4IT7A

Crystal structure of al-cpi
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
GGFSTKDVNDPKIQALAGKALQRINAASNDLFQQTIVKVISAKTQVVAGTNTVLELLIAPTSCRKNETSAGNCEAVSNGTKQICTVAIWEKPWENFEEITIKECKSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CPI
publication title Structural Basis for the Immunomodulatory Function of Cysteine Protease Inhibitor from Human Roundworm Ascaris lumbricoides.
pubmed doi rcsb
source organism Ascaris lumbricoides
molecule tags Hydrolase inhibitor
total genus 21
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4it7A00
1STFI 3LH4A 4ZM8A 3S67A 1GD3A 1NB5I 3GAXA 1IV9A 1TIJA 1FA3A 4N6MA 1MNLA 3SVAA 3UL6A 5A0OB 1N5PA 2BO9B 1A67A 1MOLA 1YVBI 1A90A 3NX0A 1PFPA 1N5HA 3KFQC 1R4CA 4LZIA 4N6NB 2CH9A 1IV7A 1CEWI 3L0RA 2OCTA 2W9QA 4N6TA 1EQKA 4CCVA 5ELJA 3KSED 1NB3I 1N9JA 3PXMA 4N6V0 1FUWA 1DVDA 2O9UX 4EYCA 2KXGA 1WNHA 3MWZA 3QRDA 4TX4A 3PYJA 5LC7A 1CYVA 5LC6A 1M9GA 4N6LA 1DVCA 2W9PA 4N6UA 1ROAA 5EQLA 4IT7A 4N6OB 1RN7A 3K9MC 1LXEA 1GD4A 3UL5A 1CYUA 1G96A 3IMAB 3Q2PA 3PS8A 1KWIA 5ELUA
chains in the Genus database with same CATH superfamily
4HVNA 1IQYA 1JBSA 3LH4A 3S67A 1RRLA 1RJOA 3ALAA 3T8NA 3EE1A 5BIRA 2MC8A 3FLJA 1TUHA 3F8XA 1NB5I 1A2PA 2ML5A 3AHWA 5DRVA 1MGRA 3V92A 1K41A 5G2GA 1I2GA 4I5QA 3O8YA 1BVIA 2OTL3 3FH1A 3OX9A 1N5PA 4LSOA 1A67A 3X3ZA 1DMMA 2W6JH 3K63A 4R9KA 4WP5A 1X1XA 2XRXB 1SQWA 2YFJB 1BRJA 2F98A 1GMPA 2OTJ3 3PGBA 2RFRA 1IQXA 1W2B2 3HX8A 1X1YA 1RMSA 3MPHA 4CDLA 4LYLB 3SOAA 1RSNA 1JB4A 3AMOB 1BSEA 3EF8A 3MKIA 4EW5A 3CCL3 4PEJA 4LZIA 4N6NB 3RDEA 1X1WA 3D5IA 4OVMA 1VQ83 3WODG 4EC6A 3CD63 3G4S3 4XM4A 4J9AA 2WOHA 5BVBA 1VQ53 1IVWA 5FGOA 1B3SA 1RGAA 2F86B 1JJ22 4OUQA 3X42A 2L1SA 5M18A 1I3FA 1JZOA 3KN4A 5CXOA 2W9QA 2WGOA 4H61A 3DZLA 2C4BA 4HKVB 1GS3A 2ML6A 3MG2A 1LNHA 1B21A 2RSXA 3LT9A 4CCVA 1K28A 1EQKA 1FGRA 1IK3A 1NNVA 3CCV3 2O3OA 3D4AA 4HM3B 1MGWA 1LNIA 3KSED 1YJ93 1W7CA 1O7NB 2GXFA 1G0TA 2XF3A 5AYSC 3PXMA 3WR2A 8CHOA 4HM2B 4BL2A 1GY6A 2CWUA 3S27A 1E3RA 1I0XA 2GBWB 1GMRA 5AIFA 3VF1A 1AQZA 1W6CA 3CNMA 2Z76A 1B27A 1HZ1A 2CFWA 3DM8A 1I70A 4J5GA 4ORLA 4EYCA 4NREA 1YI23 2KCDA 3A5EA 3AGOA 1OCVA 1YIJ3 2M7OA 3B4OA 1SIHA 3NV0A 1ROVA 1UGHI 4O02B 3BNDA 5TGNA 1OGXA 1BNFA 2P38A 3D3LA 3X3XA 4BIRA 4BTWA 2XFSA 5D81A 2HOHA 2W04A 3DY5A 5LC7A 1ULIB 5LC6A 4GB5A 5JPUA 4L7KA 5G1KA 1M9GA 1X1UA 2CHCA 1RN4A 2IY2A 2BHMA 1W01A 3KKGA 3WA2X 2XFTA 2F5MA 5EQLA 4IT7A 1OH0A 2KF5A 2Z7AA 1KC84 1VQM3 4BU4A 1IVVA 1LOWA 1SIIA 1NDOB 2BNGA 2BMQB 2WGQA 3NBJA 2F5WA 2UUGC 4FCZA 6RNTA 4I4KA 4FMAA 4HOHA 2BT3A 1B20A 5EEOA 1A2VA 1UCKA 1CYUA 1T2IA 3IPTA 1W4NA 3GZXB 1AY7A 1T3BA 1JZDA 3CNXA 2K3DA 2A15A 3T8UA 3X41A 1VQ73 1G02A 1W6GA 1Z1SA 3Q2PA 1JKGA 2Z77A 3GZRA 1NJI4 4KT3B 5IW9A 1JBTA 3CPW2 5M19A 1GOUA 2OOVC 4ILFA 3GZYB 4NPBA 1BSAA 1L5GB 5IF6A 3V98A 2OQEC 1IVXA 4MJDA 4HM8B 5AIIA 2AADA 2CWVA 1U5OA 5KP1A 1B2MA 3F9SA 1GD3A 4R1KA 1EA2A 3EB8A 1MWTA 2V1LA 5CF1A 3GAXA 4L8OA 1LOVA 3IJEB 2FNQA 2WOFA 3OWSA 4HZ9B 3UNLA 2F4YA 5IENA 3G0KA 4XDWA 1VQ93 4H3UA 1HKXA 1MNLA 3G16A 3BB9A 5A0OB 1FUTA 3NM2A 4BTXA 3WA3A 3CXC2 3AGNA 3DGNA 1VQ43 1MOLA 4HM1B 2CX0A 1RGKA 2LQVA 3H3HA 3Q3FA 4LEHA 1UCJA 1ZO2A 2BMOB 2R41A 4HJLB 4DKIA 3CCJ3 2CIUA 1A90A 4K61A 1DMQA 3NX0A 1BSBA 3CMA3 1LRAA 1RCLA 1N5HA 1OACA 3BU4A 3KSPA 1QALA 3OV4A 2PNCA 3STDA 1RGEA 3TDGA 2UGIA 3F14A 2QGUA 3HOHA 3KZTA 4XBTA 2H0HA 1BNRA 2XEPA 3DGYA 1KQS2 1UDII 3KE7A 3F7SA 2OOVA 1IV7A 2AAEA 1UW1A 1YGEA 3U97A 1BSCA 2OQEA 1FGOA 1VQP3 3FF0A 4HYZA 4K1VA 2CFKA 3X40A 3KCHA 1YHQ3 4CPKA 4X2OA 3LZAA 2RBIA 1W6YA 1UUGB 1I8VA 2P0XA 4JF8A 3SXXA 2IMJA 1LVNA 3WHOA 1JBRA 2CKFB 2Y73A 1FZUA 3H51A 1GYBA 1MWSA 3MSOA 5IEPA 4J8TA 1JKGB 2IA7A 4GL6A 2ZHXB 3PCSA 2L4VA 3OWYA 4R80A 4BL3A 1GY7A 1MWUA 4N6V0 3I553 5AIGA 2HMLB 1BRSA 3M8CA 3MG1A 1MWRA 1FUWA 1DVDA 2F56A 1JV2B 1LQMB 2H0GA 1STDA 1QVG2 1VQN3 1IU7A 2GBXB 1NWWA 1F8NA 1QAFA 1QAKA 2CW9A 3KIIA 1I0VA 2HMNB 1PU4A 1BUQA 2D1WA 2C11A 2I9WA 3N9HA 1QJGA 1JNQA 1SARA 3PYJA 2RNTA 4FMCA 1JN5A 3EBTA 5AEWB 2YFIB 5BU4A 3CCU3 3JUMA 3LXUX 3UB1A 1RDSA 2Y74A 3URPA 1AV4A 2Z6BA 1DVCA 2W9PA 1Q40A 2P05A 2KF3A 1GOVA 4HM0B 1V74A 1RLSA 3K7CA 5G1LA 1OHSA 2ZA4A 1RN7A 1BRGA 2YFLB 1DMNA 2UX0A 3WOFB 1D6ZA 3D9RA 3LT8A 1GD4A 3ER7A 5IG4A 3FSDA 4HZBB 4O2HA 2CWTA 2H0IA 1TFKA 5DREA 3HZPA 2R4IA 4EXRA 1V57A 3SYUA 2OWPA 2CG1A 5JBSA 3F40A 1AR0A 3CU3A 5ELUA 3ZG0A 3CC73 3FG1A 1S5AA 1OPYA 3HK4A 3PCRA 1R4YA 1FUSA 1VQL3 1STFI 4J5KA 1S723 3U1WA 5BXQA 1YIT3 4EV5A 4QWTA 1K8A4 1O7PB 3OWUA 4X2HA 1ZS7A 5IERA 3JVCA 1W2ZA 3BLZA 4RBNA 3GZBA 3GWRA 2CFDA 1RGCA 1IV9A 1TIJA 1WQLB 1Q814 1O7MB 1RKYA 4U13A 1FGTA 2K54A 1FA3A 3DUKA 4N6MA 1Q9EA 3SVAA 4FCJA 1WMPA 2W56A 2BU4A 4RZMA 2STDA 1GMQA 2BO9B 5KP4A 1B2UA 2QEX3 1JRQA 4MMYB 3F8HA 1D6YA 5HOHA 3HIGA 3BNEA 3G713 1VZZA 2GSPA 7STDA 1PFPA 1HU9A 2B1XB 2SARA 3EJVA 1N8QA 2GEXA 3Q1CA 4NHFA 1JN5B 1RGGA 2KF6A 1DE3A 3K5TA 3A76A 7GSPA 1RRHA 3LTBA 1LQGC 1KSIA 4JRFA 1D6UA 4KVHA 3RGRA 1VQK3 1Q40B 3OXAA 3HI7A 1UCIA 1BSDA 1BUJA 1Q7HA 2CH9A 4WYKA 4EBGA 1BNEA 4AKZA 3X3YA 1CEWI 4RNZA 2BIRA 4AKYA 2OCTA 1BIRA 4MMXB 4N3VA 3NHXA 1M904 5HGRA 3FG4A 1C7HA 1C54A 2KAAA 1LOYA 3NV0B 2QA43 3T0UA 3CCM3 2CG0A 6GSPA 5ELJA 2C10A 2GU1A 2XSOB 2HMKB 3FF2A 1NB3I 4XDVA 1RCKA 1RHLA 3JUOA 1N9JA 1FW7A 1O7WB 3GSPA 3MHEA 1VQ63 1O7HB 3K0ZA 1I2FA 3CME3 4KFEA 2O9UX 2CX1A 1BOXA 3G6E3 3N8BA 2KXGA 4EV2A 2ZDJA 3CCS3 1RGLA 3MWZA 2K0MA 1TJDA 3EN8A 3FGYA 3CC23 3QRDA 1TU5A 2PZVA 4OK0A 4TX4A 1OUNA 8RNTA 2W56B 3F7XA 1YGWA 1DETA 1EG9B 3SOYA 5KP3A 2WO0A 4L8PA 3LTAA 4N6LA 1OF5A 1W02A 1N9EA 5AYRB 1Q864 3NBRA 1ISKA 1YNVX 1SPUA 4N6OB 4WHAA 2HMOB 2E2TA 5CLKA 2IUJA 4FCMA 4FR9A 5CF2A 3FKAA 2IUKA 3LYGA 3K9MC 1A2KA 4HM4B 3SX1A 2CC3A 1YJW3 4R4KA 3CCQ3 1JB2A 1LXEA 2RGQA 1BNIA 1RTUA 4XBXA 1U8CB 3BNBA 2CFGA 3B7CA 4WYKB 3CPOA 1YVSA 3WOEB 1BRHA 1CQSA 1LOXA 1RN1A 2GU3A 2MF7A 4XB5A 3UJMA 4O8SA 1BRNL 1K734 3S29A 1CH0A 3VSYA 1PYLA 2XH9A 5M1AA 4FMBA 1IT7A 2JDIH 4K1UA 1AVLA 4STDA 1UUWB 1Y4KA 1YJN3 1TTOA 3ECFA 3EN1B 1UUVB 3MYTA 1V58A 1VQQA 4ZM8A 1IT8A 1JB5A 9RNTA 1GSPA 4G1MB 3CCR3 1I2EA 2SBLA 4FMDA 4O3VA 1NU3A 2KRTA 1SJWA 3DMCA 4BTYA 3LTCA 1UCLA 3DXOA 3UL6A 2P09A 3NUVA 4KFDA 3V99A 4RNTA 1TRPA 4HM5B 1T2HA 3OW22 3J7Yd 1RNBA 1I3IA 1WMNA 1YVBI 3LMLA 3LOYA 1BNJA 1IQ8A 2HMJB 3ZFZA 2F99A 5JPPA 1J2BA 2IYJA 5I97A 3I563 3E99A 3HIIA 1WMOA 3ROBA 3KFQC 5IG5A 3DGOA 1R4CA 3FCSB 2HMMB 3EQQB 1ZX2A 4AEQA 3FZWA 1OF5B 2FGTA 2XR8B 3NM7A 1B2SA 5GSPA 1RGFA 2RCDA 2J8XB 2W0QA 1DYUA 1OGZA 1ASKA 1OHOA 1TFOA 4GSPA 1EEJA 1B2XA 3SEDA 1BU4A 5D82A 5IG3A 1HYFA 4RNYA 3L0RA 3GRDA 2BMRB 2QIYA 6STDA 4CJNA 1PY3A 1Q7Y4 3RNTA 3AHSA 1TP6A 1UI7A 3PZWA 4MMZB 1ZGXA 4LGQA 1N8R4 1EUIC 4N6TA 3DH2A 5AIHA 3S28A 2CFLA 2P0MA 3JUQA 1K9M4 2GEYA 3BNCA 4XBYA 1BRKA 4HM7B 3FG3A 1BNGA 1KD14 3EX9A 1UGIA 5FW5A 4MEIA 1FGQA 1M1XB 2KF4A 4IIAA 3NQYA 1W5ZA 3B4PA 3EHCA 1IVUA 1GY5A 1Q42A 2B24B 3EC9A 3JUPA 2Q07A 4HBRA 1FYSA 1W00A 4HM6B 3D5GA 3MG3A 1ULJB 1BAOA 1EKMA 1WNHA 2FXTA 4IPBA 3LTDA 3WDGB 3NQZA 1UI8A 5STDA 2INXA 1T5YA 4Q53A 3QK9A 1O7GB 3WMDA 3DGMA 5RNTA 1RGHA 2ZL8A 1CYVA 5AEUB 3DGLA 1M1K4 4WFOA 3NBBA 3AMOA 5AI1A 1E97A 1IDPA 3CC43 3JUNA 2JQ5A 4LMIA 1RNTA 1NO3A 3B8LA 3I0YA 1BGSA 4N6UA 5CK6A 4GHOA 1ROAA 3N54B 3NXJA 3RGAA 1FGMA 3CCE3 2D42A 2E2VA 2XGLA 1BRIA 1US1A 4HAAA 4K90B 4R9LA 3VGNA 1VQO3 3BIRA 4KFFA 5EVHA 1QVF2 3D79A 1IYYA 3EBYA 1OHPA 3UL5A 7RNTA 2CK3H 4WWUC 1Q824 1B2ZA 1E3VA 1G96A 3G8ZA 2W03A 1WTHA 2E2UA 3IMAB 3Q90A 1BANA 2LYXA 1AVKA 2YX9A 3ZG5A 1TRQA 5D83A 3PS8A 5IG0A 1BNSA 1GOYA 1KWIA 2XGNA 2XSHB 1QMAA 3S5CA 2W2CA 4KZ1A 3SLUA 5IEOA
chains in the Genus database with same CATH topology
4HVNA 1IQYA 3LH4A 3S67A 1RRLA 1RJOA 3ALAA 3T8NA 3EE1A 2MC8A 3FLJA 1TUHA 3F8XA 1NB5I 2ML5A 5DRVA 3V92A 1K41A 5G2GA 3O8YA 2OTL3 3FH1A 3OX9A 1N5PA 4LSOA 1A67A 3X3ZA 1DMMA 2W6JH 3K63A 4R9KA 4WP5A 2XRXB 1SQWA 2YFJB 2F98A 2OTJ3 3PGBA 2RFRA 1IQXA 1W2B2 3HX8A 3MPHA 4CDLA 3SOAA 1JB4A 3AMOB 3MKIA 3EF8A 3CCL3 4PEJA 4LZIA 4N6NB 3RDEA 4OVMA 1VQ83 3WODG 4EC6A 3G4S3 4XM4A 4J9AA 2WOHA 5BVBA 1VQ53 1IVWA 5FGOA 2F86B 1JJ22 4OUQA 3X42A 3KN4A 5CXOA 2W9QA 2WGOA 4H61A 3DZLA 4HKVB 1GS3A 2ML6A 3MG2A 1LNHA 2RSXA 3LT9A 4CCVA 1EQKA 1K28A 1FGRA 1IK3A 3CCV3 2O3OA 4HM3B 3KSED 1YJ93 1W7CA 1O7NB 2GXFA 2XF3A 5AYSC 3PXMA 8CHOA 4HM2B 1GY6A 2CWUA 3S27A 1E3RA 2GBWB 5AIFA 3VF1A 1W6CA 3CNMA 2Z76A 2CFWA 3DM8A 4ORLA 4EYCA 4NREA 1YI23 2KCDA 1YIJ3 1OCVA 3B4OA 2M7OA 1SIHA 3NV0A 1ROVA 4O02B 3BNDA 5TGNA 1OGXA 2P38A 3X3XA 3D3LA 4BTWA 2XFSA 5D81A 2W04A 3DY5A 5LC7A 1ULIB 5LC6A 4GB5A 5JPUA 4L7KA 1M9GA 2CHCA 2BHMA 1W01A 3KKGA 3WA2X 2XFTA 5EQLA 4IT7A 1OH0A 2Z7AA 1KC84 1VQM3 1IVVA 1SIIA 2WGQA 1NDOB 2BNGA 2BMQB 3NBJA 4FCZA 4I4KA 4FMAA 2BT3A 5EEOA 1A2VA 1CYUA 3IPTA 1W4NA 3GZXB 3CNXA 3T8UA 1VQ73 3X41A 2A15A 1Z1SA 1W6GA 3Q2PA 1NJI4 1JKGA 2Z77A 3GZRA 5IW9A 3CPW2 2OOVC 3GZYB 1L5GB 5IF6A 3V98A 2OQEC 1IVXA 4MJDA 4HM8B 5AIIA 5KP1A 2CWVA 1U5OA 3F9SA 1GD3A 4R1KA 1EA2A 3EB8A 2V1LA 5CF1A 3GAXA 4L8OA 3IJEB 2FNQA 2WOFA 3OWSA 4HZ9B 3UNLA 5IENA 3G0KA 4XDWA 1VQ93 4H3UA 1HKXA 1MNLA 3G16A 3BB9A 5A0OB 3NM2A 4BTXA 3WA3A 3CXC2 1VQ43 3CD63 3DGNA 1MOLA 4HM1B 2LQVA 3H3HA 4LEHA 2BMOB 1ZO2A 4HJLB 3CCJ3 2CIUA 1A90A 4K61A 1DMQA 3NX0A 3CMA3 1N5HA 1OACA 3KSPA 1QALA 3OV4A 2PNCA 3STDA 3TDGA 3F14A 2QGUA 3KZTA 4XBTA 2XEPA 1KQS2 3KE7A 3F7SA 2OOVA 1IV7A 3U97A 1UW1A 1YGEA 1VQP3 2OQEA 1FGOA 3FF0A 4HYZA 4K1VA 2CFKA 3X40A 1YHQ3 4X2OA 3LZAA 1W6YA 2P0XA 3SXXA 4JF8A 2IMJA 1LVNA 2CKFB 2Y73A 3H51A 1GYBA 3MSOA 5IEPA 4J8TA 1JKGB 2IA7A 4GL6A 4R80A 3PCSA 2L4VA 3OWYA 1GY7A 4N6V0 3I553 5AIGA 2HMLB 3M8CA 3MG1A 1FUWA 1DVDA 1JV2B 1VQN3 1STDA 1QVG2 1IU7A 2GBXB 1NWWA 1F8NA 1QAFA 1QAKA 2CW9A 3KIIA 2HMNB 1PU4A 1BUQA 2D1WA 2C11A 2I9WA 3N9HA 1QJGA 1JNQA 3PYJA 4FMCA 1JN5A 3EBTA 5AEWB 2YFIB 3CCU3 3JUMA 3LXUX 3UB1A 2Y74A 1AV4A 2Z6BA 1DVCA 2W9PA 1Q40A 2P05A 4HM0B 1V74A 3K7CA 1OHSA 1RN7A 2YFLB 1DMNA 2UX0A 3WOFB 1D6ZA 3D9RA 3LT8A 1GD4A 3ER7A 5IG4A 3FSDA 4HZBB 4O2HA 2CWTA 1TFKA 5DREA 3HZPA 2R4IA 4EXRA 2OWPA 2CG1A 5JBSA 3F40A 1AR0A 3CU3A 5ELUA 3CC73 3FG1A 1S5AA 1OPYA 3HK4A 3PCRA 1VQL3 1STFI 1S723 3U1WA 5BXQA 1YIT3 4EV5A 4QWTA 1K8A4 1O7PB 3OWUA 4X2HA 5IERA 3JVCA 1W2ZA 3BLZA 4RBNA 3GZBA 3GWRA 2CFDA 1IV9A 1TIJA 1WQLB 1Q814 1O7MB 1RKYA 4U13A 1FGTA 2K54A 1FA3A 3DUKA 4N6MA 3SVAA 4FCJA 1WMPA 2W56A 4RZMA 2STDA 2BO9B 5KP4A 2QEX3 1JRQA 4MMYB 3F8HA 1D6YA 3HIGA 3BNEA 3G713 1VZZA 7STDA 1PFPA 1HU9A 2B1XB 3EJVA 1N8QA 2GEXA 3Q1CA 4NHFA 1JN5B 3K5TA 3A76A 1RRHA 3LTBA 4JRFA 1KSIA 4KVHA 1D6UA 3RGRA 1VQK3 1Q40B 3OXAA 3HI7A 4WYKA 2CH9A 4EBGA 4AKZA 3X3YA 1CEWI 4RNZA 4AKYA 2OCTA 4MMXB 4N3VA 3NHXA 1M904 5HGRA 3FG4A 1C7HA 3NV0B 2QA43 3T0UA 3CCM3 2CG0A 5ELJA 2C10A 2GU1A 2XSOB 2HMKB 3FF2A 1NB3I 4XDVA 3JUOA 1N9JA 1O7WB 3MHEA 1VQ63 1O7HB 3K0ZA 3CME3 4KFEA 2O9UX 3G6E3 3N8BA 2KXGA 4EV2A 2ZDJA 3CCS3 3MWZA 2K0MA 3EN8A 3FGYA 3CC23 3QRDA 1TU5A 2PZVA 4OK0A 4TX4A 1OUNA 2W56B 3F7XA 1EG9B 3SOYA 5KP3A 2WO0A 4L8PA 3LTAA 4N6LA 1OF5A 1W02A 1N9EA 5AYRB 1Q864 3NBRA 1ISKA 1SPUA 4N6OB 4WHAA 2HMOB 2E2TA 5CLKA 2IUJA 4FCMA 4FR9A 5CF2A 3FKAA 2IUKA 3LYGA 3K9MC 1A2KA 4HM4B 3SX1A 2CC3A 1YJW3 4R4KA 3CCQ3 1JB2A 1LXEA 2RGQA 4XBXA 1U8CB 3BNBA 2CFGA 3B7CA 4WYKB 3CPOA 3WOEB 1CQSA 1LOXA 2GU3A 2MF7A 4XB5A 3UJMA 4O8SA 1K734 3S29A 3VSYA 2XH9A 4FMBA 1IT7A 2JDIH 4K1UA 1AVLA 4STDA 1UUWB 1Y4KA 1YJN3 3ECFA 3EN1B 1UUVB 3MYTA 4ZM8A 1IT8A 1JB5A 4G1MB 3CCR3 2SBLA 4FMDA 4O3VA 1NU3A 2KRTA 1SJWA 3DMCA 4BTYA 3LTCA 3DXOA 3UL6A 2P09A 3NUVA 4KFDA 3V99A 4HM5B 3OW22 3J7Yd 1WMNA 1YVBI 3LMLA 3LOYA 1IQ8A 2HMJB 1J2BA 2F99A 5JPPA 5I97A 3I563 3E99A 3HIIA 1WMOA 3ROBA 3KFQC 5IG5A 3DGOA 1R4CA 3FCSB 2HMMB 3EQQB 1ZX2A 4AEQA 3FZWA 1OF5B 2FGTA 2XR8B 3NM7A 2RCDA 2W0QA 1DYUA 1OGZA 1ASKA 1OHOA 1TFOA 3SEDA 5D82A 5IG3A 4RNYA 3L0RA 3GRDA 2BMRB 2QIYA 6STDA 1Q7Y4 1TP6A 1UI7A 3PZWA 4MMZB 4LGQA 1N8R4 5AIHA 4N6TA 3S28A 2CFLA 2P0MA 3JUQA 1K9M4 2GEYA 3BNCA 4XBYA 4HM7B 3FG3A 1KD14 3EX9A 5FW5A 4MEIA 1FGQA 1M1XB 4IIAA 3NQYA 1W5ZA 3B4PA 3EHCA 1IVUA 1GY5A 1Q42A 2B24B 3EC9A 3JUPA 2Q07A 4HBRA 1W00A 4HM6B 3MG3A 1ULJB 1EKMA 1WNHA 2FXTA 4IPBA 3LTDA 3WDGB 3NQZA 1UI8A 5STDA 2INXA 1T5YA 4Q53A 3QK9A 1O7GB 3WMDA 3DGMA 2ZL8A 1CYVA 5AEUB 3DGLA 4WFOA 3NBBA 3AMOA 5AI1A 1E97A 1IDPA 3CC43 3JUNA 2JQ5A 4LMIA 5IG0A 1NO3A 3B8LA 3I0YA 4N6UA 5CK6A 1M1K4 1ROAA 3N54B 3NXJA 3RGAA 1FGMA 3CCE3 2D42A 2E2VA 2XGLA 1US1A 4K90B 4R9LA 3VGNA 1VQO3 4KFFA 5EVHA 1QVF2 3EBYA 1OHPA 3UL5A 2CK3H 4WWUC 1Q824 1E3VA 1G96A 3G8ZA 2W03A 1WTHA 2E2UA 3IMAB 3Q90A 2LYXA 1AVKA 2YX9A 5D83A 3PS8A 1KWIA 2XGNA 2XSHB 1QMAA 3S5CA 2W2CA 4KZ1A 3SLUA 5IEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STF I;  3LH4 A;  4ZM8 A;  3S67 A;  1GD3 A;  1NB5 I;  3GAX A;  1IV9 A;  1TIJ A;  1FA3 A;  4N6M A;  1MNL A;  3SVA A;  3UL6 A;  5A0O B;  1N5P A;  2BO9 B;  1A67 A;  1MOL A;  1YVB I;  1A90 A;  3NX0 A;  1PFP A;  1N5H A;  3KFQ C;  1R4C A;  4LZI A;  4N6N B;  2CH9 A;  1IV7 A;  1CEW I;  3L0R A;  2OCT A;  2W9Q A;  4N6T A;  1EQK A;  4CCV A;  5ELJ A;  3KSE D;  1NB3 I;  1N9J A;  3PXM A;  4N6V 0;  1FUW A;  1DVD A;  2O9U X;  4EYC A;  2KXG A;  1WNH A;  3MWZ A;  3QRD A;  4TX4 A;  3PYJ A;  5LC7 A;  1CYV A;  5LC6 A;  1M9G A;  4N6L A;  1DVC A;  2W9P A;  4N6U A;  1ROA A;  5EQL A;  4IT7 A;  4N6O B;  1RN7 A;  3K9M C;  1LXE A;  1GD4 A;  3UL5 A;  1CYU A;  1G96 A;  3IMA B;  3Q2P A;  3PS8 A;  1KWI A;  5ELU A; 
#chains in the Genus database with same CATH topology
 4HVN A;  1IQY A;  1JBS A;  3LH4 A;  3S67 A;  1RRL A;  1RJO A;  3ALA A;  3T8N A;  3EE1 A;  5BIR A;  2MC8 A;  3FLJ A;  1TUH A;  3F8X A;  1NB5 I;  1A2P A;  2ML5 A;  3AHW A;  5DRV A;  1MGR A;  3V92 A;  1K41 A;  5G2G A;  1I2G A;  4I5Q A;  3O8Y A;  1BVI A;  2OTL 3;  3FH1 A;  3OX9 A;  1N5P A;  4LSO A;  1A67 A;  3X3Z A;  1DMM A;  2W6J H;  3K63 A;  4R9K A;  4WP5 A;  1X1X A;  2XRX B;  1SQW A;  2YFJ B;  1BRJ A;  2F98 A;  1GMP A;  2OTJ 3;  3PGB A;  2RFR A;  1IQX A;  1W2B 2;  3HX8 A;  1X1Y A;  1RMS A;  3MPH A;  4CDL A;  4LYL B;  3SOA A;  1RSN A;  1JB4 A;  3AMO B;  1BSE A;  3EF8 A;  3MKI A;  4EW5 A;  3CCL 3;  4PEJ A;  4LZI A;  4N6N B;  3RDE A;  1X1W A;  3D5I A;  4OVM A;  1VQ8 3;  3WOD G;  4EC6 A;  3CD6 3;  3G4S 3;  4XM4 A;  4J9A A;  2WOH A;  5BVB A;  1VQ5 3;  1IVW A;  5FGO A;  1B3S A;  1RGA A;  2F86 B;  1JJ2 2;  4OUQ A;  3X42 A;  2L1S A;  5M18 A;  1I3F A;  1JZO A;  3KN4 A;  5CXO A;  2W9Q A;  2WGO A;  4H61 A;  3DZL A;  2C4B A;  4HKV B;  1GS3 A;  2ML6 A;  3MG2 A;  1LNH A;  1B21 A;  2RSX A;  3LT9 A;  4CCV A;  1K28 A;  1EQK A;  1FGR A;  1IK3 A;  1NNV A;  3CCV 3;  2O3O A;  3D4A A;  4HM3 B;  1MGW A;  1LNI A;  3KSE D;  1YJ9 3;  1W7C A;  1O7N B;  2GXF A;  1G0T A;  2XF3 A;  5AYS C;  3PXM A;  3WR2 A;  8CHO A;  4HM2 B;  4BL2 A;  1GY6 A;  2CWU A;  3S27 A;  1E3R A;  1I0X A;  2GBW B;  1GMR A;  5AIF A;  3VF1 A;  1AQZ A;  1W6C A;  3CNM A;  2Z76 A;  1B27 A;  1HZ1 A;  2CFW A;  3DM8 A;  1I70 A;  4J5G A;  4ORL A;  4EYC A;  4NRE A;  1YI2 3;  2KCD A;  3A5E A;  3AGO A;  1OCV A;  1YIJ 3;  2M7O A;  3B4O A;  1SIH A;  3NV0 A;  1ROV A;  1UGH I;  4O02 B;  3BND A;  5TGN A;  1OGX A;  1BNF A;  2P38 A;  3D3L A;  3X3X A;  4BIR A;  4BTW A;  2XFS A;  5D81 A;  2HOH A;  2W04 A;  3DY5 A;  5LC7 A;  1ULI B;  5LC6 A;  4GB5 A;  5JPU A;  4L7K A;  5G1K A;  1M9G A;  1X1U A;  2CHC A;  1RN4 A;  2IY2 A;  2BHM A;  1W01 A;  3KKG A;  3WA2 X;  2XFT A;  2F5M A;  5EQL A;  4IT7 A;  1OH0 A;  2KF5 A;  2Z7A A;  1KC8 4;  1VQM 3;  4BU4 A;  1IVV A;  1LOW A;  1SII A;  1NDO B;  2BNG A;  2BMQ B;  2WGQ A;  3NBJ A;  2F5W A;  2UUG C;  4FCZ A;  6RNT A;  4I4K A;  4FMA A;  4HOH A;  2BT3 A;  1B20 A;  5EEO A;  1A2V A;  1UCK A;  1CYU A;  1T2I A;  3IPT A;  1W4N A;  3GZX B;  1AY7 A;  1T3B A;  1JZD A;  3CNX A;  2K3D A;  2A15 A;  3T8U A;  3X41 A;  1VQ7 3;  1G02 A;  1W6G A;  1Z1S A;  3Q2P A;  1JKG A;  2Z77 A;  3GZR A;  1NJI 4;  4KT3 B;  5IW9 A;  1JBT A;  3CPW 2;  5M19 A;  1GOU A;  2OOV C;  4ILF A;  3GZY B;  4NPB A;  1BSA A;  1L5G B;  5IF6 A;  3V98 A;  2OQE C;  1IVX A;  4MJD A;  4HM8 B;  5AII A;  2AAD A;  2CWV A;  1U5O A;  5KP1 A;  1B2M A;  3F9S A;  1GD3 A;  4R1K A;  1EA2 A;  3EB8 A;  1MWT A;  2V1L A;  5CF1 A;  3GAX A;  4L8O A;  1LOV A;  3IJE B;  2FNQ A;  2WOF A;  3OWS A;  4HZ9 B;  3UNL A;  2F4Y A;  5IEN A;  3G0K A;  4XDW A;  1VQ9 3;  4H3U A;  1HKX A;  1MNL A;  3G16 A;  3BB9 A;  5A0O B;  1FUT A;  3NM2 A;  4BTX A;  3WA3 A;  3CXC 2;  3AGN A;  3DGN A;  1VQ4 3;  1MOL A;  4HM1 B;  2CX0 A;  1RGK A;  2LQV A;  3H3H A;  3Q3F A;  4LEH A;  1UCJ A;  1ZO2 A;  2BMO B;  2R41 A;  4HJL B;  4DKI A;  3CCJ 3;  2CIU A;  1A90 A;  4K61 A;  1DMQ A;  3NX0 A;  1BSB A;  3CMA 3;  1LRA A;  1RCL A;  1N5H A;  1OAC A;  3BU4 A;  3KSP A;  1QAL A;  3OV4 A;  2PNC A;  3STD A;  1RGE A;  3TDG A;  2UGI A;  3F14 A;  2QGU A;  3HOH A;  3KZT A;  4XBT A;  2H0H A;  1BNR A;  2XEP A;  3DGY A;  1KQS 2;  1UDI I;  3KE7 A;  3F7S A;  2OOV A;  1IV7 A;  2AAE A;  1UW1 A;  1YGE A;  3U97 A;  1BSC A;  2OQE A;  1FGO A;  1VQP 3;  3FF0 A;  4HYZ A;  4K1V A;  2CFK A;  3X40 A;  3KCH A;  1YHQ 3;  4CPK A;  4X2O A;  3LZA A;  2RBI A;  1W6Y A;  1UUG B;  1I8V A;  2P0X A;  4JF8 A;  3SXX A;  2IMJ A;  1LVN A;  3WHO A;  1JBR A;  2CKF B;  2Y73 A;  1FZU A;  3H51 A;  1GYB A;  1MWS A;  3MSO A;  5IEP A;  4J8T A;  1JKG B;  2IA7 A;  4GL6 A;  2ZHX B;  3PCS A;  2L4V A;  3OWY A;  4R80 A;  4BL3 A;  1GY7 A;  1MWU A;  4N6V 0;  3I55 3;  5AIG A;  2HML B;  1BRS A;  3M8C A;  3MG1 A;  1MWR A;  1FUW A;  1DVD A;  2F56 A;  1JV2 B;  1LQM B;  2H0G A;  1STD A;  1QVG 2;  1VQN 3;  1IU7 A;  2GBX B;  1NWW A;  1F8N A;  1QAF A;  1QAK A;  2CW9 A;  3KII A;  1I0V A;  2HMN B;  1PU4 A;  1BUQ A;  2D1W A;  2C11 A;  2I9W A;  3N9H A;  1QJG A;  1JNQ A;  1SAR A;  3PYJ A;  2RNT A;  4FMC A;  1JN5 A;  3EBT A;  5AEW B;  2YFI B;  5BU4 A;  3CCU 3;  3JUM A;  3LXU X;  3UB1 A;  1RDS A;  2Y74 A;  3URP A;  1AV4 A;  2Z6B A;  1DVC A;  2W9P A;  1Q40 A;  2P05 A;  2KF3 A;  1GOV A;  4HM0 B;  1V74 A;  1RLS A;  3K7C A;  5G1L A;  1OHS A;  2ZA4 A;  1RN7 A;  1BRG A;  2YFL B;  1DMN A;  2UX0 A;  3WOF B;  1D6Z A;  3D9R A;  3LT8 A;  1GD4 A;  3ER7 A;  5IG4 A;  3FSD A;  4HZB B;  4O2H A;  2CWT A;  2H0I A;  1TFK A;  5DRE A;  3HZP A;  2R4I A;  4EXR A;  1V57 A;  3SYU A;  2OWP A;  2CG1 A;  5JBS A;  3F40 A;  1AR0 A;  3CU3 A;  5ELU A;  3ZG0 A;  3CC7 3;  3FG1 A;  1S5A A;  1OPY A;  3HK4 A;  3PCR A;  1R4Y A;  1FUS A;  1VQL 3;  1STF I;  4J5K A;  1S72 3;  3U1W A;  5BXQ A;  1YIT 3;  4EV5 A;  4QWT A;  1K8A 4;  1O7P B;  3OWU A;  4X2H A;  1ZS7 A;  5IER A;  3JVC A;  1W2Z A;  3BLZ A;  4RBN A;  3GZB A;  3GWR A;  2CFD A;  1RGC A;  1IV9 A;  1TIJ A;  1WQL B;  1Q81 4;  1O7M B;  1RKY A;  4U13 A;  1FGT A;  2K54 A;  1FA3 A;  3DUK A;  4N6M A;  1Q9E A;  3SVA A;  4FCJ A;  1WMP A;  2W56 A;  2BU4 A;  4RZM A;  2STD A;  1GMQ A;  2BO9 B;  5KP4 A;  1B2U A;  2QEX 3;  1JRQ A;  4MMY B;  3F8H A;  1D6Y A;  5HOH A;  3HIG A;  3BNE A;  3G71 3;  1VZZ A;  2GSP A;  7STD A;  1PFP A;  1HU9 A;  2B1X B;  2SAR A;  3EJV A;  1N8Q A;  2GEX A;  3Q1C A;  4NHF A;  1JN5 B;  1RGG A;  2KF6 A;  1DE3 A;  3K5T A;  3A76 A;  7GSP A;  1RRH A;  3LTB A;  1LQG C;  1KSI A;  4JRF A;  1D6U A;  4KVH A;  3RGR A;  1VQK 3;  1Q40 B;  3OXA A;  3HI7 A;  1UCI A;  1BSD A;  1BUJ A;  1Q7H A;  2CH9 A;  4WYK A;  4EBG A;  1BNE A;  4AKZ A;  3X3Y A;  1CEW I;  4RNZ A;  2BIR A;  4AKY A;  2OCT A;  1BIR A;  4MMX B;  4N3V A;  3NHX A;  1M90 4;  5HGR A;  3FG4 A;  1C7H A;  1C54 A;  2KAA A;  1LOY A;  3NV0 B;  2QA4 3;  3T0U A;  3CCM 3;  2CG0 A;  6GSP A;  5ELJ A;  2C10 A;  2GU1 A;  2XSO B;  2HMK B;  3FF2 A;  1NB3 I;  4XDV A;  1RCK A;  1RHL A;  3JUO A;  1N9J A;  1FW7 A;  1O7W B;  3GSP A;  3MHE A;  1VQ6 3;  1O7H B;  3K0Z A;  1I2F A;  3CME 3;  4KFE A;  2O9U X;  2CX1 A;  1BOX A;  3G6E 3;  3N8B A;  2KXG A;  4EV2 A;  2ZDJ A;  3CCS 3;  1RGL A;  3MWZ A;  2K0M A;  1TJD A;  3EN8 A;  3FGY A;  3CC2 3;  3QRD A;  1TU5 A;  2PZV A;  4OK0 A;  4TX4 A;  1OUN A;  8RNT A;  2W56 B;  3F7X A;  1YGW A;  1DET A;  1EG9 B;  3SOY A;  5KP3 A;  2WO0 A;  4L8P A;  3LTA A;  4N6L A;  1OF5 A;  1W02 A;  1N9E A;  5AYR B;  1Q86 4;  3NBR A;  1ISK A;  1YNV X;  1SPU A;  4N6O B;  4WHA A;  2HMO B;  2E2T A;  5CLK A;  2IUJ A;  4FCM A;  4FR9 A;  5CF2 A;  3FKA A;  2IUK A;  3LYG A;  3K9M C;  1A2K A;  4HM4 B;  3SX1 A;  2CC3 A;  1YJW 3;  4R4K A;  3CCQ 3;  1JB2 A;  1LXE A;  2RGQ A;  1BNI A;  1RTU A;  4XBX A;  1U8C B;  3BNB A;  2CFG A;  3B7C A;  4WYK B;  3CPO A;  1YVS A;  3WOE B;  1BRH A;  1CQS A;  1LOX A;  1RN1 A;  2GU3 A;  2MF7 A;  4XB5 A;  3UJM A;  4O8S A;  1BRN L;  1K73 4;  3S29 A;  1CH0 A;  3VSY A;  1PYL A;  2XH9 A;  5M1A A;  4FMB A;  1IT7 A;  2JDI H;  4K1U A;  1AVL A;  4STD A;  1UUW B;  1Y4K A;  1YJN 3;  1TTO A;  3ECF A;  3EN1 B;  1UUV B;  3MYT A;  1V58 A;  1VQQ A;  4ZM8 A;  1IT8 A;  1JB5 A;  9RNT A;  1GSP A;  4G1M B;  3CCR 3;  1I2E A;  2SBL A;  4FMD A;  4O3V A;  1NU3 A;  2KRT A;  1SJW A;  3DMC A;  4BTY A;  3LTC A;  1UCL A;  3DXO A;  3UL6 A;  2P09 A;  3NUV A;  4KFD A;  3V99 A;  4RNT A;  1TRP A;  4HM5 B;  1T2H A;  3OW2 2;  3J7Y d;  1RNB A;  1I3I A;  1WMN A;  1YVB I;  3LML A;  3LOY A;  1BNJ A;  1IQ8 A;  2HMJ B;  3ZFZ A;  2F99 A;  5JPP A;  1J2B A;  2IYJ A;  5I97 A;  3I56 3;  3E99 A;  3HII A;  1WMO A;  3ROB A;  3KFQ C;  5IG5 A;  3DGO A;  1R4C A;  3FCS B;  2HMM B;  3EQQ B;  1ZX2 A;  4AEQ A;  3FZW A;  1OF5 B;  2FGT A;  2XR8 B;  3NM7 A;  1B2S A;  5GSP A;  1RGF A;  2RCD A;  2J8X B;  2W0Q A;  1DYU A;  1OGZ A;  1ASK A;  1OHO A;  1TFO A;  4GSP A;  1EEJ A;  1B2X A;  3SED A;  1BU4 A;  5D82 A;  5IG3 A;  1HYF A;  4RNY A;  3L0R A;  3GRD A;  2BMR B;  2QIY A;  6STD A;  4CJN A;  1PY3 A;  1Q7Y 4;  3RNT A;  3AHS A;  1TP6 A;  1UI7 A;  3PZW A;  4MMZ B;  1ZGX A;  4LGQ A;  1N8R 4;  1EUI C;  4N6T A;  3DH2 A;  5AIH A;  3S28 A;  2CFL A;  2P0M A;  3JUQ A;  1K9M 4;  2GEY A;  3BNC A;  4XBY A;  1BRK A;  4HM7 B;  3FG3 A;  1BNG A;  1KD1 4;  3EX9 A;  1UGI A;  5FW5 A;  4MEI A;  1FGQ A;  1M1X B;  2KF4 A;  4IIA A;  3NQY A;  1W5Z A;  3B4P A;  3EHC A;  1IVU A;  1GY5 A;  1Q42 A;  2B24 B;  3EC9 A;  3JUP A;  2Q07 A;  4HBR A;  1FYS A;  1W00 A;  4HM6 B;  3D5G A;  3MG3 A;  1ULJ B;  1BAO A;  1EKM A;  1WNH A;  2FXT A;  4IPB A;  3LTD A;  3WDG B;  3NQZ A;  1UI8 A;  5STD A;  2INX A;  1T5Y A;  4Q53 A;  3QK9 A;  1O7G B;  3WMD A;  3DGM A;  5RNT A;  1RGH A;  2ZL8 A;  1CYV A;  5AEU B;  3DGL A;  1M1K 4;  4WFO A;  3NBB A;  3AMO A;  5AI1 A;  1E97 A;  1IDP A;  3CC4 3;  3JUN A;  2JQ5 A;  4LMI A;  1RNT A;  1NO3 A;  3B8L A;  3I0Y A;  1BGS A;  4N6U A;  5CK6 A;  4GHO A;  1ROA A;  3N54 B;  3NXJ A;  3RGA A;  1FGM A;  3CCE 3;  2D42 A;  2E2V A;  2XGL A;  1BRI A;  1US1 A;  4HAA A;  4K90 B;  4R9L A;  3VGN A;  1VQO 3;  3BIR A;  4KFF A;  5EVH A;  1QVF 2;  3D79 A;  1IYY A;  3EBY A;  1OHP A;  3UL5 A;  7RNT A;  2CK3 H;  4WWU C;  1Q82 4;  1B2Z A;  1E3V A;  1G96 A;  3G8Z A;  2W03 A;  1WTH A;  2E2U A;  3IMA B;  3Q90 A;  1BAN A;  2LYX A;  1AVK A;  2YX9 A;  3ZG5 A;  1TRQ A;  5D83 A;  3PS8 A;  5IG0 A;  1BNS A;  1GOY A;  1KWI A;  2XGN A;  2XSH B;  1QMA A;  3S5C A;  2W2C A;  4KZ1 A;  3SLU A;  5IEO A; 
#chains in the Genus database with same CATH homology
 4HVN A;  1IQY A;  3LH4 A;  3S67 A;  1RRL A;  1RJO A;  3ALA A;  3T8N A;  3EE1 A;  2MC8 A;  3FLJ A;  1TUH A;  3F8X A;  1NB5 I;  2ML5 A;  5DRV A;  3V92 A;  1K41 A;  5G2G A;  3O8Y A;  2OTL 3;  3FH1 A;  3OX9 A;  1N5P A;  4LSO A;  1A67 A;  3X3Z A;  1DMM A;  2W6J H;  3K63 A;  4R9K A;  4WP5 A;  2XRX B;  1SQW A;  2YFJ B;  2F98 A;  2OTJ 3;  3PGB A;  2RFR A;  1IQX A;  1W2B 2;  3HX8 A;  3MPH A;  4CDL A;  3SOA A;  1JB4 A;  3AMO B;  3MKI A;  3EF8 A;  3CCL 3;  4PEJ A;  4LZI A;  4N6N B;  3RDE A;  4OVM A;  1VQ8 3;  3WOD G;  4EC6 A;  3G4S 3;  4XM4 A;  4J9A A;  2WOH A;  5BVB A;  1VQ5 3;  1IVW A;  5FGO A;  2F86 B;  1JJ2 2;  4OUQ A;  3X42 A;  3KN4 A;  5CXO A;  2W9Q A;  2WGO A;  4H61 A;  3DZL A;  4HKV B;  1GS3 A;  2ML6 A;  3MG2 A;  1LNH A;  2RSX A;  3LT9 A;  4CCV A;  1EQK A;  1K28 A;  1FGR A;  1IK3 A;  3CCV 3;  2O3O A;  4HM3 B;  3KSE D;  1YJ9 3;  1W7C A;  1O7N B;  2GXF A;  2XF3 A;  5AYS C;  3PXM A;  8CHO A;  4HM2 B;  1GY6 A;  2CWU A;  3S27 A;  1E3R A;  2GBW B;  5AIF A;  3VF1 A;  1W6C A;  3CNM A;  2Z76 A;  2CFW A;  3DM8 A;  4ORL A;  4EYC A;  4NRE A;  1YI2 3;  2KCD A;  1YIJ 3;  1OCV A;  3B4O A;  2M7O A;  1SIH A;  3NV0 A;  1ROV A;  4O02 B;  3BND A;  5TGN A;  1OGX A;  2P38 A;  3X3X A;  3D3L A;  4BTW A;  2XFS A;  5D81 A;  2W04 A;  3DY5 A;  5LC7 A;  1ULI B;  5LC6 A;  4GB5 A;  5JPU A;  4L7K A;  1M9G A;  2CHC A;  2BHM A;  1W01 A;  3KKG A;  3WA2 X;  2XFT A;  5EQL A;  4IT7 A;  1OH0 A;  2Z7A A;  1KC8 4;  1VQM 3;  1IVV A;  1SII A;  2WGQ A;  1NDO B;  2BNG A;  2BMQ B;  3NBJ A;  4FCZ A;  4I4K A;  4FMA A;  2BT3 A;  5EEO A;  1A2V A;  1CYU A;  3IPT A;  1W4N A;  3GZX B;  3CNX A;  3T8U A;  1VQ7 3;  3X41 A;  2A15 A;  1Z1S A;  1W6G A;  3Q2P A;  1NJI 4;  1JKG A;  2Z77 A;  3GZR A;  5IW9 A;  3CPW 2;  2OOV C;  3GZY B;  1L5G B;  5IF6 A;  3V98 A;  2OQE C;  1IVX A;  4MJD A;  4HM8 B;  5AII A;  5KP1 A;  2CWV A;  1U5O A;  3F9S A;  1GD3 A;  4R1K A;  1EA2 A;  3EB8 A;  2V1L A;  5CF1 A;  3GAX A;  4L8O A;  3IJE B;  2FNQ A;  2WOF A;  3OWS A;  4HZ9 B;  3UNL A;  5IEN A;  3G0K A;  4XDW A;  1VQ9 3;  4H3U A;  1HKX A;  1MNL A;  3G16 A;  3BB9 A;  5A0O B;  3NM2 A;  4BTX A;  3WA3 A;  3CXC 2;  1VQ4 3;  3CD6 3;  3DGN A;  1MOL A;  4HM1 B;  2LQV A;  3H3H A;  4LEH A;  2BMO B;  1ZO2 A;  4HJL B;  3CCJ 3;  2CIU A;  1A90 A;  4K61 A;  1DMQ A;  3NX0 A;  3CMA 3;  1N5H A;  1OAC A;  3KSP A;  1QAL A;  3OV4 A;  2PNC A;  3STD A;  3TDG A;  3F14 A;  2QGU A;  3KZT A;  4XBT A;  2XEP A;  1KQS 2;  3KE7 A;  3F7S A;  2OOV A;  1IV7 A;  3U97 A;  1UW1 A;  1YGE A;  1VQP 3;  2OQE A;  1FGO A;  3FF0 A;  4HYZ A;  4K1V A;  2CFK A;  3X40 A;  1YHQ 3;  4X2O A;  3LZA A;  1W6Y A;  2P0X A;  3SXX A;  4JF8 A;  2IMJ A;  1LVN A;  2CKF B;  2Y73 A;  3H51 A;  1GYB A;  3MSO A;  5IEP A;  4J8T A;  1JKG B;  2IA7 A;  4GL6 A;  4R80 A;  3PCS A;  2L4V A;  3OWY A;  1GY7 A;  4N6V 0;  3I55 3;  5AIG A;  2HML B;  3M8C A;  3MG1 A;  1FUW A;  1DVD A;  1JV2 B;  1VQN 3;  1STD A;  1QVG 2;  1IU7 A;  2GBX B;  1NWW A;  1F8N A;  1QAF A;  1QAK A;  2CW9 A;  3KII A;  2HMN B;  1PU4 A;  1BUQ A;  2D1W A;  2C11 A;  2I9W A;  3N9H A;  1QJG A;  1JNQ A;  3PYJ A;  4FMC A;  1JN5 A;  3EBT A;  5AEW B;  2YFI B;  3CCU 3;  3JUM A;  3LXU X;  3UB1 A;  2Y74 A;  1AV4 A;  2Z6B A;  1DVC A;  2W9P A;  1Q40 A;  2P05 A;  4HM0 B;  1V74 A;  3K7C A;  1OHS A;  1RN7 A;  2YFL B;  1DMN A;  2UX0 A;  3WOF B;  1D6Z A;  3D9R A;  3LT8 A;  1GD4 A;  3ER7 A;  5IG4 A;  3FSD A;  4HZB B;  4O2H A;  2CWT A;  1TFK A;  5DRE A;  3HZP A;  2R4I A;  4EXR A;  2OWP A;  2CG1 A;  5JBS A;  3F40 A;  1AR0 A;  3CU3 A;  5ELU A;  3CC7 3;  3FG1 A;  1S5A A;  1OPY A;  3HK4 A;  3PCR A;  1VQL 3;  1STF I;  1S72 3;  3U1W A;  5BXQ A;  1YIT 3;  4EV5 A;  4QWT A;  1K8A 4;  1O7P B;  3OWU A;  4X2H A;  5IER A;  3JVC A;  1W2Z A;  3BLZ A;  4RBN A;  3GZB A;  3GWR A;  2CFD A;  1IV9 A;  1TIJ A;  1WQL B;  1Q81 4;  1O7M B;  1RKY A;  4U13 A;  1FGT A;  2K54 A;  1FA3 A;  3DUK A;  4N6M A;  3SVA A;  4FCJ A;  1WMP A;  2W56 A;  4RZM A;  2STD A;  2BO9 B;  5KP4 A;  2QEX 3;  1JRQ A;  4MMY B;  3F8H A;  1D6Y A;  3HIG A;  3BNE A;  3G71 3;  1VZZ A;  7STD A;  1PFP A;  1HU9 A;  2B1X B;  3EJV A;  1N8Q A;  2GEX A;  3Q1C A;  4NHF A;  1JN5 B;  3K5T A;  3A76 A;  1RRH A;  3LTB A;  4JRF A;  1KSI A;  4KVH A;  1D6U A;  3RGR A;  1VQK 3;  1Q40 B;  3OXA A;  3HI7 A;  4WYK A;  2CH9 A;  4EBG A;  4AKZ A;  3X3Y A;  1CEW I;  4RNZ A;  4AKY A;  2OCT A;  4MMX B;  4N3V A;  3NHX A;  1M90 4;  5HGR A;  3FG4 A;  1C7H A;  3NV0 B;  2QA4 3;  3T0U A;  3CCM 3;  2CG0 A;  5ELJ A;  2C10 A;  2GU1 A;  2XSO B;  2HMK B;  3FF2 A;  1NB3 I;  4XDV A;  3JUO A;  1N9J A;  1O7W B;  3MHE A;  1VQ6 3;  1O7H B;  3K0Z A;  3CME 3;  4KFE A;  2O9U X;  3G6E 3;  3N8B A;  2KXG A;  4EV2 A;  2ZDJ A;  3CCS 3;  3MWZ A;  2K0M A;  3EN8 A;  3FGY A;  3CC2 3;  3QRD A;  1TU5 A;  2PZV A;  4OK0 A;  4TX4 A;  1OUN A;  2W56 B;  3F7X A;  1EG9 B;  3SOY A;  5KP3 A;  2WO0 A;  4L8P A;  3LTA A;  4N6L A;  1OF5 A;  1W02 A;  1N9E A;  5AYR B;  1Q86 4;  3NBR A;  1ISK A;  1SPU A;  4N6O B;  4WHA A;  2HMO B;  2E2T A;  5CLK A;  2IUJ A;  4FCM A;  4FR9 A;  5CF2 A;  3FKA A;  2IUK A;  3LYG A;  3K9M C;  1A2K A;  4HM4 B;  3SX1 A;  2CC3 A;  1YJW 3;  4R4K A;  3CCQ 3;  1JB2 A;  1LXE A;  2RGQ A;  4XBX A;  1U8C B;  3BNB A;  2CFG A;  3B7C A;  4WYK B;  3CPO A;  3WOE B;  1CQS A;  1LOX A;  2GU3 A;  2MF7 A;  4XB5 A;  3UJM A;  4O8S A;  1K73 4;  3S29 A;  3VSY A;  2XH9 A;  4FMB A;  1IT7 A;  2JDI H;  4K1U A;  1AVL A;  4STD A;  1UUW B;  1Y4K A;  1YJN 3;  3ECF A;  3EN1 B;  1UUV B;  3MYT A;  4ZM8 A;  1IT8 A;  1JB5 A;  4G1M B;  3CCR 3;  2SBL A;  4FMD A;  4O3V A;  1NU3 A;  2KRT A;  1SJW A;  3DMC A;  4BTY A;  3LTC A;  3DXO A;  3UL6 A;  2P09 A;  3NUV A;  4KFD A;  3V99 A;  4HM5 B;  3OW2 2;  3J7Y d;  1WMN A;  1YVB I;  3LML A;  3LOY A;  1IQ8 A;  2HMJ B;  1J2B A;  2F99 A;  5JPP A;  5I97 A;  3I56 3;  3E99 A;  3HII A;  1WMO A;  3ROB A;  3KFQ C;  5IG5 A;  3DGO A;  1R4C A;  3FCS B;  2HMM B;  3EQQ B;  1ZX2 A;  4AEQ A;  3FZW A;  1OF5 B;  2FGT A;  2XR8 B;  3NM7 A;  2RCD A;  2W0Q A;  1DYU A;  1OGZ A;  1ASK A;  1OHO A;  1TFO A;  3SED A;  5D82 A;  5IG3 A;  4RNY A;  3L0R A;  3GRD A;  2BMR B;  2QIY A;  6STD A;  1Q7Y 4;  1TP6 A;  1UI7 A;  3PZW A;  4MMZ B;  4LGQ A;  1N8R 4;  5AIH A;  4N6T A;  3S28 A;  2CFL A;  2P0M A;  3JUQ A;  1K9M 4;  2GEY A;  3BNC A;  4XBY A;  4HM7 B;  3FG3 A;  1KD1 4;  3EX9 A;  5FW5 A;  4MEI A;  1FGQ A;  1M1X B;  4IIA A;  3NQY A;  1W5Z A;  3B4P A;  3EHC A;  1IVU A;  1GY5 A;  1Q42 A;  2B24 B;  3EC9 A;  3JUP A;  2Q07 A;  4HBR A;  1W00 A;  4HM6 B;  3MG3 A;  1ULJ B;  1EKM A;  1WNH A;  2FXT A;  4IPB A;  3LTD A;  3WDG B;  3NQZ A;  1UI8 A;  5STD A;  2INX A;  1T5Y A;  4Q53 A;  3QK9 A;  1O7G B;  3WMD A;  3DGM A;  2ZL8 A;  1CYV A;  5AEU B;  3DGL A;  4WFO A;  3NBB A;  3AMO A;  5AI1 A;  1E97 A;  1IDP A;  3CC4 3;  3JUN A;  2JQ5 A;  4LMI A;  5IG0 A;  1NO3 A;  3B8L A;  3I0Y A;  4N6U A;  5CK6 A;  1M1K 4;  1ROA A;  3N54 B;  3NXJ A;  3RGA A;  1FGM A;  3CCE 3;  2D42 A;  2E2V A;  2XGL A;  1US1 A;  4K90 B;  4R9L A;  3VGN A;  1VQO 3;  4KFF A;  5EVH A;  1QVF 2;  3EBY A;  1OHP A;  3UL5 A;  2CK3 H;  4WWU C;  1Q82 4;  1E3V A;  1G96 A;  3G8Z A;  2W03 A;  1WTH A;  2E2U A;  3IMA B;  3Q90 A;  2LYX A;  1AVK A;  2YX9 A;  5D83 A;  3PS8 A;  1KWI A;  2XGN A;  2XSH B;  1QMA A;  3S5C A;  2W2C A;  4KZ1 A;  3SLU A;  5IEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...