4IT7A

Crystal structure of al-cpi
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
b'GGFSTKDVNDPKIQALAGKALQRINAASNDLFQQTIVKVISAKTQVVAGTNTVLELLIAPTSCRKNETSAGNCEAVSNGTKQICTVAIWEKPWENFEEITIKECKSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CPI
molecule tags Hydrolase inhibitor
source organism Ascaris lumbricoides
publication title Structural Basis for the Immunomodulatory Function of Cysteine Protease Inhibitor from Human Roundworm Ascaris lumbricoides.
pubmed doi rcsb
total genus 21
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4it7A00
1NB3I 2BO9B 1CYVA 3LH4A 1DVCA 3QRDA 1IV9A 3K9MC 2CH9A 2KXGA 3PXMA 4N6V0 3UL5A 3PS8A 4ZM8A 1CYUA 1CEWI 4N6MA 3KSED 4N6TA 1TIJA 1MNLA 3IMAB 1GD4A 4N6NB 1M9GA 3MWZA 3SVAA 3PYJA 5ELUA 1N5PA 3KFQC 1N5HA 1EQKA 1G96A 4N6OB 1FA3A 2W9PA 5EQLA 1GD3A 1WNHA 1MOLA 1RN7A 2W9QA 5A0OB 4CCVA 1A67A 3UL6A 1LXEA 1ROAA 5ELJA 3S67A 3GAXA 1FUWA 5LC7A 5LC6A 4EYCA 1STFI 3L0RA 4N6UA 1IV7A 3Q2PA 1KWIA 1N9JA 3NX0A 4IT7A 1R4CA 2O9UX 1A90A 1PFPA 1NB5I 4N6LA 4LZIA 1DVDA 2OCTA 4TX4A 1YVBI
chains in the Genus database with same CATH superfamily
1RRLA 3DY5A 3F7XA 3IPTA 1BRHA 5AIGA 1WMPA 2UX0A 3NV0A 2CFWA 3BNCA 4WHAA 1E3RA 1BIRA 1Q40B 3GZBA 4RZMA 3KFQC 3FZWA 1B3SA 2XFSA 3UNLA 1BSDA 3S5CA 3AHSA 3DGYA 5GSPA 3WOFB 5AYRB 2Y74A 3X42A 1TTOA 1BSEA 5CXOA 2CFDA 5D81A 2W0QA 4MMXB 3N8BA 2SBLA 2D42A 3DXOA 2RNTA 1SIIA 2XGLA 4HOHA 3AHWA 3DGMA 4U13A 4KVHA 4OVMA 2F56A 3MG2A 3MYTA 1RGGA 3FG3A 1WQLB 4ORLA 3WHOA 2AAEA 3CCQ3 2SARA 2CIUA 3D5IA 4XDVA 1JB5A 1JV2B 1LNIA 2F99A 2XF3A 1A2PA 1AVKA 2RCDA 1QJGA 2P0MA 2CC3A 4N6NB 5AIHA 3TDGA 3LTDA 1CQSA 2R4IA 5JBSA 3Q3FA 2XH9A 3NM7A 3B8LA 2K3DA 3S67A 2WO0A 5D82A 4NHFA 3D9RA 1JNQA 1WTHA 3UJMA 2CG0A 4HKVB 4CPKA 1MWSA 1PY3A 1UGHI 2C10A 2GXFA 1UUVB 2KAAA 5AYSC 3BNDA 4HAAA 2OQEA 1ZX2A 3CCE3 1N9JA 2E2UA 1Q7HA 5DREA 5KP3A 1ROVA 3MG3A 4WP5A 2D1WA 3KN4A 3QRDA 1LNHA 2XFTA 2XSHB 3U1WA 3CPOA 1V58A 1IVXA 4EW5A 1HYFA 6STDA 5IENA 1SIHA 2L1SA 5TGNA 3RDEA 3G713 2E2TA 3IJEB 4HZBB 4CDLA 4EV2A 3FGYA 3CCR3 1ULJB 2OWPA 1O7HB 3WOEB 1BRSA 1FGMA 1ULIB 1OHSA 1S5AA 1Q40A 2A15A 1N8R4 1EUIC 1GOYA 2CW9A 3OW22 4HM7B 1DMMA 1QALA 3JUNA 5CLKA 1R4CA 1RSNA 2Z77A 1A2VA 3DM8A 2R41A 3B7CA 3I0YA 1VQ73 1BNSA 1FGRA 1LOWA 2INXA 1T3BA 4J5KA 1SARA 4L7KA 1B2XA 2IUKA 1BVIA 2KF4A 2K54A 2O3OA 2ML5A 3KKGA 1FUSA 2P05A 3KZTA 1YNVX 3FG4A 3VF1A 1YJW3 1BNGA 4KT3B 2BMQB 2P0XA 2XSOB 2UGIA 3CC73 4STDA 1BSCA 1X1UA 1SJWA 4N6OB 5EQLA 1DE3A 3FCSB 4LEHA 1GY6A 1O7NB 1RNTA 2YFIB 3LT8A 3V98A 1LOYA 1VQ63 3V92A 3STDA 2JQ5A 5BVBA 1FGQA 4FCZA 4K1UA 2ML6A 3LTBA 5LC7A 1JKGB 1STFI 1Q42A 3NBRA 3M8CA 4N6UA 4NREA 4L8OA 4RBNA 1WMNA 3CCL3 3EBTA 1D6ZA 1O7MB 4L8PA 4FMDA 4MJDA 1RNBA 3OWYA 1FZUA 1JBTA 1IQXA 4HM4B 1OHOA 4O02B 3MKIA 1IQYA 4H3UA 3GWRA 3A76A 4RNYA 3ER7A 1BUQA 3NXJA 1RGLA 2BIRA 3IMAB 1T2HA 3FF2A 1G02A 3LOYA 1EG9B 1N5PA 1BNFA 1I3FA 1T5YA 3DGNA 3DH2A 2B1XB 4HM1B 4XBTA 3WODG 4XB5A 2QEX3 1KQS2 1UI8A 5IEPA 1GSPA 1I70A 1BNEA 1M1XB 5ELJA 5AI1A 1GMQA 2YFLB 1UCLA 3CNMA 1JZDA 1UI7A 3K5TA 1RKYA 1KWIA 1FGTA 4KFFA 5IW9A 3X3YA 3NUVA 3S27A 1ZS7A 3SYUA 3ZG5A 4TX4A 3WDGB 1W6YA 1YJN3 1W6GA 3FF0A 1KC84 3NM2A 1BOXA 3EF8A 1DVCA 2KF5A 4KZ1A 4QWTA 4G1MB 5M18A 3S29A 4DKIA 4O8SA 3DGLA 4HJLB 2HMJB 3ZG0A 1Q9EA 3GRDA 5EEOA 1OHPA 4ILFA 1RTUA 1TU5A 3Q1CA 1HZ1A 4HM2B 1B20A 2RBIA 3OX9A 1BGSA 3OXAA 3RGRA 1X1XA 3CNXA 1VQK3 2Q07A 2W9QA 1MGWA 1W7CA 4EXRA 2HOHA 2OOVC 2I9WA 1IDPA 1RN4A 3GZRA 5JPUA 1YI23 1FUWA 5FGOA 4MMZB 2HMOB 1UGIA 3HX8A 3CXC2 5BIRA 3PGBA 2IMJA 1YGEA 5AIFA 3MHEA 1LOXA 1PFPA 1NB5I 3EX9A 3D4AA 8CHOA 3JUOA 1GY5A 5RNTA 1JJ22 1CH0A 1TP6A 1X1WA 5M1AA 3ROBA 1VQL3 3UL5A 2HMKB 4KFDA 3B4OA 4MEIA 1PU4A 3DMCA 5AIIA 2KF6A 4LYLB 2P09A 1GOUA 2CX0A 3CC43 6GSPA 5IEOA 3NBBA 2GEXA 1TJDA 3NQYA 2BMOB 2WGOA 3G16A 2HMLB 2LYXA 3LXUX 4I5QA 3X40A 1B2SA 1NO3A 3AGNA 4K90B 1S723 1JBSA 2P38A 2XEPA 3E99A 5G1KA 3H3HA 1RGHA 3KE7A 1RMSA 1FYSA 1IK3A 1OF5A 2W03A 2C4BA 3JUPA 2LQVA 3F14A 1GS3A 1UDII 3FLJA 1Q814 1Q864 3D79A 1B27A 1CYVA 1RDSA 1RGKA 2F4YA 4BTWA 1W6CA 3AMOB 3OWSA 1IV9A 2BU4A 1FA3A 1MWUA 1LQMB 2F86B 1DMQA 4N6TA 3FSDA 1UW1A 1RN1A 1ASKA 3N54B 5ELUA 2Z6BA 3VGNA 2IUJA 2QA43 1JKGA 3KIIA 1LRAA 4BL2A 2CWUA 4RNTA 5IG4A 1U8CB 4CCVA 4WFOA 3SOAA 1Q7Y4 3SLUA 4BU4A 1JZOA 1GY7A 1I2FA 1BRNL 1JB4A 3Q2PA 2CKFB 1GMRA 2GEYA 3LYGA 3X3XA 4IT7A 1B21A 3NX0A 3OV4A 3AGOA 1ZGXA 3G0KA 3CD63 1A90A 1TUHA 1BRGA 2OCTA 2GU1A 1F8NA 1STDA 3K7CA 1BRJA 1NJI4 1GYBA 1US1A 2CWTA 2BNGA 1N9EA 5AEUB 1DVDA 1HKXA 1TRPA 4WYKB 3WA3A 4Q53A 4OK0A 1I2EA 1W5ZA 4HM0B 4X2HA 5G2GA 1EQKA 3QK9A 4R9KA 5D83A 1TFKA 1ISKA 1MOLA 3CCM3 4HM5B 2HMNB 2YFJB 1IVUA 1ROAA 1RJOA 3HI7A 1W2B2 1VQ83 2ZA4A 3ECFA 2BHMA 3K63A 3L0RA 3LZAA 4PEJA 3PCRA 4AKYA 5M19A 1YVSA 1K28A 3U97A 2OOVA 4XM4A 6RNTA 5IF6A 3Q90A 5I97A 2CG1A 3BNBA 4LZIA 1RRHA 3SEDA 1NB3I 1W00A 3DGOA 4LMIA 1JN5B 3WMDA 2C11A 3EE1A 3I553 2MF7A 2FGTA 2CK3H 3KSED 1RGCA 4J5GA 1A67A 4AKZA 1JBRA 2E2VA 1M9GA 3MWZA 1MWRA 1GMPA 1RLSA 5KP4A 4WYKA 4K1VA 3RGAA 1K41A 1Y4KA 2XR8B 4BIRA 3GZYB 5IG5A 2QIYA 1I0VA 2IYJA 4XBYA 1I8VA 1OH0A 1K8A4 3FH1A 1G0TA 3OWUA 1LXEA 2V1LA 4HZ9B 2MC8A 3UL6A 3G4S3 1FW7A 1UCKA 5LC6A 2W04A 3GSPA 4FMCA 1AQZA 2CHCA 1BNRA 1I3IA 1TRQA 3F7SA 4EV5A 3HIGA 2WOHA 3K0ZA 4K61A 4N6LA 2BMRB 2XGNA 1B2ZA 3HOHA 1BSBA 2J8XB 4O3VA 2BT3A 3KSPA 2HMMB 2STDA 1V74A 1RCKA 1LVNA 1FGOA 2IY2A 2KXGA 4X2OA 1MGRA 4CJNA 1JN5A 1V57A 7RNTA 2H0IA 3PYJA 1EEJA 1E3VA 1N5HA 3WR2A 3BB9A 4GL6A 2GBXB 3D3LA 4FMAA 1OACA 3NHXA 3HZPA 4IPBA 1L5GB 4BL3A 3CCV3 1YJ93 9RNTA 1VQ93 4O2HA 1BANA 3X3ZA 2CWVA 1IVVA 4LGQA 3J7Yd 1DETA 1VZZA 2F5WA 2AADA 3CME3 1GOVA 4R80A 5KP1A 1YHQ3 5STDA 4BTXA 1D6UA 4EBGA 2BO9B 1K734 3F9SA 3LH4A 1JRQA 1LQGC 3T8NA 3UB1A 1BU4A 1IYYA 2WGQA 1AV4A 1TIJA 4HM6B 4J9AA 1VQ53 1TFOA 2M7OA 2W56B 2OTL3 2KF3A 4EC6A 2W6JH 3DUKA 4BTYA 7GSPA 1GD3A 3CPW2 3F8XA 4MMYB 3EN1B 1M1K4 1BNIA 1Q824 5DRVA 5BXQA 1AY7A 2RSXA 5CK6A 5IERA 1QVF2 2IA7A 2Y73A 3RNTA 3I563 4IIAA 1YIJ3 1RGFA 4HM3B 4KFEA 4NPBA 3FKAA 3D5GA 1NU3A 5IG0A 5CF1A 5HOHA 2Z76A 3CC23 3ZFZA 1KSIA 2GBWB 3EN8A 1IU7A 2RGQA 1I0XA 2L4VA 3JUMA 1RHLA 2KRTA 2XRXB 3ALAA 1W01A 1W02A 1X1YA 3LTAA 3PCSA 4FCJA 4GHOA 1VQP3 1VQ43 1QAKA 3NBJA 2UUGC 2B24B 3EC9A 1BRIA 2ZL8A 2Z7AA 1SQWA 2F98A 1R4YA 1RN7A 2PNCA 5A0OB 2ZHXB 4HM8B 4XBXA 7STDA 1YIT3 3VSYA 2OTJ3 3MG1A 3G6E3 1ZO2A 5CF2A 1RGEA 5JPPA 1E97A 1SPUA 4OUQA 1B2MA 2PZVA 1A2KA 3BU4A 4FR9A 5EVHA 3BLZA 1OGZA 1C54A 1IVWA 3F8HA 3BNEA 2CFKA 1M904 4H61A 2OQEC 1QMAA 3CU3A 3PXMA 1DMNA 1B2UA 1UCIA 3H51A 3PS8A 3HK4A 4WWUC 3A5EA 8RNTA 1MWTA 1GD4A 2WOFA 1PYLA 4GB5A 1O7WB 3PZWA 1EA2A 1Z1SA 2GSPA 2JDIH 1T2IA 3BIRA 1BUJA 1W2ZA 2RFRA 3LTCA 4R9LA 1D6YA 3CCU3 3URPA 2QGUA 3F40A 2W56A 1BAOA 4AEQA 1EKMA 2YX9A 3MSOA 2KCDA 4HBRA 3G8ZA 4R1KA 1NNVA 1OUNA 3EBYA 1DYUA 5IG3A 1YVBI 4J8TA 3GZXB 1OF5B 2FXTA 4I4KA 3K9MC 2F5MA 2CH9A 1FUTA 4ZM8A 4N6V0 1AR0A 4N6MA 1BSAA 1UCJA 3DZLA 1RCLA 1NDOB 1G96A 2CFLA 2W9PA 3MPHA 2H0HA 3AMOA 1WNHA 1IT8A 1VQO3 3B4PA 4FMBA 3N9HA 2W2CA 4LSOA 3SXXA 1JB2A 3S28A 3FG1A 1KD14 1VQQA 5BU4A 4EYCA 1UUWB 1K9M4 1I2GA 1QVG2 1IQ8A 1RGAA 3SOYA 4GSPA 3EQQB 1C7HA 5HGRA 4FCMA 1AVLA 2O9UX 3JUQA 2CX1A 1VQM3 1NWWA 3NV0B 5AEWB 4RNZA 1LOVA 1OPYA 3EB8A 5FW5A 4R4KA 1CYUA 3EJVA 1CEWI 1N8QA 1OCVA 3SX1A 1BNJA 1MNLA 3KCHA 1QAFA 1U5OA 2ZDJA 3LMLA 1OGXA 2H0GA 4HYZA 3SVAA 3T0UA 3T8UA 2CFGA 5G1LA 2FNQA 3CMA3 3NQZA 1HU9A 1O7PB 4N3VA 3CCS3 1VQN3 3JVCA 3GAXA 3CCJ3 1J2BA 4JRFA 3WA2X 3X41A 1O7GB 3O8YA 1UUGB 1W4NA 1IV7A 1YGWA 3HIIA 3LT9A 4XDWA 3V99A 1IT7A 3EHCA 4HVNA 2GU3A 1WMOA 4JF8A 1BRKA 2K0MA
chains in the Genus database with same CATH topology
1RRLA 3DY5A 3F7XA 3IPTA 5AIGA 1WMPA 2UX0A 3NV0A 2CFWA 3BNCA 4WHAA 1E3RA 1Q40B 3GZBA 4RZMA 3KFQC 3FZWA 3UNLA 2XFSA 3S5CA 3WOFB 5AYRB 2Y74A 3X42A 5CXOA 2CFDA 5D81A 2W0QA 4MMXB 3N8BA 2SBLA 2D42A 3DXOA 4U13A 1SIIA 2XGLA 3DGMA 4KVHA 4OVMA 3MG2A 3MYTA 3FG3A 4ORLA 1WQLB 3CCQ3 2CIUA 4XDVA 1JB5A 1JV2B 2F99A 2XF3A 1AVKA 2RCDA 1QJGA 2P0MA 2CC3A 4N6NB 5AIHA 3TDGA 3LTDA 1CQSA 2R4IA 5JBSA 2XH9A 3NM7A 3B8LA 3S67A 2WO0A 5D82A 4NHFA 3D9RA 1JNQA 1WTHA 3UJMA 2CG0A 4HKVB 2C10A 2GXFA 1UUVB 5AYSC 3BNDA 2OQEA 1ZX2A 3CCE3 1N9JA 2E2UA 5DREA 5KP3A 1ROVA 3MG3A 4WP5A 2D1WA 3KN4A 3QRDA 1LNHA 2XFTA 2XSHB 3U1WA 3CPOA 1IVXA 5IENA 6STDA 1SIHA 5TGNA 3RDEA 3G713 2E2TA 3IJEB 4HZBB 4CDLA 4EV2A 3FGYA 3CCR3 1ULJB 2OWPA 1O7HB 3WOEB 1FGMA 1ULIB 1OHSA 1S5AA 1Q40A 2A15A 1N8R4 2CW9A 3OW22 4HM7B 1DMMA 1QALA 3JUNA 5CLKA 1R4CA 2Z77A 3I0YA 1A2VA 3DM8A 1VQ73 3B7CA 1FGRA 2INXA 4L7KA 2O3OA 2IUKA 3KKGA 2K54A 2ML5A 2P05A 3KZTA 3FG4A 3VF1A 1YJW3 2BMQB 2P0XA 2XSOB 3CC73 4STDA 4N6OB 1SJWA 5EQLA 3FCSB 4LEHA 1GY6A 1O7NB 2YFIB 3LT8A 3V98A 1VQ63 3V92A 3STDA 2JQ5A 5BVBA 1FGQA 4FCZA 4K1UA 2ML6A 3LTBA 5LC7A 1JKGB 1STFI 1Q42A 3NBRA 3M8CA 4N6UA 4NREA 4L8OA 4RBNA 1WMNA 3CCL3 3EBTA 1D6ZA 1O7MB 4L8PA 4FMDA 4MJDA 3OWYA 1IQXA 4HM4B 1OHOA 4O02B 3MKIA 1IQYA 4H3UA 3GWRA 3A76A 4RNYA 3ER7A 1BUQA 3NXJA 3IMAB 3FF2A 3LOYA 1EG9B 1N5PA 1T5YA 3DGNA 4XBTA 4XM4A 2B1XB 4HM1B 3WODG 4XB5A 2QEX3 1KQS2 1UI8A 5IEPA 1M1XB 5ELJA 5AI1A 2YFLB 3CNMA 1UI7A 3K5TA 1KWIA 1FGTA 4KFFA 5IW9A 3X3YA 3NUVA 3S27A 4TX4A 3WDGB 1W6YA 1YJN3 1W6GA 3FF0A 1KC84 3NM2A 3EF8A 4KZ1A 1DVCA 4QWTA 4G1MB 3S29A 4O8SA 3DGLA 4HJLB 2HMJB 3GRDA 5EEOA 1OHPA 1TU5A 3Q1CA 4HM2B 3OX9A 3OXAA 1VQK3 3RGRA 3CNXA 2Q07A 2W9QA 1W7CA 4EXRA 2OOVC 2I9WA 1IDPA 3GZRA 5JPUA 1YI23 1FUWA 5FGOA 4MMZB 2HMOB 3HX8A 3CXC2 3PGBA 2IMJA 1YGEA 5AIFA 3MHEA 1LOXA 1PFPA 1NB5I 3EX9A 8CHOA 3JUOA 1GY5A 1JJ22 1TP6A 1VQL3 3ROBA 3UL5A 2HMKB 4KFDA 3B4OA 4MEIA 1PU4A 3DMCA 5AIIA 2P09A 3CC43 5IEOA 3NBBA 2GEXA 3NQYA 3X40A 2BMOB 2WGOA 3G16A 2HMLB 2LYXA 3LXUX 1VQN3 1A67A 1NO3A 1S723 4K90B 2P38A 2XEPA 3E99A 3H3HA 3KE7A 1IK3A 1OF5A 2W03A 3JUPA 2LQVA 3F14A 1GS3A 3FLJA 1Q814 1Q864 1CYVA 4BTWA 1W6CA 3AMOB 3OWSA 1IV9A 1FA3A 2F86B 1DMQA 4N6TA 3FSDA 1UW1A 1ASKA 3N54B 5ELUA 2Z6BA 3VGNA 2IUJA 2QA43 1JKGA 3KIIA 2CWUA 5IG4A 1U8CB 4CCVA 4WFOA 3SOAA 1Q7Y4 3SLUA 1GY7A 1JB4A 3Q2PA 2CKFB 2GEYA 3X3XA 3LYGA 1RKYA 4IT7A 3NX0A 3OV4A 1A90A 3G0KA 1TUHA 3K7CA 2OCTA 2GU1A 1F8NA 1STDA 1NJI4 1GYBA 1US1A 2CWTA 2BNGA 1N9EA 5AEUB 1DVDA 1HKXA 4WYKB 3WA3A 4Q53A 4OK0A 1W5ZA 5G2GA 4HM0B 4X2HA 1EQKA 3QK9A 4R9KA 5D83A 1TFKA 1ISKA 1MOLA 3CCM3 4HM5B 2HMNB 2YFJB 1IVUA 1ROAA 1RJOA 3HI7A 1W2B2 1VQ83 3ECFA 2BHMA 3K63A 3L0RA 3LZAA 4PEJA 3PCRA 4AKYA 1K28A 3U97A 2OOVA 5IF6A 3Q90A 5I97A 2CG1A 3BNBA 4LZIA 1RRHA 3SEDA 1NB3I 1W00A 3DGOA 4LMIA 1JN5B 3WMDA 2C11A 3EE1A 3I553 2MF7A 2FGTA 2CK3H 3KSED 4AKZA 2E2VA 1M9GA 3MWZA 5KP4A 4WYKA 4K1VA 3RGAA 1K41A 1Y4KA 2XR8B 5IG5A 3GZYB 3CME3 2QIYA 1K8A4 3CD63 4XBYA 1OH0A 3FH1A 3OWUA 1LXEA 2V1LA 4HZ9B 2MC8A 3UL6A 3G4S3 5LC6A 2W04A 4FMCA 2CHCA 3F7SA 4EV5A 3HIGA 2WOHA 3K0ZA 4K61A 4N6LA 2BMRB 2XGNA 4O3VA 2BT3A 3KSPA 2HMMB 2STDA 1V74A 2KXGA 1LVNA 1FGOA 4X2OA 1JN5A 3PYJA 1E3VA 1N5HA 3BB9A 4GL6A 2GBXB 3D3LA 4FMAA 1OACA 3NHXA 3HZPA 4IPBA 1L5GB 1YJ93 3CCV3 1VQ93 4O2HA 3X3ZA 2CWVA 1IVVA 4LGQA 3J7Yd 1VZZA 4R80A 5KP1A 1YHQ3 5STDA 4BTXA 1D6UA 4EBGA 2BO9B 1K734 3F9SA 3LH4A 1JRQA 3T8NA 3UB1A 2WGQA 1AV4A 1TIJA 4HM6B 4J9AA 1VQ53 1TFOA 2M7OA 2W56B 2OTL3 4EC6A 2W6JH 3DUKA 4BTYA 1GD3A 3CPW2 3F8XA 4MMYB 3EN1B 1M1K4 1Q824 5DRVA 5BXQA 5CK6A 2RSXA 5IERA 1QVF2 2IA7A 2Y73A 3I563 4IIAA 1YIJ3 4HM3B 4KFEA 3FKAA 1NU3A 5IG0A 5CF1A 2Z76A 3CC23 1KSIA 2GBWB 3EN8A 1IU7A 2RGQA 2L4VA 3JUMA 2KRTA 2XRXB 3ALAA 3PCSA 1W01A 1W02A 3LTAA 4FCJA 1VQP3 1VQ43 1QAKA 3NBJA 2B24B 3EC9A 2ZL8A 2Z7AA 1SQWA 2F98A 1RN7A 2PNCA 5A0OB 4HM8B 4XBXA 7STDA 1YIT3 2OTJ3 3VSYA 3MG1A 3G6E3 1ZO2A 5CF2A 5JPPA 1E97A 1SPUA 4OUQA 2PZVA 1A2KA 4FR9A 5EVHA 3BLZA 1OGZA 1IVWA 3F8HA 3BNEA 2CFKA 1M904 4H61A 2OQEC 1QMAA 3CU3A 3PXMA 1DMNA 3PS8A 4WWUC 3H51A 3HK4A 1GD4A 2WOFA 4GB5A 1O7WB 3PZWA 1EA2A 1Z1SA 2JDIH 1W2ZA 2RFRA 3LTCA 4R9LA 1D6YA 3CCU3 2QGUA 3F40A 2W56A 4AEQA 1EKMA 2YX9A 3MSOA 2KCDA 4HBRA 3G8ZA 4R1KA 1OUNA 3EBYA 1DYUA 5IG3A 1YVBI 4J8TA 3GZXB 1OF5B 2FXTA 4I4KA 3K9MC 2CH9A 4ZM8A 4N6V0 1AR0A 4N6MA 3DZLA 1NDOB 1G96A 2CFLA 2W9PA 3MPHA 3AMOA 1WNHA 1IT8A 1VQO3 3B4PA 4FMBA 3N9HA 2W2CA 4LSOA 3SXXA 1JB2A 3S28A 3FG1A 1KD14 4EYCA 1UUWB 1K9M4 1QVG2 1IQ8A 3SOYA 3EQQB 1C7HA 5HGRA 4FCMA 1AVLA 2O9UX 3JUQA 1VQM3 1NWWA 3NV0B 5AEWB 4RNZA 1OPYA 3EB8A 5FW5A 4R4KA 1CYUA 3EJVA 1CEWI 1N8QA 1OCVA 3SX1A 1MNLA 3LMLA 1QAFA 1U5OA 2ZDJA 1OGXA 4HYZA 3T8UA 3SVAA 3T0UA 2CFGA 2FNQA 3CMA3 3NQZA 1HU9A 1O7PB 4N3VA 3CCS3 3JVCA 3GAXA 3CCJ3 1J2BA 4JRFA 3WA2X 3X41A 1O7GB 3O8YA 3HIIA 1W4NA 1IV7A 3LT9A 4XDWA 3V99A 1IT7A 3EHCA 4HVNA 2GU3A 1WMOA 4JF8A 2K0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB3 I;  2BO9 B;  1CYV A;  3LH4 A;  1DVC A;  3QRD A;  1IV9 A;  3K9M C;  2CH9 A;  2KXG A;  3PXM A;  4N6V 0;  3UL5 A;  3PS8 A;  4ZM8 A;  1CYU A;  1CEW I;  4N6M A;  3KSE D;  4N6T A;  1TIJ A;  1MNL A;  3IMA B;  1GD4 A;  4N6N B;  1M9G A;  3MWZ A;  3SVA A;  3PYJ A;  5ELU A;  1N5P A;  3KFQ C;  1N5H A;  1EQK A;  1G96 A;  4N6O B;  1FA3 A;  2W9P A;  5EQL A;  1GD3 A;  1WNH A;  1MOL A;  1RN7 A;  2W9Q A;  5A0O B;  4CCV A;  1A67 A;  3UL6 A;  1LXE A;  1ROA A;  5ELJ A;  3S67 A;  3GAX A;  1FUW A;  5LC7 A;  5LC6 A;  4EYC A;  1STF I;  3L0R A;  4N6U A;  1IV7 A;  3Q2P A;  1KWI A;  1N9J A;  3NX0 A;  4IT7 A;  1R4C A;  2O9U X;  1A90 A;  1PFP A;  1NB5 I;  4N6L A;  4LZI A;  1DVD A;  2OCT A;  4TX4 A;  1YVB I; 
#chains in the Genus database with same CATH topology
 1RRL A;  3DY5 A;  3F7X A;  3IPT A;  1BRH A;  5AIG A;  1WMP A;  2UX0 A;  3NV0 A;  2CFW A;  3BNC A;  4WHA A;  1E3R A;  1BIR A;  1Q40 B;  3GZB A;  4RZM A;  3KFQ C;  3FZW A;  1B3S A;  2XFS A;  3UNL A;  1BSD A;  3S5C A;  3AHS A;  3DGY A;  5GSP A;  3WOF B;  5AYR B;  2Y74 A;  3X42 A;  1TTO A;  1BSE A;  5CXO A;  2CFD A;  5D81 A;  2W0Q A;  4MMX B;  3N8B A;  2SBL A;  2D42 A;  3DXO A;  2RNT A;  1SII A;  2XGL A;  4HOH A;  3AHW A;  3DGM A;  4U13 A;  4KVH A;  4OVM A;  2F56 A;  3MG2 A;  3MYT A;  1RGG A;  3FG3 A;  1WQL B;  4ORL A;  3WHO A;  2AAE A;  3CCQ 3;  2SAR A;  2CIU A;  3D5I A;  4XDV A;  1JB5 A;  1JV2 B;  1LNI A;  2F99 A;  2XF3 A;  1A2P A;  1AVK A;  2RCD A;  1QJG A;  2P0M A;  2CC3 A;  4N6N B;  5AIH A;  3TDG A;  3LTD A;  1CQS A;  2R4I A;  5JBS A;  3Q3F A;  2XH9 A;  3NM7 A;  3B8L A;  2K3D A;  3S67 A;  2WO0 A;  5D82 A;  4NHF A;  3D9R A;  1JNQ A;  1WTH A;  3UJM A;  2CG0 A;  4HKV B;  4CPK A;  1MWS A;  1PY3 A;  1UGH I;  2C10 A;  2GXF A;  1UUV B;  2KAA A;  5AYS C;  3BND A;  4HAA A;  2OQE A;  1ZX2 A;  3CCE 3;  1N9J A;  2E2U A;  1Q7H A;  5DRE A;  5KP3 A;  1ROV A;  3MG3 A;  4WP5 A;  2D1W A;  3KN4 A;  3QRD A;  1LNH A;  2XFT A;  2XSH B;  3U1W A;  3CPO A;  1V58 A;  1IVX A;  4EW5 A;  1HYF A;  6STD A;  5IEN A;  1SIH A;  2L1S A;  5TGN A;  3RDE A;  3G71 3;  2E2T A;  3IJE B;  4HZB B;  4CDL A;  4EV2 A;  3FGY A;  3CCR 3;  1ULJ B;  2OWP A;  1O7H B;  3WOE B;  1BRS A;  1FGM A;  1ULI B;  1OHS A;  1S5A A;  1Q40 A;  2A15 A;  1N8R 4;  1EUI C;  1GOY A;  2CW9 A;  3OW2 2;  4HM7 B;  1DMM A;  1QAL A;  3JUN A;  5CLK A;  1R4C A;  1RSN A;  2Z77 A;  1A2V A;  3DM8 A;  2R41 A;  3B7C A;  3I0Y A;  1VQ7 3;  1BNS A;  1FGR A;  1LOW A;  2INX A;  1T3B A;  4J5K A;  1SAR A;  4L7K A;  1B2X A;  2IUK A;  1BVI A;  2KF4 A;  2K54 A;  2O3O A;  2ML5 A;  3KKG A;  1FUS A;  2P05 A;  3KZT A;  1YNV X;  3FG4 A;  3VF1 A;  1YJW 3;  1BNG A;  4KT3 B;  2BMQ B;  2P0X A;  2XSO B;  2UGI A;  3CC7 3;  4STD A;  1BSC A;  1X1U A;  1SJW A;  4N6O B;  5EQL A;  1DE3 A;  3FCS B;  4LEH A;  1GY6 A;  1O7N B;  1RNT A;  2YFI B;  3LT8 A;  3V98 A;  1LOY A;  1VQ6 3;  3V92 A;  3STD A;  2JQ5 A;  5BVB A;  1FGQ A;  4FCZ A;  4K1U A;  2ML6 A;  3LTB A;  5LC7 A;  1JKG B;  1STF I;  1Q42 A;  3NBR A;  3M8C A;  4N6U A;  4NRE A;  4L8O A;  4RBN A;  1WMN A;  3CCL 3;  3EBT A;  1D6Z A;  1O7M B;  4L8P A;  4FMD A;  4MJD A;  1RNB A;  3OWY A;  1FZU A;  1JBT A;  1IQX A;  4HM4 B;  1OHO A;  4O02 B;  3MKI A;  1IQY A;  4H3U A;  3GWR A;  3A76 A;  4RNY A;  3ER7 A;  1BUQ A;  3NXJ A;  1RGL A;  2BIR A;  3IMA B;  1T2H A;  3FF2 A;  1G02 A;  3LOY A;  1EG9 B;  1N5P A;  1BNF A;  1I3F A;  1T5Y A;  3DGN A;  3DH2 A;  2B1X B;  4HM1 B;  4XBT A;  3WOD G;  4XB5 A;  2QEX 3;  1KQS 2;  1UI8 A;  5IEP A;  1GSP A;  1I70 A;  1BNE A;  1M1X B;  5ELJ A;  5AI1 A;  1GMQ A;  2YFL B;  1UCL A;  3CNM A;  1JZD A;  1UI7 A;  3K5T A;  1RKY A;  1KWI A;  1FGT A;  4KFF A;  5IW9 A;  3X3Y A;  3NUV A;  3S27 A;  1ZS7 A;  3SYU A;  3ZG5 A;  4TX4 A;  3WDG B;  1W6Y A;  1YJN 3;  1W6G A;  3FF0 A;  1KC8 4;  3NM2 A;  1BOX A;  3EF8 A;  1DVC A;  2KF5 A;  4KZ1 A;  4QWT A;  4G1M B;  5M18 A;  3S29 A;  4DKI A;  4O8S A;  3DGL A;  4HJL B;  2HMJ B;  3ZG0 A;  1Q9E A;  3GRD A;  5EEO A;  1OHP A;  4ILF A;  1RTU A;  1TU5 A;  3Q1C A;  1HZ1 A;  4HM2 B;  1B20 A;  2RBI A;  3OX9 A;  1BGS A;  3OXA A;  3RGR A;  1X1X A;  3CNX A;  1VQK 3;  2Q07 A;  2W9Q A;  1MGW A;  1W7C A;  4EXR A;  2HOH A;  2OOV C;  2I9W A;  1IDP A;  1RN4 A;  3GZR A;  5JPU A;  1YI2 3;  1FUW A;  5FGO A;  4MMZ B;  2HMO B;  1UGI A;  3HX8 A;  3CXC 2;  5BIR A;  3PGB A;  2IMJ A;  1YGE A;  5AIF A;  3MHE A;  1LOX A;  1PFP A;  1NB5 I;  3EX9 A;  3D4A A;  8CHO A;  3JUO A;  1GY5 A;  5RNT A;  1JJ2 2;  1CH0 A;  1TP6 A;  1X1W A;  5M1A A;  3ROB A;  1VQL 3;  3UL5 A;  2HMK B;  4KFD A;  3B4O A;  4MEI A;  1PU4 A;  3DMC A;  5AII A;  2KF6 A;  4LYL B;  2P09 A;  1GOU A;  2CX0 A;  3CC4 3;  6GSP A;  5IEO A;  3NBB A;  2GEX A;  1TJD A;  3NQY A;  2BMO B;  2WGO A;  3G16 A;  2HML B;  2LYX A;  3LXU X;  4I5Q A;  3X40 A;  1B2S A;  1NO3 A;  3AGN A;  4K90 B;  1S72 3;  1JBS A;  2P38 A;  2XEP A;  3E99 A;  5G1K A;  3H3H A;  1RGH A;  3KE7 A;  1RMS A;  1FYS A;  1IK3 A;  1OF5 A;  2W03 A;  2C4B A;  3JUP A;  2LQV A;  3F14 A;  1GS3 A;  1UDI I;  3FLJ A;  1Q81 4;  1Q86 4;  3D79 A;  1B27 A;  1CYV A;  1RDS A;  1RGK A;  2F4Y A;  4BTW A;  1W6C A;  3AMO B;  3OWS A;  1IV9 A;  2BU4 A;  1FA3 A;  1MWU A;  1LQM B;  2F86 B;  1DMQ A;  4N6T A;  3FSD A;  1UW1 A;  1RN1 A;  1ASK A;  3N54 B;  5ELU A;  2Z6B A;  3VGN A;  2IUJ A;  2QA4 3;  1JKG A;  3KII A;  1LRA A;  4BL2 A;  2CWU A;  4RNT A;  5IG4 A;  1U8C B;  4CCV A;  4WFO A;  3SOA A;  1Q7Y 4;  3SLU A;  4BU4 A;  1JZO A;  1GY7 A;  1I2F A;  1BRN L;  1JB4 A;  3Q2P A;  2CKF B;  1GMR A;  2GEY A;  3LYG A;  3X3X A;  4IT7 A;  1B21 A;  3NX0 A;  3OV4 A;  3AGO A;  1ZGX A;  3G0K A;  3CD6 3;  1A90 A;  1TUH A;  1BRG A;  2OCT A;  2GU1 A;  1F8N A;  1STD A;  3K7C A;  1BRJ A;  1NJI 4;  1GYB A;  1US1 A;  2CWT A;  2BNG A;  1N9E A;  5AEU B;  1DVD A;  1HKX A;  1TRP A;  4WYK B;  3WA3 A;  4Q53 A;  4OK0 A;  1I2E A;  1W5Z A;  4HM0 B;  4X2H A;  5G2G A;  1EQK A;  3QK9 A;  4R9K A;  5D83 A;  1TFK A;  1ISK A;  1MOL A;  3CCM 3;  4HM5 B;  2HMN B;  2YFJ B;  1IVU A;  1ROA A;  1RJO A;  3HI7 A;  1W2B 2;  1VQ8 3;  2ZA4 A;  3ECF A;  2BHM A;  3K63 A;  3L0R A;  3LZA A;  4PEJ A;  3PCR A;  4AKY A;  5M19 A;  1YVS A;  1K28 A;  3U97 A;  2OOV A;  4XM4 A;  6RNT A;  5IF6 A;  3Q90 A;  5I97 A;  2CG1 A;  3BNB A;  4LZI A;  1RRH A;  3SED A;  1NB3 I;  1W00 A;  3DGO A;  4LMI A;  1JN5 B;  3WMD A;  2C11 A;  3EE1 A;  3I55 3;  2MF7 A;  2FGT A;  2CK3 H;  3KSE D;  1RGC A;  4J5G A;  1A67 A;  4AKZ A;  1JBR A;  2E2V A;  1M9G A;  3MWZ A;  1MWR A;  1GMP A;  1RLS A;  5KP4 A;  4WYK A;  4K1V A;  3RGA A;  1K41 A;  1Y4K A;  2XR8 B;  4BIR A;  3GZY B;  5IG5 A;  2QIY A;  1I0V A;  2IYJ A;  4XBY A;  1I8V A;  1OH0 A;  1K8A 4;  3FH1 A;  1G0T A;  3OWU A;  1LXE A;  2V1L A;  4HZ9 B;  2MC8 A;  3UL6 A;  3G4S 3;  1FW7 A;  1UCK A;  5LC6 A;  2W04 A;  3GSP A;  4FMC A;  1AQZ A;  2CHC A;  1BNR A;  1I3I A;  1TRQ A;  3F7S A;  4EV5 A;  3HIG A;  2WOH A;  3K0Z A;  4K61 A;  4N6L A;  2BMR B;  2XGN A;  1B2Z A;  3HOH A;  1BSB A;  2J8X B;  4O3V A;  2BT3 A;  3KSP A;  2HMM B;  2STD A;  1V74 A;  1RCK A;  1LVN A;  1FGO A;  2IY2 A;  2KXG A;  4X2O A;  1MGR A;  4CJN A;  1JN5 A;  1V57 A;  7RNT A;  2H0I A;  3PYJ A;  1EEJ A;  1E3V A;  1N5H A;  3WR2 A;  3BB9 A;  4GL6 A;  2GBX B;  3D3L A;  4FMA A;  1OAC A;  3NHX A;  3HZP A;  4IPB A;  1L5G B;  4BL3 A;  3CCV 3;  1YJ9 3;  9RNT A;  1VQ9 3;  4O2H A;  1BAN A;  3X3Z A;  2CWV A;  1IVV A;  4LGQ A;  3J7Y d;  1DET A;  1VZZ A;  2F5W A;  2AAD A;  3CME 3;  1GOV A;  4R80 A;  5KP1 A;  1YHQ 3;  5STD A;  4BTX A;  1D6U A;  4EBG A;  2BO9 B;  1K73 4;  3F9S A;  3LH4 A;  1JRQ A;  1LQG C;  3T8N A;  3UB1 A;  1BU4 A;  1IYY A;  2WGQ A;  1AV4 A;  1TIJ A;  4HM6 B;  4J9A A;  1VQ5 3;  1TFO A;  2M7O A;  2W56 B;  2OTL 3;  2KF3 A;  4EC6 A;  2W6J H;  3DUK A;  4BTY A;  7GSP A;  1GD3 A;  3CPW 2;  3F8X A;  4MMY B;  3EN1 B;  1M1K 4;  1BNI A;  1Q82 4;  5DRV A;  5BXQ A;  1AY7 A;  2RSX A;  5CK6 A;  5IER A;  1QVF 2;  2IA7 A;  2Y73 A;  3RNT A;  3I56 3;  4IIA A;  1YIJ 3;  1RGF A;  4HM3 B;  4KFE A;  4NPB A;  3FKA A;  3D5G A;  1NU3 A;  5IG0 A;  5CF1 A;  5HOH A;  2Z76 A;  3CC2 3;  3ZFZ A;  1KSI A;  2GBW B;  3EN8 A;  1IU7 A;  2RGQ A;  1I0X A;  2L4V A;  3JUM A;  1RHL A;  2KRT A;  2XRX B;  3ALA A;  1W01 A;  1W02 A;  1X1Y A;  3LTA A;  3PCS A;  4FCJ A;  4GHO A;  1VQP 3;  1VQ4 3;  1QAK A;  3NBJ A;  2UUG C;  2B24 B;  3EC9 A;  1BRI A;  2ZL8 A;  2Z7A A;  1SQW A;  2F98 A;  1R4Y A;  1RN7 A;  2PNC A;  5A0O B;  2ZHX B;  4HM8 B;  4XBX A;  7STD A;  1YIT 3;  3VSY A;  2OTJ 3;  3MG1 A;  3G6E 3;  1ZO2 A;  5CF2 A;  1RGE A;  5JPP A;  1E97 A;  1SPU A;  4OUQ A;  1B2M A;  2PZV A;  1A2K A;  3BU4 A;  4FR9 A;  5EVH A;  3BLZ A;  1OGZ A;  1C54 A;  1IVW A;  3F8H A;  3BNE A;  2CFK A;  1M90 4;  4H61 A;  2OQE C;  1QMA A;  3CU3 A;  3PXM A;  1DMN A;  1B2U A;  1UCI A;  3H51 A;  3PS8 A;  3HK4 A;  4WWU C;  3A5E A;  8RNT A;  1MWT A;  1GD4 A;  2WOF A;  1PYL A;  4GB5 A;  1O7W B;  3PZW A;  1EA2 A;  1Z1S A;  2GSP A;  2JDI H;  1T2I A;  3BIR A;  1BUJ A;  1W2Z A;  2RFR A;  3LTC A;  4R9L A;  1D6Y A;  3CCU 3;  3URP A;  2QGU A;  3F40 A;  2W56 A;  1BAO A;  4AEQ A;  1EKM A;  2YX9 A;  3MSO A;  2KCD A;  4HBR A;  3G8Z A;  4R1K A;  1NNV A;  1OUN A;  3EBY A;  1DYU A;  5IG3 A;  1YVB I;  4J8T A;  3GZX B;  1OF5 B;  2FXT A;  4I4K A;  3K9M C;  2F5M A;  2CH9 A;  1FUT A;  4ZM8 A;  4N6V 0;  1AR0 A;  4N6M A;  1BSA A;  1UCJ A;  3DZL A;  1RCL A;  1NDO B;  1G96 A;  2CFL A;  2W9P A;  3MPH A;  2H0H A;  3AMO A;  1WNH A;  1IT8 A;  1VQO 3;  3B4P A;  4FMB A;  3N9H A;  2W2C A;  4LSO A;  3SXX A;  1JB2 A;  3S28 A;  3FG1 A;  1KD1 4;  1VQQ A;  5BU4 A;  4EYC A;  1UUW B;  1K9M 4;  1I2G A;  1QVG 2;  1IQ8 A;  1RGA A;  3SOY A;  4GSP A;  3EQQ B;  1C7H A;  5HGR A;  4FCM A;  1AVL A;  2O9U X;  3JUQ A;  2CX1 A;  1VQM 3;  1NWW A;  3NV0 B;  5AEW B;  4RNZ A;  1LOV A;  1OPY A;  3EB8 A;  5FW5 A;  4R4K A;  1CYU A;  3EJV A;  1CEW I;  1N8Q A;  1OCV A;  3SX1 A;  1BNJ A;  1MNL A;  3KCH A;  1QAF A;  1U5O A;  2ZDJ A;  3LML A;  1OGX A;  2H0G A;  4HYZ A;  3SVA A;  3T0U A;  3T8U A;  2CFG A;  5G1L A;  2FNQ A;  3CMA 3;  3NQZ A;  1HU9 A;  1O7P B;  4N3V A;  3CCS 3;  1VQN 3;  3JVC A;  3GAX A;  3CCJ 3;  1J2B A;  4JRF A;  3WA2 X;  3X41 A;  1O7G B;  3O8Y A;  1UUG B;  1W4N A;  1IV7 A;  1YGW A;  3HII A;  3LT9 A;  4XDW A;  3V99 A;  1IT7 A;  3EHC A;  4HVN A;  2GU3 A;  1WMO A;  4JF8 A;  1BRK A;  2K0M A; 
#chains in the Genus database with same CATH homology
 1RRL A;  3DY5 A;  3F7X A;  3IPT A;  5AIG A;  1WMP A;  2UX0 A;  3NV0 A;  2CFW A;  3BNC A;  4WHA A;  1E3R A;  1Q40 B;  3GZB A;  4RZM A;  3KFQ C;  3FZW A;  3UNL A;  2XFS A;  3S5C A;  3WOF B;  5AYR B;  2Y74 A;  3X42 A;  5CXO A;  2CFD A;  5D81 A;  2W0Q A;  4MMX B;  3N8B A;  2SBL A;  2D42 A;  3DXO A;  4U13 A;  1SII A;  2XGL A;  3DGM A;  4KVH A;  4OVM A;  3MG2 A;  3MYT A;  3FG3 A;  4ORL A;  1WQL B;  3CCQ 3;  2CIU A;  4XDV A;  1JB5 A;  1JV2 B;  2F99 A;  2XF3 A;  1AVK A;  2RCD A;  1QJG A;  2P0M A;  2CC3 A;  4N6N B;  5AIH A;  3TDG A;  3LTD A;  1CQS A;  2R4I A;  5JBS A;  2XH9 A;  3NM7 A;  3B8L A;  3S67 A;  2WO0 A;  5D82 A;  4NHF A;  3D9R A;  1JNQ A;  1WTH A;  3UJM A;  2CG0 A;  4HKV B;  2C10 A;  2GXF A;  1UUV B;  5AYS C;  3BND A;  2OQE A;  1ZX2 A;  3CCE 3;  1N9J A;  2E2U A;  5DRE A;  5KP3 A;  1ROV A;  3MG3 A;  4WP5 A;  2D1W A;  3KN4 A;  3QRD A;  1LNH A;  2XFT A;  2XSH B;  3U1W A;  3CPO A;  1IVX A;  5IEN A;  6STD A;  1SIH A;  5TGN A;  3RDE A;  3G71 3;  2E2T A;  3IJE B;  4HZB B;  4CDL A;  4EV2 A;  3FGY A;  3CCR 3;  1ULJ B;  2OWP A;  1O7H B;  3WOE B;  1FGM A;  1ULI B;  1OHS A;  1S5A A;  1Q40 A;  2A15 A;  1N8R 4;  2CW9 A;  3OW2 2;  4HM7 B;  1DMM A;  1QAL A;  3JUN A;  5CLK A;  1R4C A;  2Z77 A;  3I0Y A;  1A2V A;  3DM8 A;  1VQ7 3;  3B7C A;  1FGR A;  2INX A;  4L7K A;  2O3O A;  2IUK A;  3KKG A;  2K54 A;  2ML5 A;  2P05 A;  3KZT A;  3FG4 A;  3VF1 A;  1YJW 3;  2BMQ B;  2P0X A;  2XSO B;  3CC7 3;  4STD A;  4N6O B;  1SJW A;  5EQL A;  3FCS B;  4LEH A;  1GY6 A;  1O7N B;  2YFI B;  3LT8 A;  3V98 A;  1VQ6 3;  3V92 A;  3STD A;  2JQ5 A;  5BVB A;  1FGQ A;  4FCZ A;  4K1U A;  2ML6 A;  3LTB A;  5LC7 A;  1JKG B;  1STF I;  1Q42 A;  3NBR A;  3M8C A;  4N6U A;  4NRE A;  4L8O A;  4RBN A;  1WMN A;  3CCL 3;  3EBT A;  1D6Z A;  1O7M B;  4L8P A;  4FMD A;  4MJD A;  3OWY A;  1IQX A;  4HM4 B;  1OHO A;  4O02 B;  3MKI A;  1IQY A;  4H3U A;  3GWR A;  3A76 A;  4RNY A;  3ER7 A;  1BUQ A;  3NXJ A;  3IMA B;  3FF2 A;  3LOY A;  1EG9 B;  1N5P A;  1T5Y A;  3DGN A;  4XBT A;  4XM4 A;  2B1X B;  4HM1 B;  3WOD G;  4XB5 A;  2QEX 3;  1KQS 2;  1UI8 A;  5IEP A;  1M1X B;  5ELJ A;  5AI1 A;  2YFL B;  3CNM A;  1UI7 A;  3K5T A;  1KWI A;  1FGT A;  4KFF A;  5IW9 A;  3X3Y A;  3NUV A;  3S27 A;  4TX4 A;  3WDG B;  1W6Y A;  1YJN 3;  1W6G A;  3FF0 A;  1KC8 4;  3NM2 A;  3EF8 A;  4KZ1 A;  1DVC A;  4QWT A;  4G1M B;  3S29 A;  4O8S A;  3DGL A;  4HJL B;  2HMJ B;  3GRD A;  5EEO A;  1OHP A;  1TU5 A;  3Q1C A;  4HM2 B;  3OX9 A;  3OXA A;  1VQK 3;  3RGR A;  3CNX A;  2Q07 A;  2W9Q A;  1W7C A;  4EXR A;  2OOV C;  2I9W A;  1IDP A;  3GZR A;  5JPU A;  1YI2 3;  1FUW A;  5FGO A;  4MMZ B;  2HMO B;  3HX8 A;  3CXC 2;  3PGB A;  2IMJ A;  1YGE A;  5AIF A;  3MHE A;  1LOX A;  1PFP A;  1NB5 I;  3EX9 A;  8CHO A;  3JUO A;  1GY5 A;  1JJ2 2;  1TP6 A;  1VQL 3;  3ROB A;  3UL5 A;  2HMK B;  4KFD A;  3B4O A;  4MEI A;  1PU4 A;  3DMC A;  5AII A;  2P09 A;  3CC4 3;  5IEO A;  3NBB A;  2GEX A;  3NQY A;  3X40 A;  2BMO B;  2WGO A;  3G16 A;  2HML B;  2LYX A;  3LXU X;  1VQN 3;  1A67 A;  1NO3 A;  1S72 3;  4K90 B;  2P38 A;  2XEP A;  3E99 A;  3H3H A;  3KE7 A;  1IK3 A;  1OF5 A;  2W03 A;  3JUP A;  2LQV A;  3F14 A;  1GS3 A;  3FLJ A;  1Q81 4;  1Q86 4;  1CYV A;  4BTW A;  1W6C A;  3AMO B;  3OWS A;  1IV9 A;  1FA3 A;  2F86 B;  1DMQ A;  4N6T A;  3FSD A;  1UW1 A;  1ASK A;  3N54 B;  5ELU A;  2Z6B A;  3VGN A;  2IUJ A;  2QA4 3;  1JKG A;  3KII A;  2CWU A;  5IG4 A;  1U8C B;  4CCV A;  4WFO A;  3SOA A;  1Q7Y 4;  3SLU A;  1GY7 A;  1JB4 A;  3Q2P A;  2CKF B;  2GEY A;  3X3X A;  3LYG A;  1RKY A;  4IT7 A;  3NX0 A;  3OV4 A;  1A90 A;  3G0K A;  1TUH A;  3K7C A;  2OCT A;  2GU1 A;  1F8N A;  1STD A;  1NJI 4;  1GYB A;  1US1 A;  2CWT A;  2BNG A;  1N9E A;  5AEU B;  1DVD A;  1HKX A;  4WYK B;  3WA3 A;  4Q53 A;  4OK0 A;  1W5Z A;  5G2G A;  4HM0 B;  4X2H A;  1EQK A;  3QK9 A;  4R9K A;  5D83 A;  1TFK A;  1ISK A;  1MOL A;  3CCM 3;  4HM5 B;  2HMN B;  2YFJ B;  1IVU A;  1ROA A;  1RJO A;  3HI7 A;  1W2B 2;  1VQ8 3;  3ECF A;  2BHM A;  3K63 A;  3L0R A;  3LZA A;  4PEJ A;  3PCR A;  4AKY A;  1K28 A;  3U97 A;  2OOV A;  5IF6 A;  3Q90 A;  5I97 A;  2CG1 A;  3BNB A;  4LZI A;  1RRH A;  3SED A;  1NB3 I;  1W00 A;  3DGO A;  4LMI A;  1JN5 B;  3WMD A;  2C11 A;  3EE1 A;  3I55 3;  2MF7 A;  2FGT A;  2CK3 H;  3KSE D;  4AKZ A;  2E2V A;  1M9G A;  3MWZ A;  5KP4 A;  4WYK A;  4K1V A;  3RGA A;  1K41 A;  1Y4K A;  2XR8 B;  5IG5 A;  3GZY B;  3CME 3;  2QIY A;  1K8A 4;  3CD6 3;  4XBY A;  1OH0 A;  3FH1 A;  3OWU A;  1LXE A;  2V1L A;  4HZ9 B;  2MC8 A;  3UL6 A;  3G4S 3;  5LC6 A;  2W04 A;  4FMC A;  2CHC A;  3F7S A;  4EV5 A;  3HIG A;  2WOH A;  3K0Z A;  4K61 A;  4N6L A;  2BMR B;  2XGN A;  4O3V A;  2BT3 A;  3KSP A;  2HMM B;  2STD A;  1V74 A;  2KXG A;  1LVN A;  1FGO A;  4X2O A;  1JN5 A;  3PYJ A;  1E3V A;  1N5H A;  3BB9 A;  4GL6 A;  2GBX B;  3D3L A;  4FMA A;  1OAC A;  3NHX A;  3HZP A;  4IPB A;  1L5G B;  1YJ9 3;  3CCV 3;  1VQ9 3;  4O2H A;  3X3Z A;  2CWV A;  1IVV A;  4LGQ A;  3J7Y d;  1VZZ A;  4R80 A;  5KP1 A;  1YHQ 3;  5STD A;  4BTX A;  1D6U A;  4EBG A;  2BO9 B;  1K73 4;  3F9S A;  3LH4 A;  1JRQ A;  3T8N A;  3UB1 A;  2WGQ A;  1AV4 A;  1TIJ A;  4HM6 B;  4J9A A;  1VQ5 3;  1TFO A;  2M7O A;  2W56 B;  2OTL 3;  4EC6 A;  2W6J H;  3DUK A;  4BTY A;  1GD3 A;  3CPW 2;  3F8X A;  4MMY B;  3EN1 B;  1M1K 4;  1Q82 4;  5DRV A;  5BXQ A;  5CK6 A;  2RSX A;  5IER A;  1QVF 2;  2IA7 A;  2Y73 A;  3I56 3;  4IIA A;  1YIJ 3;  4HM3 B;  4KFE A;  3FKA A;  1NU3 A;  5IG0 A;  5CF1 A;  2Z76 A;  3CC2 3;  1KSI A;  2GBW B;  3EN8 A;  1IU7 A;  2RGQ A;  2L4V A;  3JUM A;  2KRT A;  2XRX B;  3ALA A;  3PCS A;  1W01 A;  1W02 A;  3LTA A;  4FCJ A;  1VQP 3;  1VQ4 3;  1QAK A;  3NBJ A;  2B24 B;  3EC9 A;  2ZL8 A;  2Z7A A;  1SQW A;  2F98 A;  1RN7 A;  2PNC A;  5A0O B;  4HM8 B;  4XBX A;  7STD A;  1YIT 3;  2OTJ 3;  3VSY A;  3MG1 A;  3G6E 3;  1ZO2 A;  5CF2 A;  5JPP A;  1E97 A;  1SPU A;  4OUQ A;  2PZV A;  1A2K A;  4FR9 A;  5EVH A;  3BLZ A;  1OGZ A;  1IVW A;  3F8H A;  3BNE A;  2CFK A;  1M90 4;  4H61 A;  2OQE C;  1QMA A;  3CU3 A;  3PXM A;  1DMN A;  3PS8 A;  4WWU C;  3H51 A;  3HK4 A;  1GD4 A;  2WOF A;  4GB5 A;  1O7W B;  3PZW A;  1EA2 A;  1Z1S A;  2JDI H;  1W2Z A;  2RFR A;  3LTC A;  4R9L A;  1D6Y A;  3CCU 3;  2QGU A;  3F40 A;  2W56 A;  4AEQ A;  1EKM A;  2YX9 A;  3MSO A;  2KCD A;  4HBR A;  3G8Z A;  4R1K A;  1OUN A;  3EBY A;  1DYU A;  5IG3 A;  1YVB I;  4J8T A;  3GZX B;  1OF5 B;  2FXT A;  4I4K A;  3K9M C;  2CH9 A;  4ZM8 A;  4N6V 0;  1AR0 A;  4N6M A;  3DZL A;  1NDO B;  1G96 A;  2CFL A;  2W9P A;  3MPH A;  3AMO A;  1WNH A;  1IT8 A;  1VQO 3;  3B4P A;  4FMB A;  3N9H A;  2W2C A;  4LSO A;  3SXX A;  1JB2 A;  3S28 A;  3FG1 A;  1KD1 4;  4EYC A;  1UUW B;  1K9M 4;  1QVG 2;  1IQ8 A;  3SOY A;  3EQQ B;  1C7H A;  5HGR A;  4FCM A;  1AVL A;  2O9U X;  3JUQ A;  1VQM 3;  1NWW A;  3NV0 B;  5AEW B;  4RNZ A;  1OPY A;  3EB8 A;  5FW5 A;  4R4K A;  1CYU A;  3EJV A;  1CEW I;  1N8Q A;  1OCV A;  3SX1 A;  1MNL A;  3LML A;  1QAF A;  1U5O A;  2ZDJ A;  1OGX A;  4HYZ A;  3T8U A;  3SVA A;  3T0U A;  2CFG A;  2FNQ A;  3CMA 3;  3NQZ A;  1HU9 A;  1O7P B;  4N3V A;  3CCS 3;  3JVC A;  3GAX A;  3CCJ 3;  1J2B A;  4JRF A;  3WA2 X;  3X41 A;  1O7G B;  3O8Y A;  3HII A;  1W4N A;  1IV7 A;  3LT9 A;  4XDW A;  3V99 A;  1IT7 A;  3EHC A;  4HVN A;  2GU3 A;  1WMO A;  4JF8 A;  2K0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...