCM A;  1I2E A;  2Y73 A;  2GXF A;  2YFI B;  3BB9 A;  3NQY A;  3LTC A;  3NV0 A;  1MWS A;  2RNT A;  5CXO A;  3S28 A;  1Z1S A;  1NDO B;  1FW7 A;  1VZZ A;  4EW5 A;  5IG4 A;  3LT9 A;  1VQO 3;  3B8L A;  1DVC A;  2FGT A;  1IV7 A;  4MMX B;  3CC2 3;  1B2M A;  1DMN A;  5IEP A;  1EQK A;  1JBR A;  2CFL A;  1U8C B;  1YJ9 3;  1RGK A;  1UI7 A;  2XF3 A;  1RGG A;  3WA3 A;  4FCJ A;  1R4C A;  1UGH I;  1NNV A;  5BIR A;  1VQK 3;  1VQP 3;  3CCR 3;  4LZI A;  3F7S A;  1FGT A;  2HML B;  3OWY A;  2A15 A;  4HM1 B;  3DGO A;  3X40 A;  1GOV A;  2QGU A;  3JUO A;  3GWR A;  3N54 B;  3ZG0 A;  1G96 A;  1FGM A;  3DUK A;  3HIG A;  2HMN B;  1PU4 A;  4EXR A;  1IDP A;  2F4Y A;  3PXM A;  2HMO B;  3LTB A;  1BRK A;  2IY2 A;  5KP3 A;  1BRS A;  5CF2 A;  3CNX A;  2CW9 A;  3A76 A;  3WR2 A;  1GY5 A;  2XGN A;  4QWT A;  3PGB A;  2P05 A;  5AIF A;  5DRV A;  1IYY A;  1BNE A;  4AKZ A;  2IUK A;  1QMA A;  3NHX A;  4U13 A;  5AIH A;  3CCQ 3;  1YI2 3;  3K63 A;  3H51 A;  4RNZ A;  1RN4 A;  1CEW I;  1KC8 4;  2XFT A;  3FG4 A;  5D82 A;  1G02 A;  5IEN A;  3VSY A;  1IQ8 A;  4EYC A;  4HAA A;  4N6T A;  1OUN A;  2KXG A;  1ULI B;  4BTY A;  5TGN A;  1BNG A;  1RLS A;  3OXA A;  1K73 4;  3MKI A;  3T0U A;  3KN4 A;  1X1W A;  5AEW B;  2K54 A;  1IVU A;  3ER7 A;  2H0H A;  1Q7H A;  3HOH A;  3NUV A;  1DYU A;  4HYZ A;  1TIJ A;  3PS8 A;  2OOV A;  1W00 A;  5IG5 A;  1I3I A;  2W0Q A;  1Q86 4;  1G0T A;  1K41 A;  2GU1 A;  3BIR A;  1PY3 A;  3JVC A;  1MOL A;  1BSD A;  1N8Q A;  2W56 A;  2ZA4 A;  3MG3 A;  3I55 3;  1UCI A;  3NX0 A;  3CC4 3;  1A2V A;  1BNI A;  2BU4 A;  2CWT A;  5M1A A;  1LXE A;  3SYU A;  3V98 A;  5JBS A;  1BSC A;  1Q42 A;  3GZX B;  1MGW A;  3DM8 A;  1FUW A;  4HOH A;  3GZR A;  2PNC A;  4RNY A;  1BSA A;  3T8U A;  3BNE A;  4OK0 A;  2XR8 B;  3CMA 3;  3B4P A;  1RJO A;  2CFK A;  5EEO A;  3BLZ A;  4N6O B;  2CC3 A;  4HM4 B;  2CWU A;  1DE3 A;  1Q40 A;  2CIU A;  1JBT A;  1GOU A;  3G71 3;  1LOY A;  4N6M A;  1BUJ A;  5G1K A;  2FXT A;  2F5W A;  2QIY A;  4KZ1 A;  1V74 A;  1BU4 A;  2RSX A;  5A0O B;  1UUV B;  4N6L A;  2W03 A;  1RGA A;  1TTO A;  1IQX A;  1RGH A;  1QAK A;  3RGR A;  3DGN A;  3U97 A;  3DY5 A;  1JB2 A;  4EV2 A;  2WOF A;  1HU9 A;  3K0Z A;  2OOV C;  3SLU A;  5ELU A;  1IT7 A;  1MGR A;  1T3B A;  1B2U A;  4L8O A;  2WO0 A;  3H3H A;  1VQ6 3;  2HMJ B;  1DMM A;  4HM6 B;  5JPU A;  3OWU A;  2Z76 A;  1LQG C;  2KF6 A;  3DH2 A;  2H0I A;  3CCM 3;  1V58 A;  7RNT A;  3FG3 A;  1I2G A;  1RDS A;  3DGL A;  1YIJ 3;  3BU4 A;  5AEU B;  1QVG 2;  4BL2 A;  1W01 A;  4R80 A;  2W9Q A;  3SED A;  2GBW B;  3CPO A;  1OF5 A;  3LTD A;  1A90 A;  3UNL A;  4HZ9 B;  4CPK A;  3SXX A;  4GSP A;  1ZX2 A;  3VGN A;  4GB5 A;  1GY7 A;  3I0Y A;  1B2X A;  1TRQ A;  3L0R A;  1JN5 A;  1N9E A;  1DMQ A;  3JUN A;  4LEH A;  3T8N A;  5RNT A;  1OCV A;  3RNT A;  1BNR A;  1BRN L;  1WMP A;  4NPB A;  2Q07 A;  3G4S 3;  1BAO A;  3F7X A;  5BVB A;  2C10 A;  1GMQ A;  4AKY A;  3IMA B;  1X1X A;  2L4V A;  1BRG A;  1MWR A;  3JUM A;  1BRJ A;  1JKG B;  1STD A;  2O3O A;  4KT3 B;  1PFP A;  1WQL B;  1OH0 A;  3N8B A;  2K0M A;  3UB1 A;  1UUG B;  3NBR A;  2W56 B;  2CH9 A;  3D4A A;  2P09 A;  1VQ7 3;  3OWS A;  1I3F A;  4IIA A;  4X2O A;  4XBX A;  1UUW B;  3E99 A;  1BSE A;  3OX9 A;  2K3D A;  3ZG5 A;  1UCL A;  1BVI A;  4HVN A;  2XEP A;  3NXJ A;  2XSH B;  1TUH A;  2BMQ B;  1AVK A;  1A2P A;  3KZT A;  3S5C A;  4FMC A;  2OTL 3;  1RSN A;  1MWT A;  3PCR A;  3X3Y A;  5IG3 A;  1Q40 B;  1UGI A;  1C54 A;  1QJG A;  1IU7 A;  2LYX A;  1Y4K A;  4EC6 A;  1B20 A;  1DVD A;  1YJN 3;  5IW9 A;  1GMP A;  1PYL A;  2WOH A;  3DXO A;  2IYJ A;  4N6U A;  4WYK B;  1X1U A;  2M7O A;  3WDG B;  1GOY A;  3SVA A;  1US1 A;  1IT8 A;  1TFK A;  2R41 A;  2E2T A;  2XRX B;  3WOF B;  3RGA A;  2SBL A;  5CF1 A;  5BXQ A;  1NU3 A;  4JF8 A;  4Q53 A;  3STD A;  1ASK A;  3ZFZ A;  4BTX A;  4KFF A;  2CK3 H;  4N6V 0;  1LVN A;  2CWV A;  1GYB A;  1FA3 A;  1ZS7 A;  1I0V A;  3LOY A;  1RGE A;  1BUQ A;  3EB8 A;  1HZ1 A;  4KFD A;  3I56 3;  1GSP A;  5IG0 A;  1E3R A;  3Q1C A;  1IVW A;  4OVM A;  2Z77 A;  4CJN A;  1FYS A;  1OPY A;  2YX9 A;  3KSE D;  3CCV 3;  1I70 A;  2MC8 A;  1CYU A;  3HX8 A;  5STD A;  2I9W A;  3NBJ A;  3S29 A;  2W9P A;  1Q82 4;  1RTU A;  4NHF A;  3X3X A;  7STD A;  3CCS 3;  1DET A;  1N5H A;  1LNH A;  3CCL 3;  1SAR A;  3JUP A;  4G1M B;  1M90 4;  3UJM A;  1TJD A;  4HKV B;  1K8A 4;  3KKG A;  6RNT A;  3AMO A;  1JN5 B;  1Q7Y 4;  3KCH A;  2KF3 A;  1UCK A;  2GEY A;  3HI7 A;  4RBN A;  4X2H A;  2F86 B;  3V92 A;  4HBR A;  3CD6 3;  5JPP A;  1E97 A;  2BHM A;  1RN1 A;  2ML5 A;  1AR0 A;  5EVH A;  3X42 A;  5D81 A;  1VQM 3;  1HYF A;  3F9S A;  2ZL8 A;  4EBG A;  4J5G A;  2SAR A;  4BL3 A;  3O8Y A;  1BAN A;  1KD1 4;  3G0K A;  3ECF A;  3K5T A;  4O2H A;  2W04 A;  2QA4 3;  3PCS A;  3EC9 A;  5EQL A;  1VQL 3;  6STD A;  1N8R 4;  1YNV X;  3NV0 B;  3KFQ C;  3BNC A;  1TP6 A;  3EBY A;  1Q81 4;  3DGM A;  1OHP A;  3Q3F A;  5KP1 A;  4K1V A;  1AY7 A;  3UL5 A;  2CX1 A;  5IER A;  4O8S A;  3G6E 3;  4FMA A;  1W7C A;  5FGO A;  1NO3 A;  3FZW A;  3FF2 A;  1YGE A;  4XM4 A;  8CHO A;  1MWU A;  1LOV A;  3FCS B;  3LT8 A;  3U1W A;  3KE7 A;  1TRP A;  3PYJ A;  2AAD A;  4TX4 A;  1YVB I;  1JB4 A;  2BT3 A;  3AHW A;  5AIG A;  1BNF A;  1FGO A;  5IEO A;  3URP A;  4ZM8 A;  2BNG A;  2C4B A;  1LRA A;  3NM7 A;  4FMD A;  1ULJ B;  1NB3 I;  1EA2 A;  4GL6 A;  1D6Y A;  2D42 A;  1JZO A;  1O7G B;  2XH9 A;  5CK6 A;  2Z7A A;  2E2U A;  1JB5 A;  2Z6B A;  3DZL A;  3EF8 A;  1QAL A;  1IQY A;  1VQ4 3;  3CU3 A;  2YFJ B;  1YHQ 3;  1EKM A;  4LYL B;  2WGO A;  3BNB A;  1VQ9 3;  3FLJ A;  1EG9 B;  1V57 A;  2KF5 A;  4IPB A;  3EHC A;  2P0X A;  1B3S A;  1BGS A;  1O7N B;  3KSP A;  3V99 A;  2OTJ 3;  1D6U A;  1RN7 A;  1U5O A;  2UX0 A;  3MG2 A;  1KWI A;  1YJW 3;  2IUJ A;  1STF I;  2CKF B;  1B2Z A;  4CDL A;  3LTA A;  3Q90 A;  2LQV A;  4STD A;  1UCJ A;  3RDE A;  8RNT A;  1BRH A;  1JBS A;  1K9M 4;  1C7H A;  3BND A;  3FSD A;  3EX9 A;  4WWU C;  5DRE A;  4XDV A;  1RNT A;  1NJI 4;  1A67 A;  3MG1 A;  4ORL A;  3ALA A;  1NB5 I;  3LYG A;  2ZDJ A;  3LXU X;  1SII A;  3LZA A;  4JRF A;  3OV4 A;  1RNB A;  5G1L A;  5AII A;  3QK9 A;  2F98 A;  3EJV A;  4HM2 B;  3SOY A;  1I8V A;  5I97 A;  4AEQ A;  1BSB A;  1M1X B;  1N5P A;  1ROA A;  3X3Z A;  1RGF A;  1GY6 A;  1FGR A;  2RFR A;  5AI1 A;  1RMS A;  3D5G A;  2OQE A;  1OHS A;  2MF7 A;  1IK3 A;  1VQQ A;  4HJL B;  4R9K A;  2KF4 A;  4BIR A;  4DKI A;  1KSI A;  6GSP A;  1Q9E A;  4KVH A;  3FKA A;  1IV9 A;  1JNQ A;  4H61 A;  1YIT 3;  3CPW 2;  2F5M A;  4K90 B;  4MMY B;  5AYS C;  3CCE 3;  2PZV A;  3K9M C;  2R4I A;  1W6C A;  5GSP A;  1WMO A;  1YVS A;  4ILF A;  4K61 A;  5M19 A;  5IF6 A;  4L7K A;  4MMZ B;  1RGL A;  3EBT A;  1RCL A;  1W02 A;  3LML A;  2IMJ A;  2WGQ A;  3HK4 A;  1CYV A;  4O02 B;  1KQS 2;  3LH4 A;  4LSO A;  1ZO2 A;  2O9U X;  2OCT A;  4PEJ A;  1IVX A;  3CCU 3;  2XGL A;  4J8T A;  2FNQ A;  1EEJ A;  2W2C A;  2B1X B;  4BU4 A;  1OHO A;  3NQZ A;  3AGO A;  4FMB A;  1WNH A;  1SQW A;  5G2G A;  3M8C A;  5FW5 A;  4HZB B;  2GBX B;  1SJW A;  1T2I A;  1RRL A;  1B2S A;  3F8H A;  1I0X A;  1OAC A;  2JQ5 A;  4IT7 A;  2OQE C;  4RZM A;  4O3V A;  1AVL A;  1JRQ A;  3CC7 3;  3X41 A;  1K28 A;  1NWW A;  4HM0 B;  1SPU A;  1OF5 B;  1T2H A;  2RCD A;  1UDI I;  2E2V A;  3D9R A;  2CG1 A;  4R9L A;  3PZW A;  1VQ8 3;  1FGQ A;  1R4Y A;  1W6Y A;  1N9J A;  1S5A A;  1RRH A;  3FG1 A;  3SX1 A;  4LGQ A;  1TFO A;  3MHE A;  2W6J H;  4HM7 B;  4I5Q A;  2CFW A;  1B21 A;  1GS3 A;  2OWP A;  7GSP A;  1FUS A;  4MJD A;  4R1K A;  2GSP A;  2JDI H;  2J8X B;  2XFS A;  9RNT A;  2ML6 A;  2BMR B;  1GMR A;  4XDW A;  5ELJ A;  3CNM A;  1W6G A;  2HOH A;  1W2Z A;  1HKX A;  3MYT A;  4HM8 B;  1JZD A;  2D1W A;  3S67 A;  3HZP A;  3F14 A;  3GAX A;  3EN1 B;  3TDG A;  3VF1 A;  1SIH A;  3F8X A;  2B24 B;  1W4N A;  1E3V A;  1LOX A;  3MWZ A;  2KCD A;  1RCK A;  3B7C A;  1O7W B;  3NM2 A;  3WHO A;  4NRE A;  1ROV A;  1ISK A;  1GD3 A;  1RKY A;  1JJ2 2;  1B27 A;  1OGZ A;  3GZB A;  1S72 3;  2INX A;  2P38 A;  4BTW A;  1L5G B;  1LOW A;  2QEX 3;  1O7H B;  1BOX A;  3K7C A;  1UI8 A;  1LQM B;  2CHC A;  1I2F A;  3IPT A;  1TU5 A;  1JKG A;  2CG0 A;  1BIR A;  1GD4 A;  3NBB A;  4K1U A;  4WP5 A;  2AAE A;  3N9H A;  1BNJ A;  1BRI A;  3FH1 A;  1CQS A;  3KII A;  4CCV A;  1WMN A;  1AV4 A;  2HMK B;  2Y74 A;  5BU4 A;  1YGW A;  3GSP A;  5KP4 A;  1J2B A;  1WTH A;  3IJE B;  3WOD G;  1QVF 2;  1JV2 B;  3MPH A;  3DMC A;  2CX0 A;  1FZU A;  3QRD A;  4I4K A;  3F40 A;  4XB5 A;  3D3L A;  3EN8 A;  3FF0 A;  1LNI A;  1X1Y A;  4WFO A;  3MSO A;  4N6N B;  1A2K A;  3EQQ B;  2XSO B;  3EE1 A;  2KRT A;  2BO9 B;  4FCZ A;  3UL6 A;  4EV5 A;  1OGX A;  2STD A;  4KFE A;  1CH0 A;  4WYK A;  4H3U A;  5HOH A;  1W2B 2;  3JUQ A;  4HM3 B;  1VQ5 3;  1O7P B;  4XBT A;  3D5I A;  1M9G A;  4LMI A;  1UW1 A;  5LC7 A;  3B4O A;  3AGN A;  4RNT A;  5LC6 A;  3AMO B;  3J7Y d;  2UUG C;  1IVV A;  3Q2P A;  3WA2 X;  5CLK A;  4OUQ A;  5AYR B;  1EUI C;  1D6Z A;  2GU3 A;  4FR9 A;  2H0G A;  4MEI A;  2RBI A;  5D83 A;  3A5E A;  1T5Y A;  3CME 3;  2YFL B; 
#chains in the Genus database with same CATH homology
 1M1K 4;  3WMD A;  1O7M B;  3FGY A;  3ROB A;  4WHA A;  5HGR A;  2RGQ A;  2F99 A;  2V1L A;  2P0M A;  3G8Z A;  1MNL A;  1VQN 3;  3GRD A;  4XBY A;  2IA7 A;  4R4K A;  2HMM B;  4HM5 B;  3OW2 2;  3S27 A;  4N3V A;  2C11 A;  1F8N A;  3CXC 2;  1QAF A;  3GZY B;  1W5Z A;  2BMO B;  3CCJ 3;  2CFG A;  3HII A;  3SOA A;  4L8P A;  3WOE B;  3G16 A;  2CFD A;  4J9A A;  2GEX A;  4FCM A;  2Y73 A;  2GXF A;  2YFI B;  3BB9 A;  3NQY A;  3LTC A;  3NV0 A;  5CXO A;  3S28 A;  1Z1S A;  1NDO B;  1VZZ A;  5IG4 A;  3LT9 A;  1VQO 3;  3B8L A;  1DVC A;  2FGT A;  1IV7 A;  4MMX B;  3CC2 3;  1DMN A;  5IEP A;  1EQK A;  2CFL A;  1U8C B;  1YJ9 3;  1UI7 A;  2XF3 A;  3WA3 A;  4FCJ A;  1R4C A;  1VQK 3;  1VQP 3;  3CCR 3;  4LZI A;  3F7S A;  1FGT A;  2HML B;  3OWY A;  2A15 A;  4HM1 B;  3DGO A;  3X40 A;  2QGU A;  3JUO A;  3GWR A;  3N54 B;  1G96 A;  1FGM A;  3DUK A;  3HIG A;  2HMN B;  1PU4 A;  4EXR A;  1IDP A;  3PXM A;  2HMO B;  3LTB A;  5KP3 A;  5CF2 A;  3CNX A;  2CW9 A;  3A76 A;  1GY5 A;  2XGN A;  4QWT A;  3PGB A;  2P05 A;  5AIF A;  5DRV A;  4AKZ A;  2IUK A;  1QMA A;  3NHX A;  4U13 A;  5AIH A;  3CCQ 3;  1YI2 3;  3K63 A;  3H51 A;  4RNZ A;  1KC8 4;  1CEW I;  2XFT A;  3FG4 A;  5D82 A;  5IEN A;  3VSY A;  1IQ8 A;  4EYC A;  4N6T A;  1OUN A;  2KXG A;  1ULI B;  4BTY A;  5TGN A;  3OXA A;  1K73 4;  3MKI A;  3T0U A;  3KN4 A;  5AEW B;  2K54 A;  1IVU A;  3ER7 A;  3NUV A;  2OOV A;  4HYZ A;  1DYU A;  5IG5 A;  1TIJ A;  3PS8 A;  1W00 A;  1Q86 4;  2W0Q A;  1K41 A;  2GU1 A;  3JVC A;  1MOL A;  2W56 A;  1N8Q A;  3CC4 3;  3I55 3;  3MG3 A;  3NX0 A;  1A2V A;  2CWT A;  3V98 A;  1LXE A;  5JBS A;  1Q42 A;  3GZX B;  3DM8 A;  1FUW A;  3GZR A;  2PNC A;  4RNY A;  3T8U A;  3BNE A;  4OK0 A;  2XR8 B;  3CMA 3;  3B4P A;  1RJO A;  2CFK A;  5EEO A;  3BLZ A;  4N6O B;  2CC3 A;  4HM4 B;  2CWU A;  1Q40 A;  2CIU A;  3G71 3;  4N6M A;  2FXT A;  2QIY A;  4KZ1 A;  1V74 A;  2RSX A;  5A0O B;  1UUV B;  4N6L A;  2W03 A;  1IQX A;  1QAK A;  3RGR A;  3DGN A;  3U97 A;  3DY5 A;  1JB2 A;  4EV2 A;  2WOF A;  1HU9 A;  3K0Z A;  2OOV C;  3SLU A;  5ELU A;  1IT7 A;  4L8O A;  2WO0 A;  3H3H A;  1VQ6 3;  2HMJ B;  1DMM A;  4HM6 B;  5JPU A;  3OWU A;  2Z76 A;  3CCM 3;  3FG3 A;  3DGL A;  1YIJ 3;  5AEU B;  1QVG 2;  1W01 A;  4R80 A;  2W9Q A;  3SED A;  2GBW B;  3CPO A;  1OF5 A;  3LTD A;  1A90 A;  3UNL A;  4HZ9 B;  3SXX A;  1ZX2 A;  3VGN A;  4GB5 A;  1GY7 A;  3I0Y A;  3T8N A;  3L0R A;  1JN5 A;  1N9E A;  1DMQ A;  3JUN A;  4LEH A;  1OCV A;  1WMP A;  2Q07 A;  3G4S 3;  3F7X A;  5BVB A;  2C10 A;  4AKY A;  3IMA B;  2L4V A;  3JUM A;  1JKG B;  1STD A;  2O3O A;  1PFP A;  1WQL B;  1OH0 A;  3N8B A;  2K0M A;  3UB1 A;  3NBR A;  2W56 B;  2CH9 A;  2P09 A;  1VQ7 3;  3OWS A;  4IIA A;  4X2O A;  4XBX A;  1UUW B;  3E99 A;  3OX9 A;  4HVN A;  2XEP A;  3NXJ A;  2XSH B;  1TUH A;  2BMQ B;  1AVK A;  3KZT A;  3S5C A;  4FMC A;  2OTL 3;  3PCR A;  3X3Y A;  5IG3 A;  1Q40 B;  1QJG A;  1IU7 A;  2LYX A;  1Y4K A;  4EC6 A;  1DVD A;  1YJN 3;  5IW9 A;  4N6U A;  2WOH A;  3DXO A;  4WYK B;  2M7O A;  3WDG B;  3SVA A;  1US1 A;  1IT8 A;  1TFK A;  2XRX B;  2E2T A;  3WOF B;  3RGA A;  2SBL A;  5CF1 A;  5BXQ A;  1NU3 A;  4JF8 A;  4Q53 A;  3STD A;  1ASK A;  4BTX A;  4KFF A;  2CK3 H;  4N6V 0;  1LVN A;  2CWV A;  1GYB A;  1FA3 A;  3LOY A;  1BUQ A;  3EB8 A;  4KFD A;  3I56 3;  5IG0 A;  1E3R A;  3Q1C A;  1IVW A;  4OVM A;  2Z77 A;  3CCV 3;  1OPY A;  2YX9 A;  3KSE D;  2MC8 A;  1CYU A;  3HX8 A;  5STD A;  2I9W A;  3NBJ A;  3S29 A;  2W9P A;  1Q82 4;  4NHF A;  3X3X A;  7STD A;  3CCS 3;  1N5H A;  1LNH A;  3CCL 3;  3JUP A;  1M90 4;  4G1M B;  3UJM A;  4HKV B;  1K8A 4;  3KKG A;  3AMO A;  1JN5 B;  1Q7Y 4;  2GEY A;  3HI7 A;  4RBN A;  4X2H A;  2F86 B;  3V92 A;  4HBR A;  3CD6 3;  5JPP A;  1E97 A;  2BHM A;  2ML5 A;  5EVH A;  1AR0 A;  3X42 A;  1VQM 3;  5D81 A;  3F9S A;  2ZL8 A;  4EBG A;  3O8Y A;  1KD1 4;  3G0K A;  3ECF A;  3K5T A;  4O2H A;  2W04 A;  2QA4 3;  3PCS A;  3EC9 A;  5EQL A;  1VQL 3;  6STD A;  1N8R 4;  3NV0 B;  3KFQ C;  3BNC A;  1TP6 A;  3EBY A;  1Q81 4;  3DGM A;  1OHP A;  5KP1 A;  4K1V A;  3UL5 A;  3G6E 3;  5IER A;  4O8S A;  4FMA A;  1W7C A;  5FGO A;  1NO3 A;  3FZW A;  3FF2 A;  1YGE A;  4XM4 A;  8CHO A;  3FCS B;  3U1W A;  3LT8 A;  3KE7 A;  3PYJ A;  4TX4 A;  1YVB I;  1JB4 A;  2BT3 A;  5AIG A;  5IEO A;  1FGO A;  4ZM8 A;  2BNG A;  3NM7 A;  4FMD A;  1ULJ B;  1NB3 I;  1EA2 A;  4GL6 A;  1D6Y A;  2D42 A;  2XH9 A;  1O7G B;  5CK6 A;  2Z7A A;  2E2U A;  1JB5 A;  2Z6B A;  3DZL A;  3EF8 A;  1QAL A;  1IQY A;  1VQ4 3;  3CU3 A;  2YFJ B;  1YHQ 3;  1EKM A;  2WGO A;  3BNB A;  1VQ9 3;  3FLJ A;  1EG9 B;  4IPB A;  3EHC A;  2P0X A;  3V99 A;  1O7N B;  3KSP A;  2OTJ 3;  1D6U A;  1RN7 A;  1U5O A;  2UX0 A;  3MG2 A;  1KWI A;  1YJW 3;  2IUJ A;  1STF I;  2CKF B;  4CDL A;  3LTA A;  3Q90 A;  2LQV A;  4STD A;  3RDE A;  1K9M 4;  1C7H A;  3BND A;  3FSD A;  3EX9 A;  4WWU C;  5DRE A;  4XDV A;  1NJI 4;  1A67 A;  3MG1 A;  4ORL A;  3ALA A;  1NB5 I;  3LYG A;  2ZDJ A;  3LXU X;  1SII A;  3LZA A;  4JRF A;  3OV4 A;  5AII A;  3QK9 A;  2F98 A;  3EJV A;  4HM2 B;  3SOY A;  5I97 A;  4AEQ A;  1M1X B;  1N5P A;  1ROA A;  3X3Z A;  1GY6 A;  1FGR A;  2RFR A;  5AI1 A;  2OQE A;  1OHS A;  2MF7 A;  1IK3 A;  4HJL B;  4R9K A;  1KSI A;  4KVH A;  3FKA A;  1IV9 A;  1JNQ A;  4H61 A;  1YIT 3;  3CPW 2;  4K90 B;  4MMY B;  5AYS C;  3CCE 3;  2PZV A;  3K9M C;  2R4I A;  1W6C A;  1WMO A;  4K61 A;  5IF6 A;  4L7K A;  4MMZ B;  3EBT A;  1W02 A;  3LML A;  2IMJ A;  2WGQ A;  3HK4 A;  1CYV A;  4O02 B;  1KQS 2;  3LH4 A;  4LSO A;  1ZO2 A;  2O9U X;  2OCT A;  4PEJ A;  1IVX A;  3CCU 3;  2XGL A;  4J8T A;  2FNQ A;  2W2C A;  2B1X B;  1OHO A;  3NQZ A;  4FMB A;  1WNH A;  1SQW A;  5G2G A;  3M8C A;  5FW5 A;  4HZB B;  2GBX B;  1SJW A;  1RRL A;  3F8H A;  4IT7 A;  1OAC A;  2JQ5 A;  2OQE C;  4RZM A;  4O3V A;  1AVL A;  1JRQ A;  3CC7 3;  3X41 A;  1K28 A;  1NWW A;  4HM0 B;  1SPU A;  1OF5 B;  2RCD A;  2E2V A;  3D9R A;  2CG1 A;  4R9L A;  3PZW A;  1VQ8 3;  1FGQ A;  1W6Y A;  1N9J A;  1S5A A;  1RRH A;  3FG1 A;  3SX1 A;  4LGQ A;  1TFO A;  3MHE A;  2W6J H;  4HM7 B;  2CFW A;  2OWP A;  1GS3 A;  4MJD A;  4R1K A;  2JDI H;  2XFS A;  2ML6 A;  2BMR B;  5ELJ A;  4XDW A;  3CNM A;  1W6G A;  1W2Z A;  1HKX A;  3MYT A;  4HM8 B;  2D1W A;  3S67 A;  3HZP A;  3F14 A;  3GAX A;  3EN1 B;  3TDG A;  3VF1 A;  1SIH A;  3F8X A;  2B24 B;  1W4N A;  1E3V A;  1LOX A;  3MWZ A;  2KCD A;  3B7C A;  3NM2 A;  1O7W B;  4NRE A;  1ROV A;  1ISK A;  1GD3 A;  1RKY A;  1JJ2 2;  1OGZ A;  3GZB A;  1S72 3;  2INX A;  2P38 A;  4BTW A;  1L5G B;  2QEX 3;  1O7H B;  3K7C A;  1UI8 A;  2CHC A;  3IPT A;  1TU5 A;  1JKG A;  2CG0 A;  1GD4 A;  3NBB A;  4K1U A;  4WP5 A;  3N9H A;  3FH1 A;  1CQS A;  3KII A;  4CCV A;  1WMN A;  1AV4 A;  2HMK B;  2Y74 A;  5KP4 A;  1J2B A;  1WTH A;  3IJE B;  3WOD G;  1QVF 2;  1JV2 B;  3MPH A;  3DMC A;  4I4K A;  3QRD A;  4XB5 A;  3F40 A;  3D3L A;  3EN8 A;  3FF0 A;  4WFO A;  3MSO A;  4N6N B;  1A2K A;  3EQQ B;  2XSO B;  3EE1 A;  2KRT A;  2BO9 B;  4FCZ A;  3UL6 A;  4EV5 A;  1OGX A;  2STD A;  4KFE A;  4WYK A;  4H3U A;  1W2B 2;  3JUQ A;  4HM3 B;  1VQ5 3;  1O7P B;  4XBT A;  4LMI A;  1M9G A;  1UW1 A;  5LC7 A;  3B4O A;  3J7Y d;  5LC6 A;  3AMO B;  1IVV A;  3Q2P A;  3WA2 X;  5CLK A;  4OUQ A;  5AYR B;  1D6Z A;  2GU3 A;  4FR9 A;  4MEI A;  5D83 A;  1T5Y A;  3CME 3;  2YFL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...