4XBXA

Crystal structure of the l74f/m78f/l103v/l114v/i116v/f139v/l147v mutant of leh
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
149
structure length
149
Chain Sequence
HHTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFTVFSIDAVETFHIGSSNGLVYTERVDVVRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREVEEAVDLPVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Reshaping an Enzyme Binding Pocket for Enhanced and Inverted Stereoselectivity: Use of Smallest Amino Acid Alphabets in Directed Evolution
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 44
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4xbxA00
1C7HA 1A2KA 1GYBA 4L7KA 5D81A 3NV0A 5D83A 3JUMA 2B24B 2GEYA 1JB5A 1GY7A 2RFRA 3F40A 1OGXA 3D9RA 5KP4A 1UUVB 5EVHA 4WWUC 3DUKA 3CPOA 3FF0A 3GZBA 2XR8B 5IEOA 2K54A 1OHPA 3GZRA 3KE7A 3DXOA 3CU3A 3FSDA 1K41A 3NM2A 4XDWA 3KKGA 5CLKA 4XB5A 2F99A 4WP5A 1DMNA 5IEPA 2GBWB 1ULJB 1Z1SA 3FH1A 3RGAA 3BB9A 4STDA 8CHOA 2GXFA 1DMQA 1U5OA 4R1KA 4HM3B 3JUNA 1TP6A 3DMCA 3B4OA 3EN1B 2QGUA 3SEDA 2STDA 1W00A 2XSOB 4HM2B 2BMQB 3ROBA 5DREA 3F9SA 4WYKB 4HM7B 1NU3A 3EHCA 2A15A 3IPTA 3EBTA 3DZLA 5CF1A 1JKGA 4XBXA 2F98A 1E3RA 3FGYA 4R9LA 1E97A 4R9KA 1EG9B 3F7XA 1CQSA 3FLJA 4J9AA 1ISKA 3G0KA 3NXJA 6STDA 1JN5B 3MHEA 1WQLB 4XBTA 5IF6A 5IERA 2HMJB 4RZMA 2F86B 2YFLB 1STDA 5IENA 3WMDA 1ZO2A 4HM8B 3NBRA 4ORLA 3STDA 3SOYA 2XSHB 5AIFA 3OXAA 5HGRA 1JB2A 3SOAA 1OCVA 3I0YA 1NDOB 5IG3A 2CKFB 2HMKB 3UJMA 5IG4A 1Q40B 3F7SA 3B7CA 1O7MB 4HKVB 1O7PB 1OF5B 1BUQA 4HM6B 3JUPA 3HZPA 3MKIA 4HZ9B 3Q90A 1VZZA 4HM5B 3MG2A 3DM8A 4K1VA 4LGQA 1JB4A 4N3VA 5FW5A 2GBXB 3KSPA 1O7GB 1OF5A 2PZVA 3MSOA 1OPYA 5BXQA 1OHSA 2GEXA 5IG5A 3OWUA 3A76A 4XDVA 2R4IA 3BLZA 5CK6A 3OX9A 1OUNA 4K1UA 3MG3A 3EF8A 3NUVA 1QMAA 2Z77A 3CNMA 3G16A 3K7CA 2Z76A 1E3VA 1W6YA 5AIIA 7STDA 1ULIB 5KP1A 4HZBB 3JUQA 5AEUB 3T8UA 2INXA 4KVHA 3EX9A 5AEWB 5AI1A 4HM1B 5KP3A 2W2CA 3F8HA 5CF2A 4WYKA 3LYGA 3HX8A 3OWSA 3B4PA 3M8CA 3VGNA 3T8NA 1UUWB 1O7HB 4IIAA 4HJLB 1IDPA 4H3UA 2BMOB 2IMJA 3E99A 1S5AA 3NV0B 1OHOA 1TUHA 2CHCA 4LMIA 3EC9A 1OGZA 4CDLA 3H51A 2BMRB 3KZTA 4X2OA 4HM4B 1DMMA 1JN5A 3LZAA 4FCJA 1O7NB 3GZXB 1EA2A 3G8ZA 4OUQA 5CXOA 5AIGA 5AIHA 1GY6A 4L8PA 2OWPA 3EN8A 3MG1A 4OVMA 1QJGA 2YFIB 4J8TA 4XBYA 2HMOB 3K0ZA 2XRXB 1Q40A 4Q53A 2UX0A 4MJDA 3CNXA 1SJWA 2HMMB 3F8XA 3S5CA 3UNLA 3NHXA 3RGRA 3EJVA 3ER7A 1Q42A 1HKXA 3ECFA 5TGNA 4HVNA 1NWWA 3GZYB 4L8OA 2HMLB 2HMNB 2RCDA 1W01A 1GS3A 5D82A 4FCMA 2I9WA 4GB5A 4PEJA 5G2GA 1OH0A 3F14A 3JUOA 1W02A 1JKGB 3VSYA 4I4KA 3EBYA 3HK4A 3FZWA 2YFJB 5IG0A 3MYTA 2Z7AA 4HM0B 5JPUA 4X2HA 3GWRA 2QIYA 3OWYA 3B8LA 3FKAA 3EQQB 5BVBA 4XM4A 1AR0A 1GY5A 2RGQA 1O7WB 3OV4A 3H3HA 1ASKA 5DRVA 4U13A 1ZX2A 3FF2A 3GRDA 2JQ5A 2BNGA 5JPPA 2B1XB 4LEHA 5STDA
chains in the Genus database with same CATH superfamily
1BRKA 6RNTA 1C7HA 1A2KA 1K28A 5M19A 1Q814 1UCIA 1W6GA 2HOHA 1GYBA 4L7KA 4BL3A 1Q7Y4 5D81A 1CYVA 5M18A 1T2HA 5ELUA 1BUJA 1FGMA 3NV0A 1VQO3 5D83A 2CX1A 3JUMA 3DH2A 4HOHA 2P0XA 2B24B 2GEYA 3AMOB 3DGMA 1JB5A 1IVXA 4O3VA 1GY7A 2H0GA 2RFRA 1IT8A 3F40A 1FA3A 1VQQA 1OGXA 1TU5A 1YIT3 1RN4A 1IT7A 1BU4A 1RRHA 3CC73 1EKMA 3D9RA 4K61A 3LXUX 5KP4A 3U1WA 1UUVB 2D1WA 1RGHA 2F5MA 5EVHA 3N8BA 4WWUC 1B27A 3D79A 1NNVA 3FG3A 4MEIA 1V74A 3EB8A 3DUKA 3CPOA 3FF0A 1Q824 3GZBA 2XR8B 1FGRA 5IEOA 2K54A 3ZFZA 1OHPA 3BNDA 4KFEA 3CCM3 1BAOA 3GZRA 2BIRA 2KRTA 3KE7A 3ZG5A 1TFKA 3Q2PA 2K3DA 3DXOA 3CU3A 3VF1A 1RGGA 3FSDA 1DYUA 1JBTA 1K41A 1BNRA 1IYYA 2OCTA 1D6YA 3NM2A 4XDWA 3KKGA 3WODG 3K63A 2IUJA 5CLKA 2Y73A 5I97A 1YI23 1BNIA 2KCDA 1B3SA 4IPBA 4XB5A 5G1KA 2OTL3 2F99A 2SBLA 4WP5A 4NHFA 1N5HA 1G96A 2XF3A 3KN4A 4GHOA 4N6TA 1DMNA 1JV2B 4LSOA 1LOYA 1FW7A 1BRGA 1LOWA 4J5KA 4N6LA 3CD63 5IEPA 3DGLA 2GBWB 1ULJB 1Z1SA 3FH1A 3CCQ3 3RGAA 1AQZA 3WHOA 3BB9A 4STDA 8CHOA 2GXFA 1DMQA 1U5OA 2RNTA 2H0IA 4FMBA 4N6OB 4R1KA 4NREA 4HM3B 3JUNA 1RKYA 1RGCA 1TP6A 2W56B 1MNLA 3DMCA 3B4OA 4CPKA 1W2B2 1I3IA 1BOXA 3EN1B 1TRQA 1SQWA 1N9JA 4RNZA 1BRNL 1UI8A 4FMAA 2QGUA 2UGIA 2OQEA 2XH9A 3SEDA 1UCKA 2FNQA 5LC6A 2STDA 1I3FA 1W00A 2XSOB 3HIIA 4HM2B 3UB1A 2J8XB 1WMOA 3FCSB 2BMQB 5EQLA 1MWRA 3ROBA 3GSPA 2WO0A 5DREA 1VQ43 3F9SA 4LZIA 4WYKB 3ALAA 3SXXA 1NB5I 4HM7B 3NBJA 4O8SA 1NU3A 3X3XA 3EHCA 2W0QA 2A15A 2PNCA 3IPTA 3EBTA 2XGNA 2C10A 3DZLA 5CF1A 1JKGA 3DGOA 2CC3A 3LH4A 3KSED 4MMZB 4XBXA 2F98A 1OACA 3MWZA 1E3RA 2BU4A 5FGOA 3FGYA 4RNTA 5IG4A 1M9GA 2K0MA 1IVUA 2P05A 4K90B 3BNCA 5A0OB 2CX0A 2L1SA 1EEJA 1E97A 2BT3A 2W9PA 4R9LA 4RBNA 2L4VA 4R9KA 1JBRA 1IU7A 1EG9B 1GD4A 2JDIH 2R41A 3F7XA 1CQSA 1I8VA 2ZA4A 3FLJA 4I5QA 2BHMA 1AY7A 4J9AA 3QK9A 1ISKA 3G0KA 3CCV3 1BNGA 1LQMB 1LNHA 5RNTA 3L0RA 3NXJA 1GOVA 6STDA 1BANA 3G6E3 1K9M4 1JN5B 1JRQA 1WQLB 3FG4A 3MHEA 4JRFA 3V92A 1M904 1I2EA 4XBTA 1LXEA 1MOLA 2SARA 5IF6A 4DKIA 8RNTA 1RDSA 2ML5A 3ZG0A 5IERA 3OW22 2HMJB 2XGLA 4RZMA 1BRIA 1GMPA 1X1XA 9RNTA 2YX9A 2F86B 1FGTA 4JF8A 3RDEA 2W6JH 2YFLB 3PCRA 1STDA 5IENA 1N5PA 1SPUA 3X40A 2CG0A 3WMDA 1GMQA 1NB3I 2CFLA 1VQN3 3TDGA 1ZO2A 3I563 4HYZA 1EQKA 4HM8B 1B2SA 3NBRA 4ORLA 3GAXA 1T2IA 3STDA 3Q1CA 2GU3A 3SOYA 4BIRA 2OTJ3 1WTHA 1DVDA 2XSHB 2BO9B 1T5YA 5AIFA 2Z6BA 2LQVA 3OXAA 3PS8A 5HGRA 5LC7A 3WA3A 1VQ83 1JZDA 2KF3A 1PY3A 1JB2A 3KFQC 4H61A 1MWSA 3SOAA 2QA43 1OCVA 1B2UA 2IA7A 3CCR3 3I0YA 1Q9EA 3PCSA 1NDOB 3WOFB 1I0VA 3LTDA 3NQYA 5IG3A 2CKFB 2HMKB 1BIRA 1IVVA 2CFDA 2IYJA 3NQZA 1Q40B 1TIJA 2H0HA 2Q07A 4KZ1A 1F8NA 3LT8A 1JNQA 1TFOA 3BU4A 1YGWA 1AV4A 3AMOA 3B7CA 3F7SA 1MGWA 2GSPA 3D5IA 1O7MB 1BSEA 1N8R4 5GSPA 1BGSA 1TJDA 1KC84 4HKVB 1TRPA 1US1A 1O7PB 1OF5B 1BUQA 2E2TA 3N9HA 4HM6B 1X1YA 3HZPA 3JUPA 3MKIA 4HZ9B 3Q90A 4BTWA 4BTXA 1VZZA 1UGHI 4O2HA 4HM5B 1NJI4 1ROVA 1UCLA 1DVCA 1BSAA 2CWTA 2KAAA 4EXRA 2E2UA 5AYSC 2AAEA 1VQM3 3MG2A 3DM8A 3T0UA 3CME3 4K1VA 4LGQA 1VQ73 1JB4A 2M7OA 3SYUA 2WGQA 4N3VA 1ZGXA 1I2GA 3AGNA 2O9UX 1B2XA 5FW5A 1YJN3 1RNTA 2GBXB 1Y4KA 4BL2A 1MWTA 3KSPA 1UUGB 3G4S3 3O8YA 1A2VA 1O7GB 4EC6A 1BNSA 1RTUA 1OF5A 2PZVA 1LOVA 1RLSA 3MSOA 7RNTA 1OPYA 5BU4A 5BXQA 1KSIA 3AHSA 1N8QA 2OOVA 1GOYA 3SX1A 1OHSA 4ILFA 2GEXA 1K734 5IG5A 3UJMA 3CCS3 3OWUA 3I553 1X1WA 2GU1A 3A76A 3A5EA 4XDVA 3URPA 5JBSA 3CPW2 3CCL3 2R4IA 3BLZA 1S723 1QVF2 5CK6A 1IQ8A 3DGYA 1J2BA 1FYSA 3OX9A 1B2ZA 2P09A 1WNHA 4RNYA 1OUNA 2CWUA 3CMA3 1MWUA 2XFTA 1V57A 3Q3FA 5G1LA 2W9QA 3CCU3 2KXGA 4K1UA 3MG3A 1MGRA 3EF8A 1G0TA 1W2ZA 3IJEB 3NUVA 1QAKA 1LOXA 1QMAA 2Z77A 3AHWA 3CNMA 3G16A 4CCVA 2W56A 3K7CA 4N6MA 4WHAA 2Z76A 1E3VA 2CH9A 1FUWA 3WA2X 1W6YA 5AIIA 7STDA 3X3ZA 2WOFA 3S29A 1ULIB 5HOHA 2F56A 1L5GB 3CC43 2MF7A 2W03A 2O3OA 3FG1A 4N6NB 4GL6A 4HZBB 4N6V0 5KP1A 1IVWA 3NBBA 3BNBA 1VQ63 2CG1A 1UCJA 2QEX3 1I0XA 3JUQA 1R4CA 5AEUB 1RCKA 1D6UA 3T8UA 2INXA 2RBIA 2IY2A 4KVHA 1RGAA 3EX9A 1CEWI 5AEWB 1ROAA 3LMLA 4R80A 5AI1A 4HM1B 5KP3A 3MPHA 2W2CA 3F8HA 2V1LA 5CF2A 4WYKA 1AVLA 3HX8A 3LYGA 1C54A 3OWSA 2ZL8A 4CJNA 3B4PA 3M8CA 3VGNA 3CCE3 3T8NA 1QALA 1UUWB 4EV2A 1JBSA 1O7HB 4IIAA 1NO3A 1YJ93 3HI7A 1YGEA 4HJLB 1IDPA 4KT3B 5IW9A 3WDGB 1RGFA 4H3UA 2BMOB 1RSNA 2IMJA 3E99A 1S5AA 3NV0B 1LVNA 1OHOA 1TUHA 1LQGC 4HBRA 1VQP3 1BVIA 2LYXA 2CHCA 4J5GA 4LMIA 3EC9A 3WOEB 1OGZA 1WMPA 4CDLA 3X41A 3H51A 2BMRB 1UGIA 1DETA 1RHLA 3KZTA 3K5TA 1RCLA 2E2VA 4HM4B 4X2OA 1DMMA 1JN5A 1STFI 1YNVX 1ZS7A 3LZAA 3D5GA 4FCJA 4FMDA 1LRAA 1O7NB 3GZXB 2OQEC 3LTAA 2C4BA 1VQ93 3DY5A 1R4YA 1IV9A 1BRJA 1EA2A 2P0MA 4R4KA 1RMSA 3G8ZA 1UW1A 2IUKA 2UUGC 4AKZA 2W04A 1M1K4 1RJOA 2FXTA 1YVBI 1BNEA 3NX0A 3V98A 3HIGA 2CFGA 1RGEA 2ZDJA 4OUQA 1SIIA 4WFOA 1BRHA 3SLUA 1RGKA 5CXOA 1M1XB 5AIGA 4IT7A 1GOUA 5M1AA 4MMYB 5AIHA 2CK3H 1GY6A 1HZ1A 1B21A 1W6CA 2CIUA 3LTBA 4O02B 4L8PA 1FGQA 2OWPA 1VQK3 1GD3A 1BNFA 2D42A 3EN8A 3MG1A 4OVMA 2WGOA 1I2FA 1QJGA 2YFIB 4FCZA 4J8TA 3CCJ3 4XBYA 1HU9A 3N54B 1YHQ3 2WOHA 2HMOB 3K0ZA 4N6UA 1SIHA 3EE1A 1JZOA 2ML6A 3HOHA 3BIRA 2XRXB 3U97A 3V99A 1Q40A 2P38A 4Q53A 1V58A 2UX0A 4EBGA 1N9EA 4MJDA 1D6ZA 3CNXA 1SJWA 2HMMB 2FGTA 3F8XA 2CFWA 3S5CA 3NM7A 3D4AA 1RRLA 3UNLA 4G1MB 1VQ53 1W7CA 3NHXA 3AGOA 3RGRA 3EJVA 2CWVA 3ER7A 1Q42A 1HKXA 1IQXA 2RSXA 3ECFA 5BIRA 5TGNA 4HVNA 1QVG2 1GSPA 1T3BA 1W5ZA 1CYUA 1QAFA 2CFKA 1NWWA 3GZYB 4L8OA 4TX4A 4EV5A 1BSDA 1K8A4 2HMLB 2Y74A 2KF4A 4BU4A 2HMNB 1DE3A 3WR2A 2RCDA 1U8CB 1W01A 1GS3A 2XFSA 5D82A 3X42A 2XEPA 1HYFA 3X3YA 3KIIA 3KCHA 3G713 3BNEA 4FCMA 1YJW3 1TTOA 4OK0A 2I9WA 3LOYA 1A67A 4LYLB 4GB5A 4PEJA 5G2GA 2KF5A 1OH0A 1RN1A 1UI7A 4NPBA 1BRSA 2KF6A 3F14A 6GSPA 3LT9A 1SARA 3JUOA 4EW5A 5AYRB 3J7Yd 1W02A 1JKGB 3VSYA 1AVKA 4I4KA 3PYJA 1A2PA 3QRDA 3EBYA 3HK4A 2MC8A 3UL6A 3FZWA 4AKYA 1PYLA 4MMXB 5EEOA 2YFJB 5IG0A 1Q864 1FZUA 1BNJA 1A90A 2F5WA 1G02A 1B20A 3D3LA 3MYTA 3S67A 2Z7AA 4FMCA 1I70A 4HM0B 4KFDA 1KWIA 4HAAA 4GSPA 5JPUA 4X2HA 4QWTA 2AADA 3DGNA 1PU4A 3GWRA 4KFFA 1LNIA 3RNTA 2QIYA 3CC23 1Q7HA 2C11A 1JJ22 3OWYA 1FUTA 1WMNA 2ZHXB 3B8LA 3FKAA 1B2MA 3EQQB 3JVCA 3S27A 4ZM8A 5BVBA 3PXMA 4XM4A 3PGBA 1AR0A 1RNBA 1IK3A 1GY5A 1IV7A 1PFPA 3IMAB 1FGOA 2RGQA 1O7WB 2F4YA 1RGLA 1X1UA 1UDII 3OV4A 1YIJ3 3H3HA 3PZWA 1FUSA 1ASKA 5DRVA 4AEQA 1IQYA 1YVSA 4U13A 1ZX2A 3S28A 1RN7A 4FR9A 3FF2A 3GRDA 1CH0A 3K9MC 4BTYA 5ELJA 1VQL3 2OOVC 3UL5A 2JQ5A 3LTCA 3SVAA 4EYCA 2BNGA 5JPPA 1BSBA 1EUIC 1GMRA 1W4NA 2CW9A 7GSPA 3CXC2 1KQS2 1KD14 2B1XB 4LEHA 1BSCA 5STDA
chains in the Genus database with same CATH topology
1C7HA 1A2KA 1K28A 1Q814 1W6GA 1GYBA 4L7KA 1Q7Y4 5D81A 1CYVA 5ELUA 1FGMA 3NV0A 1VQO3 5D83A 3JUMA 2P0XA 2B24B 2GEYA 3AMOB 3DGMA 1JB5A 1IVXA 4O3VA 1GY7A 2RFRA 1IT8A 3F40A 1FA3A 1OGXA 1TU5A 1YIT3 1IT7A 1RRHA 3CC73 1EKMA 3D9RA 4K61A 3LXUX 5KP4A 3U1WA 1UUVB 2D1WA 5EVHA 3N8BA 4WWUC 3FG3A 4MEIA 1V74A 3EB8A 3DUKA 3CPOA 3FF0A 1Q824 3GZBA 2XR8B 1FGRA 5IEOA 2K54A 1OHPA 3BNDA 4KFEA 3CCM3 3GZRA 2KRTA 3KE7A 1TFKA 3Q2PA 3DXOA 3CU3A 3VF1A 3FSDA 1DYUA 1K41A 2OCTA 1D6YA 3NM2A 4XDWA 3KKGA 3WODG 3K63A 2IUJA 5CLKA 2Y73A 5I97A 1YI23 2KCDA 4IPBA 4XB5A 2OTL3 2F99A 2SBLA 4WP5A 4NHFA 1N5HA 1G96A 2XF3A 3KN4A 4N6TA 1DMNA 1JV2B 4LSOA 4N6LA 3CD63 5IEPA 3DGLA 2GBWB 1ULJB 1Z1SA 3FH1A 3CCQ3 3RGAA 3BB9A 4STDA 8CHOA 2GXFA 1DMQA 1U5OA 4FMBA 4N6OB 4R1KA 4NREA 4HM3B 3JUNA 1RKYA 1TP6A 2W56B 1MNLA 3DMCA 3B4OA 1W2B2 3EN1B 1SQWA 1N9JA 4RNZA 1UI8A 4FMAA 2QGUA 2OQEA 2XH9A 3SEDA 2FNQA 5LC6A 2STDA 1W00A 2XSOB 3HIIA 4HM2B 3UB1A 3FCSB 1WMOA 2BMQB 5EQLA 3ROBA 2WO0A 5DREA 1VQ43 3F9SA 4LZIA 4WYKB 3ALAA 3SXXA 1NB5I 4HM7B 3NBJA 4O8SA 1NU3A 3X3XA 3EHCA 2W0QA 2A15A 2PNCA 3IPTA 3EBTA 2XGNA 2C10A 3DZLA 5CF1A 1JKGA 3DGOA 2CC3A 3LH4A 3KSED 4MMZB 4XBXA 2F98A 1OACA 3MWZA 1E3RA 5FGOA 3FGYA 1M9GA 2K0MA 1IVUA 2P05A 4K90B 3BNCA 5A0OB 2BT3A 1E97A 2W9PA 4R9LA 4RBNA 2L4VA 4R9KA 1IU7A 1EG9B 1GD4A 2JDIH 3F7XA 1CQSA 3FLJA 2BHMA 4J9AA 3QK9A 1ISKA 3G0KA 3CCV3 1LNHA 3L0RA 3NXJA 6STDA 3G6E3 1K9M4 1JN5B 1JRQA 1WQLB 3FG4A 3MHEA 4JRFA 3V92A 1M904 4XBTA 1LXEA 1MOLA 5IF6A 2ML5A 3OW22 5IERA 2HMJB 2XGLA 4RZMA 2YX9A 2F86B 1FGTA 4JF8A 3RDEA 2W6JH 2YFLB 3PCRA 1STDA 5IENA 1N5PA 1SPUA 3X40A 2CG0A 3WMDA 1NB3I 2CFLA 1VQN3 3TDGA 1ZO2A 3I563 4HYZA 1EQKA 4HM8B 3NBRA 4ORLA 3GAXA 3STDA 3Q1CA 2GU3A 3SOYA 2OTJ3 1WTHA 1DVDA 2XSHB 2BO9B 1T5YA 5AIFA 2Z6BA 2LQVA 3OXAA 3PS8A 5HGRA 5LC7A 3WA3A 1VQ83 4H61A 1JB2A 3KFQC 2QA43 3SOAA 1OCVA 2IA7A 3CCR3 3I0YA 3WOFB 3PCSA 1NDOB 3LTDA 3NQYA 5IG3A 2CKFB 2HMKB 2CFDA 1IVVA 4KZ1A 3UJMA 3NQZA 1Q40B 1TIJA 2Q07A 5IG4A 1F8NA 3LT8A 1JNQA 1TFOA 3F7SA 1AV4A 3AMOA 3B7CA 1O7MB 1N8R4 1KC84 4HKVB 1US1A 1O7PB 1OF5B 1BUQA 2E2TA 3N9HA 4HM6B 3JUPA 3HZPA 3MKIA 4HZ9B 3Q90A 4BTWA 4BTXA 1VZZA 4O2HA 4HM5B 1NJI4 1ROVA 2CWTA 1DVCA 4EXRA 2E2UA 5AYSC 1VQM3 3MG2A 3DM8A 3T0UA 3CME3 4K1VA 4LGQA 1VQ73 1JB4A 2M7OA 2WGQA 4N3VA 2O9UX 5FW5A 1YJN3 2GBXB 1Y4KA 3KSPA 3G4S3 3O8YA 1A2VA 1O7GB 4EC6A 1OF5A 2PZVA 3MSOA 1OPYA 5BXQA 1KSIA 1N8QA 2OOVA 3SX1A 1OHSA 2GEXA 1K734 5IG5A 3CCS3 3OWUA 3I553 2GU1A 3A76A 4XDVA 5JBSA 3CPW2 3CCL3 2R4IA 3BLZA 1S723 1QVF2 5CK6A 1IQ8A 1J2BA 3OX9A 2P09A 1WNHA 4RNYA 1OUNA 2CWUA 3CMA3 2XFTA 2W9QA 3CCU3 2KXGA 4K1UA 3MG3A 3EF8A 3IJEB 1W2ZA 3NUVA 1QAKA 1LOXA 1QMAA 2Z77A 3CNMA 3G16A 4CCVA 2W56A 3K7CA 4N6MA 4WHAA 2Z76A 1E3VA 2CH9A 1FUWA 3WA2X 1W6YA 5AIIA 7STDA 3X3ZA 2WOFA 3S29A 1ULIB 1L5GB 3CC43 2MF7A 2W03A 2O3OA 3FG1A 4N6NB 4GL6A 4HZBB 4N6V0 5KP1A 1IVWA 3NBBA 3BNBA 1VQ63 2CG1A 2QEX3 3JUQA 1R4CA 5AEUB 3T8UA 1D6UA 2INXA 4KVHA 3EX9A 1CEWI 5AEWB 1ROAA 3LMLA 4R80A 5AI1A 4HM1B 5KP3A 3MPHA 2W2CA 3F8HA 2V1LA 5CF2A 4WYKA 1AVLA 3HX8A 3LYGA 3OWSA 2ZL8A 3B4PA 3M8CA 3VGNA 3CCE3 3T8NA 1QALA 1UUWB 4EV2A 1O7HB 4IIAA 1NO3A 1YJ93 3HI7A 1YGEA 4HJLB 1IDPA 5IW9A 3WDGB 4H3UA 2BMOB 2IMJA 3E99A 1S5AA 3NV0B 1LVNA 1OHOA 1TUHA 4HBRA 1VQP3 2LYXA 2CHCA 4LMIA 3EC9A 3WOEB 1OGZA 1WMPA 4CDLA 3X41A 3H51A 2BMRB 3KZTA 3K5TA 2E2VA 4X2OA 4HM4B 1DMMA 1JN5A 1STFI 3LZAA 4FCJA 4FMDA 1O7NB 3GZXB 2OQEC 3LTAA 1VQ93 3DY5A 1IV9A 1EA2A 4R4KA 2P0MA 3G8ZA 1UW1A 2IUKA 4AKZA 2W04A 1M1K4 1RJOA 2FXTA 1YVBI 3NX0A 3V98A 3HIGA 2CFGA 4OUQA 2ZDJA 4WFOA 1SIIA 3SLUA 5CXOA 1M1XB 5AIGA 4IT7A 4MMYB 5AIHA 2CK3H 1GY6A 2CIUA 1W6CA 3LTBA 4O02B 4L8PA 1FGQA 2OWPA 1VQK3 1GD3A 3EN8A 2D42A 3MG1A 4OVMA 2WGOA 1QJGA 2YFIB 4FCZA 4J8TA 3CCJ3 4XBYA 1HU9A 3N54B 1YHQ3 2WOHA 2HMOB 3K0ZA 4N6UA 1SIHA 3EE1A 2ML6A 2XRXB 3U97A 3V99A 1Q40A 2P38A 4Q53A 2UX0A 4EBGA 1N9EA 4MJDA 1D6ZA 3CNXA 1SJWA 2HMMB 2FGTA 3F8XA 2CFWA 3S5CA 3NM7A 3UNLA 1RRLA 4G1MB 1VQ53 1W7CA 3NHXA 3RGRA 3EJVA 2CWVA 3ER7A 1Q42A 1HKXA 1IQXA 2RSXA 3ECFA 5TGNA 4HVNA 1QVG2 1W5ZA 1CYUA 1QAFA 2CFKA 1NWWA 3GZYB 4L8OA 4TX4A 4EV5A 1K8A4 2HMLB 2Y74A 2HMNB 2RCDA 1U8CB 1W01A 1GS3A 2XFSA 5D82A 3X42A 2XEPA 3X3YA 3KIIA 3G713 3BNEA 4FCMA 1YJW3 4OK0A 2I9WA 3LOYA 1A67A 4GB5A 4PEJA 5G2GA 1OH0A 1UI7A 3F14A 3LT9A 3JUOA 5AYRB 3J7Yd 1W02A 1JKGB 3VSYA 1AVKA 4I4KA 3PYJA 3QRDA 3EBYA 3HK4A 2MC8A 3UL6A 3FZWA 4AKYA 4MMXB 5EEOA 2YFJB 5IG0A 1Q864 1A90A 3D3LA 3MYTA 3S67A 2Z7AA 4FMCA 4HM0B 4KFDA 1KWIA 5JPUA 4X2HA 4QWTA 3DGNA 1PU4A 3GWRA 4KFFA 2QIYA 3CC23 2C11A 1JJ22 3OWYA 1WMNA 3B8LA 3FKAA 3EQQB 3JVCA 3S27A 4ZM8A 5BVBA 3PXMA 4XM4A 3PGBA 1AR0A 1IK3A 1GY5A 1IV7A 1PFPA 3IMAB 1FGOA 2RGQA 1O7WB 3OV4A 1YIJ3 3H3HA 3PZWA 4AEQA 1ASKA 5DRVA 1IQYA 4U13A 1ZX2A 3S28A 1RN7A 4FR9A 3FF2A 3GRDA 3K9MC 4BTYA 5ELJA 1VQL3 2OOVC 3UL5A 2JQ5A 3LTCA 3SVAA 4EYCA 2BNGA 5JPPA 1KQS2 1W4NA 2CW9A 3CXC2 1KD14 2B1XB 4LEHA 5STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7H A;  1A2K A;  1GYB A;  4L7K A;  5D81 A;  3NV0 A;  5D83 A;  3JUM A;  2B24 B;  2GEY A;  1JB5 A;  1GY7 A;  2RFR A;  3F40 A;  1OGX A;  3D9R A;  5KP4 A;  1UUV B;  5EVH A;  4WWU C;  3DUK A;  3CPO A;  3FF0 A;  3GZB A;  2XR8 B;  5IEO A;  2K54 A;  1OHP A;  3GZR A;  3KE7 A;  3DXO A;  3CU3 A;  3FSD A;  1K41 A;  3NM2 A;  4XDW A;  3KKG A;  5CLK A;  4XB5 A;  2F99 A;  4WP5 A;  1DMN A;  5IEP A;  2GBW B;  1ULJ B;  1Z1S A;  3FH1 A;  3RGA A;  3BB9 A;  4STD A;  8CHO A;  2GXF A;  1DMQ A;  1U5O A;  4R1K A;  4HM3 B;  3JUN A;  1TP6 A;  3DMC A;  3B4O A;  3EN1 B;  2QGU A;  3SED A;  2STD A;  1W00 A;  2XSO B;  4HM2 B;  2BMQ B;  3ROB A;  5DRE A;  3F9S A;  4WYK B;  4HM7 B;  1NU3 A;  3EHC A;  2A15 A;  3IPT A;  3EBT A;  3DZL A;  5CF1 A;  1JKG A;  4XBX A;  2F98 A;  1E3R A;  3FGY A;  4R9L A;  1E97 A;  4R9K A;  1EG9 B;  3F7X A;  1CQS A;  3FLJ A;  4J9A A;  1ISK A;  3G0K A;  3NXJ A;  6STD A;  1JN5 B;  3MHE A;  1WQL B;  4XBT A;  5IF6 A;  5IER A;  2HMJ B;  4RZM A;  2F86 B;  2YFL B;  1STD A;  5IEN A;  3WMD A;  1ZO2 A;  4HM8 B;  3NBR A;  4ORL A;  3STD A;  3SOY A;  2XSH B;  5AIF A;  3OXA A;  5HGR A;  1JB2 A;  3SOA A;  1OCV A;  3I0Y A;  1NDO B;  5IG3 A;  2CKF B;  2HMK B;  3UJM A;  5IG4 A;  1Q40 B;  3F7S A;  3B7C A;  1O7M B;  4HKV B;  1O7P B;  1OF5 B;  1BUQ A;  4HM6 B;  3JUP A;  3HZP A;  3MKI A;  4HZ9 B;  3Q90 A;  1VZZ A;  4HM5 B;  3MG2 A;  3DM8 A;  4K1V A;  4LGQ A;  1JB4 A;  4N3V A;  5FW5 A;  2GBX B;  3KSP A;  1O7G B;  1OF5 A;  2PZV A;  3MSO A;  1OPY A;  5BXQ A;  1OHS A;  2GEX A;  5IG5 A;  3OWU A;  3A76 A;  4XDV A;  2R4I A;  3BLZ A;  5CK6 A;  3OX9 A;  1OUN A;  4K1U A;  3MG3 A;  3EF8 A;  3NUV A;  1QMA A;  2Z77 A;  3CNM A;  3G16 A;  3K7C A;  2Z76 A;  1E3V A;  1W6Y A;  5AII A;  7STD A;  1ULI B;  5KP1 A;  4HZB B;  3JUQ A;  5AEU B;  3T8U A;  2INX A;  4KVH A;  3EX9 A;  5AEW B;  5AI1 A;  4HM1 B;  5KP3 A;  2W2C A;  3F8H A;  5CF2 A;  4WYK A;  3LYG A;  3HX8 A;  3OWS A;  3B4P A;  3M8C A;  3VGN A;  3T8N A;  1UUW B;  1O7H B;  4IIA A;  4HJL B;  1IDP A;  4H3U A;  2BMO B;  2IMJ A;  3E99 A;  1S5A A;  3NV0 B;  1OHO A;  1TUH A;  2CHC A;  4LMI A;  3EC9 A;  1OGZ A;  4CDL A;  3H51 A;  2BMR B;  3KZT A;  4X2O A;  4HM4 B;  1DMM A;  1JN5 A;  3LZA A;  4FCJ A;  1O7N B;  3GZX B;  1EA2 A;  3G8Z A;  4OUQ A;  5CXO A;  5AIG A;  5AIH A;  1GY6 A;  4L8P A;  2OWP A;  3EN8 A;  3MG1 A;  4OVM A;  1QJG A;  2YFI B;  4J8T A;  4XBY A;  2HMO B;  3K0Z A;  2XRX B;  1Q40 A;  4Q53 A;  2UX0 A;  4MJD A;  3CNX A;  1SJW A;  2HMM B;  3F8X A;  3S5C A;  3UNL A;  3NHX A;  3RGR A;  3EJV A;  3ER7 A;  1Q42 A;  1HKX A;  3ECF A;  5TGN A;  4HVN A;  1NWW A;  3GZY B;  4L8O A;  2HML B;  2HMN B;  2RCD A;  1W01 A;  1GS3 A;  5D82 A;  4FCM A;  2I9W A;  4GB5 A;  4PEJ A;  5G2G A;  1OH0 A;  3F14 A;  3JUO A;  1W02 A;  1JKG B;  3VSY A;  4I4K A;  3EBY A;  3HK4 A;  3FZW A;  2YFJ B;  5IG0 A;  3MYT A;  2Z7A A;  4HM0 B;  5JPU A;  4X2H A;  3GWR A;  2QIY A;  3OWY A;  3B8L A;  3FKA A;  3EQQ B;  5BVB A;  4XM4 A;  1AR0 A;  1GY5 A;  2RGQ A;  1O7W B;  3OV4 A;  3H3H A;  1ASK A;  5DRV A;  4U13 A;  1ZX2 A;  3FF2 A;  3GRD A;  2JQ5 A;  2BNG A;  5JPP A;  2B1X B;  4LEH A;  5STD A; 
#chains in the Genus database with same CATH topology
 1BRK A;  6RNT A;  1C7H A;  1A2K A;  1K28 A;  5M19 A;  1Q81 4;  1UCI A;  1W6G A;  2HOH A;  1GYB A;  4L7K A;  4BL3 A;  1Q7Y 4;  5D81 A;  1CYV A;  5M18 A;  1T2H A;  5ELU A;  1BUJ A;  1FGM A;  3NV0 A;  1VQO 3;  5D83 A;  2CX1 A;  3JUM A;  3DH2 A;  4HOH A;  2P0X A;  2B24 B;  2GEY A;  3AMO B;  3DGM A;  1JB5 A;  1IVX A;  4O3V A;  1GY7 A;  2H0G A;  2RFR A;  1IT8 A;  3F40 A;  1FA3 A;  1VQQ A;  1OGX A;  1TU5 A;  1YIT 3;  1RN4 A;  1IT7 A;  1BU4 A;  1RRH A;  3CC7 3;  1EKM A;  3D9R A;  4K61 A;  3LXU X;  5KP4 A;  3U1W A;  1UUV B;  2D1W A;  1RGH A;  2F5M A;  5EVH A;  3N8B A;  4WWU C;  1B27 A;  3D79 A;  1NNV A;  3FG3 A;  4MEI A;  1V74 A;  3EB8 A;  3DUK A;  3CPO A;  3FF0 A;  1Q82 4;  3GZB A;  2XR8 B;  1FGR A;  5IEO A;  2K54 A;  3ZFZ A;  1OHP A;  3BND A;  4KFE A;  3CCM 3;  1BAO A;  3GZR A;  2BIR A;  2KRT A;  3KE7 A;  3ZG5 A;  1TFK A;  3Q2P A;  2K3D A;  3DXO A;  3CU3 A;  3VF1 A;  1RGG A;  3FSD A;  1DYU A;  1JBT A;  1K41 A;  1BNR A;  1IYY A;  2OCT A;  1D6Y A;  3NM2 A;  4XDW A;  3KKG A;  3WOD G;  3K63 A;  2IUJ A;  5CLK A;  2Y73 A;  5I97 A;  1YI2 3;  1BNI A;  2KCD A;  1B3S A;  4IPB A;  4XB5 A;  5G1K A;  2OTL 3;  2F99 A;  2SBL A;  4WP5 A;  4NHF A;  1N5H A;  1G96 A;  2XF3 A;  3KN4 A;  4GHO A;  4N6T A;  1DMN A;  1JV2 B;  4LSO A;  1LOY A;  1FW7 A;  1BRG A;  1LOW A;  4J5K A;  4N6L A;  3CD6 3;  5IEP A;  3DGL A;  2GBW B;  1ULJ B;  1Z1S A;  3FH1 A;  3CCQ 3;  3RGA A;  1AQZ A;  3WHO A;  3BB9 A;  4STD A;  8CHO A;  2GXF A;  1DMQ A;  1U5O A;  2RNT A;  2H0I A;  4FMB A;  4N6O B;  4R1K A;  4NRE A;  4HM3 B;  3JUN A;  1RKY A;  1RGC A;  1TP6 A;  2W56 B;  1MNL A;  3DMC A;  3B4O A;  4CPK A;  1W2B 2;  1I3I A;  1BOX A;  3EN1 B;  1TRQ A;  1SQW A;  1N9J A;  4RNZ A;  1BRN L;  1UI8 A;  4FMA A;  2QGU A;  2UGI A;  2OQE A;  2XH9 A;  3SED A;  1UCK A;  2FNQ A;  5LC6 A;  2STD A;  1I3F A;  1W00 A;  2XSO B;  3HII A;  4HM2 B;  3UB1 A;  2J8X B;  1WMO A;  3FCS B;  2BMQ B;  5EQL A;  1MWR A;  3ROB A;  3GSP A;  2WO0 A;  5DRE A;  1VQ4 3;  3F9S A;  4LZI A;  4WYK B;  3ALA A;  3SXX A;  1NB5 I;  4HM7 B;  3NBJ A;  4O8S A;  1NU3 A;  3X3X A;  3EHC A;  2W0Q A;  2A15 A;  2PNC A;  3IPT A;  3EBT A;  2XGN A;  2C10 A;  3DZL A;  5CF1 A;  1JKG A;  3DGO A;  2CC3 A;  3LH4 A;  3KSE D;  4MMZ B;  4XBX A;  2F98 A;  1OAC A;  3MWZ A;  1E3R A;  2BU4 A;  5FGO A;  3FGY A;  4RNT A;  5IG4 A;  1M9G A;  2K0M A;  1IVU A;  2P05 A;  4K90 B;  3BNC A;  5A0O B;  2CX0 A;  2L1S A;  1EEJ A;  1E97 A;  2BT3 A;  2W9P A;  4R9L A;  4RBN A;  2L4V A;  4R9K A;  1JBR A;  1IU7 A;  1EG9 B;  1GD4 A;  2JDI H;  2R41 A;  3F7X A;  1CQS A;  1I8V A;  2ZA4 A;  3FLJ A;  4I5Q A;  2BHM A;  1AY7 A;  4J9A A;  3QK9 A;  1ISK A;  3G0K A;  3CCV 3;  1BNG A;  1LQM B;  1LNH A;  5RNT A;  3L0R A;  3NXJ A;  1GOV A;  6STD A;  1BAN A;  3G6E 3;  1K9M 4;  1JN5 B;  1JRQ A;  1WQL B;  3FG4 A;  3MHE A;  4JRF A;  3V92 A;  1M90 4;  1I2E A;  4XBT A;  1LXE A;  1MOL A;  2SAR A;  5IF6 A;  4DKI A;  8RNT A;  1RDS A;  2ML5 A;  3ZG0 A;  5IER A;  3OW2 2;  2HMJ B;  2XGL A;  4RZM A;  1BRI A;  1GMP A;  1X1X A;  9RNT A;  2YX9 A;  2F86 B;  1FGT A;  4JF8 A;  3RDE A;  2W6J H;  2YFL B;  3PCR A;  1STD A;  5IEN A;  1N5P A;  1SPU A;  3X40 A;  2CG0 A;  3WMD A;  1GMQ A;  1NB3 I;  2CFL A;  1VQN 3;  3TDG A;  1ZO2 A;  3I56 3;  4HYZ A;  1EQK A;  4HM8 B;  1B2S A;  3NBR A;  4ORL A;  3GAX A;  1T2I A;  3STD A;  3Q1C A;  2GU3 A;  3SOY A;  4BIR A;  2OTJ 3;  1WTH A;  1DVD A;  2XSH B;  2BO9 B;  1T5Y A;  5AIF A;  2Z6B A;  2LQV A;  3OXA A;  3PS8 A;  5HGR A;  5LC7 A;  3WA3 A;  1VQ8 3;  1JZD A;  2KF3 A;  1PY3 A;  1JB2 A;  3KFQ C;  4H61 A;  1MWS A;  3SOA A;  2QA4 3;  1OCV A;  1B2U A;  2IA7 A;  3CCR 3;  3I0Y A;  1Q9E A;  3PCS A;  1NDO B;  3WOF B;  1I0V A;  3LTD A;  3NQY A;  5IG3 A;  2CKF B;  2HMK B;  1BIR A;  1IVV A;  2CFD A;  2IYJ A;  3NQZ A;  1Q40 B;  1TIJ A;  2H0H A;  2Q07 A;  4KZ1 A;  1F8N A;  3LT8 A;  1JNQ A;  1TFO A;  3BU4 A;  1YGW A;  1AV4 A;  3AMO A;  3B7C A;  3F7S A;  1MGW A;  2GSP A;  3D5I A;  1O7M B;  1BSE A;  1N8R 4;  5GSP A;  1BGS A;  1TJD A;  1KC8 4;  4HKV B;  1TRP A;  1US1 A;  1O7P B;  1OF5 B;  1BUQ A;  2E2T A;  3N9H A;  4HM6 B;  1X1Y A;  3HZP A;  3JUP A;  3MKI A;  4HZ9 B;  3Q90 A;  4BTW A;  4BTX A;  1VZZ A;  1UGH I;  4O2H A;  4HM5 B;  1NJI 4;  1ROV A;  1UCL A;  1DVC A;  1BSA A;  2CWT A;  2KAA A;  4EXR A;  2E2U A;  5AYS C;  2AAE A;  1VQM 3;  3MG2 A;  3DM8 A;  3T0U A;  3CME 3;  4K1V A;  4LGQ A;  1VQ7 3;  1JB4 A;  2M7O A;  3SYU A;  2WGQ A;  4N3V A;  1ZGX A;  1I2G A;  3AGN A;  2O9U X;  1B2X A;  5FW5 A;  1YJN 3;  1RNT A;  2GBX B;  1Y4K A;  4BL2 A;  1MWT A;  3KSP A;  1UUG B;  3G4S 3;  3O8Y A;  1A2V A;  1O7G B;  4EC6 A;  1BNS A;  1RTU A;  1OF5 A;  2PZV A;  1LOV A;  1RLS A;  3MSO A;  7RNT A;  1OPY A;  5BU4 A;  5BXQ A;  1KSI A;  3AHS A;  1N8Q A;  2OOV A;  1GOY A;  3SX1 A;  1OHS A;  4ILF A;  2GEX A;  1K73 4;  5IG5 A;  3UJM A;  3CCS 3;  3OWU A;  3I55 3;  1X1W A;  2GU1 A;  3A76 A;  3A5E A;  4XDV A;  3URP A;  5JBS A;  3CPW 2;  3CCL 3;  2R4I A;  3BLZ A;  1S72 3;  1QVF 2;  5CK6 A;  1IQ8 A;  3DGY A;  1J2B A;  1FYS A;  3OX9 A;  1B2Z A;  2P09 A;  1WNH A;  4RNY A;  1OUN A;  2CWU A;  3CMA 3;  1MWU A;  2XFT A;  1V57 A;  3Q3F A;  5G1L A;  2W9Q A;  3CCU 3;  2KXG A;  4K1U A;  3MG3 A;  1MGR A;  3EF8 A;  1G0T A;  1W2Z A;  3IJE B;  3NUV A;  1QAK A;  1LOX A;  1QMA A;  2Z77 A;  3AHW A;  3CNM A;  3G16 A;  4CCV A;  2W56 A;  3K7C A;  4N6M A;  4WHA A;  2Z76 A;  1E3V A;  2CH9 A;  1FUW A;  3WA2 X;  1W6Y A;  5AII A;  7STD A;  3X3Z A;  2WOF A;  3S29 A;  1ULI B;  5HOH A;  2F56 A;  1L5G B;  3CC4 3;  2MF7 A;  2W03 A;  2O3O A;  3FG1 A;  4N6N B;  4GL6 A;  4HZB B;  4N6V 0;  5KP1 A;  1IVW A;  3NBB A;  3BNB A;  1VQ6 3;  2CG1 A;  1UCJ A;  2QEX 3;  1I0X A;  3JUQ A;  1R4C A;  5AEU B;  1RCK A;  1D6U A;  3T8U A;  2INX A;  2RBI A;  2IY2 A;  4KVH A;  1RGA A;  3EX9 A;  1CEW I;  5AEW B;  1ROA A;  3LML A;  4R80 A;  5AI1 A;  4HM1 B;  5KP3 A;  3MPH A;  2W2C A;  3F8H A;  2V1L A;  5CF2 A;  4WYK A;  1AVL A;  3HX8 A;  3LYG A;  1C54 A;  3OWS A;  2ZL8 A;  4CJN A;  3B4P A;  3M8C A;  3VGN A;  3CCE 3;  3T8N A;  1QAL A;  1UUW B;  4EV2 A;  1JBS A;  1O7H B;  4IIA A;  1NO3 A;  1YJ9 3;  3HI7 A;  1YGE A;  4HJL B;  1IDP A;  4KT3 B;  5IW9 A;  3WDG B;  1RGF A;  4H3U A;  2BMO B;  1RSN A;  2IMJ A;  3E99 A;  1S5A A;  3NV0 B;  1LVN A;  1OHO A;  1TUH A;  1LQG C;  4HBR A;  1VQP 3;  1BVI A;  2LYX A;  2CHC A;  4J5G A;  4LMI A;  3EC9 A;  3WOE B;  1OGZ A;  1WMP A;  4CDL A;  3X41 A;  3H51 A;  2BMR B;  1UGI A;  1DET A;  1RHL A;  3KZT A;  3K5T A;  1RCL A;  2E2V A;  4HM4 B;  4X2O A;  1DMM A;  1JN5 A;  1STF I;  1YNV X;  1ZS7 A;  3LZA A;  3D5G A;  4FCJ A;  4FMD A;  1LRA A;  1O7N B;  3GZX B;  2OQE C;  3LTA A;  2C4B A;  1VQ9 3;  3DY5 A;  1R4Y A;  1IV9 A;  1BRJ A;  1EA2 A;  2P0M A;  4R4K A;  1RMS A;  3G8Z A;  1UW1 A;  2IUK A;  2UUG C;  4AKZ A;  2W04 A;  1M1K 4;  1RJO A;  2FXT A;  1YVB I;  1BNE A;  3NX0 A;  3V98 A;  3HIG A;  2CFG A;  1RGE A;  2ZDJ A;  4OUQ A;  1SII A;  4WFO A;  1BRH A;  3SLU A;  1RGK A;  5CXO A;  1M1X B;  5AIG A;  4IT7 A;  1GOU A;  5M1A A;  4MMY B;  5AIH A;  2CK3 H;  1GY6 A;  1HZ1 A;  1B21 A;  1W6C A;  2CIU A;  3LTB A;  4O02 B;  4L8P A;  1FGQ A;  2OWP A;  1VQK 3;  1GD3 A;  1BNF A;  2D42 A;  3EN8 A;  3MG1 A;  4OVM A;  2WGO A;  1I2F A;  1QJG A;  2YFI B;  4FCZ A;  4J8T A;  3CCJ 3;  4XBY A;  1HU9 A;  3N54 B;  1YHQ 3;  2WOH A;  2HMO B;  3K0Z A;  4N6U A;  1SIH A;  3EE1 A;  1JZO A;  2ML6 A;  3HOH A;  3BIR A;  2XRX B;  3U97 A;  3V99 A;  1Q40 A;  2P38 A;  4Q53 A;  1V58 A;  2UX0 A;  4EBG A;  1N9E A;  4MJD A;  1D6Z A;  3CNX A;  1SJW A;  2HMM B;  2FGT A;  3F8X A;  2CFW A;  3S5C A;  3NM7 A;  3D4A A;  1RRL A;  3UNL A;  4G1M B;  1VQ5 3;  1W7C A;  3NHX A;  3AGO A;  3RGR A;  3EJV A;  2CWV A;  3ER7 A;  1Q42 A;  1HKX A;  1IQX A;  2RSX A;  3ECF A;  5BIR A;  5TGN A;  4HVN A;  1QVG 2;  1GSP A;  1T3B A;  1W5Z A;  1CYU A;  1QAF A;  2CFK A;  1NWW A;  3GZY B;  4L8O A;  4TX4 A;  4EV5 A;  1BSD A;  1K8A 4;  2HML B;  2Y74 A;  2KF4 A;  4BU4 A;  2HMN B;  1DE3 A;  3WR2 A;  2RCD A;  1U8C B;  1W01 A;  1GS3 A;  2XFS A;  5D82 A;  3X42 A;  2XEP A;  1HYF A;  3X3Y A;  3KII A;  3KCH A;  3G71 3;  3BNE A;  4FCM A;  1YJW 3;  1TTO A;  4OK0 A;  2I9W A;  3LOY A;  1A67 A;  4LYL B;  4GB5 A;  4PEJ A;  5G2G A;  2KF5 A;  1OH0 A;  1RN1 A;  1UI7 A;  4NPB A;  1BRS A;  2KF6 A;  3F14 A;  6GSP A;  3LT9 A;  1SAR A;  3JUO A;  4EW5 A;  5AYR B;  3J7Y d;  1W02 A;  1JKG B;  3VSY A;  1AVK A;  4I4K A;  3PYJ A;  1A2P A;  3QRD A;  3EBY A;  3HK4 A;  2MC8 A;  3UL6 A;  3FZW A;  4AKY A;  1PYL A;  4MMX B;  5EEO A;  2YFJ B;  5IG0 A;  1Q86 4;  1FZU A;  1BNJ A;  1A90 A;  2F5W A;  1G02 A;  1B20 A;  3D3L A;  3MYT A;  3S67 A;  2Z7A A;  4FMC A;  1I70 A;  4HM0 B;  4KFD A;  1KWI A;  4HAA A;  4GSP A;  5JPU A;  4X2H A;  4QWT A;  2AAD A;  3DGN A;  1PU4 A;  3GWR A;  4KFF A;  1LNI A;  3RNT A;  2QIY A;  3CC2 3;  1Q7H A;  2C11 A;  1JJ2 2;  3OWY A;  1FUT A;  1WMN A;  2ZHX B;  3B8L A;  3FKA A;  1B2M A;  3EQQ B;  3JVC A;  3S27 A;  4ZM8 A;  5BVB A;  3PXM A;  4XM4 A;  3PGB A;  1AR0 A;  1RNB A;  1IK3 A;  1GY5 A;  1IV7 A;  1PFP A;  3IMA B;  1FGO A;  2RGQ A;  1O7W B;  2F4Y A;  1RGL A;  1X1U A;  1UDI I;  3OV4 A;  1YIJ 3;  3H3H A;  3PZW A;  1FUS A;  1ASK A;  5DRV A;  4AEQ A;  1IQY A;  1YVS A;  4U13 A;  1ZX2 A;  3S28 A;  1RN7 A;  4FR9 A;  3FF2 A;  3GRD A;  1CH0 A;  3K9M C;  4BTY A;  5ELJ A;  1VQL 3;  2OOV C;  3UL5 A;  2JQ5 A;  3LTC A;  3SVA A;  4EYC A;  2BNG A;  5JPP A;  1BSB A;  1EUI C;  1GMR A;  1W4N A;  2CW9 A;  7GSP A;  3CXC 2;  1KQS 2;  1KD1 4;  2B1X B;  4LEH A;  1BSC A;  5STD A; 
#chains in the Genus database with same CATH homology
 1C7H A;  1A2K A;  1K28 A;  1Q81 4;  1W6G A;  1GYB A;  4L7K A;  1Q7Y 4;  5D81 A;  1CYV A;  5ELU A;  1FGM A;  3NV0 A;  1VQO 3;  5D83 A;  3JUM A;  2P0X A;  2B24 B;  2GEY A;  3AMO B;  3DGM A;  1JB5 A;  1IVX A;  4O3V A;  1GY7 A;  2RFR A;  1IT8 A;  3F40 A;  1FA3 A;  1OGX A;  1TU5 A;  1YIT 3;  1IT7 A;  1RRH A;  3CC7 3;  1EKM A;  3D9R A;  4K61 A;  3LXU X;  5KP4 A;  3U1W A;  1UUV B;  2D1W A;  5EVH A;  3N8B A;  4WWU C;  3FG3 A;  4MEI A;  1V74 A;  3EB8 A;  3DUK A;  3CPO A;  3FF0 A;  1Q82 4;  3GZB A;  2XR8 B;  1FGR A;  5IEO A;  2K54 A;  1OHP A;  3BND A;  4KFE A;  3CCM 3;  3GZR A;  2KRT A;  3KE7 A;  1TFK A;  3Q2P A;  3DXO A;  3CU3 A;  3VF1 A;  3FSD A;  1DYU A;  1K41 A;  2OCT A;  1D6Y A;  3NM2 A;  4XDW A;  3KKG A;  3WOD G;  3K63 A;  2IUJ A;  5CLK A;  2Y73 A;  5I97 A;  1YI2 3;  2KCD A;  4IPB A;  4XB5 A;  2OTL 3;  2F99 A;  2SBL A;  4WP5 A;  4NHF A;  1N5H A;  1G96 A;  2XF3 A;  3KN4 A;  4N6T A;  1DMN A;  1JV2 B;  4LSO A;  4N6L A;  3CD6 3;  5IEP A;  3DGL A;  2GBW B;  1ULJ B;  1Z1S A;  3FH1 A;  3CCQ 3;  3RGA A;  3BB9 A;  4STD A;  8CHO A;  2GXF A;  1DMQ A;  1U5O A;  4FMB A;  4N6O B;  4R1K A;  4NRE A;  4HM3 B;  3JUN A;  1RKY A;  1TP6 A;  2W56 B;  1MNL A;  3DMC A;  3B4O A;  1W2B 2;  3EN1 B;  1SQW A;  1N9J A;  4RNZ A;  1UI8 A;  4FMA A;  2QGU A;  2OQE A;  2XH9 A;  3SED A;  2FNQ A;  5LC6 A;  2STD A;  1W00 A;  2XSO B;  3HII A;  4HM2 B;  3UB1 A;  3FCS B;  1WMO A;  2BMQ B;  5EQL A;  3ROB A;  2WO0 A;  5DRE A;  1VQ4 3;  3F9S A;  4LZI A;  4WYK B;  3ALA A;  3SXX A;  1NB5 I;  4HM7 B;  3NBJ A;  4O8S A;  1NU3 A;  3X3X A;  3EHC A;  2W0Q A;  2A15 A;  2PNC A;  3IPT A;  3EBT A;  2XGN A;  2C10 A;  3DZL A;  5CF1 A;  1JKG A;  3DGO A;  2CC3 A;  3LH4 A;  3KSE D;  4MMZ B;  4XBX A;  2F98 A;  1OAC A;  3MWZ A;  1E3R A;  5FGO A;  3FGY A;  1M9G A;  2K0M A;  1IVU A;  2P05 A;  4K90 B;  3BNC A;  5A0O B;  2BT3 A;  1E97 A;  2W9P A;  4R9L A;  4RBN A;  2L4V A;  4R9K A;  1IU7 A;  1EG9 B;  1GD4 A;  2JDI H;  3F7X A;  1CQS A;  3FLJ A;  2BHM A;  4J9A A;  3QK9 A;  1ISK A;  3G0K A;  3CCV 3;  1LNH A;  3L0R A;  3NXJ A;  6STD A;  3G6E 3;  1K9M 4;  1JN5 B;  1JRQ A;  1WQL B;  3FG4 A;  3MHE A;  4JRF A;  3V92 A;  1M90 4;  4XBT A;  1LXE A;  1MOL A;  5IF6 A;  2ML5 A;  3OW2 2;  5IER A;  2HMJ B;  2XGL A;  4RZM A;  2YX9 A;  2F86 B;  1FGT A;  4JF8 A;  3RDE A;  2W6J H;  2YFL B;  3PCR A;  1STD A;  5IEN A;  1N5P A;  1SPU A;  3X40 A;  2CG0 A;  3WMD A;  1NB3 I;  2CFL A;  1VQN 3;  3TDG A;  1ZO2 A;  3I56 3;  4HYZ A;  1EQK A;  4HM8 B;  3NBR A;  4ORL A;  3GAX A;  3STD A;  3Q1C A;  2GU3 A;  3SOY A;  2OTJ 3;  1WTH A;  1DVD A;  2XSH B;  2BO9 B;  1T5Y A;  5AIF A;  2Z6B A;  2LQV A;  3OXA A;  3PS8 A;  5HGR A;  5LC7 A;  3WA3 A;  1VQ8 3;  4H61 A;  1JB2 A;  3KFQ C;  2QA4 3;  3SOA A;  1OCV A;  2IA7 A;  3CCR 3;  3I0Y A;  3WOF B;  3PCS A;  1NDO B;  3LTD A;  3NQY A;  5IG3 A;  2CKF B;  2HMK B;  2CFD A;  1IVV A;  4KZ1 A;  3UJM A;  3NQZ A;  1Q40 B;  1TIJ A;  2Q07 A;  5IG4 A;  1F8N A;  3LT8 A;  1JNQ A;  1TFO A;  3F7S A;  1AV4 A;  3AMO A;  3B7C A;  1O7M B;  1N8R 4;  1KC8 4;  4HKV B;  1US1 A;  1O7P B;  1OF5 B;  1BUQ A;  2E2T A;  3N9H A;  4HM6 B;  3JUP A;  3HZP A;  3MKI A;  4HZ9 B;  3Q90 A;  4BTW A;  4BTX A;  1VZZ A;  4O2H A;  4HM5 B;  1NJI 4;  1ROV A;  2CWT A;  1DVC A;  4EXR A;  2E2U A;  5AYS C;  1VQM 3;  3MG2 A;  3DM8 A;  3T0U A;  3CME 3;  4K1V A;  4LGQ A;  1VQ7 3;  1JB4 A;  2M7O A;  2WGQ A;  4N3V A;  2O9U X;  5FW5 A;  1YJN 3;  2GBX B;  1Y4K A;  3KSP A;  3G4S 3;  3O8Y A;  1A2V A;  1O7G B;  4EC6 A;  1OF5 A;  2PZV A;  3MSO A;  1OPY A;  5BXQ A;  1KSI A;  1N8Q A;  2OOV A;  3SX1 A;  1OHS A;  2GEX A;  1K73 4;  5IG5 A;  3CCS 3;  3OWU A;  3I55 3;  2GU1 A;  3A76 A;  4XDV A;  5JBS A;  3CPW 2;  3CCL 3;  2R4I A;  3BLZ A;  1S72 3;  1QVF 2;  5CK6 A;  1IQ8 A;  1J2B A;  3OX9 A;  2P09 A;  1WNH A;  4RNY A;  1OUN A;  2CWU A;  3CMA 3;  2XFT A;  2W9Q A;  3CCU 3;  2KXG A;  4K1U A;  3MG3 A;  3EF8 A;  3IJE B;  1W2Z A;  3NUV A;  1QAK A;  1LOX A;  1QMA A;  2Z77 A;  3CNM A;  3G16 A;  4CCV A;  2W56 A;  3K7C A;  4N6M A;  4WHA A;  2Z76 A;  1E3V A;  2CH9 A;  1FUW A;  3WA2 X;  1W6Y A;  5AII A;  7STD A;  3X3Z A;  2WOF A;  3S29 A;  1ULI B;  1L5G B;  3CC4 3;  2MF7 A;  2W03 A;  2O3O A;  3FG1 A;  4N6N B;  4GL6 A;  4HZB B;  4N6V 0;  5KP1 A;  1IVW A;  3NBB A;  3BNB A;  1VQ6 3;  2CG1 A;  2QEX 3;  3JUQ A;  1R4C A;  5AEU B;  3T8U A;  1D6U A;  2INX A;  4KVH A;  3EX9 A;  1CEW I;  5AEW B;  1ROA A;  3LML A;  4R80 A;  5AI1 A;  4HM1 B;  5KP3 A;  3MPH A;  2W2C A;  3F8H A;  2V1L A;  5CF2 A;  4WYK A;  1AVL A;  3HX8 A;  3LYG A;  3OWS A;  2ZL8 A;  3B4P A;  3M8C A;  3VGN A;  3CCE 3;  3T8N A;  1QAL A;  1UUW B;  4EV2 A;  1O7H B;  4IIA A;  1NO3 A;  1YJ9 3;  3HI7 A;  1YGE A;  4HJL B;  1IDP A;  5IW9 A;  3WDG B;  4H3U A;  2BMO B;  2IMJ A;  3E99 A;  1S5A A;  3NV0 B;  1LVN A;  1OHO A;  1TUH A;  4HBR A;  1VQP 3;  2LYX A;  2CHC A;  4LMI A;  3EC9 A;  3WOE B;  1OGZ A;  1WMP A;  4CDL A;  3X41 A;  3H51 A;  2BMR B;  3KZT A;  3K5T A;  2E2V A;  4X2O A;  4HM4 B;  1DMM A;  1JN5 A;  1STF I;  3LZA A;  4FCJ A;  4FMD A;  1O7N B;  3GZX B;  2OQE C;  3LTA A;  1VQ9 3;  3DY5 A;  1IV9 A;  1EA2 A;  4R4K A;  2P0M A;  3G8Z A;  1UW1 A;  2IUK A;  4AKZ A;  2W04 A;  1M1K 4;  1RJO A;  2FXT A;  1YVB I;  3NX0 A;  3V98 A;  3HIG A;  2CFG A;  4OUQ A;  2ZDJ A;  4WFO A;  1SII A;  3SLU A;  5CXO A;  1M1X B;  5AIG A;  4IT7 A;  4MMY B;  5AIH A;  2CK3 H;  1GY6 A;  2CIU A;  1W6C A;  3LTB A;  4O02 B;  4L8P A;  1FGQ A;  2OWP A;  1VQK 3;  1GD3 A;  3EN8 A;  2D42 A;  3MG1 A;  4OVM A;  2WGO A;  1QJG A;  2YFI B;  4FCZ A;  4J8T A;  3CCJ 3;  4XBY A;  1HU9 A;  3N54 B;  1YHQ 3;  2WOH A;  2HMO B;  3K0Z A;  4N6U A;  1SIH A;  3EE1 A;  2ML6 A;  2XRX B;  3U97 A;  3V99 A;  1Q40 A;  2P38 A;  4Q53 A;  2UX0 A;  4EBG A;  1N9E A;  4MJD A;  1D6Z A;  3CNX A;  1SJW A;  2HMM B;  2FGT A;  3F8X A;  2CFW A;  3S5C A;  3NM7 A;  3UNL A;  1RRL A;  4G1M B;  1VQ5 3;  1W7C A;  3NHX A;  3RGR A;  3EJV A;  2CWV A;  3ER7 A;  1Q42 A;  1HKX A;  1IQX A;  2RSX A;  3ECF A;  5TGN A;  4HVN A;  1QVG 2;  1W5Z A;  1CYU A;  1QAF A;  2CFK A;  1NWW A;  3GZY B;  4L8O A;  4TX4 A;  4EV5 A;  1K8A 4;  2HML B;  2Y74 A;  2HMN B;  2RCD A;  1U8C B;  1W01 A;  1GS3 A;  2XFS A;  5D82 A;  3X42 A;  2XEP A;  3X3Y A;  3KII A;  3G71 3;  3BNE A;  4FCM A;  1YJW 3;  4OK0 A;  2I9W A;  3LOY A;  1A67 A;  4GB5 A;  4PEJ A;  5G2G A;  1OH0 A;  1UI7 A;  3F14 A;  3LT9 A;  3JUO A;  5AYR B;  3J7Y d;  1W02 A;  1JKG B;  3VSY A;  1AVK A;  4I4K A;  3PYJ A;  3QRD A;  3EBY A;  3HK4 A;  2MC8 A;  3UL6 A;  3FZW A;  4AKY A;  4MMX B;  5EEO A;  2YFJ B;  5IG0 A;  1Q86 4;  1A90 A;  3D3L A;  3MYT A;  3S67 A;  2Z7A A;  4FMC A;  4HM0 B;  4KFD A;  1KWI A;  5JPU A;  4X2H A;  4QWT A;  3DGN A;  1PU4 A;  3GWR A;  4KFF A;  2QIY A;  3CC2 3;  2C11 A;  1JJ2 2;  3OWY A;  1WMN A;  3B8L A;  3FKA A;  3EQQ B;  3JVC A;  3S27 A;  4ZM8 A;  5BVB A;  3PXM A;  4XM4 A;  3PGB A;  1AR0 A;  1IK3 A;  1GY5 A;  1IV7 A;  1PFP A;  3IMA B;  1FGO A;  2RGQ A;  1O7W B;  3OV4 A;  1YIJ 3;  3H3H A;  3PZW A;  4AEQ A;  1ASK A;  5DRV A;  1IQY A;  4U13 A;  1ZX2 A;  3S28 A;  1RN7 A;  4FR9 A;  3FF2 A;  3GRD A;  3K9M C;  4BTY A;  5ELJ A;  1VQL 3;  2OOV C;  3UL5 A;  2JQ5 A;  3LTC A;  3SVA A;  4EYC A;  2BNG A;  5JPP A;  1KQS 2;  1W4N A;  2CW9 A;  3CXC 2;  1KD1 4;  2B1X B;  4LEH A;  5STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...