4XBXA

Crystal structure of the l74f/m78f/l103v/l114v/i116v/f139v/l147v mutant of leh
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
149
structure length
149
Chain Sequence
HHTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFTVFSIDAVETFHIGSSNGLVYTERVDVVRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREVEEAVDLPVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Reshaping an Enzyme Binding Pocket for Enhanced and Inverted Stereoselectivity: Use of Smallest Amino Acid Alphabets in Directed Evolution
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 44
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4xbxA00
5IEOA 2B1XB 1OHSA 4HVNA 4XDWA 1QMAA 3MYTA 3NBRA 4WYKA 3D9RA 1W00A 2HMLB 2UX0A 3BB9A 1OF5A 4HM3B 1GY5A 3CNMA 1EG9B 5DRVA 5IENA 3OWSA 1Q42A 4STDA 5FW5A 1CQSA 3GWRA 3F40A 3FKAA 3DMCA 1O7WB 1GY6A 4LEHA 1JB4A 2F99A 3FF0A 1E97A 3Q90A 2QGUA 3GZXB 1ULJB 3KKGA 5JPUA 5AIIA 3NM2A 4HM8B 1AR0A 2BMQB 1JN5A 2CKFB 5STDA 4J8TA 3EQQB 5IEPA 1VZZA 1W01A 3EX9A 1NWWA 1ZO2A 2GEYA 1HKXA 3FSDA 1WQLB 4Q53A 1E3RA 3UJMA 4HM4B 3T8NA 3OV4A 3LYGA 3GZYB 1QJGA 4LGQA 3G0KA 2F86B 5D82A 1OCVA 5AEWB 3G16A 2OWPA 4XBTA 4IIAA 3DUKA 3GRDA 5D81A 4X2HA 5AEUB 3B8LA 3ROBA 3EJVA 1NU3A 3LZAA 4OVMA 4HM1B 3GZBA 3MSOA 3DXOA 3HZPA 4HM2B 3WMDA 4HJLB 1UUWB 1JB2A 1JKGB 5HGRA 3RGAA 3MG1A 1GY7A 4J9AA 4H3UA 3FLJA 1O7MB 2GEXA 2INXA 4HM5B 4XBXA 2GBXB 5G2GA 1O7GB 4OUQA 4L8PA 1GS3A 5IG4A 4GB5A 4U13A 3F14A 4HM7B 5CK6A 5TGNA 1IDPA 5DREA 2HMOB 2BMRB 5KP1A 3OWUA 2RCDA 5D83A 1A2KA 1O7HB 2JQ5A 3STDA 1W02A 4RZMA 4KVHA 5KP3A 4L8OA 3OXAA 3KSPA 3MG2A 3CNXA 1TUHA 3EC9A 3JUOA 1OH0A 2XSOB 1DMQA 3MKIA 5EVHA 3NUVA 5JPPA 3B4OA 2R4IA 2QIYA 1STDA 3T8UA 3JUNA 3FF2A 1OHOA 1UUVB 2STDA 1JB5A 1Q40B 2HMJB 3FZWA 3JUPA 1O7NB 1SJWA 4K1UA 2RGQA 3ECFA 4X2OA 3F8XA 3FGYA 3NV0B 3BLZA 1ZX2A 2I9WA 4WP5A 1DMMA 1OHPA 2RFRA 1K41A 1ISKA 3H51A 3EN8A 3KZTA 1OGZA 1OPYA 4MJDA 3CU3A 5CF1A 4HZBB 2BMOB 2PZVA 5AI1A 7STDA 5IERA 3SEDA 5IG5A 4HM6B 2XR8B 2Z77A 4HKVB 5IG0A 3EN1B 3GZRA 2HMMB 3DM8A 4HZ9B 3VGNA 3EF8A 3E99A 3EBYA 1OGXA 4R9LA 3A76A 1U5OA 4PEJA 3IPTA 4WYKB 3F7SA 4ORLA 3OX9A 1GYBA 1JKGA 1S5AA 3F7XA 2XSHB 1OF5B 4R1KA 3SOAA 3B4PA 3VSYA 3EHCA 3F8HA 3HX8A 3DZLA 5AIGA 2Z7AA 3RGRA 5KP4A 3HK4A 5IF6A 1ULIB 4XM4A 2IMJA 3NXJA 2YFLB 1NDOB 3FH1A 4L7KA 3CPOA 1JN5B 5CLKA 4XBYA 4FCJA 8CHOA 3SOYA 1O7PB 1TP6A 4WWUC 3JUMA 4LMIA 3EBTA 2W2CA 2A15A 4K1VA 5BVBA 4XB5A 1E3VA 2HMKB 3UNLA 2GBWB 3NHXA 3JUQA 4I4KA 5AIFA 1Q40A 3OWYA 1W6YA 2F98A 4CDLA 3MG3A 1DMNA 2CHCA 2HMNB 4R9KA 3I0YA 2GXFA 3NV0A 3KE7A 4XDVA 1BUQA 3ER7A 2Z76A 5AIHA 2BNGA 3G8ZA 2B24B 3F9SA 3B7CA 4N3VA 3H3HA 6STDA 2YFIB 2K54A 3MHEA 3M8CA 1Z1SA 1C7HA 5BXQA 3K0ZA 2XRXB 5IG3A 5CF2A 3S5CA 1EA2A 4FCMA 2YFJB 1OUNA 5CXOA 1ASKA 4HM0B 3K7CA
chains in the Genus database with same CATH superfamily
2SARA 5IEOA 5G1KA 2FGTA 2B1XB 1YNVX 1I0XA 1OHSA 1TJDA 1GMQA 1RSNA 4HVNA 4XDWA 2BT3A 3K9MC 5FGOA 1QMAA 3PXMA 1SARA 3MYTA 4G1MB 3D5IA 3NBRA 4WYKA 4WHAA 2P38A 1W00A 3D9RA 3V99A 1KD14 2HMLB 1VQO3 2XFSA 3X3YA 2UX0A 3N9HA 3BB9A 1YHQ3 1OF5A 1VQM3 1NO3A 1IV7A 4HM3B 2W04A 2CG0A 1GY5A 1LVNA 4CCVA 1GMRA 1BNFA 1QAFA 3CD63 1UGIA 1W7CA 4O8SA 2IYJA 1FGRA 1SPUA 1GOUA 1KQS2 3CNMA 1EG9B 4MMZB 1MWTA 5DRVA 5IENA 3OWSA 1LNIA 2D42A 1IK3A 1Q42A 4STDA 5FW5A 1L5GB 5A0OB 5BIRA 1UI8A 1CQSA 3GWRA 5ELUA 2C10A 3F40A 3PGBA 3FKAA 2CW9A 1IVWA 2UGIA 3DMCA 2K3DA 1O7WB 1IQXA 1GY6A 1US1A 2CFLA 4LEHA 1NJI4 2YX9A 1JB4A 2F99A 3FF0A 1BVIA 1M9GA 1E97A 3Q90A 2H0GA 3BU4A 2QGUA 1A2VA 3GZXB 1ULJB 3KKGA 1B2ZA 5JPUA 1WMNA 5AIIA 4AEQA 2MF7A 3G6E3 3NM2A 1DVDA 2GU1A 2L4VA 4HM8B 1M1K4 1AR0A 3D3LA 3CXC2 2BMQB 2XF3A 1I2EA 3PZWA 1K9M4 2W56B 1JN5A 3DGLA 3ZG5A 2CKFB 4QWTA 2P05A 5STDA 4RBNA 3DY5A 4J8TA 3EQQB 3I563 1BNIA 2ZDJA 1RGFA 2F4YA 1CYVA 1RN7A 1IQ8A 1RN1A 3S28A 1HYFA 3Q2PA 3WOFB 1B2UA 4CJNA 5IEPA 1VZZA 1GD4A 1W01A 3EX9A 5AYRB 1NWWA 1PY3A 1ZO2A 4MMYB 1SIIA 2GEYA 3DH2A 1HKXA 3FSDA 1G96A 1WQLB 1W5ZA 3Q1CA 4Q53A 1E3RA 4N6V0 1BUJA 3UJMA 1IV9A 1Y4KA 2CFGA 1D6YA 4HM4B 4DKIA 1HU9A 2LYXA 4BU4A 5HOHA 3T8NA 1STFI 3S67A 3OV4A 3X3ZA 2OOVA 1BAOA 1MOLA 1ZS7A 5IW9A 1B2MA 3OW22 3LYGA 1LRAA 1VQQA 1RGAA 1UW1A 3TDGA 3CC73 3GZYB 1QJGA 2F5WA 1UCJA 4LGQA 2O9UX 4BL2A 3G0KA 3LT8A 1LOVA 1NNVA 2F86B 5D82A 2P09A 1Q824 1VQ63 2IY2A 1OCVA 2BU4A 3G16A 2KRTA 2OWPA 4KFEA 4XBTA 5AEWB 4BTWA 1RNTA 4IIAA 4IPBA 3UB1A 3DUKA 4N6OB 3CC43 3AHSA 3AMOA 1TRQA 4HYZA 3GRDA 4X2HA 5D81A 5M19A 2W0QA 3BNDA 5AEUB 3B8LA 1FGTA 5EQLA 5AYSC 1TFKA 1J2BA 1LOXA 2PNCA 3ROBA 4EV5A 3EJVA 1NU3A 3GSPA 3KIIA 3LZAA 4OVMA 1MNLA 2KF3A 4R80A 2OTL3 1MGWA 1W2ZA 1QVF2 3KFQC 4HM1B 2XGNA 1F8NA 3GZBA 3MSOA 4GSPA 3DXOA 3HZPA 4HM2B 2CG1A 1BGSA 1Q814 1VQ83 2W9PA 1EEJA 3NQZA 4J5GA 3LMLA 1B27A 2UUGC 1MWRA 3WMDA 8RNTA 3I553 1BRHA 4HJLB 1B2SA 3D79A 4RNZA 3URPA 3CCR3 3WR2A 1UUWB 1JB2A 1N8QA 4IT7A 1S723 1KWIA 1BRIA 1JKGB 1WNHA 4KFDA 5HGRA 3RGAA 2IUJA 1RGHA 1V74A 3MG1A 4N6UA 3WA2X 1BANA 1GY7A 4J9AA 4H3UA 1VQ73 3FLJA 2BHMA 1LQGC 1O7MB 1SQWA 2GEXA 4RNTA 2INXA 5JBSA 2D1WA 1YVBI 3HOHA 4N6NB 4HM5B 3IMAB 1TU5A 1WMOA 1W4NA 2XH9A 4XBXA 1JZDA 2OQEA 1BNJA 2GBXB 5G2GA 1O7GB 3KSED 1CYUA 2KCDA 1RDSA 1UGHI 4OUQA 4O2HA 1QVG2 4L8PA 3V98A 2Y74A 1FZUA 3LTCA 1GS3A 1YJ93 5IG4A 4KT3B 1SIHA 4NHFA 1FA3A 4AKYA 3UL6A 1JZOA 1VQ93 4GB5A 1RLSA 1V58A 4AKZA 1YIJ3 4U13A 3F14A 4HM7B 5CK6A 2WGQA 1RTUA 2F5MA 2AAEA 5TGNA 3CCV3 1I3IA 1IDPA 2KAAA 2HMOB 2XGLA 3EE1A 5DREA 2BMRB 3ZG0A 5M18A 1UCLA 3HIGA 5KP1A 1Q9EA 3OWUA 4H61A 1FGMA 5GSPA 1RGGA 2OTJ3 1M904 2E2TA 2RCDA 1X1WA 3AGNA 5D83A 3X3XA 1A2KA 1I2FA 2LQVA 1O7HB 2CFDA 4FMAA 2JQ5A 2R41A 3STDA 1W02A 1RNBA 1UUGB 1W2B2 2JDIH 4RZMA 1N5HA 4KVHA 1MGRA 5KP3A 2QEX3 3J7Yd 1VQ53 3QK9A 1A90A 4N6TA 2C4BA 4GHOA 2P0XA 4L8OA 3T0UA 3OXAA 3WHOA 1T2HA 2F56A 1R4YA 5BU4A 1LOWA 1BNSA 1RCKA 3KN4A 3KSPA 1LOYA 2O3OA 4FR9A 4EW5A 1YIT3 3MG2A 3CNXA 2K0MA 1TUHA 3EC9A 3JUOA 4EC6A 1BOXA 3SLUA 1OH0A 3NBJA 3CCU3 2W56A 2XSOB 1I8VA 1EKMA 1X1UA 3D5GA 1DMQA 1X1YA 3MKIA 5EVHA 2BO9B 2OCTA 2Z6BA 3NUVA 2HOHA 5JPPA 1VQP3 1R4CA 3B4OA 1FUSA 3LTAA 3MPHA 1VQL3 1AV4A 4EBGA 1ROAA 2GU3A 1GMPA 1A2PA 2R4IA 3G713 4I5QA 3S29A 1OACA 3BNCA 1STDA 2QIYA 3PYJA 3X42A 1JBSA 1IT8A 2V1LA 3T8UA 1JBRA 1N9EA 3JUNA 2L1SA 2CC3A 1D6UA 1HZ1A 1OHOA 1UUVB 2STDA 1UCKA 1JB5A 1Q40B 3FF2A 2CWTA 2HMJB 2KXGA 3FZWA 2W6JH 3JUPA 1O7NB 2XEPA 1SJWA 4K1UA 5ELJA 2RGQA 3ECFA 4X2OA 3F8XA 3FGYA 3NV0B 1RGKA 3BLZA 1JBTA 1BIRA 2CWUA 4BL3A 3SVAA 1ZX2A 1I3FA 2I9WA 3CCM3 4WP5A 1DMMA 4ZM8A 1OHPA 2RFRA 1K41A 4LZIA 6RNTA 7RNTA 1ISKA 1BSCA 3H51A 1AQZA 1WTHA 3EN8A 3KZTA 3L0RA 3K5TA 3DGMA 3N54B 1VQK3 1OGZA 1YVSA 1EUIC 1OPYA 4MJDA 1YI23 2AADA 3CU3A 1BRJA 5CF1A 1GOVA 2BMOB 4HZBB 5G1LA 1BSBA 2CFKA 3FG4A 2PZVA 5AI1A 1YJN3 3K63A 4K61A 4MEIA 7STDA 3LOYA 1B20A 2KF4A 1DVCA 5IERA 3SEDA 5IG5A 3CPW2 1BU4A 4HM6B 4R4KA 2CWVA 1TIJA 1B3SA 1WMPA 3X41A 1DYUA 4TX4A 1N5PA 2XR8B 1IQYA 2Z77A 4HKVB 3SXXA 3LXUX 5IG0A 2CH9A 1BSDA 3EN1B 3GZRA 2HMMB 1RGLA 3DM8A 1BNGA 4HZ9B 4KZ1A 2J8XB 3VGNA 3WA3A 3EF8A 1U8CB 3A5EA 3KCHA 3DGYA 3SYUA 1AVKA 1YJW3 3CME3 1RGCA 3FCSB 3E99A 3EBYA 3PCSA 1BNEA 1KSIA 4LSOA 1OGXA 4R9LA 3DGOA 1RJOA 4O3VA 3A76A 1U5OA 4PEJA 1T5YA 3D4AA 4HAAA 2ML6A 2RBIA 3IPTA 1X1XA 3F7SA 4FMBA 3LTBA 4WYKB 6GSPA 3AGOA 4ORLA 1NB3I 3OX9A 1GYBA 1JKGA 1S5AA 3F7XA 2XSHB 2ZA4A 4J5KA 1OF5B 4NREA 1FYSA 2IA7A 3U97A 4R1KA 4ILFA 1MWSA 3SOAA 1FUTA 1RHLA 3B4PA 1FGOA 3VSYA 1IVVA 3VF1A 1TFOA 1BRNL 3EHCA 2W03A 1JNQA 3F8HA 3HX8A 3QRDA 2CX0A 1FUWA 1LQMB 3BNEA 1W6CA 3DZLA 4KFFA 5AIGA 4CPKA 3FG1A 2Z7AA 1FW7A 2CX1A 3RGRA 1UI7A 2CFWA 3BIRA 5KP4A 4OK0A 3LT9A 2W9QA 1TTOA 3ZFZA 3HK4A 1QAKA 4MMXB 1BSEA 1YGWA 3LH4A 1ZGXA 1K734 1UDII 1NB5I 5IF6A 1IU7A 3CCL3 1ULIB 4XM4A 1RKYA 2IMJA 2WGOA 1I0VA 1LNHA 3NXJA 1BRSA 2YFLB 1IT7A 3WOEB 1NDOB 4N6LA 3FH1A 4L7KA 3CPOA 3RNTA 1N9JA 2OOVC 1IYYA 2WOFA 1RRLA 4LYLB 3CCE3 1JN5B 3NQYA 1V57A 5CLKA 3NBBA 4XBYA 4FCJA 3X40A 8CHOA 1RCLA 3SOYA 3CCQ3 2CIUA 2E2UA 4WFOA 9RNTA 1UCIA 1YGEA 1PFPA 1O7PB 3FG3A 1TRPA 3WDGB 1TP6A 4WWUC 1PU4A 1RMSA 1K28A 1RRHA 3G4S3 1T2IA 3JUMA 2H0HA 2FNQA 4HBRA 4LMIA 1BRGA 2RNTA 2Y73A 4NPBA 5EEOA 1VQ43 2KF6A 3CCS3 3EBTA 1C54A 2CK3H 3O8YA 2QA43 4FMDA 2W2CA 4JF8A 1BSAA 2A15A 4K1VA 5BVBA 4K90B 4XB5A 1E3VA 1M1XB 2P0MA 2HMKB 1RN4A 3LTDA 3PCRA 3UL5A 3HIIA 3UNLA 1QALA 4BTXA 2GBWB 4N6MA 2H0IA 3NHXA 1Q7Y4 1DETA 1ROVA 2SBLA 3JUQA 4I4KA 1LXEA 5AIFA 5I97A 1Q40A 4BTYA 3OWYA 2MC8A 1JRQA 2C11A 5RNTA 3Q3FA 1W6YA 2F98A 3HI7A 3PS8A 4CDLA 3MG3A 2BIRA 2RSXA 1MWUA 2WO0A 1DMNA 2CHCA 2HMNB 4R9KA 1EQKA 3CC23 3I0YA 1GD3A 2GXFA 3NV0A 3KE7A 2XFTA 3AMOB 3IJEB 1Q7HA 4FCZA 1B2XA 1BRKA 1I2GA 1IVXA 3WODG 3AHWA 3BNBA 3DGNA 3JVCA 3NM7A 3NX0A 4HOHA 3GAXA 4O02B 4XDVA 3V92A 1BUQA 3ER7A 3MWZA 1DE3A 2Z76A 5LC7A 1KC84 1AVLA 2ML5A 1GSPA 5AIHA 2M7OA 4BIRA 2BNGA 7GSPA 3G8ZA 1G02A 2B24B 1D6ZA 4EYCA 3F9SA 3SX1A 3B7CA 4N3VA 3S27A 1Q864 1GOYA 5M1AA 2WOHA 1BNRA 1B21A 2OQEC 3H3HA 6STDA 2YFIB 2K54A 1T3BA 1I70A 1AY7A 1JJ22 3CMA3 1FGQA 4EXRA 3MHEA 3M8CA 1G0TA 1Z1SA 1PYLA 3ALAA 2E2VA 2ZL8A 1C7HA 3EB8A 1CH0A 5BXQA 3K0ZA 3CCJ3 2KF5A 1RGEA 2Q07A 2XRXB 3RDEA 5IG3A 1K8A4 5CF2A 1A67A 1W6GA 3S5CA 1EA2A 2ZHXB 4FCMA 2GSPA 1CEWI 5LC6A 3U1WA 1JV2B 2YFJB 1OUNA 5CXOA 1N8R4 2IUKA 4JRFA 1ASKA 4RNYA 1IVUA 2FXTA 3N8BA 4FMCA 4HM0B 1VQN3 3K7CA 4GL6A 4EV2A
chains in the Genus database with same CATH topology
5IEOA 2FGTA 2B1XB 1OHSA 4HVNA 4XDWA 2BT3A 3K9MC 5FGOA 1QMAA 3PXMA 3MYTA 4G1MB 3NBRA 4WHAA 4WYKA 2P38A 1W00A 3D9RA 3V99A 1KD14 2HMLB 1VQO3 2XFSA 3X3YA 2UX0A 3N9HA 3BB9A 1YHQ3 1OF5A 1VQM3 1NO3A 1IV7A 4HM3B 2W04A 2CG0A 1GY5A 1LVNA 4CCVA 1QAFA 3CD63 1W7CA 4O8SA 1FGRA 1SPUA 1KQS2 3CNMA 1EG9B 4MMZB 5DRVA 5IENA 3OWSA 2D42A 1IK3A 1Q42A 4STDA 5FW5A 1L5GB 5A0OB 1UI8A 1CQSA 3GWRA 5ELUA 2C10A 3F40A 3PGBA 3FKAA 2CW9A 1IVWA 3DMCA 1O7WB 1IQXA 1GY6A 1US1A 2CFLA 4LEHA 1NJI4 2YX9A 1JB4A 2F99A 3FF0A 1M9GA 1E97A 3Q90A 2QGUA 1A2VA 3GZXB 1ULJB 3KKGA 5JPUA 1DVDA 1WMNA 5AIIA 4AEQA 2MF7A 3G6E3 3NM2A 2GU1A 2L4VA 4HM8B 1M1K4 1AR0A 3D3LA 3CXC2 2BMQB 2XF3A 3PZWA 1K9M4 2W56B 1JN5A 3DGLA 2CKFB 4QWTA 2P05A 5STDA 4RBNA 3DY5A 4J8TA 3EQQB 3I563 2ZDJA 1CYVA 1RN7A 1IQ8A 3S28A 3Q2PA 3WOFB 5IEPA 1VZZA 1GD4A 1W01A 3EX9A 5AYRB 1NWWA 4MMYB 1ZO2A 1SIIA 2GEYA 1HKXA 3FSDA 1G96A 1WQLB 1W5ZA 3Q1CA 4Q53A 1E3RA 4N6V0 3UJMA 1IV9A 1Y4KA 2CFGA 1D6YA 4HM4B 1HU9A 2LYXA 3T8NA 1STFI 3S67A 3OV4A 2OOVA 1MOLA 5IW9A 3OW22 3LYGA 1UW1A 3TDGA 3CC73 3GZYB 1QJGA 4LGQA 2O9UX 3G0KA 3LT8A 2F86B 5D82A 2P09A 1Q824 1VQ63 1OCVA 4KFEA 3G16A 2KRTA 2OWPA 4XBTA 5AEWB 4BTWA 4IPBA 4IIAA 3UB1A 3DUKA 4N6OB 3CC43 3AMOA 4HYZA 3GRDA 4X2HA 5D81A 2W0QA 3BNDA 5AEUB 3B8LA 1FGTA 5EQLA 5AYSC 1TFKA 1J2BA 1LOXA 2PNCA 3ROBA 4EV5A 3EJVA 1NU3A 3KIIA 3LZAA 4OVMA 1MNLA 4R80A 2OTL3 1W2ZA 1QVF2 3KFQC 4HM1B 2XGNA 1F8NA 3GZBA 3MSOA 3DXOA 3HZPA 4HM2B 2CG1A 1Q814 1VQ83 2W9PA 3NQZA 3LMLA 3WMDA 3I553 4HJLB 4RNZA 3CCR3 1UUWB 1JB2A 1N8QA 4IT7A 1S723 1KWIA 1JKGB 1WNHA 4KFDA 5HGRA 3RGAA 2IUJA 1V74A 3MG1A 4N6UA 3WA2X 1GY7A 4J9AA 4H3UA 1VQ73 3FLJA 2BHMA 1O7MB 1SQWA 2GEXA 5JBSA 2INXA 2D1WA 1YVBI 4N6NB 4HM5B 3IMAB 1TU5A 1WMOA 1W4NA 2XH9A 4XBXA 2OQEA 2GBXB 5G2GA 1O7GB 3KSED 1CYUA 2KCDA 4OUQA 4O2HA 1QVG2 4L8PA 3V98A 2Y74A 3LTCA 1GS3A 1YJ93 5IG4A 1SIHA 4NHFA 1FA3A 4AKYA 3UL6A 1VQ93 4GB5A 4AKZA 1YIJ3 4U13A 3F14A 4HM7B 5CK6A 2WGQA 5TGNA 3CCV3 2XGLA 1IDPA 3EE1A 2HMOB 5DREA 2BMRB 3HIGA 5KP1A 3OWUA 4H61A 1FGMA 2OTJ3 1M904 2E2TA 2RCDA 5D83A 3X3XA 1A2KA 2LQVA 1O7HB 2CFDA 4FMAA 2JQ5A 3STDA 1W02A 1W2B2 2JDIH 4RZMA 1N5HA 4KVHA 5KP3A 2QEX3 3J7Yd 1VQ53 3QK9A 1A90A 4N6TA 4L8OA 2P0XA 3T0UA 3OXAA 3KSPA 3KN4A 2O3OA 4FR9A 1YIT3 3MG2A 3CNXA 2K0MA 1TUHA 3EC9A 3JUOA 3SLUA 1OH0A 3NBJA 3CCU3 2W56A 2XSOB 1EKMA 1DMQA 3MKIA 5EVHA 2BO9B 2OCTA 2Z6BA 3NUVA 5JPPA 1VQP3 1VQL3 1R4CA 3B4OA 3LTAA 3MPHA 1AV4A 4EBGA 1ROAA 2GU3A 2R4IA 3G713 3S29A 1OACA 3BNCA 2QIYA 1STDA 3PYJA 3X42A 1IT8A 2V1LA 3T8UA 1N9EA 3JUNA 2CC3A 1D6UA 1OHOA 1UUVB 2STDA 3FF2A 4EC6A 1JB5A 1Q40B 2CWTA 2HMJB 2KXGA 3FZWA 2W6JH 3JUPA 1O7NB 2XEPA 1SJWA 4K1UA 5ELJA 2RGQA 3ECFA 4X2OA 3F8XA 3FGYA 3NV0B 3BLZA 2CWUA 3SVAA 1ZX2A 2I9WA 3CCM3 4WP5A 1DMMA 4ZM8A 1OHPA 2RFRA 1K41A 4LZIA 1ISKA 3H51A 1WTHA 3EN8A 3KZTA 3L0RA 3K5TA 3DGMA 3N54B 1VQK3 1OGZA 1YI23 1OPYA 4MJDA 3CU3A 5CF1A 4HZBB 2BMOB 2CFKA 3FG4A 2PZVA 5AI1A 1YJN3 3K63A 4K61A 4MEIA 7STDA 3LOYA 1DVCA 5IERA 3SEDA 5IG5A 3CPW2 4HM6B 4R4KA 2CWVA 1TIJA 1WMPA 3X41A 1DYUA 4TX4A 1N5PA 2XR8B 1IQYA 2Z77A 4HKVB 3SXXA 3LXUX 5IG0A 2CH9A 3EN1B 3GZRA 2HMMB 3DM8A 4HZ9B 4KZ1A 3VGNA 3WA3A 3EF8A 1U8CB 1YJW3 1AVKA 3CME3 3FCSB 3E99A 3EBYA 3PCSA 1KSIA 4LSOA 1OGXA 4R9LA 3DGOA 1RJOA 4O3VA 3A76A 1U5OA 4PEJA 1T5YA 3X3ZA 2ML6A 3IPTA 4FMBA 4WYKB 3F7SA 3LTBA 4ORLA 1NB3I 3OX9A 1GYBA 1JKGA 1S5AA 3F7XA 2XSHB 1OF5B 4NREA 2IA7A 3U97A 4R1KA 3SOAA 3B4PA 1FGOA 3VSYA 1IVVA 3VF1A 1TFOA 3EHCA 2W03A 1JNQA 3F8HA 3HX8A 3QRDA 1FUWA 3BNEA 3DZLA 1W6CA 4KFFA 5AIGA 3FG1A 2Z7AA 3RGRA 1UI7A 2CFWA 5KP4A 4OK0A 3LT9A 2W9QA 3HK4A 1QAKA 4MMXB 3LH4A 1K734 1NB5I 5IF6A 1IU7A 3CCL3 1ULIB 4XM4A 1RKYA 2WGOA 2IMJA 3NXJA 1LNHA 2YFLB 1IT7A 3WOEB 1NDOB 4N6LA 3FH1A 4L7KA 3CPOA 1N9JA 2OOVC 2WOFA 1RRLA 3CCE3 1JN5B 3NQYA 5CLKA 3NBBA 4XBYA 4FCJA 3X40A 8CHOA 3SOYA 3CCQ3 2CIUA 2E2UA 4WFOA 1YGEA 1PFPA 1O7PB 3FG3A 3WDGB 1TP6A 4WWUC 1PU4A 1K28A 1RRHA 3G4S3 3JUMA 2FNQA 4HBRA 4LMIA 2Y73A 5EEOA 1VQ43 3CCS3 3EBTA 2CK3H 3O8YA 2QA43 4FMDA 2W2CA 4JF8A 2A15A 4K1VA 5BVBA 4K90B 4XB5A 1E3VA 1M1XB 2P0MA 2HMKB 3LTDA 3PCRA 3UL5A 3HIIA 3UNLA 1QALA 4BTXA 2GBWB 4N6MA 3NHXA 1Q7Y4 1ROVA 2SBLA 3JUQA 4I4KA 1LXEA 5AIFA 5I97A 1Q40A 4BTYA 3OWYA 2MC8A 1JRQA 2C11A 1W6YA 2F98A 3HI7A 3PS8A 4CDLA 3MG3A 2RSXA 2WO0A 1DMNA 2CHCA 2HMNB 4R9KA 1EQKA 3CC23 3I0YA 1GD3A 2GXFA 3NV0A 3KE7A 2XFTA 3AMOB 3IJEB 4FCZA 1IVXA 3WODG 3BNBA 3DGNA 3JVCA 3NM7A 3NX0A 4XDVA 3GAXA 4O02B 3V92A 1BUQA 3ER7A 3MWZA 2Z76A 5LC7A 1KC84 1AVLA 2ML5A 5AIHA 2M7OA 2BNGA 3G8ZA 2B24B 1D6ZA 4EYCA 3F9SA 3SX1A 3B7CA 4N3VA 3S27A 1Q864 2WOHA 3H3HA 2OQEC 6STDA 2YFIB 2K54A 1JJ22 3CMA3 1FGQA 4EXRA 3MHEA 3M8CA 1Z1SA 3ALAA 2E2VA 2ZL8A 1C7HA 3EB8A 5BXQA 3K0ZA 3CCJ3 2Q07A 2XRXB 3RDEA 5IG3A 1K8A4 5CF2A 1A67A 1W6GA 3S5CA 1EA2A 4FCMA 1CEWI 5LC6A 3U1WA 1JV2B 2YFJB 1OUNA 5CXOA 1N8R4 2IUKA 4JRFA 1ASKA 4RNYA 1IVUA 2FXTA 3N8BA 4FMCA 4HM0B 1VQN3 3K7CA 4GL6A 4EV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IEO A;  2B1X B;  1OHS A;  4HVN A;  4XDW A;  1QMA A;  3MYT A;  3NBR A;  4WYK A;  3D9R A;  1W00 A;  2HML B;  2UX0 A;  3BB9 A;  1OF5 A;  4HM3 B;  1GY5 A;  3CNM A;  1EG9 B;  5DRV A;  5IEN A;  3OWS A;  1Q42 A;  4STD A;  5FW5 A;  1CQS A;  3GWR A;  3F40 A;  3FKA A;  3DMC A;  1O7W B;  1GY6 A;  4LEH A;  1JB4 A;  2F99 A;  3FF0 A;  1E97 A;  3Q90 A;  2QGU A;  3GZX B;  1ULJ B;  3KKG A;  5JPU A;  5AII A;  3NM2 A;  4HM8 B;  1AR0 A;  2BMQ B;  1JN5 A;  2CKF B;  5STD A;  4J8T A;  3EQQ B;  5IEP A;  1VZZ A;  1W01 A;  3EX9 A;  1NWW A;  1ZO2 A;  2GEY A;  1HKX A;  3FSD A;  1WQL B;  4Q53 A;  1E3R A;  3UJM A;  4HM4 B;  3T8N A;  3OV4 A;  3LYG A;  3GZY B;  1QJG A;  4LGQ A;  3G0K A;  2F86 B;  5D82 A;  1OCV A;  5AEW B;  3G16 A;  2OWP A;  4XBT A;  4IIA A;  3DUK A;  3GRD A;  5D81 A;  4X2H A;  5AEU B;  3B8L A;  3ROB A;  3EJV A;  1NU3 A;  3LZA A;  4OVM A;  4HM1 B;  3GZB A;  3MSO A;  3DXO A;  3HZP A;  4HM2 B;  3WMD A;  4HJL B;  1UUW B;  1JB2 A;  1JKG B;  5HGR A;  3RGA A;  3MG1 A;  1GY7 A;  4J9A A;  4H3U A;  3FLJ A;  1O7M B;  2GEX A;  2INX A;  4HM5 B;  4XBX A;  2GBX B;  5G2G A;  1O7G B;  4OUQ A;  4L8P A;  1GS3 A;  5IG4 A;  4GB5 A;  4U13 A;  3F14 A;  4HM7 B;  5CK6 A;  5TGN A;  1IDP A;  5DRE A;  2HMO B;  2BMR B;  5KP1 A;  3OWU A;  2RCD A;  5D83 A;  1A2K A;  1O7H B;  2JQ5 A;  3STD A;  1W02 A;  4RZM A;  4KVH A;  5KP3 A;  4L8O A;  3OXA A;  3KSP A;  3MG2 A;  3CNX A;  1TUH A;  3EC9 A;  3JUO A;  1OH0 A;  2XSO B;  1DMQ A;  3MKI A;  5EVH A;  3NUV A;  5JPP A;  3B4O A;  2R4I A;  2QIY A;  1STD A;  3T8U A;  3JUN A;  3FF2 A;  1OHO A;  1UUV B;  2STD A;  1JB5 A;  1Q40 B;  2HMJ B;  3FZW A;  3JUP A;  1O7N B;  1SJW A;  4K1U A;  2RGQ A;  3ECF A;  4X2O A;  3F8X A;  3FGY A;  3NV0 B;  3BLZ A;  1ZX2 A;  2I9W A;  4WP5 A;  1DMM A;  1OHP A;  2RFR A;  1K41 A;  1ISK A;  3H51 A;  3EN8 A;  3KZT A;  1OGZ A;  1OPY A;  4MJD A;  3CU3 A;  5CF1 A;  4HZB B;  2BMO B;  2PZV A;  5AI1 A;  7STD A;  5IER A;  3SED A;  5IG5 A;  4HM6 B;  2XR8 B;  2Z77 A;  4HKV B;  5IG0 A;  3EN1 B;  3GZR A;  2HMM B;  3DM8 A;  4HZ9 B;  3VGN A;  3EF8 A;  3E99 A;  3EBY A;  1OGX A;  4R9L A;  3A76 A;  1U5O A;  4PEJ A;  3IPT A;  4WYK B;  3F7S A;  4ORL A;  3OX9 A;  1GYB A;  1JKG A;  1S5A A;  3F7X A;  2XSH B;  1OF5 B;  4R1K A;  3SOA A;  3B4P A;  3VSY A;  3EHC A;  3F8H A;  3HX8 A;  3DZL A;  5AIG A;  2Z7A A;  3RGR A;  5KP4 A;  3HK4 A;  5IF6 A;  1ULI B;  4XM4 A;  2IMJ A;  3NXJ A;  2YFL B;  1NDO B;  3FH1 A;  4L7K A;  3CPO A;  1JN5 B;  5CLK A;  4XBY A;  4FCJ A;  8CHO A;  3SOY A;  1O7P B;  1TP6 A;  4WWU C;  3JUM A;  4LMI A;  3EBT A;  2W2C A;  2A15 A;  4K1V A;  5BVB A;  4XB5 A;  1E3V A;  2HMK B;  3UNL A;  2GBW B;  3NHX A;  3JUQ A;  4I4K A;  5AIF A;  1Q40 A;  3OWY A;  1W6Y A;  2F98 A;  4CDL A;  3MG3 A;  1DMN A;  2CHC A;  2HMN B;  4R9K A;  3I0Y A;  2GXF A;  3NV0 A;  3KE7 A;  4XDV A;  1BUQ A;  3ER7 A;  2Z76 A;  5AIH A;  2BNG A;  3G8Z A;  2B24 B;  3F9S A;  3B7C A;  4N3V A;  3H3H A;  6STD A;  2YFI B;  2K54 A;  3MHE A;  3M8C A;  1Z1S A;  1C7H A;  5BXQ A;  3K0Z A;  2XRX B;  5IG3 A;  5CF2 A;  3S5C A;  1EA2 A;  4FCM A;  2YFJ B;  1OUN A;  5CXO A;  1ASK A;  4HM0 B;  3K7C A; 
#chains in the Genus database with same CATH topology
 2SAR A;  5IEO A;  5G1K A;  2FGT A;  2B1X B;  1YNV X;  1I0X A;  1OHS A;  1TJD A;  1GMQ A;  1RSN A;  4HVN A;  4XDW A;  2BT3 A;  3K9M C;  5FGO A;  1QMA A;  3PXM A;  1SAR A;  3MYT A;  4G1M B;  3D5I A;  3NBR A;  4WYK A;  4WHA A;  2P38 A;  1W00 A;  3D9R A;  3V99 A;  1KD1 4;  2HML B;  1VQO 3;  2XFS A;  3X3Y A;  2UX0 A;  3N9H A;  3BB9 A;  1YHQ 3;  1OF5 A;  1VQM 3;  1NO3 A;  1IV7 A;  4HM3 B;  2W04 A;  2CG0 A;  1GY5 A;  1LVN A;  4CCV A;  1GMR A;  1BNF A;  1QAF A;  3CD6 3;  1UGI A;  1W7C A;  4O8S A;  2IYJ A;  1FGR A;  1SPU A;  1GOU A;  1KQS 2;  3CNM A;  1EG9 B;  4MMZ B;  1MWT A;  5DRV A;  5IEN A;  3OWS A;  1LNI A;  2D42 A;  1IK3 A;  1Q42 A;  4STD A;  5FW5 A;  1L5G B;  5A0O B;  5BIR A;  1UI8 A;  1CQS A;  3GWR A;  5ELU A;  2C10 A;  3F40 A;  3PGB A;  3FKA A;  2CW9 A;  1IVW A;  2UGI A;  3DMC A;  2K3D A;  1O7W B;  1IQX A;  1GY6 A;  1US1 A;  2CFL A;  4LEH A;  1NJI 4;  2YX9 A;  1JB4 A;  2F99 A;  3FF0 A;  1BVI A;  1M9G A;  1E97 A;  3Q90 A;  2H0G A;  3BU4 A;  2QGU A;  1A2V A;  3GZX B;  1ULJ B;  3KKG A;  1B2Z A;  5JPU A;  1WMN A;  5AII A;  4AEQ A;  2MF7 A;  3G6E 3;  3NM2 A;  1DVD A;  2GU1 A;  2L4V A;  4HM8 B;  1M1K 4;  1AR0 A;  3D3L A;  3CXC 2;  2BMQ B;  2XF3 A;  1I2E A;  3PZW A;  1K9M 4;  2W56 B;  1JN5 A;  3DGL A;  3ZG5 A;  2CKF B;  4QWT A;  2P05 A;  5STD A;  4RBN A;  3DY5 A;  4J8T A;  3EQQ B;  3I56 3;  1BNI A;  2ZDJ A;  1RGF A;  2F4Y A;  1CYV A;  1RN7 A;  1IQ8 A;  1RN1 A;  3S28 A;  1HYF A;  3Q2P A;  3WOF B;  1B2U A;  4CJN A;  5IEP A;  1VZZ A;  1GD4 A;  1W01 A;  3EX9 A;  5AYR B;  1NWW A;  1PY3 A;  1ZO2 A;  4MMY B;  1SII A;  2GEY A;  3DH2 A;  1HKX A;  3FSD A;  1G96 A;  1WQL B;  1W5Z A;  3Q1C A;  4Q53 A;  1E3R A;  4N6V 0;  1BUJ A;  3UJM A;  1IV9 A;  1Y4K A;  2CFG A;  1D6Y A;  4HM4 B;  4DKI A;  1HU9 A;  2LYX A;  4BU4 A;  5HOH A;  3T8N A;  1STF I;  3S67 A;  3OV4 A;  3X3Z A;  2OOV A;  1BAO A;  1MOL A;  1ZS7 A;  5IW9 A;  1B2M A;  3OW2 2;  3LYG A;  1LRA A;  1VQQ A;  1RGA A;  1UW1 A;  3TDG A;  3CC7 3;  3GZY B;  1QJG A;  2F5W A;  1UCJ A;  4LGQ A;  2O9U X;  4BL2 A;  3G0K A;  3LT8 A;  1LOV A;  1NNV A;  2F86 B;  5D82 A;  2P09 A;  1Q82 4;  1VQ6 3;  2IY2 A;  1OCV A;  2BU4 A;  3G16 A;  2KRT A;  2OWP A;  4KFE A;  4XBT A;  5AEW B;  4BTW A;  1RNT A;  4IIA A;  4IPB A;  3UB1 A;  3DUK A;  4N6O B;  3CC4 3;  3AHS A;  3AMO A;  1TRQ A;  4HYZ A;  3GRD A;  4X2H A;  5D81 A;  5M19 A;  2W0Q A;  3BND A;  5AEU B;  3B8L A;  1FGT A;  5EQL A;  5AYS C;  1TFK A;  1J2B A;  1LOX A;  2PNC A;  3ROB A;  4EV5 A;  3EJV A;  1NU3 A;  3GSP A;  3KII A;  3LZA A;  4OVM A;  1MNL A;  2KF3 A;  4R80 A;  2OTL 3;  1MGW A;  1W2Z A;  1QVF 2;  3KFQ C;  4HM1 B;  2XGN A;  1F8N A;  3GZB A;  3MSO A;  4GSP A;  3DXO A;  3HZP A;  4HM2 B;  2CG1 A;  1BGS A;  1Q81 4;  1VQ8 3;  2W9P A;  1EEJ A;  3NQZ A;  4J5G A;  3LML A;  1B27 A;  2UUG C;  1MWR A;  3WMD A;  8RNT A;  3I55 3;  1BRH A;  4HJL B;  1B2S A;  3D79 A;  4RNZ A;  3URP A;  3CCR 3;  3WR2 A;  1UUW B;  1JB2 A;  1N8Q A;  4IT7 A;  1S72 3;  1KWI A;  1BRI A;  1JKG B;  1WNH A;  4KFD A;  5HGR A;  3RGA A;  2IUJ A;  1RGH A;  1V74 A;  3MG1 A;  4N6U A;  3WA2 X;  1BAN A;  1GY7 A;  4J9A A;  4H3U A;  1VQ7 3;  3FLJ A;  2BHM A;  1LQG C;  1O7M B;  1SQW A;  2GEX A;  4RNT A;  2INX A;  5JBS A;  2D1W A;  1YVB I;  3HOH A;  4N6N B;  4HM5 B;  3IMA B;  1TU5 A;  1WMO A;  1W4N A;  2XH9 A;  4XBX A;  1JZD A;  2OQE A;  1BNJ A;  2GBX B;  5G2G A;  1O7G B;  3KSE D;  1CYU A;  2KCD A;  1RDS A;  1UGH I;  4OUQ A;  4O2H A;  1QVG 2;  4L8P A;  3V98 A;  2Y74 A;  1FZU A;  3LTC A;  1GS3 A;  1YJ9 3;  5IG4 A;  4KT3 B;  1SIH A;  4NHF A;  1FA3 A;  4AKY A;  3UL6 A;  1JZO A;  1VQ9 3;  4GB5 A;  1RLS A;  1V58 A;  4AKZ A;  1YIJ 3;  4U13 A;  3F14 A;  4HM7 B;  5CK6 A;  2WGQ A;  1RTU A;  2F5M A;  2AAE A;  5TGN A;  3CCV 3;  1I3I A;  1IDP A;  2KAA A;  2HMO B;  2XGL A;  3EE1 A;  5DRE A;  2BMR B;  3ZG0 A;  5M18 A;  1UCL A;  3HIG A;  5KP1 A;  1Q9E A;  3OWU A;  4H61 A;  1FGM A;  5GSP A;  1RGG A;  2OTJ 3;  1M90 4;  2E2T A;  2RCD A;  1X1W A;  3AGN A;  5D83 A;  3X3X A;  1A2K A;  1I2F A;  2LQV A;  1O7H B;  2CFD A;  4FMA A;  2JQ5 A;  2R41 A;  3STD A;  1W02 A;  1RNB A;  1UUG B;  1W2B 2;  2JDI H;  4RZM A;  1N5H A;  4KVH A;  1MGR A;  5KP3 A;  2QEX 3;  3J7Y d;  1VQ5 3;  3QK9 A;  1A90 A;  4N6T A;  2C4B A;  4GHO A;  2P0X A;  4L8O A;  3T0U A;  3OXA A;  3WHO A;  1T2H A;  2F56 A;  1R4Y A;  5BU4 A;  1LOW A;  1BNS A;  1RCK A;  3KN4 A;  3KSP A;  1LOY A;  2O3O A;  4FR9 A;  4EW5 A;  1YIT 3;  3MG2 A;  3CNX A;  2K0M A;  1TUH A;  3EC9 A;  3JUO A;  4EC6 A;  1BOX A;  3SLU A;  1OH0 A;  3NBJ A;  3CCU 3;  2W56 A;  2XSO B;  1I8V A;  1EKM A;  1X1U A;  3D5G A;  1DMQ A;  1X1Y A;  3MKI A;  5EVH A;  2BO9 B;  2OCT A;  2Z6B A;  3NUV A;  2HOH A;  5JPP A;  1VQP 3;  1R4C A;  3B4O A;  1FUS A;  3LTA A;  3MPH A;  1VQL 3;  1AV4 A;  4EBG A;  1ROA A;  2GU3 A;  1GMP A;  1A2P A;  2R4I A;  3G71 3;  4I5Q A;  3S29 A;  1OAC A;  3BNC A;  1STD A;  2QIY A;  3PYJ A;  3X42 A;  1JBS A;  1IT8 A;  2V1L A;  3T8U A;  1JBR A;  1N9E A;  3JUN A;  2L1S A;  2CC3 A;  1D6U A;  1HZ1 A;  1OHO A;  1UUV B;  2STD A;  1UCK A;  1JB5 A;  1Q40 B;  3FF2 A;  2CWT A;  2HMJ B;  2KXG A;  3FZW A;  2W6J H;  3JUP A;  1O7N B;  2XEP A;  1SJW A;  4K1U A;  5ELJ A;  2RGQ A;  3ECF A;  4X2O A;  3F8X A;  3FGY A;  3NV0 B;  1RGK A;  3BLZ A;  1JBT A;  1BIR A;  2CWU A;  4BL3 A;  3SVA A;  1ZX2 A;  1I3F A;  2I9W A;  3CCM 3;  4WP5 A;  1DMM A;  4ZM8 A;  1OHP A;  2RFR A;  1K41 A;  4LZI A;  6RNT A;  7RNT A;  1ISK A;  1BSC A;  3H51 A;  1AQZ A;  1WTH A;  3EN8 A;  3KZT A;  3L0R A;  3K5T A;  3DGM A;  3N54 B;  1VQK 3;  1OGZ A;  1YVS A;  1EUI C;  1OPY A;  4MJD A;  1YI2 3;  2AAD A;  3CU3 A;  1BRJ A;  5CF1 A;  1GOV A;  2BMO B;  4HZB B;  5G1L A;  1BSB A;  2CFK A;  3FG4 A;  2PZV A;  5AI1 A;  1YJN 3;  3K63 A;  4K61 A;  4MEI A;  7STD A;  3LOY A;  1B20 A;  2KF4 A;  1DVC A;  5IER A;  3SED A;  5IG5 A;  3CPW 2;  1BU4 A;  4HM6 B;  4R4K A;  2CWV A;  1TIJ A;  1B3S A;  1WMP A;  3X41 A;  1DYU A;  4TX4 A;  1N5P A;  2XR8 B;  1IQY A;  2Z77 A;  4HKV B;  3SXX A;  3LXU X;  5IG0 A;  2CH9 A;  1BSD A;  3EN1 B;  3GZR A;  2HMM B;  1RGL A;  3DM8 A;  1BNG A;  4HZ9 B;  4KZ1 A;  2J8X B;  3VGN A;  3WA3 A;  3EF8 A;  1U8C B;  3A5E A;  3KCH A;  3DGY A;  3SYU A;  1AVK A;  1YJW 3;  3CME 3;  1RGC A;  3FCS B;  3E99 A;  3EBY A;  3PCS A;  1BNE A;  1KSI A;  4LSO A;  1OGX A;  4R9L A;  3DGO A;  1RJO A;  4O3V A;  3A76 A;  1U5O A;  4PEJ A;  1T5Y A;  3D4A A;  4HAA A;  2ML6 A;  2RBI A;  3IPT A;  1X1X A;  3F7S A;  4FMB A;  3LTB A;  4WYK B;  6GSP A;  3AGO A;  4ORL A;  1NB3 I;  3OX9 A;  1GYB A;  1JKG A;  1S5A A;  3F7X A;  2XSH B;  2ZA4 A;  4J5K A;  1OF5 B;  4NRE A;  1FYS A;  2IA7 A;  3U97 A;  4R1K A;  4ILF A;  1MWS A;  3SOA A;  1FUT A;  1RHL A;  3B4P A;  1FGO A;  3VSY A;  1IVV A;  3VF1 A;  1TFO A;  1BRN L;  3EHC A;  2W03 A;  1JNQ A;  3F8H A;  3HX8 A;  3QRD A;  2CX0 A;  1FUW A;  1LQM B;  3BNE A;  1W6C A;  3DZL A;  4KFF A;  5AIG A;  4CPK A;  3FG1 A;  2Z7A A;  1FW7 A;  2CX1 A;  3RGR A;  1UI7 A;  2CFW A;  3BIR A;  5KP4 A;  4OK0 A;  3LT9 A;  2W9Q A;  1TTO A;  3ZFZ A;  3HK4 A;  1QAK A;  4MMX B;  1BSE A;  1YGW A;  3LH4 A;  1ZGX A;  1K73 4;  1UDI I;  1NB5 I;  5IF6 A;  1IU7 A;  3CCL 3;  1ULI B;  4XM4 A;  1RKY A;  2IMJ A;  2WGO A;  1I0V A;  1LNH A;  3NXJ A;  1BRS A;  2YFL B;  1IT7 A;  3WOE B;  1NDO B;  4N6L A;  3FH1 A;  4L7K A;  3CPO A;  3RNT A;  1N9J A;  2OOV C;  1IYY A;  2WOF A;  1RRL A;  4LYL B;  3CCE 3;  1JN5 B;  3NQY A;  1V57 A;  5CLK A;  3NBB A;  4XBY A;  4FCJ A;  3X40 A;  8CHO A;  1RCL A;  3SOY A;  3CCQ 3;  2CIU A;  2E2U A;  4WFO A;  9RNT A;  1UCI A;  1YGE A;  1PFP A;  1O7P B;  3FG3 A;  1TRP A;  3WDG B;  1TP6 A;  4WWU C;  1PU4 A;  1RMS A;  1K28 A;  1RRH A;  3G4S 3;  1T2I A;  3JUM A;  2H0H A;  2FNQ A;  4HBR A;  4LMI A;  1BRG A;  2RNT A;  2Y73 A;  4NPB A;  5EEO A;  1VQ4 3;  2KF6 A;  3CCS 3;  3EBT A;  1C54 A;  2CK3 H;  3O8Y A;  2QA4 3;  4FMD A;  2W2C A;  4JF8 A;  1BSA A;  2A15 A;  4K1V A;  5BVB A;  4K90 B;  4XB5 A;  1E3V A;  1M1X B;  2P0M A;  2HMK B;  1RN4 A;  3LTD A;  3PCR A;  3UL5 A;  3HII A;  3UNL A;  1QAL A;  4BTX A;  2GBW B;  4N6M A;  2H0I A;  3NHX A;  1Q7Y 4;  1DET A;  1ROV A;  2SBL A;  3JUQ A;  4I4K A;  1LXE A;  5AIF A;  5I97 A;  1Q40 A;  4BTY A;  3OWY A;  2MC8 A;  1JRQ A;  2C11 A;  5RNT A;  3Q3F A;  1W6Y A;  2F98 A;  3HI7 A;  3PS8 A;  4CDL A;  3MG3 A;  2BIR A;  2RSX A;  1MWU A;  2WO0 A;  1DMN A;  2CHC A;  2HMN B;  4R9K A;  1EQK A;  3CC2 3;  3I0Y A;  1GD3 A;  2GXF A;  3NV0 A;  3KE7 A;  2XFT A;  3AMO B;  3IJE B;  1Q7H A;  4FCZ A;  1B2X A;  1BRK A;  1I2G A;  1IVX A;  3WOD G;  3AHW A;  3BNB A;  3DGN A;  3JVC A;  3NM7 A;  3NX0 A;  4HOH A;  3GAX A;  4O02 B;  4XDV A;  3V92 A;  1BUQ A;  3ER7 A;  3MWZ A;  1DE3 A;  2Z76 A;  5LC7 A;  1KC8 4;  1AVL A;  2ML5 A;  1GSP A;  5AIH A;  2M7O A;  4BIR A;  2BNG A;  7GSP A;  3G8Z A;  1G02 A;  2B24 B;  1D6Z A;  4EYC A;  3F9S A;  3SX1 A;  3B7C A;  4N3V A;  3S27 A;  1Q86 4;  1GOY A;  5M1A A;  2WOH A;  1BNR A;  1B21 A;  2OQE C;  3H3H A;  6STD A;  2YFI B;  2K54 A;  1T3B A;  1I70 A;  1AY7 A;  1JJ2 2;  3CMA 3;  1FGQ A;  4EXR A;  3MHE A;  3M8C A;  1G0T A;  1Z1S A;  1PYL A;  3ALA A;  2E2V A;  2ZL8 A;  1C7H A;  3EB8 A;  1CH0 A;  5BXQ A;  3K0Z A;  3CCJ 3;  2KF5 A;  1RGE A;  2Q07 A;  2XRX B;  3RDE A;  5IG3 A;  1K8A 4;  5CF2 A;  1A67 A;  1W6G A;  3S5C A;  1EA2 A;  2ZHX B;  4FCM A;  2GSP A;  1CEW I;  5LC6 A;  3U1W A;  1JV2 B;  2YFJ B;  1OUN A;  5CXO A;  1N8R 4;  2IUK A;  4JRF A;  1ASK A;  4RNY A;  1IVU A;  2FXT A;  3N8B A;  4FMC A;  4HM0 B;  1VQN 3;  3K7C A;  4GL6 A;  4EV2 A; 
#chains in the Genus database with same CATH homology
 5IEO A;  2FGT A;  2B1X B;  1OHS A;  4HVN A;  4XDW A;  2BT3 A;  3K9M C;  5FGO A;  1QMA A;  3PXM A;  3MYT A;  4G1M B;  3NBR A;  4WHA A;  4WYK A;  2P38 A;  1W00 A;  3D9R A;  3V99 A;  1KD1 4;  2HML B;  1VQO 3;  2XFS A;  3X3Y A;  2UX0 A;  3N9H A;  3BB9 A;  1YHQ 3;  1OF5 A;  1VQM 3;  1NO3 A;  1IV7 A;  4HM3 B;  2W04 A;  2CG0 A;  1GY5 A;  1LVN A;  4CCV A;  1QAF A;  3CD6 3;  1W7C A;  4O8S A;  1FGR A;  1SPU A;  1KQS 2;  3CNM A;  1EG9 B;  4MMZ B;  5DRV A;  5IEN A;  3OWS A;  2D42 A;  1IK3 A;  1Q42 A;  4STD A;  5FW5 A;  1L5G B;  5A0O B;  1UI8 A;  1CQS A;  3GWR A;  5ELU A;  2C10 A;  3F40 A;  3PGB A;  3FKA A;  2CW9 A;  1IVW A;  3DMC A;  1O7W B;  1IQX A;  1GY6 A;  1US1 A;  2CFL A;  4LEH A;  1NJI 4;  2YX9 A;  1JB4 A;  2F99 A;  3FF0 A;  1M9G A;  1E97 A;  3Q90 A;  2QGU A;  1A2V A;  3GZX B;  1ULJ B;  3KKG A;  5JPU A;  1DVD A;  1WMN A;  5AII A;  4AEQ A;  2MF7 A;  3G6E 3;  3NM2 A;  2GU1 A;  2L4V A;  4HM8 B;  1M1K 4;  1AR0 A;  3D3L A;  3CXC 2;  2BMQ B;  2XF3 A;  3PZW A;  1K9M 4;  2W56 B;  1JN5 A;  3DGL A;  2CKF B;  4QWT A;  2P05 A;  5STD A;  4RBN A;  3DY5 A;  4J8T A;  3EQQ B;  3I56 3;  2ZDJ A;  1CYV A;  1RN7 A;  1IQ8 A;  3S28 A;  3Q2P A;  3WOF B;  5IEP A;  1VZZ A;  1GD4 A;  1W01 A;  3EX9 A;  5AYR B;  1NWW A;  4MMY B;  1ZO2 A;  1SII A;  2GEY A;  1HKX A;  3FSD A;  1G96 A;  1WQL B;  1W5Z A;  3Q1C A;  4Q53 A;  1E3R A;  4N6V 0;  3UJM A;  1IV9 A;  1Y4K A;  2CFG A;  1D6Y A;  4HM4 B;  1HU9 A;  2LYX A;  3T8N A;  1STF I;  3S67 A;  3OV4 A;  2OOV A;  1MOL A;  5IW9 A;  3OW2 2;  3LYG A;  1UW1 A;  3TDG A;  3CC7 3;  3GZY B;  1QJG A;  4LGQ A;  2O9U X;  3G0K A;  3LT8 A;  2F86 B;  5D82 A;  2P09 A;  1Q82 4;  1VQ6 3;  1OCV A;  4KFE A;  3G16 A;  2KRT A;  2OWP A;  4XBT A;  5AEW B;  4BTW A;  4IPB A;  4IIA A;  3UB1 A;  3DUK A;  4N6O B;  3CC4 3;  3AMO A;  4HYZ A;  3GRD A;  4X2H A;  5D81 A;  2W0Q A;  3BND A;  5AEU B;  3B8L A;  1FGT A;  5EQL A;  5AYS C;  1TFK A;  1J2B A;  1LOX A;  2PNC A;  3ROB A;  4EV5 A;  3EJV A;  1NU3 A;  3KII A;  3LZA A;  4OVM A;  1MNL A;  4R80 A;  2OTL 3;  1W2Z A;  1QVF 2;  3KFQ C;  4HM1 B;  2XGN A;  1F8N A;  3GZB A;  3MSO A;  3DXO A;  3HZP A;  4HM2 B;  2CG1 A;  1Q81 4;  1VQ8 3;  2W9P A;  3NQZ A;  3LML A;  3WMD A;  3I55 3;  4HJL B;  4RNZ A;  3CCR 3;  1UUW B;  1JB2 A;  1N8Q A;  4IT7 A;  1S72 3;  1KWI A;  1JKG B;  1WNH A;  4KFD A;  5HGR A;  3RGA A;  2IUJ A;  1V74 A;  3MG1 A;  4N6U A;  3WA2 X;  1GY7 A;  4J9A A;  4H3U A;  1VQ7 3;  3FLJ A;  2BHM A;  1O7M B;  1SQW A;  2GEX A;  5JBS A;  2INX A;  2D1W A;  1YVB I;  4N6N B;  4HM5 B;  3IMA B;  1TU5 A;  1WMO A;  1W4N A;  2XH9 A;  4XBX A;  2OQE A;  2GBX B;  5G2G A;  1O7G B;  3KSE D;  1CYU A;  2KCD A;  4OUQ A;  4O2H A;  1QVG 2;  4L8P A;  3V98 A;  2Y74 A;  3LTC A;  1GS3 A;  1YJ9 3;  5IG4 A;  1SIH A;  4NHF A;  1FA3 A;  4AKY A;  3UL6 A;  1VQ9 3;  4GB5 A;  4AKZ A;  1YIJ 3;  4U13 A;  3F14 A;  4HM7 B;  5CK6 A;  2WGQ A;  5TGN A;  3CCV 3;  2XGL A;  1IDP A;  3EE1 A;  2HMO B;  5DRE A;  2BMR B;  3HIG A;  5KP1 A;  3OWU A;  4H61 A;  1FGM A;  2OTJ 3;  1M90 4;  2E2T A;  2RCD A;  5D83 A;  3X3X A;  1A2K A;  2LQV A;  1O7H B;  2CFD A;  4FMA A;  2JQ5 A;  3STD A;  1W02 A;  1W2B 2;  2JDI H;  4RZM A;  1N5H A;  4KVH A;  5KP3 A;  2QEX 3;  3J7Y d;  1VQ5 3;  3QK9 A;  1A90 A;  4N6T A;  4L8O A;  2P0X A;  3T0U A;  3OXA A;  3KSP A;  3KN4 A;  2O3O A;  4FR9 A;  1YIT 3;  3MG2 A;  3CNX A;  2K0M A;  1TUH A;  3EC9 A;  3JUO A;  3SLU A;  1OH0 A;  3NBJ A;  3CCU 3;  2W56 A;  2XSO B;  1EKM A;  1DMQ A;  3MKI A;  5EVH A;  2BO9 B;  2OCT A;  2Z6B A;  3NUV A;  5JPP A;  1VQP 3;  1VQL 3;  1R4C A;  3B4O A;  3LTA A;  3MPH A;  1AV4 A;  4EBG A;  1ROA A;  2GU3 A;  2R4I A;  3G71 3;  3S29 A;  1OAC A;  3BNC A;  2QIY A;  1STD A;  3PYJ A;  3X42 A;  1IT8 A;  2V1L A;  3T8U A;  1N9E A;  3JUN A;  2CC3 A;  1D6U A;  1OHO A;  1UUV B;  2STD A;  3FF2 A;  4EC6 A;  1JB5 A;  1Q40 B;  2CWT A;  2HMJ B;  2KXG A;  3FZW A;  2W6J H;  3JUP A;  1O7N B;  2XEP A;  1SJW A;  4K1U A;  5ELJ A;  2RGQ A;  3ECF A;  4X2O A;  3F8X A;  3FGY A;  3NV0 B;  3BLZ A;  2CWU A;  3SVA A;  1ZX2 A;  2I9W A;  3CCM 3;  4WP5 A;  1DMM A;  4ZM8 A;  1OHP A;  2RFR A;  1K41 A;  4LZI A;  1ISK A;  3H51 A;  1WTH A;  3EN8 A;  3KZT A;  3L0R A;  3K5T A;  3DGM A;  3N54 B;  1VQK 3;  1OGZ A;  1YI2 3;  1OPY A;  4MJD A;  3CU3 A;  5CF1 A;  4HZB B;  2BMO B;  2CFK A;  3FG4 A;  2PZV A;  5AI1 A;  1YJN 3;  3K63 A;  4K61 A;  4MEI A;  7STD A;  3LOY A;  1DVC A;  5IER A;  3SED A;  5IG5 A;  3CPW 2;  4HM6 B;  4R4K A;  2CWV A;  1TIJ A;  1WMP A;  3X41 A;  1DYU A;  4TX4 A;  1N5P A;  2XR8 B;  1IQY A;  2Z77 A;  4HKV B;  3SXX A;  3LXU X;  5IG0 A;  2CH9 A;  3EN1 B;  3GZR A;  2HMM B;  3DM8 A;  4HZ9 B;  4KZ1 A;  3VGN A;  3WA3 A;  3EF8 A;  1U8C B;  1YJW 3;  1AVK A;  3CME 3;  3FCS B;  3E99 A;  3EBY A;  3PCS A;  1KSI A;  4LSO A;  1OGX A;  4R9L A;  3DGO A;  1RJO A;  4O3V A;  3A76 A;  1U5O A;  4PEJ A;  1T5Y A;  3X3Z A;  2ML6 A;  3IPT A;  4FMB A;  4WYK B;  3F7S A;  3LTB A;  4ORL A;  1NB3 I;  3OX9 A;  1GYB A;  1JKG A;  1S5A A;  3F7X A;  2XSH B;  1OF5 B;  4NRE A;  2IA7 A;  3U97 A;  4R1K A;  3SOA A;  3B4P A;  1FGO A;  3VSY A;  1IVV A;  3VF1 A;  1TFO A;  3EHC A;  2W03 A;  1JNQ A;  3F8H A;  3HX8 A;  3QRD A;  1FUW A;  3BNE A;  3DZL A;  1W6C A;  4KFF A;  5AIG A;  3FG1 A;  2Z7A A;  3RGR A;  1UI7 A;  2CFW A;  5KP4 A;  4OK0 A;  3LT9 A;  2W9Q A;  3HK4 A;  1QAK A;  4MMX B;  3LH4 A;  1K73 4;  1NB5 I;  5IF6 A;  1IU7 A;  3CCL 3;  1ULI B;  4XM4 A;  1RKY A;  2WGO A;  2IMJ A;  3NXJ A;  1LNH A;  2YFL B;  1IT7 A;  3WOE B;  1NDO B;  4N6L A;  3FH1 A;  4L7K A;  3CPO A;  1N9J A;  2OOV C;  2WOF A;  1RRL A;  3CCE 3;  1JN5 B;  3NQY A;  5CLK A;  3NBB A;  4XBY A;  4FCJ A;  3X40 A;  8CHO A;  3SOY A;  3CCQ 3;  2CIU A;  2E2U A;  4WFO A;  1YGE A;  1PFP A;  1O7P B;  3FG3 A;  3WDG B;  1TP6 A;  4WWU C;  1PU4 A;  1K28 A;  1RRH A;  3G4S 3;  3JUM A;  2FNQ A;  4HBR A;  4LMI A;  2Y73 A;  5EEO A;  1VQ4 3;  3CCS 3;  3EBT A;  2CK3 H;  3O8Y A;  2QA4 3;  4FMD A;  2W2C A;  4JF8 A;  2A15 A;  4K1V A;  5BVB A;  4K90 B;  4XB5 A;  1E3V A;  1M1X B;  2P0M A;  2HMK B;  3LTD A;  3PCR A;  3UL5 A;  3HII A;  3UNL A;  1QAL A;  4BTX A;  2GBW B;  4N6M A;  3NHX A;  1Q7Y 4;  1ROV A;  2SBL A;  3JUQ A;  4I4K A;  1LXE A;  5AIF A;  5I97 A;  1Q40 A;  4BTY A;  3OWY A;  2MC8 A;  1JRQ A;  2C11 A;  1W6Y A;  2F98 A;  3HI7 A;  3PS8 A;  4CDL A;  3MG3 A;  2RSX A;  2WO0 A;  1DMN A;  2CHC A;  2HMN B;  4R9K A;  1EQK A;  3CC2 3;  3I0Y A;  1GD3 A;  2GXF A;  3NV0 A;  3KE7 A;  2XFT A;  3AMO B;  3IJE B;  4FCZ A;  1IVX A;  3WOD G;  3BNB A;  3DGN A;  3JVC A;  3NM7 A;  3NX0 A;  4XDV A;  3GAX A;  4O02 B;  3V92 A;  1BUQ A;  3ER7 A;  3MWZ A;  2Z76 A;  5LC7 A;  1KC8 4;  1AVL A;  2ML5 A;  5AIH A;  2M7O A;  2BNG A;  3G8Z A;  2B24 B;  1D6Z A;  4EYC A;  3F9S A;  3SX1 A;  3B7C A;  4N3V A;  3S27 A;  1Q86 4;  2WOH A;  3H3H A;  2OQE C;  6STD A;  2YFI B;  2K54 A;  1JJ2 2;  3CMA 3;  1FGQ A;  4EXR A;  3MHE A;  3M8C A;  1Z1S A;  3ALA A;  2E2V A;  2ZL8 A;  1C7H A;  3EB8 A;  5BXQ A;  3K0Z A;  3CCJ 3;  2Q07 A;  2XRX B;  3RDE A;  5IG3 A;  1K8A 4;  5CF2 A;  1A67 A;  1W6G A;  3S5C A;  1EA2 A;  4FCM A;  1CEW I;  5LC6 A;  3U1W A;  1JV2 B;  2YFJ B;  1OUN A;  5CXO A;  1N8R 4;  2IUK A;  4JRF A;  1ASK A;  4RNY A;  1IVU A;  2FXT A;  3N8B A;  4FMC A;  4HM0 B;  1VQN 3;  3K7C A;  4GL6 A;  4EV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...