4IT7A

Crystal structure of al-cpi
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
GGFSTKDVNDPKIQALAGKALQRINAASNDLFQQTIVKVISAKTQVVAGTNTVLELLIAPTSCRKNETSAGNCEAVSNGTKQICTVAIWEKPWENFEEITIKECKSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Immunomodulatory Function of Cysteine Protease Inhibitor from Human Roundworm Ascaris lumbricoides.
pubmed doi rcsb
source organism Ascaris lumbricoides
molecule tags Hydrolase inhibitor
molecule keywords CPI
total genus 21
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4it7A00
4IT7A 3PYJA 1KWIA 3L0RA 3QRDA 1LXEA 3PXMA 3UL5A 1MOLA 3KSED 1GD3A 3PS8A 5LC6A 3UL6A 2O9UX 1CYUA 1CEWI 2CH9A 3MWZA 4N6TA 1RN7A 5ELUA 3GAXA 4N6NB 1EQKA 1G96A 4N6MA 1M9GA 4N6V0 2OCTA 1N5PA 1A67A 1A90A 1N5HA 4CCVA 1PFPA 3SVAA 1GD4A 5A0OB 2BO9B 1IV9A 1IV7A 2W9PA 3IMAB 5ELJA 1TIJA 1CYVA 1STFI 1DVCA 5EQLA 4ZM8A 1FA3A 1DVDA 4N6UA 1ROAA 3NX0A 5LC7A 1FUWA 3LH4A 4EYCA 4N6LA 2KXGA 2W9QA 1YVBI 1WNHA 1NB5I 4N6OB 3KFQC 3Q2PA 1R4CA 4LZIA 4TX4A 1MNLA 3S67A 3K9MC 1N9JA 1NB3I
chains in the Genus database with same CATH superfamily
5D81A 2H0HA 1WMOA 3RNTA 3PS8A 1GD3A 1NNVA 1FGRA 2Q07A 3F9SA 4K90B 4I4KA 5G1LA 1FZUA 2I9WA 8RNTA 3EJVA 3KKGA 4LYLB 2IMJA 1LQMB 1E3VA 1JBTA 3EN1B 4STDA 6STDA 3I563 5M1AA 3EN8A 2BO9B 1Q9EA 1RHLA 3DM8A 3JVCA 2W04A 1OHSA 1JB4A 1T5YA 1ROAA 3FSDA 1O7HB 3X3XA 3LTBA 4H61A 3J7Yd 4EXRA 5CF1A 1B3SA 1I8VA 2IY2A 1O7NB 1OPYA 2CG1A 2GU1A 1B2MA 4KVHA 2GSPA 4K1UA 3QRDA 1JBSA 1FYSA 3U97A 3NM7A 1FGTA 3OWYA 1IQXA 3OW22 1RGCA 2Z76A 4O8SA 1G96A 4WWUC 1DETA 1D6YA 1N8R4 1DE3A 2XSOB 1GY5A 1RJOA 2XR8B 3MPHA 2K0MA 1KQS2 3UNLA 3N9HA 4FCJA 2WOHA 5AIHA 3FGYA 3A5EA 1S723 1GMQA 1DMMA 3KN4A 4EC6A 3SOYA 1LQGC 2W9QA 1RNBA 1B20A 4AEQA 3T0UA 1BUQA 2RBIA 3CNMA 3CCU3 1MNLA 3EBYA 3LT8A 1GMPA 1RLSA 3LT9A 4WFOA 3F7XA 4O2HA 1JZOA 1LXEA 5EEOA 3CCE3 1V74A 1RGAA 4AKZA 5IG3A 3FG3A 2KRTA 1IVXA 1D6UA 2STDA 4FCZA 3CCQ3 3OWUA 1L5GB 2XEPA 5IEPA 2E2UA 1V57A 3NM2A 5AYSC 4MMZB 5IEOA 3ZG5A 1IT7A 3CPW2 1HU9A 1RTUA 1IQ8A 1T2HA 1ZGXA 3IJEB 3KZTA 4L8OA 1EQKA 1RMSA 2KF6A 2KF4A 2BHMA 2C11A 2RCDA 3E99A 2F5WA 4XDWA 4DKIA 1IYYA 2CWVA 1KC84 2AADA 1CQSA 2YFJB 3FLJA 3FG1A 4XDVA 1LNIA 4HM3B 1RGGA 1U5OA 1PY3A 1LRAA 1A2KA 2E2VA 2WO0A 2Z6BA 3CU3A 4FMBA 5AIIA 5AI1A 1VQQA 4X2OA 5ELUA 3D79A 4EV2A 1R4YA 1V58A 4HJLB 4N6MA 3CME3 1DYUA 1TU5A 1JRQA 2K54A 1K734 1VQ43 3BNCA 5EVHA 1STDA 3U1WA 1K8A4 1LOVA 1PFPA 1W2ZA 1VQN3 1Q42A 1BUJA 1K9M4 3IMAB 2XFTA 2W2CA 3MKIA 2ML5A 3FH1A 3SX1A 2IUKA 5DRVA 2IA7A 3MG2A 1VQO3 3KFQC 3Q2PA 1IVVA 1NB3I 3LOYA 5FGOA 1BNSA 1BNFA 2BMQB 3SXXA 3V98A 3D3LA 3NBRA 2LQVA 5AIFA 2MC8A 3AHWA 2RSXA 1LOXA 2W6JH 2O3OA 3AHSA 3BU4A 1WMNA 1RN1A 7STDA 3LTCA 3HZPA 1B21A 2CFWA 1UGHI 2AAEA 1OGZA 3DGYA 1GD4A 3EF8A 2JDIH 4J5GA 1GOVA 1RCKA 1CYVA 1TIJA 5EQLA 3WOEB 2ZL8A 3AMOB 3F40A 2P38A 2XH9A 1O7PB 1OF5B 4LZIA 1WQLB 4J5KA 3SYUA 3BB9A 1W00A 3LMLA 1O7GB 3QK9A 2B1XB 1AR0A 1EKMA 3JUQA 3CXC2 3T8NA 3F8HA 1TRQA 3FG4A 4HM7B 1BNRA 5LC6A 4HBRA 1IDPA 1TFOA 3NHXA 1UUVB 2HMNB 3F7SA 1VQL3 3CC73 1SJWA 1IT8A 1VZZA 1VQP3 3NQZA 2GU3A 3WR2A 1ULIB 1MWTA 1E3RA 2UUGC 2XF3A 3S28A 1Y4KA 4PEJA 4I5QA 3RGAA 3D5GA 1BRHA 3SVAA 2CKFB 3NV0B 1SQWA 2ML6A 2A15A 1MWRA 1X1YA 4EYCA 3D5IA 2RFRA 3F14A 1PYLA 1UCIA 3G8ZA 1SPUA 3Q90A 1UCKA 1NWWA 1I3IA 2HMKB 2YX9A 3O8YA 3PCRA 1GOUA 5M18A 4GL6A 4XB5A 3EC9A 1LOYA 2HMOB 5IW9A 5M19A 1CYUA 1BOXA 2CH9A 1ZX2A 3K5TA 1RN7A 2PZVA 2D42A 1BVIA 1OH0A 1FW7A 1EA2A 1QAFA 3AGOA 3PGBA 3WA3A 2H0GA 5STDA 1A67A 3N54B 1UUGB 1I2EA 4HM0B 2QIYA 1ROVA 1YNVX 4HZBB 5BU4A 2CC3A 1Q7Y4 4LSOA 3CC43 1QALA 1MGWA 2KF3A 1BANA 1OUNA 3BLZA 3LTDA 5LC7A 2MF7A 1SARA 3GSPA 4QWTA 4ORLA 5CLKA 3NUVA 4MMXB 1BNJA 1JZDA 3UJMA 1LNHA 3LTAA 4JF8A 4IPBA 2XSHB 1SIIA 1UCJA 1W4NA 2F56A 1EUIC 2CWUA 1MOLA 3KE7A 3DGNA 4HZ9B 1UUWB 4XBTA 1YIJ3 5DREA 1VQ83 2WOFA 1GY7A 3UL6A 1JB2A 1EG9B 3V99A 1GY6A 1GS3A 1TRPA 4U13A 4WYKA 5I97A 2CW9A 1J2BA 3UB1A 3VGNA 4RNZA 2C10A 3KSPA 1I2FA 1W02A 2BMOB 5IERA 1O7MB 1TFKA 2KF5A 1TTOA 4OVMA 9RNTA 3DH2A 4NREA 4CPKA 3GRDA 5FW5A 2CIUA 4L8PA 4HM2B 3GZBA 1I0VA 3K7CA 1G0TA 3NXJA 4N6LA 2C4BA 4L7KA 3FF0A 1BSEA 1FUSA 2F4YA 3DUKA 3S67A 3K9MC 3H51A 2OWPA 3B4OA 4H3UA 4IT7A 1GSPA 3N8BA 1ULJB 3G713 3ROBA 5AIGA 2OOVA 2XGNA 5G2GA 1YJ93 2CFDA 3HI7A 5CF2A 1IK3A 1RKYA 1X1XA 2PNCA 1W7CA 4XBYA 2BIRA 1BRNL 3G0KA 3OV4A 1AQZA 3STDA 1SIHA 1W6YA 3NV0A 3Q1CA 3HK4A 5G1KA 2SBLA 3MHEA 3DY5A 3S29A 3X40A 7RNTA 3GWRA 5JPUA 4HYZA 5D82A 1IQYA 4WYKB 1W6CA 2JQ5A 2W56B 4CCVA 3SEDA 3CCL3 1C54A 3M8CA 2L1SA 1Z1SA 3EHCA 1KSIA 4R9LA 5IG5A 1U8CB 3CPOA 2HMLB 1BSAA 1US1A 1LVNA 2FNQA 3MSOA 3Q3FA 1TP6A 3GZRA 3OX9A 5HOHA 1K41A 1BSDA 3RGRA 6GSPA 1JKGB 1A90A 2QEX3 1QMAA 2WGOA 1AY7A 2INXA 4RZMA 3MG1A 5AEUB 1JN5A 3B7CA 1M1K4 1RDSA 2QA43 1VQ53 1GOYA 1G02A 3DGLA 1N8QA 1RGFA 5CK6A 3FCSB 4G1MB 1MWUA 1MWSA 2GEXA 2OQEC 3X3YA 1QVF2 1A2PA 4J9AA 1N5PA 2M7OA 2CX0A 1TUHA 4BL3A 4HAAA 4ILFA 1VQ93 3JUMA 1BIRA 2CFKA 6RNTA 1ZO2A 3H3HA 2P0XA 1Q40B 2HOHA 1UGIA 1JB5A 2L4VA 3NX0A 2P05A 1QAKA 3ZFZA 1T3BA 1Q824 4CDLA 2W56A 2QGUA 3NBBA 1EEJA 4HKVB 2RNTA 3EB8A 5BIRA 3D4AA 4FMCA 3CC23 1FGOA 2R41A 3AMOA 1UDII 2UX0A 3K63A 4GB5A 2CX1A 2F5MA 3EBTA 4HM6B 5CXOA 1OF5A 3PYJA 3TDGA 3WODG 1NDOB 2YFLB 3BIRA 3BNDA 3OXAA 1RNTA 2RGQA 2E2TA 1RN4A 5IF6A 2BNGA 3GAXA 2Z7AA 4FCMA 2P0MA 5JPPA 1N9EA 4NPBA 2FGTA 1M1XB 2CG0A 3DGMA 3HOHA 4Q53A 4HM5B 3JUNA 1W2B2 5HGRA 1OHOA 1IVUA 1B2SA 3S5CA 1M904 3SLUA 1IV7A 4HVNA 1RCLA 3MYTA 2IUJA 1STFI 3FF2A 5AEWB 4R4KA 1DMNA 1BU4A 2F98A 1JJ22 1TJDA 2GXFA 1S5AA 1BNGA 2WGQA 3HX8A 1A2VA 2KXGA 3I553 1NB5I 3PZWA 3GZYB 3WOFB 3EQQB 1BAOA 5KP1A 2H0IA 1IU7A 4HOHA 1W01A 2CK3H 3EE1A 1ISKA 5D83A 3FKAA 4FMDA 3I0YA 1BGSA 4HM1B 3V92A 3DZLA 1MGRA 4MEIA 2LYXA 3D9RA 4FMAA 1FUTA 3BNBA 4RNYA 1ZS7A 3LYGA 1YJW3 2CHCA 2HMJB 1IV9A 2W9PA 2ZDJA 1BSBA 1AV4A 1BRIA 1I2GA 4KT3B 3G6E3 1JV2B 1DVCA 3CCM3 1OACA 3RDEA 4FR9A 1QVG2 3KCHA 4N6UA 4CJNA 4LMIA 4KFDA 1HZ1A 1JN5B 1WNHA 3VF1A 4KFFA 3EX9A 4N6OB 3ZG0A 1CH0A 1HKXA 1AVLA 4GHOA 4WHAA 3LZAA 1DVDA 3CCS3 3PXMA 1B2ZA 2XRXB 4RNTA 1B2XA 1RGHA 1NO3A 1CEWI 1YJN3 1I0XA 1RRHA 4N6TA 3WA2X 1RGEA 3WHOA 2BMRB 2ZHXB 2SARA 4N6V0 2OOVC 1UI8A 2OTJ3 4EBGA 3G16A 1Q40A 3AGNA 1KD14 1VQM3 3DGOA 2HMMB 5JBSA 1JNQA 1K28A 3F8XA 1T2IA 4R1KA 4BL2A 4LGQA 1RGLA 1UI7A 3A76A 3X42A 2CFLA 3PCSA 1VQ73 1FUWA 3B4PA 4GSPA 3GZXB 1R4CA 4O02B 2XFSA 4K1VA 1BRJA 3OWSA 2GBXB 1UW1A 3UL5A 4BIRA 3X41A 3ER7A 3KSED 4NHFA 4R80A 1E97A 4AKYA 4N3VA 4JRFA 1BRSA 2O9UX 1B27A 4OUQA 2W03A 1RSNA 4XM4A 3JUOA 4MMYB 2YFIB 1FGMA 5IG0A 1NJI4 2KAAA 4OK0A 1D6ZA 1HYFA 3ALAA 1X1WA 4KFEA 2P09A 3WMDA 5KP3A 1IVWA 5IENA 1I70A 2GEYA 4R9KA 2OQEA 2ZA4A 1QJGA 2KCDA 3SOAA 3LH4A 3CD63 4BU4A 3VSYA 3CMA3 1Q864 1O7WB 3KIIA 3HIIA 4TX4A 2BU4A 1OCVA 3CNXA 4KZ1A 5BXQA 1GYBA 1DMQA 1KWIA 1LOWA 2Y73A 1I3FA 3LXUX 3WDGB 3S27A 1JBRA 3ECFA 3MWZA 4MJDA 1W6GA 3CCJ3 3HIGA 2OCTA 4X2HA 1AVKA 4BTWA 1Q7HA 5BVBA 1RRLA 1N5HA 1WMPA 2W0QA 1OHPA 3DXOA 4IIAA 1X1UA 1YIT3 1NU3A 1YHQ3 1BRGA 5ELJA 1FGQA 5GSPA 4ZM8A 1FA3A 2K3DA 3MG3A 5KP4A 1BNIA 3JUPA 2J8XB 2R4IA 1W5ZA 3BNEA 4XBXA 1B2UA 1N9JA 4BTXA 1YGEA 4HM8B 4BTYA 3L0RA 1BSCA 1YGWA 3CCV3 2V1LA 4HM4B 1RGKA 3B8LA 2F86B 1VQK3 1YVSA 1YI23 1C7HA 1BNEA 2F99A 2FXTA 3FZWA 4J8TA 4O3VA 4N6NB 5RNTA 4EV5A 2OTL3 1VQ63 1F8NA 1M9GA 2IYJA 2Z77A 3IPTA 5TGNA 3T8UA 3G4S3 1UCLA 1ASKA 3X3ZA 8CHOA 2CWTA 5IG4A 4LEHA 3DMCA 2XGLA 1PU4A 1Q814 5A0OB 3NBJA 2CFGA 1WTHA 4RBNA 4WP5A 1JKGA 4K61A 2BT3A 3K0ZA 5AYRB 2GBWB 1BRKA 2Y74A 1YVBI 1GMRA 3NQYA 3URPA 2UGIA 3CCR3 7GSPA 4EW5A 2D1WA 1OGXA 2B24B
chains in the Genus database with same CATH topology
5D81A 1WMOA 3PS8A 1GD3A 2Q07A 1FGRA 3F9SA 4K90B 4I4KA 2I9WA 3EJVA 3KKGA 2IMJA 1E3VA 3EN1B 4STDA 6STDA 3I563 3EN8A 2BO9B 3DM8A 3JVCA 2W04A 1OHSA 1JB4A 1T5YA 1ROAA 3FSDA 1O7HB 3X3XA 3LTBA 4H61A 3J7Yd 4EXRA 5CF1A 1O7NB 1OPYA 2CG1A 2GU1A 4KVHA 4K1UA 3QRDA 3U97A 3NM7A 1FGTA 3OWYA 1IQXA 3OW22 2Z76A 4O8SA 1G96A 4WWUC 1D6YA 1N8R4 2XSOB 1GY5A 1RJOA 2XR8B 3MPHA 2K0MA 1KQS2 3UNLA 3N9HA 4FCJA 2WOHA 5AIHA 3FGYA 1S723 1DMMA 3KN4A 4EC6A 3SOYA 2W9QA 1BUQA 4AEQA 3T0UA 3CNMA 3CCU3 1MNLA 3EBYA 3LT8A 3LT9A 4WFOA 3F7XA 4O2HA 5EEOA 1LXEA 3CCE3 1V74A 4AKZA 5IG3A 3FG3A 2KRTA 1IVXA 1D6UA 2STDA 4FCZA 3CCQ3 3OWUA 1L5GB 2XEPA 5IEPA 2E2UA 3NM2A 5AYSC 4MMZB 5IEOA 1IT7A 3CPW2 1HU9A 1IQ8A 3IJEB 3KZTA 4L8OA 2BHMA 2C11A 2RCDA 3E99A 4XDWA 2CWVA 1KC84 2YFJB 1CQSA 3FLJA 3FG1A 4XDVA 4HM3B 1U5OA 4FMBA 2WO0A 1A2KA 2E2VA 2Z6BA 3CU3A 5AIIA 5AI1A 4X2OA 5ELUA 4EV2A 4HJLB 4N6MA 3CME3 1VQ43 1DYUA 1TU5A 1JRQA 2K54A 1K734 3BNCA 5EVHA 1STDA 3U1WA 1K8A4 1PFPA 1W2ZA 1VQN3 1Q42A 1K9M4 3IMAB 2XFTA 2W2CA 3MKIA 2ML5A 3FH1A 3SX1A 2IUKA 5DRVA 2IA7A 3MG2A 1VQO3 3KFQC 3Q2PA 1IVVA 1NB3I 3LOYA 5FGOA 2BMQB 3SXXA 3V98A 3D3LA 3NBRA 2LQVA 5AIFA 2MC8A 2RSXA 1LOXA 2W6JH 2O3OA 1WMNA 7STDA 3LTCA 3HZPA 2CFWA 1OGZA 1GD4A 3EF8A 2JDIH 1TIJA 1CYVA 5EQLA 3WOEB 2ZL8A 3AMOB 3F40A 2P38A 2XH9A 1O7PB 1OF5B 4LZIA 1WQLB 3BB9A 1W00A 3LMLA 1O7GB 3QK9A 2B1XB 1AR0A 1EKMA 3JUQA 3CXC2 3T8NA 3F8HA 3FG4A 4HM7B 5LC6A 4HBRA 1IDPA 1TFOA 3NHXA 1UUVB 2HMNB 3F7SA 1VQL3 3CC73 1SJWA 1IT8A 1VZZA 1VQP3 3NQZA 2GU3A 1ULIB 1E3RA 2XF3A 3S28A 1Y4KA 4PEJA 3RGAA 3SVAA 2CKFB 3NV0B 1SQWA 2ML6A 2A15A 4EYCA 2RFRA 3F14A 3G8ZA 1SPUA 3Q90A 1NWWA 2HMKB 3O8YA 2YX9A 3PCRA 4GL6A 4XB5A 3EC9A 2HMOB 5IW9A 1CYUA 2CH9A 1ZX2A 3K5TA 1RN7A 2PZVA 2D42A 1OH0A 1EA2A 1QAFA 3PGBA 3WA3A 5STDA 1A67A 3N54B 4HM0B 2QIYA 1ROVA 4HZBB 2CC3A 1Q7Y4 4LSOA 3CC43 1QALA 3BLZA 1OUNA 3LTDA 5LC7A 2MF7A 4QWTA 4ORLA 5CLKA 3NUVA 4MMXB 3UJMA 1LNHA 3LTAA 4JF8A 4IPBA 2XSHB 1SIIA 4X2HA 1W4NA 2CWUA 3KE7A 4HZ9B 1MOLA 3DGNA 4XBTA 1UUWB 1VQ83 1YIJ3 5DREA 2WOFA 1GY7A 3UL6A 1JB2A 1EG9B 3V99A 1GY6A 1GS3A 4U13A 4WYKA 5I97A 2CW9A 1J2BA 3UB1A 3VGNA 4RNZA 2C10A 3KSPA 2BMOB 1W02A 5IERA 1O7MB 1TFKA 4OVMA 4NREA 3GRDA 5FW5A 2CIUA 4L8PA 4HM2B 3GZBA 4N6LA 3K7CA 3NXJA 4L7KA 3FF0A 3DUKA 3S67A 3K9MC 3H51A 2OWPA 3B4OA 4H3UA 4IT7A 3N8BA 1ULJB 3G713 3ROBA 5AIGA 2OOVA 2XGNA 5G2GA 1YJ93 2CFDA 3HI7A 5CF2A 1IK3A 1RKYA 2PNCA 1W7CA 4XBYA 3G0KA 3OV4A 3STDA 1SIHA 1W6YA 3NV0A 3Q1CA 3HK4A 2SBLA 3MHEA 3DY5A 3S29A 3X40A 3GWRA 5JPUA 4HYZA 5D82A 1IQYA 4WYKB 1W6CA 2JQ5A 2W56B 4CCVA 3SEDA 3CCL3 3M8CA 1Z1SA 3EHCA 1KSIA 4R9LA 5IG5A 1U8CB 3CPOA 2HMLB 2FNQA 1US1A 1LVNA 3MSOA 1TP6A 3GZRA 3OX9A 1K41A 3RGRA 1JKGB 1A90A 2QEX3 1QMAA 2WGOA 2INXA 4RZMA 3MG1A 5AEUB 1JN5A 3B7CA 1M1K4 2QA43 1VQ53 3DGLA 1N8QA 5CK6A 3FCSB 4G1MB 2GEXA 3X3YA 2OQEC 1QVF2 4J9AA 1N5PA 2M7OA 1TUHA 1VQ93 3JUMA 2CFKA 1ZO2A 3H3HA 2P0XA 1Q40B 2L4VA 1JB5A 3NX0A 2P05A 1QAKA 1Q824 4CDLA 2W56A 2QGUA 3NBBA 4HKVB 3EB8A 4FMCA 3CC23 1FGOA 3AMOA 2UX0A 4HM6B 3K63A 4GB5A 3EBTA 5CXOA 1OF5A 3PYJA 3TDGA 3WODG 1NDOB 2YFLB 3BNDA 3OXAA 2RGQA 2E2TA 5IF6A 2BNGA 3GAXA 2Z7AA 4FCMA 2P0MA 5JPPA 1N9EA 2FGTA 1M1XB 2CG0A 3DGMA 4Q53A 4HM5B 3JUNA 1W2B2 5HGRA 1OHOA 1IVUA 3S5CA 1M904 3SLUA 1IV7A 4HVNA 3MYTA 2IUJA 1STFI 3FF2A 5AEWB 4R4KA 1DMNA 2F98A 1JJ22 2GXFA 1S5AA 2WGQA 3HX8A 1A2VA 2KXGA 3I553 1NB5I 3PZWA 3GZYB 3WOFB 3EQQB 5KP1A 1IU7A 1W01A 2CK3H 3EE1A 1ISKA 5D83A 3FKAA 4FMDA 3I0YA 4HM1B 3V92A 3DZLA 4MEIA 2LYXA 3D9RA 4FMAA 3BNBA 4RNYA 3LYGA 1YJW3 2CHCA 2HMJB 1IV9A 2W9PA 2ZDJA 1AV4A 3G6E3 1JV2B 1DVCA 3CCM3 1OACA 3RDEA 4FR9A 1QVG2 4N6UA 4LMIA 4KFDA 1JN5B 1WNHA 3VF1A 4KFFA 3EX9A 4N6OB 1HKXA 1AVLA 4WHAA 3LZAA 1DVDA 3CCS3 3PXMA 2XRXB 1NO3A 1CEWI 1YJN3 4N6TA 1RRHA 3WA2X 2BMRB 4N6V0 2OOVC 1UI8A 2OTJ3 4EBGA 3G16A 1Q40A 1KD14 1VQM3 3DGOA 2HMMB 5JBSA 1JNQA 1K28A 3F8XA 4R1KA 4LGQA 1UI7A 3A76A 3X42A 2CFLA 3PCSA 1VQ73 1FUWA 3B4PA 3GZXB 1R4CA 4O02B 2XFSA 4K1VA 3OWSA 2GBXB 1UW1A 3UL5A 3X41A 3ER7A 3KSED 4NHFA 4R80A 1E97A 4AKYA 4N3VA 4JRFA 2O9UX 4OUQA 2W03A 4XM4A 3JUOA 4MMYB 2YFIB 1FGMA 5IG0A 1NJI4 4OK0A 1D6ZA 3ALAA 4KFEA 3WMDA 2P09A 5KP3A 1IVWA 5IENA 4R9KA 2GEYA 2OQEA 1QJGA 2KCDA 3SOAA 3LH4A 3CD63 3VSYA 3CMA3 1Q864 1O7WB 3KIIA 3HIIA 4TX4A 1OCVA 3CNXA 4KZ1A 5BXQA 1GYBA 1DMQA 1KWIA 2Y73A 3LXUX 3WDGB 3S27A 3ECFA 3MWZA 4MJDA 1W6GA 3CCJ3 3HIGA 2OCTA 1AVKA 4BTWA 5BVBA 1RRLA 1N5HA 1WMPA 2W0QA 1OHPA 3DXOA 4IIAA 1YIT3 1NU3A 1YHQ3 5ELJA 1FGQA 4ZM8A 1FA3A 3MG3A 5KP4A 3JUPA 2R4IA 1W5ZA 3BNEA 4XBXA 1N9JA 4BTXA 1YGEA 4HM8B 4BTYA 3L0RA 3CCV3 2V1LA 4HM4B 3B8LA 2F86B 1VQK3 1YI23 1C7HA 3FZWA 2F99A 2FXTA 4J8TA 4O3VA 4N6NB 1EQKA 4EV5A 2OTL3 1VQ63 1F8NA 1M9GA 3IPTA 2Z77A 5TGNA 3G4S3 3T8UA 3X3ZA 1ASKA 8CHOA 2CWTA 5IG4A 4LEHA 3DMCA 2XGLA 1PU4A 1Q814 5A0OB 3NBJA 2CFGA 1WTHA 4RBNA 4WP5A 1JKGA 4K61A 2BT3A 3K0ZA 5AYRB 2GBWB 2Y74A 1YVBI 3NQYA 3CCR3 2D1WA 1OGXA 2B24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT7 A;  3PYJ A;  1KWI A;  3L0R A;  3QRD A;  1LXE A;  3PXM A;  3UL5 A;  1MOL A;  3KSE D;  1GD3 A;  3PS8 A;  5LC6 A;  3UL6 A;  2O9U X;  1CYU A;  1CEW I;  2CH9 A;  3MWZ A;  4N6T A;  1RN7 A;  5ELU A;  3GAX A;  4N6N B;  1EQK A;  1G96 A;  4N6M A;  1M9G A;  4N6V 0;  2OCT A;  1N5P A;  1A67 A;  1A90 A;  1N5H A;  4CCV A;  1PFP A;  3SVA A;  1GD4 A;  5A0O B;  2BO9 B;  1IV9 A;  1IV7 A;  2W9P A;  3IMA B;  5ELJ A;  1TIJ A;  1CYV A;  1STF I;  1DVC A;  5EQL A;  4ZM8 A;  1FA3 A;  1DVD A;  4N6U A;  1ROA A;  3NX0 A;  5LC7 A;  1FUW A;  3LH4 A;  4EYC A;  4N6L A;  2KXG A;  2W9Q A;  1YVB I;  1WNH A;  1NB5 I;  4N6O B;  3KFQ C;  3Q2P A;  1R4C A;  4LZI A;  4TX4 A;  1MNL A;  3S67 A;  3K9M C;  1N9J A;  1NB3 I; 
#chains in the Genus database with same CATH topology
 5D81 A;  2H0H A;  1WMO A;  3RNT A;  3PS8 A;  1GD3 A;  1NNV A;  1FGR A;  2Q07 A;  3F9S A;  4K90 B;  4I4K A;  5G1L A;  1FZU A;  2I9W A;  8RNT A;  3EJV A;  3KKG A;  4LYL B;  2IMJ A;  1LQM B;  1E3V A;  1JBT A;  3EN1 B;  4STD A;  6STD A;  3I56 3;  5M1A A;  3EN8 A;  2BO9 B;  1Q9E A;  1RHL A;  3DM8 A;  3JVC A;  2W04 A;  1OHS A;  1JB4 A;  1T5Y A;  1ROA A;  3FSD A;  1O7H B;  3X3X A;  3LTB A;  4H61 A;  3J7Y d;  4EXR A;  5CF1 A;  1B3S A;  1I8V A;  2IY2 A;  1O7N B;  1OPY A;  2CG1 A;  2GU1 A;  1B2M A;  4KVH A;  2GSP A;  4K1U A;  3QRD A;  1JBS A;  1FYS A;  3U97 A;  3NM7 A;  1FGT A;  3OWY A;  1IQX A;  3OW2 2;  1RGC A;  2Z76 A;  4O8S A;  1G96 A;  4WWU C;  1DET A;  1D6Y A;  1N8R 4;  1DE3 A;  2XSO B;  1GY5 A;  1RJO A;  2XR8 B;  3MPH A;  2K0M A;  1KQS 2;  3UNL A;  3N9H A;  4FCJ A;  2WOH A;  5AIH A;  3FGY A;  3A5E A;  1S72 3;  1GMQ A;  1DMM A;  3KN4 A;  4EC6 A;  3SOY A;  1LQG C;  2W9Q A;  1RNB A;  1B20 A;  4AEQ A;  3T0U A;  1BUQ A;  2RBI A;  3CNM A;  3CCU 3;  1MNL A;  3EBY A;  3LT8 A;  1GMP A;  1RLS A;  3LT9 A;  4WFO A;  3F7X A;  4O2H A;  1JZO A;  1LXE A;  5EEO A;  3CCE 3;  1V74 A;  1RGA A;  4AKZ A;  5IG3 A;  3FG3 A;  2KRT A;  1IVX A;  1D6U A;  2STD A;  4FCZ A;  3CCQ 3;  3OWU A;  1L5G B;  2XEP A;  5IEP A;  2E2U A;  1V57 A;  3NM2 A;  5AYS C;  4MMZ B;  5IEO A;  3ZG5 A;  1IT7 A;  3CPW 2;  1HU9 A;  1RTU A;  1IQ8 A;  1T2H A;  1ZGX A;  3IJE B;  3KZT A;  4L8O A;  1EQK A;  1RMS A;  2KF6 A;  2KF4 A;  2BHM A;  2C11 A;  2RCD A;  3E99 A;  2F5W A;  4XDW A;  4DKI A;  1IYY A;  2CWV A;  1KC8 4;  2AAD A;  1CQS A;  2YFJ B;  3FLJ A;  3FG1 A;  4XDV A;  1LNI A;  4HM3 B;  1RGG A;  1U5O A;  1PY3 A;  1LRA A;  1A2K A;  2E2V A;  2WO0 A;  2Z6B A;  3CU3 A;  4FMB A;  5AII A;  5AI1 A;  1VQQ A;  4X2O A;  5ELU A;  3D79 A;  4EV2 A;  1R4Y A;  1V58 A;  4HJL B;  4N6M A;  3CME 3;  1DYU A;  1TU5 A;  1JRQ A;  2K54 A;  1K73 4;  1VQ4 3;  3BNC A;  5EVH A;  1STD A;  3U1W A;  1K8A 4;  1LOV A;  1PFP A;  1W2Z A;  1VQN 3;  1Q42 A;  1BUJ A;  1K9M 4;  3IMA B;  2XFT A;  2W2C A;  3MKI A;  2ML5 A;  3FH1 A;  3SX1 A;  2IUK A;  5DRV A;  2IA7 A;  3MG2 A;  1VQO 3;  3KFQ C;  3Q2P A;  1IVV A;  1NB3 I;  3LOY A;  5FGO A;  1BNS A;  1BNF A;  2BMQ B;  3SXX A;  3V98 A;  3D3L A;  3NBR A;  2LQV A;  5AIF A;  2MC8 A;  3AHW A;  2RSX A;  1LOX A;  2W6J H;  2O3O A;  3AHS A;  3BU4 A;  1WMN A;  1RN1 A;  7STD A;  3LTC A;  3HZP A;  1B21 A;  2CFW A;  1UGH I;  2AAE A;  1OGZ A;  3DGY A;  1GD4 A;  3EF8 A;  2JDI H;  4J5G A;  1GOV A;  1RCK A;  1CYV A;  1TIJ A;  5EQL A;  3WOE B;  2ZL8 A;  3AMO B;  3F40 A;  2P38 A;  2XH9 A;  1O7P B;  1OF5 B;  4LZI A;  1WQL B;  4J5K A;  3SYU A;  3BB9 A;  1W00 A;  3LML A;  1O7G B;  3QK9 A;  2B1X B;  1AR0 A;  1EKM A;  3JUQ A;  3CXC 2;  3T8N A;  3F8H A;  1TRQ A;  3FG4 A;  4HM7 B;  1BNR A;  5LC6 A;  4HBR A;  1IDP A;  1TFO A;  3NHX A;  1UUV B;  2HMN B;  3F7S A;  1VQL 3;  3CC7 3;  1SJW A;  1IT8 A;  1VZZ A;  1VQP 3;  3NQZ A;  2GU3 A;  3WR2 A;  1ULI B;  1MWT A;  1E3R A;  2UUG C;  2XF3 A;  3S28 A;  1Y4K A;  4PEJ A;  4I5Q A;  3RGA A;  3D5G A;  1BRH A;  3SVA A;  2CKF B;  3NV0 B;  1SQW A;  2ML6 A;  2A15 A;  1MWR A;  1X1Y A;  4EYC A;  3D5I A;  2RFR A;  3F14 A;  1PYL A;  1UCI A;  3G8Z A;  1SPU A;  3Q90 A;  1UCK A;  1NWW A;  1I3I A;  2HMK B;  2YX9 A;  3O8Y A;  3PCR A;  1GOU A;  5M18 A;  4GL6 A;  4XB5 A;  3EC9 A;  1LOY A;  2HMO B;  5IW9 A;  5M19 A;  1CYU A;  1BOX A;  2CH9 A;  1ZX2 A;  3K5T A;  1RN7 A;  2PZV A;  2D42 A;  1BVI A;  1OH0 A;  1FW7 A;  1EA2 A;  1QAF A;  3AGO A;  3PGB A;  3WA3 A;  2H0G A;  5STD A;  1A67 A;  3N54 B;  1UUG B;  1I2E A;  4HM0 B;  2QIY A;  1ROV A;  1YNV X;  4HZB B;  5BU4 A;  2CC3 A;  1Q7Y 4;  4LSO A;  3CC4 3;  1QAL A;  1MGW A;  2KF3 A;  1BAN A;  1OUN A;  3BLZ A;  3LTD A;  5LC7 A;  2MF7 A;  1SAR A;  3GSP A;  4QWT A;  4ORL A;  5CLK A;  3NUV A;  4MMX B;  1BNJ A;  1JZD A;  3UJM A;  1LNH A;  3LTA A;  4JF8 A;  4IPB A;  2XSH B;  1SII A;  1UCJ A;  1W4N A;  2F56 A;  1EUI C;  2CWU A;  1MOL A;  3KE7 A;  3DGN A;  4HZ9 B;  1UUW B;  4XBT A;  1YIJ 3;  5DRE A;  1VQ8 3;  2WOF A;  1GY7 A;  3UL6 A;  1JB2 A;  1EG9 B;  3V99 A;  1GY6 A;  1GS3 A;  1TRP A;  4U13 A;  4WYK A;  5I97 A;  2CW9 A;  1J2B A;  3UB1 A;  3VGN A;  4RNZ A;  2C10 A;  3KSP A;  1I2F A;  1W02 A;  2BMO B;  5IER A;  1O7M B;  1TFK A;  2KF5 A;  1TTO A;  4OVM A;  9RNT A;  3DH2 A;  4NRE A;  4CPK A;  3GRD A;  5FW5 A;  2CIU A;  4L8P A;  4HM2 B;  3GZB A;  1I0V A;  3K7C A;  1G0T A;  3NXJ A;  4N6L A;  2C4B A;  4L7K A;  3FF0 A;  1BSE A;  1FUS A;  2F4Y A;  3DUK A;  3S67 A;  3K9M C;  3H51 A;  2OWP A;  3B4O A;  4H3U A;  4IT7 A;  1GSP A;  3N8B A;  1ULJ B;  3G71 3;  3ROB A;  5AIG A;  2OOV A;  2XGN A;  5G2G A;  1YJ9 3;  2CFD A;  3HI7 A;  5CF2 A;  1IK3 A;  1RKY A;  1X1X A;  2PNC A;  1W7C A;  4XBY A;  2BIR A;  1BRN L;  3G0K A;  3OV4 A;  1AQZ A;  3STD A;  1SIH A;  1W6Y A;  3NV0 A;  3Q1C A;  3HK4 A;  5G1K A;  2SBL A;  3MHE A;  3DY5 A;  3S29 A;  3X40 A;  7RNT A;  3GWR A;  5JPU A;  4HYZ A;  5D82 A;  1IQY A;  4WYK B;  1W6C A;  2JQ5 A;  2W56 B;  4CCV A;  3SED A;  3CCL 3;  1C54 A;  3M8C A;  2L1S A;  1Z1S A;  3EHC A;  1KSI A;  4R9L A;  5IG5 A;  1U8C B;  3CPO A;  2HML B;  1BSA A;  1US1 A;  1LVN A;  2FNQ A;  3MSO A;  3Q3F A;  1TP6 A;  3GZR A;  3OX9 A;  5HOH A;  1K41 A;  1BSD A;  3RGR A;  6GSP A;  1JKG B;  1A90 A;  2QEX 3;  1QMA A;  2WGO A;  1AY7 A;  2INX A;  4RZM A;  3MG1 A;  5AEU B;  1JN5 A;  3B7C A;  1M1K 4;  1RDS A;  2QA4 3;  1VQ5 3;  1GOY A;  1G02 A;  3DGL A;  1N8Q A;  1RGF A;  5CK6 A;  3FCS B;  4G1M B;  1MWU A;  1MWS A;  2GEX A;  2OQE C;  3X3Y A;  1QVF 2;  1A2P A;  4J9A A;  1N5P A;  2M7O A;  2CX0 A;  1TUH A;  4BL3 A;  4HAA A;  4ILF A;  1VQ9 3;  3JUM A;  1BIR A;  2CFK A;  6RNT A;  1ZO2 A;  3H3H A;  2P0X A;  1Q40 B;  2HOH A;  1UGI A;  1JB5 A;  2L4V A;  3NX0 A;  2P05 A;  1QAK A;  3ZFZ A;  1T3B A;  1Q82 4;  4CDL A;  2W56 A;  2QGU A;  3NBB A;  1EEJ A;  4HKV B;  2RNT A;  3EB8 A;  5BIR A;  3D4A A;  4FMC A;  3CC2 3;  1FGO A;  2R41 A;  3AMO A;  1UDI I;  2UX0 A;  3K63 A;  4GB5 A;  2CX1 A;  2F5M A;  3EBT A;  4HM6 B;  5CXO A;  1OF5 A;  3PYJ A;  3TDG A;  3WOD G;  1NDO B;  2YFL B;  3BIR A;  3BND A;  3OXA A;  1RNT A;  2RGQ A;  2E2T A;  1RN4 A;  5IF6 A;  2BNG A;  3GAX A;  2Z7A A;  4FCM A;  2P0M A;  5JPP A;  1N9E A;  4NPB A;  2FGT A;  1M1X B;  2CG0 A;  3DGM A;  3HOH A;  4Q53 A;  4HM5 B;  3JUN A;  1W2B 2;  5HGR A;  1OHO A;  1IVU A;  1B2S A;  3S5C A;  1M90 4;  3SLU A;  1IV7 A;  4HVN A;  1RCL A;  3MYT A;  2IUJ A;  1STF I;  3FF2 A;  5AEW B;  4R4K A;  1DMN A;  1BU4 A;  2F98 A;  1JJ2 2;  1TJD A;  2GXF A;  1S5A A;  1BNG A;  2WGQ A;  3HX8 A;  1A2V A;  2KXG A;  3I55 3;  1NB5 I;  3PZW A;  3GZY B;  3WOF B;  3EQQ B;  1BAO A;  5KP1 A;  2H0I A;  1IU7 A;  4HOH A;  1W01 A;  2CK3 H;  3EE1 A;  1ISK A;  5D83 A;  3FKA A;  4FMD A;  3I0Y A;  1BGS A;  4HM1 B;  3V92 A;  3DZL A;  1MGR A;  4MEI A;  2LYX A;  3D9R A;  4FMA A;  1FUT A;  3BNB A;  4RNY A;  1ZS7 A;  3LYG A;  1YJW 3;  2CHC A;  2HMJ B;  1IV9 A;  2W9P A;  2ZDJ A;  1BSB A;  1AV4 A;  1BRI A;  1I2G A;  4KT3 B;  3G6E 3;  1JV2 B;  1DVC A;  3CCM 3;  1OAC A;  3RDE A;  4FR9 A;  1QVG 2;  3KCH A;  4N6U A;  4CJN A;  4LMI A;  4KFD A;  1HZ1 A;  1JN5 B;  1WNH A;  3VF1 A;  4KFF A;  3EX9 A;  4N6O B;  3ZG0 A;  1CH0 A;  1HKX A;  1AVL A;  4GHO A;  4WHA A;  3LZA A;  1DVD A;  3CCS 3;  3PXM A;  1B2Z A;  2XRX B;  4RNT A;  1B2X A;  1RGH A;  1NO3 A;  1CEW I;  1YJN 3;  1I0X A;  1RRH A;  4N6T A;  3WA2 X;  1RGE A;  3WHO A;  2BMR B;  2ZHX B;  2SAR A;  4N6V 0;  2OOV C;  1UI8 A;  2OTJ 3;  4EBG A;  3G16 A;  1Q40 A;  3AGN A;  1KD1 4;  1VQM 3;  3DGO A;  2HMM B;  5JBS A;  1JNQ A;  1K28 A;  3F8X A;  1T2I A;  4R1K A;  4BL2 A;  4LGQ A;  1RGL A;  1UI7 A;  3A76 A;  3X42 A;  2CFL A;  3PCS A;  1VQ7 3;  1FUW A;  3B4P A;  4GSP A;  3GZX B;  1R4C A;  4O02 B;  2XFS A;  4K1V A;  1BRJ A;  3OWS A;  2GBX B;  1UW1 A;  3UL5 A;  4BIR A;  3X41 A;  3ER7 A;  3KSE D;  4NHF A;  4R80 A;  1E97 A;  4AKY A;  4N3V A;  4JRF A;  1BRS A;  2O9U X;  1B27 A;  4OUQ A;  2W03 A;  1RSN A;  4XM4 A;  3JUO A;  4MMY B;  2YFI B;  1FGM A;  5IG0 A;  1NJI 4;  2KAA A;  4OK0 A;  1D6Z A;  1HYF A;  3ALA A;  1X1W A;  4KFE A;  2P09 A;  3WMD A;  5KP3 A;  1IVW A;  5IEN A;  1I70 A;  2GEY A;  4R9K A;  2OQE A;  2ZA4 A;  1QJG A;  2KCD A;  3SOA A;  3LH4 A;  3CD6 3;  4BU4 A;  3VSY A;  3CMA 3;  1Q86 4;  1O7W B;  3KII A;  3HII A;  4TX4 A;  2BU4 A;  1OCV A;  3CNX A;  4KZ1 A;  5BXQ A;  1GYB A;  1DMQ A;  1KWI A;  1LOW A;  2Y73 A;  1I3F A;  3LXU X;  3WDG B;  3S27 A;  1JBR A;  3ECF A;  3MWZ A;  4MJD A;  1W6G A;  3CCJ 3;  3HIG A;  2OCT A;  4X2H A;  1AVK A;  4BTW A;  1Q7H A;  5BVB A;  1RRL A;  1N5H A;  1WMP A;  2W0Q A;  1OHP A;  3DXO A;  4IIA A;  1X1U A;  1YIT 3;  1NU3 A;  1YHQ 3;  1BRG A;  5ELJ A;  1FGQ A;  5GSP A;  4ZM8 A;  1FA3 A;  2K3D A;  3MG3 A;  5KP4 A;  1BNI A;  3JUP A;  2J8X B;  2R4I A;  1W5Z A;  3BNE A;  4XBX A;  1B2U A;  1N9J A;  4BTX A;  1YGE A;  4HM8 B;  4BTY A;  3L0R A;  1BSC A;  1YGW A;  3CCV 3;  2V1L A;  4HM4 B;  1RGK A;  3B8L A;  2F86 B;  1VQK 3;  1YVS A;  1YI2 3;  1C7H A;  1BNE A;  2F99 A;  2FXT A;  3FZW A;  4J8T A;  4O3V A;  4N6N B;  5RNT A;  4EV5 A;  2OTL 3;  1VQ6 3;  1F8N A;  1M9G A;  2IYJ A;  2Z77 A;  3IPT A;  5TGN A;  3T8U A;  3G4S 3;  1UCL A;  1ASK A;  3X3Z A;  8CHO A;  2CWT A;  5IG4 A;  4LEH A;  3DMC A;  2XGL A;  1PU4 A;  1Q81 4;  5A0O B;  3NBJ A;  2CFG A;  1WTH A;  4RBN A;  4WP5 A;  1JKG A;  4K61 A;  2BT3 A;  3K0Z A;  5AYR B;  2GBW B;  1BRK A;  2Y74 A;  1YVB I;  1GMR A;  3NQY A;  3URP A;  2UGI A;  3CCR 3;  7GSP A;  4EW5 A;  2D1W A;  1OGX A;  2B24 B; 
#chains in the Genus database with same CATH homology
 5D81 A;  1WMO A;  3PS8 A;  1GD3 A;  2Q07 A;  1FGR A;  3F9S A;  4K90 B;  4I4K A;  2I9W A;  3EJV A;  3KKG A;  2IMJ A;  1E3V A;  3EN1 B;  4STD A;  6STD A;  3I56 3;  3EN8 A;  2BO9 B;  3DM8 A;  3JVC A;  2W04 A;  1OHS A;  1JB4 A;  1T5Y A;  1ROA A;  3FSD A;  1O7H B;  3X3X A;  3LTB A;  4H61 A;  3J7Y d;  4EXR A;  5CF1 A;  1O7N B;  1OPY A;  2CG1 A;  2GU1 A;  4KVH A;  4K1U A;  3QRD A;  3U97 A;  3NM7 A;  1FGT A;  3OWY A;  1IQX A;  3OW2 2;  2Z76 A;  4O8S A;  1G96 A;  4WWU C;  1D6Y A;  1N8R 4;  2XSO B;  1GY5 A;  1RJO A;  2XR8 B;  3MPH A;  2K0M A;  1KQS 2;  3UNL A;  3N9H A;  4FCJ A;  2WOH A;  5AIH A;  3FGY A;  1S72 3;  1DMM A;  3KN4 A;  4EC6 A;  3SOY A;  2W9Q A;  1BUQ A;  4AEQ A;  3T0U A;  3CNM A;  3CCU 3;  1MNL A;  3EBY A;  3LT8 A;  3LT9 A;  4WFO A;  3F7X A;  4O2H A;  5EEO A;  1LXE A;  3CCE 3;  1V74 A;  4AKZ A;  5IG3 A;  3FG3 A;  2KRT A;  1IVX A;  1D6U A;  2STD A;  4FCZ A;  3CCQ 3;  3OWU A;  1L5G B;  2XEP A;  5IEP A;  2E2U A;  3NM2 A;  5AYS C;  4MMZ B;  5IEO A;  1IT7 A;  3CPW 2;  1HU9 A;  1IQ8 A;  3IJE B;  3KZT A;  4L8O A;  2BHM A;  2C11 A;  2RCD A;  3E99 A;  4XDW A;  2CWV A;  1KC8 4;  2YFJ B;  1CQS A;  3FLJ A;  3FG1 A;  4XDV A;  4HM3 B;  1U5O A;  4FMB A;  2WO0 A;  1A2K A;  2E2V A;  2Z6B A;  3CU3 A;  5AII A;  5AI1 A;  4X2O A;  5ELU A;  4EV2 A;  4HJL B;  4N6M A;  3CME 3;  1VQ4 3;  1DYU A;  1TU5 A;  1JRQ A;  2K54 A;  1K73 4;  3BNC A;  5EVH A;  1STD A;  3U1W A;  1K8A 4;  1PFP A;  1W2Z A;  1VQN 3;  1Q42 A;  1K9M 4;  3IMA B;  2XFT A;  2W2C A;  3MKI A;  2ML5 A;  3FH1 A;  3SX1 A;  2IUK A;  5DRV A;  2IA7 A;  3MG2 A;  1VQO 3;  3KFQ C;  3Q2P A;  1IVV A;  1NB3 I;  3LOY A;  5FGO A;  2BMQ B;  3SXX A;  3V98 A;  3D3L A;  3NBR A;  2LQV A;  5AIF A;  2MC8 A;  2RSX A;  1LOX A;  2W6J H;  2O3O A;  1WMN A;  7STD A;  3LTC A;  3HZP A;  2CFW A;  1OGZ A;  1GD4 A;  3EF8 A;  2JDI H;  1TIJ A;  1CYV A;  5EQL A;  3WOE B;  2ZL8 A;  3AMO B;  3F40 A;  2P38 A;  2XH9 A;  1O7P B;  1OF5 B;  4LZI A;  1WQL B;  3BB9 A;  1W00 A;  3LML A;  1O7G B;  3QK9 A;  2B1X B;  1AR0 A;  1EKM A;  3JUQ A;  3CXC 2;  3T8N A;  3F8H A;  3FG4 A;  4HM7 B;  5LC6 A;  4HBR A;  1IDP A;  1TFO A;  3NHX A;  1UUV B;  2HMN B;  3F7S A;  1VQL 3;  3CC7 3;  1SJW A;  1IT8 A;  1VZZ A;  1VQP 3;  3NQZ A;  2GU3 A;  1ULI B;  1E3R A;  2XF3 A;  3S28 A;  1Y4K A;  4PEJ A;  3RGA A;  3SVA A;  2CKF B;  3NV0 B;  1SQW A;  2ML6 A;  2A15 A;  4EYC A;  2RFR A;  3F14 A;  3G8Z A;  1SPU A;  3Q90 A;  1NWW A;  2HMK B;  3O8Y A;  2YX9 A;  3PCR A;  4GL6 A;  4XB5 A;  3EC9 A;  2HMO B;  5IW9 A;  1CYU A;  2CH9 A;  1ZX2 A;  3K5T A;  1RN7 A;  2PZV A;  2D42 A;  1OH0 A;  1EA2 A;  1QAF A;  3PGB A;  3WA3 A;  5STD A;  1A67 A;  3N54 B;  4HM0 B;  2QIY A;  1ROV A;  4HZB B;  2CC3 A;  1Q7Y 4;  4LSO A;  3CC4 3;  1QAL A;  3BLZ A;  1OUN A;  3LTD A;  5LC7 A;  2MF7 A;  4QWT A;  4ORL A;  5CLK A;  3NUV A;  4MMX B;  3UJM A;  1LNH A;  3LTA A;  4JF8 A;  4IPB A;  2XSH B;  1SII A;  4X2H A;  1W4N A;  2CWU A;  3KE7 A;  4HZ9 B;  1MOL A;  3DGN A;  4XBT A;  1UUW B;  1VQ8 3;  1YIJ 3;  5DRE A;  2WOF A;  1GY7 A;  3UL6 A;  1JB2 A;  1EG9 B;  3V99 A;  1GY6 A;  1GS3 A;  4U13 A;  4WYK A;  5I97 A;  2CW9 A;  1J2B A;  3UB1 A;  3VGN A;  4RNZ A;  2C10 A;  3KSP A;  2BMO B;  1W02 A;  5IER A;  1O7M B;  1TFK A;  4OVM A;  4NRE A;  3GRD A;  5FW5 A;  2CIU A;  4L8P A;  4HM2 B;  3GZB A;  4N6L A;  3K7C A;  3NXJ A;  4L7K A;  3FF0 A;  3DUK A;  3S67 A;  3K9M C;  3H51 A;  2OWP A;  3B4O A;  4H3U A;  4IT7 A;  3N8B A;  1ULJ B;  3G71 3;  3ROB A;  5AIG A;  2OOV A;  2XGN A;  5G2G A;  1YJ9 3;  2CFD A;  3HI7 A;  5CF2 A;  1IK3 A;  1RKY A;  2PNC A;  1W7C A;  4XBY A;  3G0K A;  3OV4 A;  3STD A;  1SIH A;  1W6Y A;  3NV0 A;  3Q1C A;  3HK4 A;  2SBL A;  3MHE A;  3DY5 A;  3S29 A;  3X40 A;  3GWR A;  5JPU A;  4HYZ A;  5D82 A;  1IQY A;  4WYK B;  1W6C A;  2JQ5 A;  2W56 B;  4CCV A;  3SED A;  3CCL 3;  3M8C A;  1Z1S A;  3EHC A;  1KSI A;  4R9L A;  5IG5 A;  1U8C B;  3CPO A;  2HML B;  2FNQ A;  1US1 A;  1LVN A;  3MSO A;  1TP6 A;  3GZR A;  3OX9 A;  1K41 A;  3RGR A;  1JKG B;  1A90 A;  2QEX 3;  1QMA A;  2WGO A;  2INX A;  4RZM A;  3MG1 A;  5AEU B;  1JN5 A;  3B7C A;  1M1K 4;  2QA4 3;  1VQ5 3;  3DGL A;  1N8Q A;  5CK6 A;  3FCS B;  4G1M B;  2GEX A;  3X3Y A;  2OQE C;  1QVF 2;  4J9A A;  1N5P A;  2M7O A;  1TUH A;  1VQ9 3;  3JUM A;  2CFK A;  1ZO2 A;  3H3H A;  2P0X A;  1Q40 B;  2L4V A;  1JB5 A;  3NX0 A;  2P05 A;  1QAK A;  1Q82 4;  4CDL A;  2W56 A;  2QGU A;  3NBB A;  4HKV B;  3EB8 A;  4FMC A;  3CC2 3;  1FGO A;  3AMO A;  2UX0 A;  4HM6 B;  3K63 A;  4GB5 A;  3EBT A;  5CXO A;  1OF5 A;  3PYJ A;  3TDG A;  3WOD G;  1NDO B;  2YFL B;  3BND A;  3OXA A;  2RGQ A;  2E2T A;  5IF6 A;  2BNG A;  3GAX A;  2Z7A A;  4FCM A;  2P0M A;  5JPP A;  1N9E A;  2FGT A;  1M1X B;  2CG0 A;  3DGM A;  4Q53 A;  4HM5 B;  3JUN A;  1W2B 2;  5HGR A;  1OHO A;  1IVU A;  3S5C A;  1M90 4;  3SLU A;  1IV7 A;  4HVN A;  3MYT A;  2IUJ A;  1STF I;  3FF2 A;  5AEW B;  4R4K A;  1DMN A;  2F98 A;  1JJ2 2;  2GXF A;  1S5A A;  2WGQ A;  3HX8 A;  1A2V A;  2KXG A;  3I55 3;  1NB5 I;  3PZW A;  3GZY B;  3WOF B;  3EQQ B;  5KP1 A;  1IU7 A;  1W01 A;  2CK3 H;  3EE1 A;  1ISK A;  5D83 A;  3FKA A;  4FMD A;  3I0Y A;  4HM1 B;  3V92 A;  3DZL A;  4MEI A;  2LYX A;  3D9R A;  4FMA A;  3BNB A;  4RNY A;  3LYG A;  1YJW 3;  2CHC A;  2HMJ B;  1IV9 A;  2W9P A;  2ZDJ A;  1AV4 A;  3G6E 3;  1JV2 B;  1DVC A;  3CCM 3;  1OAC A;  3RDE A;  4FR9 A;  1QVG 2;  4N6U A;  4LMI A;  4KFD A;  1JN5 B;  1WNH A;  3VF1 A;  4KFF A;  3EX9 A;  4N6O B;  1HKX A;  1AVL A;  4WHA A;  3LZA A;  1DVD A;  3CCS 3;  3PXM A;  2XRX B;  1NO3 A;  1CEW I;  1YJN 3;  4N6T A;  1RRH A;  3WA2 X;  2BMR B;  4N6V 0;  2OOV C;  1UI8 A;  2OTJ 3;  4EBG A;  3G16 A;  1Q40 A;  1KD1 4;  1VQM 3;  3DGO A;  2HMM B;  5JBS A;  1JNQ A;  1K28 A;  3F8X A;  4R1K A;  4LGQ A;  1UI7 A;  3A76 A;  3X42 A;  2CFL A;  3PCS A;  1VQ7 3;  1FUW A;  3B4P A;  3GZX B;  1R4C A;  4O02 B;  2XFS A;  4K1V A;  3OWS A;  2GBX B;  1UW1 A;  3UL5 A;  3X41 A;  3ER7 A;  3KSE D;  4NHF A;  4R80 A;  1E97 A;  4AKY A;  4N3V A;  4JRF A;  2O9U X;  4OUQ A;  2W03 A;  4XM4 A;  3JUO A;  4MMY B;  2YFI B;  1FGM A;  5IG0 A;  1NJI 4;  4OK0 A;  1D6Z A;  3ALA A;  4KFE A;  3WMD A;  2P09 A;  5KP3 A;  1IVW A;  5IEN A;  4R9K A;  2GEY A;  2OQE A;  1QJG A;  2KCD A;  3SOA A;  3LH4 A;  3CD6 3;  3VSY A;  3CMA 3;  1Q86 4;  1O7W B;  3KII A;  3HII A;  4TX4 A;  1OCV A;  3CNX A;  4KZ1 A;  5BXQ A;  1GYB A;  1DMQ A;  1KWI A;  2Y73 A;  3LXU X;  3WDG B;  3S27 A;  3ECF A;  3MWZ A;  4MJD A;  1W6G A;  3CCJ 3;  3HIG A;  2OCT A;  1AVK A;  4BTW A;  5BVB A;  1RRL A;  1N5H A;  1WMP A;  2W0Q A;  1OHP A;  3DXO A;  4IIA A;  1YIT 3;  1NU3 A;  1YHQ 3;  5ELJ A;  1FGQ A;  4ZM8 A;  1FA3 A;  3MG3 A;  5KP4 A;  3JUP A;  2R4I A;  1W5Z A;  3BNE A;  4XBX A;  1N9J A;  4BTX A;  1YGE A;  4HM8 B;  4BTY A;  3L0R A;  3CCV 3;  2V1L A;  4HM4 B;  3B8L A;  2F86 B;  1VQK 3;  1YI2 3;  1C7H A;  3FZW A;  2F99 A;  2FXT A;  4J8T A;  4O3V A;  4N6N B;  1EQK A;  4EV5 A;  2OTL 3;  1VQ6 3;  1F8N A;  1M9G A;  3IPT A;  2Z77 A;  5TGN A;  3G4S 3;  3T8U A;  3X3Z A;  1ASK A;  8CHO A;  2CWT A;  5IG4 A;  4LEH A;  3DMC A;  2XGL A;  1PU4 A;  1Q81 4;  5A0O B;  3NBJ A;  2CFG A;  1WTH A;  4RBN A;  4WP5 A;  1JKG A;  4K61 A;  2BT3 A;  3K0Z A;  5AYR B;  2GBW B;  2Y74 A;  1YVB I;  3NQY A;  3CCR 3;  2D1W A;  1OGX A;  2B24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...