4IT7A

Crystal structure of al-cpi
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
GGFSTKDVNDPKIQALAGKALQRINAASNDLFQQTIVKVISAKTQVVAGTNTVLELLIAPTSCRKNETSAGNCEAVSNGTKQICTVAIWEKPWENFEEITIKECKSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CPI
publication title Structural Basis for the Immunomodulatory Function of Cysteine Protease Inhibitor from Human Roundworm Ascaris lumbricoides.
pubmed doi rcsb
source organism Ascaris lumbricoides
molecule tags Hydrolase inhibitor
total genus 21
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4it7A00
2OCTA 5EQLA 2BO9B 1STFI 3NX0A 3KFQC 3L0RA 3UL5A 3LH4A 2KXGA 1LXEA 4N6OB 3PXMA 1IV7A 2W9QA 1FA3A 1WNHA 5A0OB 4N6NB 3PS8A 4N6LA 1MOLA 2O9UX 1DVCA 1PFPA 4IT7A 1CYUA 1ROAA 1A90A 5ELJA 1FUWA 1GD3A 1YVBI 1EQKA 1GD4A 1N9JA 4N6UA 3PYJA 3QRDA 4N6MA 1CYVA 1R4CA 3GAXA 1A67A 3K9MC 1KWIA 3KSED 1IV9A 3SVAA 5LC7A 1RN7A 1G96A 1N5HA 3MWZA 5ELUA 3S67A 3Q2PA 4ZM8A 4CCVA 4TX4A 3UL6A 1DVDA 1CEWI 1NB3I 4N6TA 1NB5I 1MNLA 2CH9A 5LC6A 1N5PA 1TIJA 2W9PA 4LZIA 3IMAB 4N6V0 4EYCA 1M9GA
chains in the Genus database with same CATH superfamily
5KP3A 2OCTA 4J5GA 3G4S3 1A2KA 5BVBA 2BU4A 1K734 4FMAA 2F56A 3LT8A 1MWTA 3E99A 1B20A 2BMRB 3OX9A 1ULJB 4WWUC 5HOHA 3FG4A 1RLSA 3HOHA 3GZBA 2B1XB 3CCV3 3DGMA 3I0YA 3F7XA 5BXQA 2RBIA 4HZBB 1BNRA 3V99A 2QA43 1Z1SA 4MJDA 5EEOA 2O3OA 4NREA 3CC43 3OW22 2KXGA 1N9EA 1LXEA 3BU4A 3CCR3 1RTUA 3LTCA 2RCDA 1I0XA 3BIRA 4KT3B 3GRDA 5AI1A 2KF5A 1O7HB 1JZDA 2F5MA 4ORLA 3G6E3 2CHCA 1I3FA 1UDII 1BSAA 5IF6A 1GMPA 2P0MA 2BNGA 1SPUA 1J2BA 1LVNA 2R41A 1OACA 1QAKA 8CHOA 1GY7A 4XBYA 5A0OB 5CXOA 4N6LA 3K0ZA 1AR0A 1I2GA 1QAFA 2Y74A 3MG1A 1B3SA 1I2FA 6GSPA 1EKMA 1BRHA 4O8SA 2OWPA 4ILFA 1HZ1A 4IT7A 1STDA 1BRJA 3PCRA 1FUWA 3B8LA 2RGQA 1K8A4 3AHWA 3KN4A 5D83A 4XBTA 1E3RA 3FH1A 3D4AA 1T3BA 4KZ1A 3Q3FA 2LYXA 2XR8B 4WYKB 3UJMA 5CF2A 1WMNA 2Y73A 1VQQA 1EEJA 1FGQA 1K41A 1HYFA 1OPYA 1QJGA 2BT3A 2WO0A 4N6UA 3N8BA 3N9HA 5AEUB 2F98A 3WA3A 3NBBA 2F5WA 3MG3A 2H0GA 3FGYA 3FKAA 3OWUA 4XM4A 3G16A 4IPBA 2L1SA 1BNEA 4BTXA 1W2ZA 1WQLB 2H0HA 4HM4B 4FMCA 3U1WA 2OTJ3 1O7MB 2ZDJA 1B21A 1AY7A 1RNTA 3HX8A 1YJW3 2MF7A 1KWIA 5IG4A 1I2EA 1JZOA 1Q7HA 4LMIA 2CW9A 2C10A 3FF0A 4NPBA 4GB5A 3JUQA 2STDA 1W6CA 3A5EA 3LT9A 1Q9EA 3PCSA 3SXXA 2GSPA 1OGXA 4R1KA 4EC6A 3STDA 2FGTA 4RZMA 2OOVC 3K5TA 3WR2A 1L5GB 3SYUA 3ZFZA 3NHXA 1Y4KA 2XF3A 1IT7A 4EW5A 4J8TA 1B2MA 1X1XA 4J5KA 1KQS2 3PGBA 4K90B 6STDA 2UUGC 1TUHA 3FCSB 3SLUA 1IQXA 1UUVB 1W5ZA 3WOFB 1Q7Y4 4I5QA 2XH9A 4R4KA 3EBYA 4WFOA 3DGYA 5AIHA 4BIRA 1N8QA 4HM5B 4N6TA 1NB5I 2CH9A 1Q40B 3WHOA 1RRHA 1MGRA 1VQ93 3JUMA 4FCMA 2UGIA 1TRPA 4HM7B 1RMSA 1VQL3 4U13A 1VQN3 5D81A 1PY3A 1JRQA 1UGIA 2SARA 3EN8A 1IVWA 3ROBA 1O7WB 4BTYA 2XGLA 1Q814 1U5OA 4GL6A 4H3UA 4L7KA 1SIHA 1RGEA 3NM2A 1JV2B 3WOEB 3NV0A 4HJLB 5EQLA 6RNTA 1YGWA 3SEDA 1YJN3 3O8YA 3S28A 5FGOA 1VQ63 1Q864 5FW5A 1ZX2A 4CPKA 2BO9B 1MWRA 1W6YA 1S723 3AMOA 1LOYA 2ZHXB 3WODG 4XB5A 3EE1A 2RNTA 2W04A 2C4BA 2R4IA 2XEPA 2Z76A 3K63A 4AKZA 1TFOA 1BSCA 3CD63 1UCKA 1VQ53 2CX1A 4OUQA 3HK4A 1UCIA 4CJNA 5BIRA 4CDLA 2GBWB 3I563 2YFJB 3TDGA 2C11A 3NBRA 4RNZA 2CWUA 3GWRA 1WNHA 4HM1B 1C54A 3ECFA 1FUTA 1I3IA 2J8XB 2ZL8A 3AGNA 1ULIB 2ML6A 3G0KA 1MOLA 4N6NB 1W4NA 1FYSA 4O2HA 5CF1A 3G713 3CC73 2Q07A 4HKVB 5IENA 2W56A 3EX9A 1YGEA 2BMOB 4HM6B 1LQGC 1AQZA 3KE7A 3LMLA 1R4YA 3T8UA 5KP1A 5KP4A 1BRNL 2CFGA 3V98A 1A2VA 3F8XA 2XRXB 3MSOA 3VGNA 4DKIA 4FMBA 4HOHA 4LYLB 2HMLB 2QGUA 2HMMB 1ZGXA 2JDIH 2W03A 1JKGA 2BMQB 3FSDA 2A15A 3CCU3 3D5GA 1GMRA 3KKGA 4MMZB 1R4CA 5I97A 3JVCA 4IIAA 1M904 1B2SA 1OCVA 2IMJA 4PEJA 3K7CA 4QWTA 1QMAA 4HBRA 1OF5A 2GEXA 1CH0A 4G1MB 4O02B 3EHCA 3KSED 3B7CA 1IYYA 4X2HA 3ER7A 1DE3A 4KFFA 3SVAA 5LC7A 4KFDA 1FW7A 4FR9A 3H3HA 5DRVA 1WMOA 3LTBA 3T8NA 4Q53A 5AYRB 1OUNA 2GU3A 1GOYA 1TTOA 2WOFA 1N5HA 1X1YA 2CFDA 3DUKA 1YIJ3 5M18A 4GSPA 1OH0A 2P05A 2K54A 3CCE3 1GOUA 4EV2A 2BIRA 1E97A 3GZRA 5CLKA 2WGOA 2KF6A 1F8NA 3SX1A 9RNTA 1DVDA 1PYLA 2IYJA 1CEWI 1IVUA 1FGRA 2KRTA 1NB3I 1RJOA 5IW9A 7RNTA 1ZS7A 1TU5A 2E2UA 1TP6A 3T0UA 2KAAA 3BNCA 2PZVA 1HU9A 2F4YA 1YJ93 2W9PA 2B24B 5M19A 2WOHA 1O7NB 3OWSA 4LZIA 1NJI4 4MMYB 1FUSA 3MKIA 4N6V0 4FCZA 2K0MA 4WP5A 1BNFA 3CNMA 1BNIA 3U97A 1JNQA 3BB9A 1JN5A 1T2IA 3NXJA 3KSPA 4R9LA 1BIRA 5AIGA 5IERA 4EBGA 2IA7A 4X2OA 1US1A 3S5CA 1DMNA 1TRQA 1STFI 2HMJB 1IQYA 1UCLA 3B4OA 3NX0A 3X42A 1EUIC 1W02A 1UI7A 4KVHA 3L0RA 1QVG2 2W0QA 2Z7AA 3MYTA 3CCM3 2CFWA 3UL5A 1BUQA 3LH4A 4HYZA 3CCJ3 3V92A 3MHEA 1B2UA 2BHMA 5AYSC 2GXFA 4O3VA 2CK3H 4AKYA 1RSNA 3EN1B 1T2HA 3BNDA 3D9RA 1ASKA 5G1KA 1JBTA 2D42A 1WTHA 2P0XA 1DMQA 3NQYA 2W9QA 3Q1CA 1M1K4 3DZLA 1FA3A 2E2VA 2ML5A 1YIT3 1V74A 1VQM3 1BRGA 1BANA 3MPHA 3PS8A 2OQEA 2O9UX 1GS3A 4H61A 1DVCA 1EA2A 1UUGB 2IUKA 4HM3B 1BVIA 1MGWA 7GSPA 1DMMA 1MWUA 3F7SA 4FMDA 3X3XA 1LOVA 1CYUA 5IG0A 3CMA3 2V1LA 1ROAA 3NQZA 1A90A 5ELJA 1RDSA 2Z6BA 1U8CB 1W7CA 5D82A 1BNJA 2W6JH 1YVBI 1BOXA 1BNGA 3KZTA 3URPA 1BSDA 3CCQ3 3CC23 1LRAA 3CCL3 3D5IA 5TGNA 3CCS3 1YHQ3 3CME3 1O7PB 4N6MA 5IG3A 2XSHB 2KCDA 1SQWA 2KF3A 3EJVA 1DYUA 3NBJA 7STDA 1Q824 1D6ZA 4I4KA 3NV0B 1YI23 1TJDA 1B27A 1NNVA 4L8OA 1E3VA 1A67A 4EXRA 1S5AA 3UNLA 1BUJA 3AMOB 5DREA 1GY5A 4LGQA 2F86B 3DM8A 3WDGB 2F99A 1UGHI 3RGAA 5RNTA 1BRSA 1W2B2 3LYGA 3X3ZA 2CG1A 1IT8A 1NU3A 1BRIA 1C7HA 3WA2X 5JBSA 1B2ZA 3BNBA 3CXC2 3MWZA 3EBTA 3RNTA 5ELUA 4JF8A 3CU3A 1K28A 1TFKA 1FGMA 1RN1A 2P09A 4BTWA 1KD14 1IVVA 1G02A 1RCLA 1IDPA 1RGAA 3ALAA 1K9M4 1OHSA 1GYBA 4TX4A 1HKXA 1SARA 1I70A 1JB5A 2AADA 2CWVA 3AGOA 2IY2A 3F9SA 4XDWA 3X40A 3QK9A 3X41A 2W56B 2CWTA 4OK0A 3B4PA 4WYKA 4BU4A 4HVNA 2XFTA 1A2PA 1N5PA 2GBXB 3EC9A 2P38A 3N54B 3S29A 1FZUA 4HM2B 3RGRA 5AEWB 1VQK3 3JUPA 2PNCA 4WHAA 1BU4A 1N8R4 2W2CA 1RRLA 4RNYA 5AIIA 3HZPA 3IMAB 2CG0A 4STDA 4EYCA 1JB2A 1EG9B 3DH2A 1FGTA 4EV5A 1QVF2 1JKGB 2LQVA 1IK3A 1LOWA 1T5YA 1UCJA 1RGHA 3DY5A 5CK6A 1I8VA 1LNIA 2K3DA 3J7Yd 4HM8B 2KF4A 2XGNA 3KFQC 1RGKA 3KCHA 3ZG5A 3M8CA 3S27A 4HZ9B 2CFKA 2HOHA 2CKFB 1AVKA 2D1WA 1OF5B 4KFEA 5G1LA 1JBSA 4HAAA 1X1WA 2I9WA 1UUWB 2OOVA 1OHPA 4FCJA 2CIUA 4AEQA 5JPUA 3JUNA 1NO3A 1YVSA 1IVXA 1RGGA 2GEYA 2L4VA 4N6OB 1KSIA 3AHSA 3EB8A 3PXMA 1RCKA 3LZAA 5IG5A 1BSBA 1Q42A 5JPPA 3ZG0A 4BL2A 4HM0B 1X1UA 1IV7A 2ZA4A 1YNVX 2XFSA 3LTDA 1BNSA 4XDVA 3GZYB 1D6UA 2UX0A 2FXTA 4LEHA 3X3YA 1W01A 3DGNA 4OVMA 3FG1A 5IEOA 1NDOB 1O7GB 1PFPA 1IU7A 1Q40A 5G2GA 3LOYA 3F8HA 4MEIA 4R80A 2WGQA 5GSPA 1CQSA 1GMQA 1UI8A 1ROVA 3FZWA 1LOXA 1B2XA 2INXA 4R9KA 1GD3A 3GSPA 3DGLA 4MMXB 2Z77A 1SIIA 2RSXA 4J9AA 5AIFA 3VSYA 1ZO2A 1EQKA 3BNEA 1RHLA 1GD4A 1WMPA 4NHFA 3D79A 1N9JA 4GHOA 1V57A 1VQ73 1BGSA 1D6YA 1V58A 1VZZA 2JQ5A 3UB1A 3PYJA 3QRDA 3CNXA 1LQMB 1CYVA 3G8ZA 3IPTA 3NUVA 1VQP3 1OGZA 1W00A 3BLZA 3EQQB 3WMDA 1AV4A 1RGFA 3MG2A 1I0VA 2M7OA 2HMKB 3D3LA 3GAXA 3EF8A 3F14A 4N3VA 3CPW2 1JN5B 2AAEA 5EVHA 3K9MC 1OHOA 2HMNB 3LTAA 2IUJA 1VQ43 2OTL3 1BRKA 1M1XB 1QALA 4L8PA 1IV9A 1VQ83 1GY6A 2CC3A 1RN7A 1G96A 1DETA 2MC8A 1ISKA 2XSOB 3FG3A 1GOVA 3I553 4RBNA 2QIYA 1G0TA 3OXAA 3F40A 3JUOA 1JB4A 1RGCA 1RNBA 3H51A 3KIIA 2YFLB 3HIIA 3HIGA 1NWWA 2YFIB 4K1VA 4RNTA 3S67A 3A76A 3Q2PA 3DGOA 3OWYA 5HGRA 4ZM8A 1JBRA 1RN4A 3PZWA 4CCVA 4K61A 3HI7A 1W6GA 8RNTA 1AVLA 1MWSA 2HMOB 5BU4A 3SOYA 2CFLA 3LXUX 1KC84 1UW1A 1LNHA 3UL6A 1BSEA 2CX0A 2SBLA 1FGOA 3FLJA 3DXOA 3VF1A 4K1UA 3NM7A 2OQEC 1MNLA 2YX9A 4XBXA 5M1AA 3IJEB 4LSOA 3GZXB 5LC6A 2GU1A 3FF2A 1RGLA 3OV4A 3Q90A 4JRFA 5IEPA 1VQO3 3RDEA 1PU4A 3SOAA 1TIJA 2H0IA 3DMCA 1JJ22 2RFRA 3CPOA 1BAOA 2FNQA 1IQ8A 1RKYA 2QEX3 1SJWA 2E2TA 4BL3A 1GSPA 1M9GA 5STDA
chains in the Genus database with same CATH topology
5KP3A 2OCTA 3G4S3 1A2KA 1K734 4FMAA 3LT8A 3E99A 2BMRB 3OX9A 1ULJB 4WWUC 3FG4A 3GZBA 2B1XB 3CCV3 3DGMA 3I0YA 3F7XA 5BXQA 4HZBB 3V99A 2QA43 1Z1SA 4MJDA 5EEOA 2O3OA 4NREA 3CC43 3OW22 2KXGA 1N9EA 1LXEA 3CCR3 3LTCA 2RCDA 5AI1A 3GRDA 1O7HB 4ORLA 2CHCA 5IF6A 2P0MA 2BNGA 1SPUA 1J2BA 1LVNA 1OACA 1QAKA 8CHOA 1GY7A 4XBYA 5A0OB 5CXOA 4N6LA 3K0ZA 1AR0A 3MG1A 1QAFA 2Y74A 1EKMA 4O8SA 2OWPA 4IT7A 1STDA 3PCRA 1FUWA 3B8LA 2RGQA 1K8A4 5D83A 3KN4A 4XBTA 1E3RA 3FH1A 4KZ1A 4WYKB 2LYXA 2XR8B 3UJMA 5CF2A 1WMNA 2Y73A 1K41A 1FGQA 1QJGA 2WO0A 1OPYA 2BT3A 5AEUB 4N6UA 3N8BA 3N9HA 3WA3A 2F98A 3NBBA 3MG3A 3FGYA 3FKAA 3OWUA 4XM4A 3G16A 4IPBA 4BTXA 1W2ZA 1WQLB 4HM4B 4FMCA 3U1WA 2OTJ3 1O7MB 2ZDJA 3HX8A 1YJW3 2MF7A 1KWIA 5IG4A 4LMIA 2CW9A 2C10A 3FF0A 4GB5A 3JUQA 2STDA 1W6CA 3PCSA 3LT9A 3SXXA 1OGXA 4R1KA 4EC6A 3STDA 2FGTA 4RZMA 2OOVC 3K5TA 1L5GB 3NHXA 1Y4KA 2XF3A 1IT7A 4J8TA 1KQS2 3PGBA 4K90B 6STDA 1TUHA 3FCSB 3SLUA 1IQXA 1UUVB 1W5ZA 3WOFB 1Q7Y4 2XH9A 4R4KA 3EBYA 4WFOA 5AIHA 1N8QA 4HM5B 4N6TA 1NB5I 2CH9A 1Q40B 1RRHA 1VQ93 3JUMA 4FCMA 4HM7B 1VQL3 4U13A 1VQN3 5D81A 1JRQA 3EN8A 1IVWA 3ROBA 1O7WB 4BTYA 2XGLA 1Q814 1U5OA 4GL6A 4H3UA 4L7KA 1SIHA 3NM2A 1JV2B 3WOEB 3NV0A 4HJLB 5EQLA 3SEDA 1YJN3 3O8YA 3S28A 5FGOA 1VQ63 1Q864 5FW5A 1ZX2A 2BO9B 1S723 1W6YA 3AMOA 3WODG 4XB5A 3EE1A 2W04A 2R4IA 2XEPA 2Z76A 3K63A 4AKZA 1TFOA 3CD63 1VQ53 4OUQA 3HK4A 4CDLA 2GBWB 3I563 2YFJB 3TDGA 2C11A 3NBRA 4RNZA 2CWUA 3GWRA 1WNHA 4HM1B 3ECFA 2ZL8A 5BVBA 4N6NB 1ULIB 2ML6A 3G0KA 1MOLA 4O2HA 1W4NA 5CF1A 3G713 3CC73 2Q07A 4HKVB 5IENA 2W56A 3EX9A 1YGEA 2BMOB 4HM6B 3KE7A 3T8UA 5KP1A 3LMLA 5KP4A 2CFGA 3V98A 1A2VA 3F8XA 2XRXB 3MSOA 3VGNA 4FMBA 2HMLB 2QGUA 2HMMB 2JDIH 2W03A 1JKGA 2BMQB 3FSDA 2A15A 3CCU3 3KKGA 4MMZB 1R4CA 5I97A 3JVCA 4IIAA 1M904 1OCVA 2IMJA 4PEJA 3K7CA 4QWTA 1QMAA 4HBRA 1OF5A 2GEXA 4G1MB 4O02B 3EHCA 3KSED 3B7CA 4X2HA 3ER7A 4KFFA 3SVAA 5LC7A 4KFDA 4FR9A 3H3HA 5DRVA 1WMOA 3LTBA 3T8NA 4Q53A 5AYRB 1OUNA 2GU3A 2WOFA 1N5HA 2CFDA 3DUKA 1YIJ3 1OH0A 2P05A 2K54A 3CCE3 4EV2A 1E97A 3GZRA 5CLKA 2WGOA 1F8NA 3SX1A 1DVDA 1CEWI 1IVUA 1FGRA 2KRTA 1NB3I 1RJOA 5IW9A 1TU5A 2E2UA 1TP6A 3T0UA 3BNCA 2PZVA 1HU9A 1YJ93 2W9PA 2B24B 1M9GA 2WOHA 1O7NB 3OWSA 4LZIA 1NJI4 4MMYB 3MKIA 4N6V0 4FCZA 2K0MA 4WP5A 3CNMA 3U97A 1JNQA 3BB9A 1JN5A 3NXJA 3KSPA 4R9LA 5AIGA 5IERA 4EBGA 2IA7A 4X2OA 1US1A 3S5CA 1DMNA 1STFI 2HMJB 1IQYA 3B4OA 3NX0A 3X42A 1W02A 1UI7A 4KVHA 3L0RA 1QVG2 2W0QA 2Z7AA 3MYTA 3CCM3 2CFWA 3UL5A 1BUQA 3LH4A 4HYZA 3CCJ3 3V92A 3MHEA 2BHMA 5AYSC 2GXFA 4O3VA 2CK3H 4AKYA 3EN1B 3BNDA 3D9RA 1ASKA 2D42A 1WTHA 2P0XA 1DMQA 3NQYA 2W9QA 3Q1CA 1M1K4 3DZLA 1FA3A 2E2VA 2ML5A 1YIT3 1V74A 1VQM3 3MPHA 3PS8A 2OQEA 2O9UX 1GS3A 4H61A 1DVCA 1EA2A 2IUKA 4HM3B 1DMMA 3F7SA 4FMDA 3X3XA 1CYUA 5IG0A 3CMA3 2V1LA 1ROAA 3NQZA 1A90A 5ELJA 2Z6BA 1U8CB 1W7CA 5D82A 2W6JH 1YVBI 3KZTA 3CCQ3 3CC23 3CCL3 5TGNA 3CCS3 1YHQ3 3CME3 1O7PB 4N6MA 5IG3A 2XSHB 2KCDA 1SQWA 3EJVA 1DYUA 3NBJA 7STDA 1Q824 1D6ZA 4I4KA 3NV0B 1YI23 4L8OA 1E3VA 1A67A 4EXRA 1S5AA 3UNLA 3AMOB 5DREA 1GY5A 4LGQA 2F86B 3DM8A 3WDGB 2F99A 3RGAA 1W2B2 3LYGA 3X3ZA 2CG1A 1IT8A 1NU3A 1C7HA 3WA2X 5JBSA 3BNBA 3CXC2 3MWZA 3EBTA 5ELUA 4JF8A 3CU3A 1K28A 1TFKA 1FGMA 4BTWA 2P09A 1KD14 1IVVA 1IDPA 3ALAA 1K9M4 1OHSA 1GYBA 4TX4A 1HKXA 1JB5A 2CWVA 3X40A 3F9SA 4XDWA 3X41A 3QK9A 2W56B 2CWTA 4OK0A 3B4PA 4WYKA 4HVNA 2XFTA 3EC9A 1N5PA 2GBXB 3N54B 2P38A 3S29A 4HM2B 3RGRA 5AEWB 1VQK3 3JUPA 2PNCA 4WHAA 1N8R4 1RRLA 4RNYA 5AIIA 3HZPA 3IMAB 2CG0A 4STDA 4EYCA 1JB2A 1EG9B 4EV5A 1FGTA 1QVF2 2LQVA 1JKGB 1IK3A 1T5YA 3DY5A 5CK6A 3J7Yd 4HM8B 2XGNA 3KFQC 3M8CA 3S27A 4HZ9B 2CFKA 2CKFB 1AVKA 2D1WA 1OF5B 4KFEA 2I9WA 1UUWB 2OOVA 1OHPA 4FCJA 2CIUA 4AEQA 5JPUA 3JUNA 1NO3A 1IVXA 2GEYA 2L4VA 4N6OB 1KSIA 3EB8A 3PXMA 5IG5A 3LZAA 1Q42A 5JPPA 4HM0B 1IV7A 2XFSA 3LTDA 4XDVA 3GZYB 1D6UA 2UX0A 2FXTA 4LEHA 3X3YA 1W01A 3DGNA 4OVMA 3FG1A 5IEOA 1NDOB 1O7GB 1PFPA 1IU7A 1Q40A 5G2GA 3LOYA 3F8HA 4MEIA 4R80A 2WGQA 1CQSA 1UI8A 1ROVA 3FZWA 1LOXA 2INXA 4R9KA 1GD3A 3DGLA 4MMXB 2Z77A 1SIIA 2RSXA 4J9AA 5AIFA 3VSYA 1ZO2A 1EQKA 3BNEA 1GD4A 1WMPA 4NHFA 1N9JA 1VQ73 1VZZA 1D6YA 2JQ5A 3UB1A 3PYJA 3QRDA 3CNXA 1CYVA 3G8ZA 3IPTA 3NUVA 1VQP3 1OGZA 1W00A 3BLZA 3EQQB 3WMDA 1AV4A 3MG2A 2M7OA 3D3LA 2HMKB 3GAXA 3EF8A 3F14A 4N3VA 3CPW2 1JN5B 5EVHA 3K9MC 1OHOA 2HMNB 3LTAA 2IUJA 1VQ43 2OTL3 1QALA 1M1XB 4L8PA 1IV9A 1VQ83 1GY6A 2CC3A 1RN7A 1G96A 2MC8A 1ISKA 2XSOB 3FG3A 3I553 4RBNA 2QIYA 3OXAA 3F40A 3JUOA 1JB4A 3H51A 3KIIA 2YFLB 3HIIA 3HIGA 1NWWA 2YFIB 4K1VA 3S67A 3G6E3 3A76A 3Q2PA 3DGOA 3OWYA 5HGRA 4ZM8A 3PZWA 4CCVA 4K61A 3HI7A 1W6GA 1AVLA 2HMOB 3SOYA 2CFLA 3LXUX 1KC84 1UW1A 1LNHA 3UL6A 2SBLA 1FGOA 3FLJA 3DXOA 3VF1A 4K1UA 3NM7A 2OQEC 1MNLA 2YX9A 4XBXA 3IJEB 4LSOA 3GZXB 5LC6A 2GU1A 3FF2A 3OV4A 4JRFA 3Q90A 5IEPA 1VQO3 3RDEA 1PU4A 3SOAA 1TIJA 3DMCA 1JJ22 2RFRA 3CPOA 2FNQA 1IQ8A 1RKYA 2QEX3 1SJWA 2E2TA 2W2CA 5STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCT A;  5EQL A;  2BO9 B;  1STF I;  3NX0 A;  3KFQ C;  3L0R A;  3UL5 A;  3LH4 A;  2KXG A;  1LXE A;  4N6O B;  3PXM A;  1IV7 A;  2W9Q A;  1FA3 A;  1WNH A;  5A0O B;  4N6N B;  3PS8 A;  4N6L A;  1MOL A;  2O9U X;  1DVC A;  1PFP A;  4IT7 A;  1CYU A;  1ROA A;  1A90 A;  5ELJ A;  1FUW A;  1GD3 A;  1YVB I;  1EQK A;  1GD4 A;  1N9J A;  4N6U A;  3PYJ A;  3QRD A;  4N6M A;  1CYV A;  1R4C A;  3GAX A;  1A67 A;  3K9M C;  1KWI A;  3KSE D;  1IV9 A;  3SVA A;  5LC7 A;  1RN7 A;  1G96 A;  1N5H A;  3MWZ A;  5ELU A;  3S67 A;  3Q2P A;  4ZM8 A;  4CCV A;  4TX4 A;  3UL6 A;  1DVD A;  1CEW I;  1NB3 I;  4N6T A;  1NB5 I;  1MNL A;  2CH9 A;  5LC6 A;  1N5P A;  1TIJ A;  2W9P A;  4LZI A;  3IMA B;  4N6V 0;  4EYC A;  1M9G A; 
#chains in the Genus database with same CATH topology
 5KP3 A;  2OCT A;  4J5G A;  3G4S 3;  1A2K A;  5BVB A;  2BU4 A;  1K73 4;  4FMA A;  2F56 A;  3LT8 A;  1MWT A;  3E99 A;  1B20 A;  2BMR B;  3OX9 A;  1ULJ B;  4WWU C;  5HOH A;  3FG4 A;  1RLS A;  3HOH A;  3GZB A;  2B1X B;  3CCV 3;  3DGM A;  3I0Y A;  3F7X A;  5BXQ A;  2RBI A;  4HZB B;  1BNR A;  3V99 A;  2QA4 3;  1Z1S A;  4MJD A;  5EEO A;  2O3O A;  4NRE A;  3CC4 3;  3OW2 2;  2KXG A;  1N9E A;  1LXE A;  3BU4 A;  3CCR 3;  1RTU A;  3LTC A;  2RCD A;  1I0X A;  3BIR A;  4KT3 B;  3GRD A;  5AI1 A;  2KF5 A;  1O7H B;  1JZD A;  2F5M A;  4ORL A;  3G6E 3;  2CHC A;  1I3F A;  1UDI I;  1BSA A;  5IF6 A;  1GMP A;  2P0M A;  2BNG A;  1SPU A;  1J2B A;  1LVN A;  2R41 A;  1OAC A;  1QAK A;  8CHO A;  1GY7 A;  4XBY A;  5A0O B;  5CXO A;  4N6L A;  3K0Z A;  1AR0 A;  1I2G A;  1QAF A;  2Y74 A;  3MG1 A;  1B3S A;  1I2F A;  6GSP A;  1EKM A;  1BRH A;  4O8S A;  2OWP A;  4ILF A;  1HZ1 A;  4IT7 A;  1STD A;  1BRJ A;  3PCR A;  1FUW A;  3B8L A;  2RGQ A;  1K8A 4;  3AHW A;  3KN4 A;  5D83 A;  4XBT A;  1E3R A;  3FH1 A;  3D4A A;  1T3B A;  4KZ1 A;  3Q3F A;  2LYX A;  2XR8 B;  4WYK B;  3UJM A;  5CF2 A;  1WMN A;  2Y73 A;  1VQQ A;  1EEJ A;  1FGQ A;  1K41 A;  1HYF A;  1OPY A;  1QJG A;  2BT3 A;  2WO0 A;  4N6U A;  3N8B A;  3N9H A;  5AEU B;  2F98 A;  3WA3 A;  3NBB A;  2F5W A;  3MG3 A;  2H0G A;  3FGY A;  3FKA A;  3OWU A;  4XM4 A;  3G16 A;  4IPB A;  2L1S A;  1BNE A;  4BTX A;  1W2Z A;  1WQL B;  2H0H A;  4HM4 B;  4FMC A;  3U1W A;  2OTJ 3;  1O7M B;  2ZDJ A;  1B21 A;  1AY7 A;  1RNT A;  3HX8 A;  1YJW 3;  2MF7 A;  1KWI A;  5IG4 A;  1I2E A;  1JZO A;  1Q7H A;  4LMI A;  2CW9 A;  2C10 A;  3FF0 A;  4NPB A;  4GB5 A;  3JUQ A;  2STD A;  1W6C A;  3A5E A;  3LT9 A;  1Q9E A;  3PCS A;  3SXX A;  2GSP A;  1OGX A;  4R1K A;  4EC6 A;  3STD A;  2FGT A;  4RZM A;  2OOV C;  3K5T A;  3WR2 A;  1L5G B;  3SYU A;  3ZFZ A;  3NHX A;  1Y4K A;  2XF3 A;  1IT7 A;  4EW5 A;  4J8T A;  1B2M A;  1X1X A;  4J5K A;  1KQS 2;  3PGB A;  4K90 B;  6STD A;  2UUG C;  1TUH A;  3FCS B;  3SLU A;  1IQX A;  1UUV B;  1W5Z A;  3WOF B;  1Q7Y 4;  4I5Q A;  2XH9 A;  4R4K A;  3EBY A;  4WFO A;  3DGY A;  5AIH A;  4BIR A;  1N8Q A;  4HM5 B;  4N6T A;  1NB5 I;  2CH9 A;  1Q40 B;  3WHO A;  1RRH A;  1MGR A;  1VQ9 3;  3JUM A;  4FCM A;  2UGI A;  1TRP A;  4HM7 B;  1RMS A;  1VQL 3;  4U13 A;  1VQN 3;  5D81 A;  1PY3 A;  1JRQ A;  1UGI A;  2SAR A;  3EN8 A;  1IVW A;  3ROB A;  1O7W B;  4BTY A;  2XGL A;  1Q81 4;  1U5O A;  4GL6 A;  4H3U A;  4L7K A;  1SIH A;  1RGE A;  3NM2 A;  1JV2 B;  3WOE B;  3NV0 A;  4HJL B;  5EQL A;  6RNT A;  1YGW A;  3SED A;  1YJN 3;  3O8Y A;  3S28 A;  5FGO A;  1VQ6 3;  1Q86 4;  5FW5 A;  1ZX2 A;  4CPK A;  2BO9 B;  1MWR A;  1W6Y A;  1S72 3;  3AMO A;  1LOY A;  2ZHX B;  3WOD G;  4XB5 A;  3EE1 A;  2RNT A;  2W04 A;  2C4B A;  2R4I A;  2XEP A;  2Z76 A;  3K63 A;  4AKZ A;  1TFO A;  1BSC A;  3CD6 3;  1UCK A;  1VQ5 3;  2CX1 A;  4OUQ A;  3HK4 A;  1UCI A;  4CJN A;  5BIR A;  4CDL A;  2GBW B;  3I56 3;  2YFJ B;  3TDG A;  2C11 A;  3NBR A;  4RNZ A;  2CWU A;  3GWR A;  1WNH A;  4HM1 B;  1C54 A;  3ECF A;  1FUT A;  1I3I A;  2J8X B;  2ZL8 A;  3AGN A;  1ULI B;  2ML6 A;  3G0K A;  1MOL A;  4N6N B;  1W4N A;  1FYS A;  4O2H A;  5CF1 A;  3G71 3;  3CC7 3;  2Q07 A;  4HKV B;  5IEN A;  2W56 A;  3EX9 A;  1YGE A;  2BMO B;  4HM6 B;  1LQG C;  1AQZ A;  3KE7 A;  3LML A;  1R4Y A;  3T8U A;  5KP1 A;  5KP4 A;  1BRN L;  2CFG A;  3V98 A;  1A2V A;  3F8X A;  2XRX B;  3MSO A;  3VGN A;  4DKI A;  4FMB A;  4HOH A;  4LYL B;  2HML B;  2QGU A;  2HMM B;  1ZGX A;  2JDI H;  2W03 A;  1JKG A;  2BMQ B;  3FSD A;  2A15 A;  3CCU 3;  3D5G A;  1GMR A;  3KKG A;  4MMZ B;  1R4C A;  5I97 A;  3JVC A;  4IIA A;  1M90 4;  1B2S A;  1OCV A;  2IMJ A;  4PEJ A;  3K7C A;  4QWT A;  1QMA A;  4HBR A;  1OF5 A;  2GEX A;  1CH0 A;  4G1M B;  4O02 B;  3EHC A;  3KSE D;  3B7C A;  1IYY A;  4X2H A;  3ER7 A;  1DE3 A;  4KFF A;  3SVA A;  5LC7 A;  4KFD A;  1FW7 A;  4FR9 A;  3H3H A;  5DRV A;  1WMO A;  3LTB A;  3T8N A;  4Q53 A;  5AYR B;  1OUN A;  2GU3 A;  1GOY A;  1TTO A;  2WOF A;  1N5H A;  1X1Y A;  2CFD A;  3DUK A;  1YIJ 3;  5M18 A;  4GSP A;  1OH0 A;  2P05 A;  2K54 A;  3CCE 3;  1GOU A;  4EV2 A;  2BIR A;  1E97 A;  3GZR A;  5CLK A;  2WGO A;  2KF6 A;  1F8N A;  3SX1 A;  9RNT A;  1DVD A;  1PYL A;  2IYJ A;  1CEW I;  1IVU A;  1FGR A;  2KRT A;  1NB3 I;  1RJO A;  5IW9 A;  7RNT A;  1ZS7 A;  1TU5 A;  2E2U A;  1TP6 A;  3T0U A;  2KAA A;  3BNC A;  2PZV A;  1HU9 A;  2F4Y A;  1YJ9 3;  2W9P A;  2B24 B;  5M19 A;  2WOH A;  1O7N B;  3OWS A;  4LZI A;  1NJI 4;  4MMY B;  1FUS A;  3MKI A;  4N6V 0;  4FCZ A;  2K0M A;  4WP5 A;  1BNF A;  3CNM A;  1BNI A;  3U97 A;  1JNQ A;  3BB9 A;  1JN5 A;  1T2I A;  3NXJ A;  3KSP A;  4R9L A;  1BIR A;  5AIG A;  5IER A;  4EBG A;  2IA7 A;  4X2O A;  1US1 A;  3S5C A;  1DMN A;  1TRQ A;  1STF I;  2HMJ B;  1IQY A;  1UCL A;  3B4O A;  3NX0 A;  3X42 A;  1EUI C;  1W02 A;  1UI7 A;  4KVH A;  3L0R A;  1QVG 2;  2W0Q A;  2Z7A A;  3MYT A;  3CCM 3;  2CFW A;  3UL5 A;  1BUQ A;  3LH4 A;  4HYZ A;  3CCJ 3;  3V92 A;  3MHE A;  1B2U A;  2BHM A;  5AYS C;  2GXF A;  4O3V A;  2CK3 H;  4AKY A;  1RSN A;  3EN1 B;  1T2H A;  3BND A;  3D9R A;  1ASK A;  5G1K A;  1JBT A;  2D42 A;  1WTH A;  2P0X A;  1DMQ A;  3NQY A;  2W9Q A;  3Q1C A;  1M1K 4;  3DZL A;  1FA3 A;  2E2V A;  2ML5 A;  1YIT 3;  1V74 A;  1VQM 3;  1BRG A;  1BAN A;  3MPH A;  3PS8 A;  2OQE A;  2O9U X;  1GS3 A;  4H61 A;  1DVC A;  1EA2 A;  1UUG B;  2IUK A;  4HM3 B;  1BVI A;  1MGW A;  7GSP A;  1DMM A;  1MWU A;  3F7S A;  4FMD A;  3X3X A;  1LOV A;  1CYU A;  5IG0 A;  3CMA 3;  2V1L A;  1ROA A;  3NQZ A;  1A90 A;  5ELJ A;  1RDS A;  2Z6B A;  1U8C B;  1W7C A;  5D82 A;  1BNJ A;  2W6J H;  1YVB I;  1BOX A;  1BNG A;  3KZT A;  3URP A;  1BSD A;  3CCQ 3;  3CC2 3;  1LRA A;  3CCL 3;  3D5I A;  5TGN A;  3CCS 3;  1YHQ 3;  3CME 3;  1O7P B;  4N6M A;  5IG3 A;  2XSH B;  2KCD A;  1SQW A;  2KF3 A;  3EJV A;  1DYU A;  3NBJ A;  7STD A;  1Q82 4;  1D6Z A;  4I4K A;  3NV0 B;  1YI2 3;  1TJD A;  1B27 A;  1NNV A;  4L8O A;  1E3V A;  1A67 A;  4EXR A;  1S5A A;  3UNL A;  1BUJ A;  3AMO B;  5DRE A;  1GY5 A;  4LGQ A;  2F86 B;  3DM8 A;  3WDG B;  2F99 A;  1UGH I;  3RGA A;  5RNT A;  1BRS A;  1W2B 2;  3LYG A;  3X3Z A;  2CG1 A;  1IT8 A;  1NU3 A;  1BRI A;  1C7H A;  3WA2 X;  5JBS A;  1B2Z A;  3BNB A;  3CXC 2;  3MWZ A;  3EBT A;  3RNT A;  5ELU A;  4JF8 A;  3CU3 A;  1K28 A;  1TFK A;  1FGM A;  1RN1 A;  2P09 A;  4BTW A;  1KD1 4;  1IVV A;  1G02 A;  1RCL A;  1IDP A;  1RGA A;  3ALA A;  1K9M 4;  1OHS A;  1GYB A;  4TX4 A;  1HKX A;  1SAR A;  1I70 A;  1JB5 A;  2AAD A;  2CWV A;  3AGO A;  2IY2 A;  3F9S A;  4XDW A;  3X40 A;  3QK9 A;  3X41 A;  2W56 B;  2CWT A;  4OK0 A;  3B4P A;  4WYK A;  4BU4 A;  4HVN A;  2XFT A;  1A2P A;  1N5P A;  2GBX B;  3EC9 A;  2P38 A;  3N54 B;  3S29 A;  1FZU A;  4HM2 B;  3RGR A;  5AEW B;  1VQK 3;  3JUP A;  2PNC A;  4WHA A;  1BU4 A;  1N8R 4;  2W2C A;  1RRL A;  4RNY A;  5AII A;  3HZP A;  3IMA B;  2CG0 A;  4STD A;  4EYC A;  1JB2 A;  1EG9 B;  3DH2 A;  1FGT A;  4EV5 A;  1QVF 2;  1JKG B;  2LQV A;  1IK3 A;  1LOW A;  1T5Y A;  1UCJ A;  1RGH A;  3DY5 A;  5CK6 A;  1I8V A;  1LNI A;  2K3D A;  3J7Y d;  4HM8 B;  2KF4 A;  2XGN A;  3KFQ C;  1RGK A;  3KCH A;  3ZG5 A;  3M8C A;  3S27 A;  4HZ9 B;  2CFK A;  2HOH A;  2CKF B;  1AVK A;  2D1W A;  1OF5 B;  4KFE A;  5G1L A;  1JBS A;  4HAA A;  1X1W A;  2I9W A;  1UUW B;  2OOV A;  1OHP A;  4FCJ A;  2CIU A;  4AEQ A;  5JPU A;  3JUN A;  1NO3 A;  1YVS A;  1IVX A;  1RGG A;  2GEY A;  2L4V A;  4N6O B;  1KSI A;  3AHS A;  3EB8 A;  3PXM A;  1RCK A;  3LZA A;  5IG5 A;  1BSB A;  1Q42 A;  5JPP A;  3ZG0 A;  4BL2 A;  4HM0 B;  1X1U A;  1IV7 A;  2ZA4 A;  1YNV X;  2XFS A;  3LTD A;  1BNS A;  4XDV A;  3GZY B;  1D6U A;  2UX0 A;  2FXT A;  4LEH A;  3X3Y A;  1W01 A;  3DGN A;  4OVM A;  3FG1 A;  5IEO A;  1NDO B;  1O7G B;  1PFP A;  1IU7 A;  1Q40 A;  5G2G A;  3LOY A;  3F8H A;  4MEI A;  4R80 A;  2WGQ A;  5GSP A;  1CQS A;  1GMQ A;  1UI8 A;  1ROV A;  3FZW A;  1LOX A;  1B2X A;  2INX A;  4R9K A;  1GD3 A;  3GSP A;  3DGL A;  4MMX B;  2Z77 A;  1SII A;  2RSX A;  4J9A A;  5AIF A;  3VSY A;  1ZO2 A;  1EQK A;  3BNE A;  1RHL A;  1GD4 A;  1WMP A;  4NHF A;  3D79 A;  1N9J A;  4GHO A;  1V57 A;  1VQ7 3;  1BGS A;  1D6Y A;  1V58 A;  1VZZ A;  2JQ5 A;  3UB1 A;  3PYJ A;  3QRD A;  3CNX A;  1LQM B;  1CYV A;  3G8Z A;  3IPT A;  3NUV A;  1VQP 3;  1OGZ A;  1W00 A;  3BLZ A;  3EQQ B;  3WMD A;  1AV4 A;  1RGF A;  3MG2 A;  1I0V A;  2M7O A;  2HMK B;  3D3L A;  3GAX A;  3EF8 A;  3F14 A;  4N3V A;  3CPW 2;  1JN5 B;  2AAE A;  5EVH A;  3K9M C;  1OHO A;  2HMN B;  3LTA A;  2IUJ A;  1VQ4 3;  2OTL 3;  1BRK A;  1M1X B;  1QAL A;  4L8P A;  1IV9 A;  1VQ8 3;  1GY6 A;  2CC3 A;  1RN7 A;  1G96 A;  1DET A;  2MC8 A;  1ISK A;  2XSO B;  3FG3 A;  1GOV A;  3I55 3;  4RBN A;  2QIY A;  1G0T A;  3OXA A;  3F40 A;  3JUO A;  1JB4 A;  1RGC A;  1RNB A;  3H51 A;  3KII A;  2YFL B;  3HII A;  3HIG A;  1NWW A;  2YFI B;  4K1V A;  4RNT A;  3S67 A;  3A76 A;  3Q2P A;  3DGO A;  3OWY A;  5HGR A;  4ZM8 A;  1JBR A;  1RN4 A;  3PZW A;  4CCV A;  4K61 A;  3HI7 A;  1W6G A;  8RNT A;  1AVL A;  1MWS A;  2HMO B;  5BU4 A;  3SOY A;  2CFL A;  3LXU X;  1KC8 4;  1UW1 A;  1LNH A;  3UL6 A;  1BSE A;  2CX0 A;  2SBL A;  1FGO A;  3FLJ A;  3DXO A;  3VF1 A;  4K1U A;  3NM7 A;  2OQE C;  1MNL A;  2YX9 A;  4XBX A;  5M1A A;  3IJE B;  4LSO A;  3GZX B;  5LC6 A;  2GU1 A;  3FF2 A;  1RGL A;  3OV4 A;  3Q90 A;  4JRF A;  5IEP A;  1VQO 3;  3RDE A;  1PU4 A;  3SOA A;  1TIJ A;  2H0I A;  3DMC A;  1JJ2 2;  2RFR A;  3CPO A;  1BAO A;  2FNQ A;  1IQ8 A;  1RKY A;  2QEX 3;  1SJW A;  2E2T A;  4BL3 A;  1GSP A;  1M9G A;  5STD A; 
#chains in the Genus database with same CATH homology
 5KP3 A;  2OCT A;  3G4S 3;  1A2K A;  1K73 4;  4FMA A;  3LT8 A;  3E99 A;  2BMR B;  3OX9 A;  1ULJ B;  4WWU C;  3FG4 A;  3GZB A;  2B1X B;  3CCV 3;  3DGM A;  3I0Y A;  3F7X A;  5BXQ A;  4HZB B;  3V99 A;  2QA4 3;  1Z1S A;  4MJD A;  5EEO A;  2O3O A;  4NRE A;  3CC4 3;  3OW2 2;  2KXG A;  1N9E A;  1LXE A;  3CCR 3;  3LTC A;  2RCD A;  5AI1 A;  3GRD A;  1O7H B;  4ORL A;  2CHC A;  5IF6 A;  2P0M A;  2BNG A;  1SPU A;  1J2B A;  1LVN A;  1OAC A;  1QAK A;  8CHO A;  1GY7 A;  4XBY A;  5A0O B;  5CXO A;  4N6L A;  3K0Z A;  1AR0 A;  3MG1 A;  1QAF A;  2Y74 A;  1EKM A;  4O8S A;  2OWP A;  4IT7 A;  1STD A;  3PCR A;  1FUW A;  3B8L A;  2RGQ A;  1K8A 4;  5D83 A;  3KN4 A;  4XBT A;  1E3R A;  3FH1 A;  4KZ1 A;  4WYK B;  2LYX A;  2XR8 B;  3UJM A;  5CF2 A;  1WMN A;  2Y73 A;  1K41 A;  1FGQ A;  1QJG A;  2WO0 A;  1OPY A;  2BT3 A;  5AEU B;  4N6U A;  3N8B A;  3N9H A;  3WA3 A;  2F98 A;  3NBB A;  3MG3 A;  3FGY A;  3FKA A;  3OWU A;  4XM4 A;  3G16 A;  4IPB A;  4BTX A;  1W2Z A;  1WQL B;  4HM4 B;  4FMC A;  3U1W A;  2OTJ 3;  1O7M B;  2ZDJ A;  3HX8 A;  1YJW 3;  2MF7 A;  1KWI A;  5IG4 A;  4LMI A;  2CW9 A;  2C10 A;  3FF0 A;  4GB5 A;  3JUQ A;  2STD A;  1W6C A;  3PCS A;  3LT9 A;  3SXX A;  1OGX A;  4R1K A;  4EC6 A;  3STD A;  2FGT A;  4RZM A;  2OOV C;  3K5T A;  1L5G B;  3NHX A;  1Y4K A;  2XF3 A;  1IT7 A;  4J8T A;  1KQS 2;  3PGB A;  4K90 B;  6STD A;  1TUH A;  3FCS B;  3SLU A;  1IQX A;  1UUV B;  1W5Z A;  3WOF B;  1Q7Y 4;  2XH9 A;  4R4K A;  3EBY A;  4WFO A;  5AIH A;  1N8Q A;  4HM5 B;  4N6T A;  1NB5 I;  2CH9 A;  1Q40 B;  1RRH A;  1VQ9 3;  3JUM A;  4FCM A;  4HM7 B;  1VQL 3;  4U13 A;  1VQN 3;  5D81 A;  1JRQ A;  3EN8 A;  1IVW A;  3ROB A;  1O7W B;  4BTY A;  2XGL A;  1Q81 4;  1U5O A;  4GL6 A;  4H3U A;  4L7K A;  1SIH A;  3NM2 A;  1JV2 B;  3WOE B;  3NV0 A;  4HJL B;  5EQL A;  3SED A;  1YJN 3;  3O8Y A;  3S28 A;  5FGO A;  1VQ6 3;  1Q86 4;  5FW5 A;  1ZX2 A;  2BO9 B;  1S72 3;  1W6Y A;  3AMO A;  3WOD G;  4XB5 A;  3EE1 A;  2W04 A;  2R4I A;  2XEP A;  2Z76 A;  3K63 A;  4AKZ A;  1TFO A;  3CD6 3;  1VQ5 3;  4OUQ A;  3HK4 A;  4CDL A;  2GBW B;  3I56 3;  2YFJ B;  3TDG A;  2C11 A;  3NBR A;  4RNZ A;  2CWU A;  3GWR A;  1WNH A;  4HM1 B;  3ECF A;  2ZL8 A;  5BVB A;  4N6N B;  1ULI B;  2ML6 A;  3G0K A;  1MOL A;  4O2H A;  1W4N A;  5CF1 A;  3G71 3;  3CC7 3;  2Q07 A;  4HKV B;  5IEN A;  2W56 A;  3EX9 A;  1YGE A;  2BMO B;  4HM6 B;  3KE7 A;  3T8U A;  5KP1 A;  3LML A;  5KP4 A;  2CFG A;  3V98 A;  1A2V A;  3F8X A;  2XRX B;  3MSO A;  3VGN A;  4FMB A;  2HML B;  2QGU A;  2HMM B;  2JDI H;  2W03 A;  1JKG A;  2BMQ B;  3FSD A;  2A15 A;  3CCU 3;  3KKG A;  4MMZ B;  1R4C A;  5I97 A;  3JVC A;  4IIA A;  1M90 4;  1OCV A;  2IMJ A;  4PEJ A;  3K7C A;  4QWT A;  1QMA A;  4HBR A;  1OF5 A;  2GEX A;  4G1M B;  4O02 B;  3EHC A;  3KSE D;  3B7C A;  4X2H A;  3ER7 A;  4KFF A;  3SVA A;  5LC7 A;  4KFD A;  4FR9 A;  3H3H A;  5DRV A;  1WMO A;  3LTB A;  3T8N A;  4Q53 A;  5AYR B;  1OUN A;  2GU3 A;  2WOF A;  1N5H A;  2CFD A;  3DUK A;  1YIJ 3;  1OH0 A;  2P05 A;  2K54 A;  3CCE 3;  4EV2 A;  1E97 A;  3GZR A;  5CLK A;  2WGO A;  1F8N A;  3SX1 A;  1DVD A;  1CEW I;  1IVU A;  1FGR A;  2KRT A;  1NB3 I;  1RJO A;  5IW9 A;  1TU5 A;  2E2U A;  1TP6 A;  3T0U A;  3BNC A;  2PZV A;  1HU9 A;  1YJ9 3;  2W9P A;  2B24 B;  1M9G A;  2WOH A;  1O7N B;  3OWS A;  4LZI A;  1NJI 4;  4MMY B;  3MKI A;  4N6V 0;  4FCZ A;  2K0M A;  4WP5 A;  3CNM A;  3U97 A;  1JNQ A;  3BB9 A;  1JN5 A;  3NXJ A;  3KSP A;  4R9L A;  5AIG A;  5IER A;  4EBG A;  2IA7 A;  4X2O A;  1US1 A;  3S5C A;  1DMN A;  1STF I;  2HMJ B;  1IQY A;  3B4O A;  3NX0 A;  3X42 A;  1W02 A;  1UI7 A;  4KVH A;  3L0R A;  1QVG 2;  2W0Q A;  2Z7A A;  3MYT A;  3CCM 3;  2CFW A;  3UL5 A;  1BUQ A;  3LH4 A;  4HYZ A;  3CCJ 3;  3V92 A;  3MHE A;  2BHM A;  5AYS C;  2GXF A;  4O3V A;  2CK3 H;  4AKY A;  3EN1 B;  3BND A;  3D9R A;  1ASK A;  2D42 A;  1WTH A;  2P0X A;  1DMQ A;  3NQY A;  2W9Q A;  3Q1C A;  1M1K 4;  3DZL A;  1FA3 A;  2E2V A;  2ML5 A;  1YIT 3;  1V74 A;  1VQM 3;  3MPH A;  3PS8 A;  2OQE A;  2O9U X;  1GS3 A;  4H61 A;  1DVC A;  1EA2 A;  2IUK A;  4HM3 B;  1DMM A;  3F7S A;  4FMD A;  3X3X A;  1CYU A;  5IG0 A;  3CMA 3;  2V1L A;  1ROA A;  3NQZ A;  1A90 A;  5ELJ A;  2Z6B A;  1U8C B;  1W7C A;  5D82 A;  2W6J H;  1YVB I;  3KZT A;  3CCQ 3;  3CC2 3;  3CCL 3;  5TGN A;  3CCS 3;  1YHQ 3;  3CME 3;  1O7P B;  4N6M A;  5IG3 A;  2XSH B;  2KCD A;  1SQW A;  3EJV A;  1DYU A;  3NBJ A;  7STD A;  1Q82 4;  1D6Z A;  4I4K A;  3NV0 B;  1YI2 3;  4L8O A;  1E3V A;  1A67 A;  4EXR A;  1S5A A;  3UNL A;  3AMO B;  5DRE A;  1GY5 A;  4LGQ A;  2F86 B;  3DM8 A;  3WDG B;  2F99 A;  3RGA A;  1W2B 2;  3LYG A;  3X3Z A;  2CG1 A;  1IT8 A;  1NU3 A;  1C7H A;  3WA2 X;  5JBS A;  3BNB A;  3CXC 2;  3MWZ A;  3EBT A;  5ELU A;  4JF8 A;  3CU3 A;  1K28 A;  1TFK A;  1FGM A;  4BTW A;  2P09 A;  1KD1 4;  1IVV A;  1IDP A;  3ALA A;  1K9M 4;  1OHS A;  1GYB A;  4TX4 A;  1HKX A;  1JB5 A;  2CWV A;  3X40 A;  3F9S A;  4XDW A;  3X41 A;  3QK9 A;  2W56 B;  2CWT A;  4OK0 A;  3B4P A;  4WYK A;  4HVN A;  2XFT A;  3EC9 A;  1N5P A;  2GBX B;  3N54 B;  2P38 A;  3S29 A;  4HM2 B;  3RGR A;  5AEW B;  1VQK 3;  3JUP A;  2PNC A;  4WHA A;  1N8R 4;  1RRL A;  4RNY A;  5AII A;  3HZP A;  3IMA B;  2CG0 A;  4STD A;  4EYC A;  1JB2 A;  1EG9 B;  4EV5 A;  1FGT A;  1QVF 2;  2LQV A;  1JKG B;  1IK3 A;  1T5Y A;  3DY5 A;  5CK6 A;  3J7Y d;  4HM8 B;  2XGN A;  3KFQ C;  3M8C A;  3S27 A;  4HZ9 B;  2CFK A;  2CKF B;  1AVK A;  2D1W A;  1OF5 B;  4KFE A;  2I9W A;  1UUW B;  2OOV A;  1OHP A;  4FCJ A;  2CIU A;  4AEQ A;  5JPU A;  3JUN A;  1NO3 A;  1IVX A;  2GEY A;  2L4V A;  4N6O B;  1KSI A;  3EB8 A;  3PXM A;  5IG5 A;  3LZA A;  1Q42 A;  5JPP A;  4HM0 B;  1IV7 A;  2XFS A;  3LTD A;  4XDV A;  3GZY B;  1D6U A;  2UX0 A;  2FXT A;  4LEH A;  3X3Y A;  1W01 A;  3DGN A;  4OVM A;  3FG1 A;  5IEO A;  1NDO B;  1O7G B;  1PFP A;  1IU7 A;  1Q40 A;  5G2G A;  3LOY A;  3F8H A;  4MEI A;  4R80 A;  2WGQ A;  1CQS A;  1UI8 A;  1ROV A;  3FZW A;  1LOX A;  2INX A;  4R9K A;  1GD3 A;  3DGL A;  4MMX B;  2Z77 A;  1SII A;  2RSX A;  4J9A A;  5AIF A;  3VSY A;  1ZO2 A;  1EQK A;  3BNE A;  1GD4 A;  1WMP A;  4NHF A;  1N9J A;  1VQ7 3;  1VZZ A;  1D6Y A;  2JQ5 A;  3UB1 A;  3PYJ A;  3QRD A;  3CNX A;  1CYV A;  3G8Z A;  3IPT A;  3NUV A;  1VQP 3;  1OGZ A;  1W00 A;  3BLZ A;  3EQQ B;  3WMD A;  1AV4 A;  3MG2 A;  2M7O A;  3D3L A;  2HMK B;  3GAX A;  3EF8 A;  3F14 A;  4N3V A;  3CPW 2;  1JN5 B;  5EVH A;  3K9M C;  1OHO A;  2HMN B;  3LTA A;  2IUJ A;  1VQ4 3;  2OTL 3;  1QAL A;  1M1X B;  4L8P A;  1IV9 A;  1VQ8 3;  1GY6 A;  2CC3 A;  1RN7 A;  1G96 A;  2MC8 A;  1ISK A;  2XSO B;  3FG3 A;  3I55 3;  4RBN A;  2QIY A;  3OXA A;  3F40 A;  3JUO A;  1JB4 A;  3H51 A;  3KII A;  2YFL B;  3HII A;  3HIG A;  1NWW A;  2YFI B;  4K1V A;  3S67 A;  3G6E 3;  3A76 A;  3Q2P A;  3DGO A;  3OWY A;  5HGR A;  4ZM8 A;  3PZW A;  4CCV A;  4K61 A;  3HI7 A;  1W6G A;  1AVL A;  2HMO B;  3SOY A;  2CFL A;  3LXU X;  1KC8 4;  1UW1 A;  1LNH A;  3UL6 A;  2SBL A;  1FGO A;  3FLJ A;  3DXO A;  3VF1 A;  4K1U A;  3NM7 A;  2OQE C;  1MNL A;  2YX9 A;  4XBX A;  3IJE B;  4LSO A;  3GZX B;  5LC6 A;  2GU1 A;  3FF2 A;  3OV4 A;  4JRF A;  3Q90 A;  5IEP A;  1VQO 3;  3RDE A;  1PU4 A;  3SOA A;  1TIJ A;  3DMC A;  1JJ2 2;  2RFR A;  3CPO A;  2FNQ A;  1IQ8 A;  1RKY A;  2QEX 3;  1SJW A;  2E2T A;  2W2C A;  5STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...