5TGNA

Crystal structure of protein sthe_2403 from sphaerobacter thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
AMAAIDLAREYISRVNGRDGSGAAALFAQDGEIIAPVGRVYRGWDAIAAFIEAAPPATTAQIAERTMGTHRVVLHGVVQTPRFAPAQIEWIFDVDGDRIRRLTINHLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of protein Sthe_2403 from Sphaerobacter thermophilus
rcsb
source organism Sphaerobacter thermophilus
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5tgnA00
1O7PB 1O7NB 4WYKA 3BB9A 1OF5B 3NM2A 3UJMA 3SOAA 1W02A 3K7CA 3RGAA 2XSOB 3FSDA 5IF6A 1OUNA 3F40A 1S5AA 1JB5A 2QGUA 2UX0A 1W00A 1NDOB 3F8XA 2XR8B 3FKAA 3EF8A 1QMAA 2F98A 2GBWB 5CLKA 3M8CA 2B1XB 2K54A 4HM6B 3NXJA 3ER7A 1OHSA 4WYKB 3DMCA 5D82A 4LMIA 3BLZA 5AEUB 5CXOA 1K41A 4HM4B 5IEOA 2INXA 1W6YA 5KP1A 1E3RA 4X2OA 1ULJB 4K1VA 3MSOA 3G0KA 3FGYA 2A15A 5DRVA 2F86B 1ZX2A 1O7MB 5G2GA 1JKGA 1OCVA 2BMRB 5JPUA 3FLJA 3H51A 4XBYA 5IENA 4RZMA 3OWUA 3EQQB 3SEDA 1STDA 1W01A 3GRDA 3WMDA 1JB4A 1OGZA 3DZLA 2GEXA 4ORLA 3JUPA 4PEJA 1HKXA 3NV0A 3KE7A 5IG4A 1A2KA 2YFLB 5DREA 1WQLB 3GZYB 5JPPA 3JUQA 5KP3A 2RCDA 5IERA 5IG0A 1JKGB 3MYTA 3OV4A 4STDA 1OH0A 3F7SA 1UUWB 5IEPA 3EN1B 4I4KA 5CF1A 2Z7AA 5D83A 3CPOA 3STDA 2YFJB 3EBTA 5D81A 4XBXA 3B8LA 3F9SA 3B4OA 3B7CA 4IIAA 3LYGA 1ZO2A 3LZAA 3NV0B 3EJVA 2XRXB 4FCMA 2IMJA 4K1UA 3OWSA 4HM3B 4WP5A 1AR0A 2HMLB 1OHOA 3OWYA 3HZPA 2Z76A 2STDA 4L7KA 3F7XA 2HMNB 1VZZA 3MHEA 2OWPA 4XM4A 3CNMA 3MG3A 4X2HA 5AIFA 4XDWA 2QIYA 1NU3A 3DM8A 2HMOB 1OGXA 3GWRA 3VSYA 1Q40A 3NHXA 3T8UA 4R9LA 4GB5A 1TUHA 7STDA 5TGNA 3NUVA 4KVHA 1OHPA 5CF2A 5HGRA 3RGRA 3HX8A 5BXQA 4R1KA 4CDLA 3K0ZA 1DMQA 4HZ9B 3T8NA 4HZBB 4N3VA 1U5OA 5IG3A 1O7WB 3D9RA 1Q40B 3FZWA 3FF2A 3ECFA 1UUVB 1O7HB 1Z1SA 3I0YA 4LGQA 4Q53A 1Q42A 2YFIB 4H3UA 2CKFB 1GY5A 3F8HA 5CK6A 3EC9A 1NWWA 4L8PA 1ASKA 4WWUC 3ROBA 2GBXB 5IG5A 3JUNA 1GY6A 4U13A 3JUMA 2BMQB 5KP4A 3JUOA 5FW5A 1ULIB 2Z77A 2RFRA 4XBTA 2I9WA 3G16A 2JQ5A 2HMJB 4HM2B 4HM8B 2BMOB 3B4PA 3FH1A 3KKGA 2B24B 1TP6A 3KZTA 3E99A 4HVNA 3MG1A 1GY7A 1C7HA 3EBYA 5STDA 3SOYA 3OXAA 5AIGA 2HMKB 4HKVB 1E97A 3S5CA 1CQSA 1ISKA 3HK4A 3MG2A 4J8TA 5EVHA 3EHCA 3CU3A 6STDA 1GS3A 3KSPA 2GXFA 3DXOA 2GEYA 4HM1B 8CHOA 2R4IA 3F14A 4R9KA 4OUQA 5AIIA 1JN5A 2CHCA 4HM5B 3FF0A 4MJDA 5AEWB 4J9AA 3GZRA 3EN8A 1GYBA 3VGNA 1BUQA 3EX9A 2W2CA 2PZVA 3GZBA 3G8ZA 2F99A 4FCJA 4L8OA 1QJGA 1SJWA 2HMMB 4XDVA 2XSHB 1EA2A 1IDPA 1EG9B 3IPTA 1JN5B 5AIHA 3GZXB 5BVBA 3H3HA 1JB2A 4OVMA 1OF5A 1DMMA 2RGQA 2BNGA 4XB5A 3DUKA 4HM0B 4LEHA 4HM7B 3UNLA 5AI1A 3CNXA 1DMNA 1O7GB 3A76A 1E3VA 4HJLB 3Q90A 3MKIA 3OX9A 1OPYA 3NBRA
chains in the Genus database with same CATH superfamily
1O7PB 9RNTA 1O7NB 4WYKA 3NBBA 3WA3A 1C54A 3X3YA 1JZDA 1MGRA 3BB9A 2WGOA 2CC3A 1OF5B 1LVNA 3NM2A 3UJMA 3SOAA 1BRHA 2KCDA 1TFKA 1SQWA 1W02A 2XGNA 3K7CA 3RGAA 3DGYA 3FG3A 2XSOB 3FSDA 1UGHI 1SPUA 3PS8A 2FGTA 4KFEA 5IF6A 2KF3A 1Y4KA 1OUNA 3F40A 4EW5A 1S5AA 3AHWA 3NM7A 1JB5A 2QGUA 2UX0A 3BNCA 4R80A 1MOLA 4BL3A 1W00A 5I97A 2SARA 5RNTA 3NBJA 1FZUA 1NDOB 1TTOA 3F8XA 2XR8B 3FKAA 1B2UA 2BO9B 3CD63 3EF8A 2CFLA 1VQP3 3HI7A 1QMAA 2F98A 2GBWB 2WOHA 5CLKA 3M8CA 2B1XB 2CX0A 2K54A 1UCIA 3UL6A 1BOXA 2LYXA 1B27A 4O2HA 4AKZA 3CMA3 3U97A 1RGEA 1N5HA 1UW1A 1SARA 3AGNA 4BU4A 1EEJA 4HM6B 1QAFA 3NXJA 5EEOA 1B2MA 1N5PA 3ER7A 1OHSA 2R41A 4WYKB 3O8YA 1QAKA 3DMCA 4N6LA 4RNTA 1D6UA 1I70A 3CME3 1T2IA 5D82A 4LMIA 3BLZA 5AEUB 1MNLA 4RBNA 4WHAA 5CXOA 1K41A 4HM4B 1Q7Y4 5IEOA 1YNVX 5AYSC 2D1WA 2INXA 1I8VA 1RCLA 1A90A 2KXGA 4JF8A 3UB1A 1HZ1A 1W6YA 2BIRA 3FG4A 1IVWA 1RGGA 5KP1A 1E3RA 1RGLA 2CFGA 4EBGA 4FR9A 4X2OA 2OQEA 1ULJB 4K1VA 1KC84 1YI23 1Q7HA 2Q07A 3HOHA 1JBTA 1GMQA 1LOVA 2H0IA 2W56A 1VQ53 2OTJ3 4BIRA 1MWSA 3CC73 2FXTA 1JNQA 2P09A 3MSOA 3G0KA 3DGOA 4MEIA 1I2FA 1UCJA 1BRSA 2W03A 2IYJA 3FGYA 3AMOA 2A15A 3OW22 1K28A 4HBRA 3CXC2 1RGCA 5DRVA 1IQYA 2CFDA 2F86B 1ZX2A 1O7MB 5G2GA 1BANA 1RN4A 3SXXA 1IU7A 1JKGA 2V1LA 1OCVA 3SX1A 2BMRB 5JPUA 3FLJA 3H51A 1NB3I 4XBYA 1IVXA 1RGKA 4BTWA 5IENA 2E2VA 3LT9A 1RNBA 1RMSA 3NQZA 3URPA 3EB8A 4RZMA 4RNYA 3OWUA 3V92A 1G0TA 3EQQB 4QWTA 3SEDA 4G1MB 1STDA 1B2ZA 1W01A 1G02A 3GRDA 4WFOA 1SIHA 2P38A 2W56B 4FCZA 1AQZA 1MGWA 3WMDA 1JB4A 2CIUA 1OGZA 4JRFA 3DZLA 1DETA 2GEXA 1IT7A 1BRGA 1X1XA 3KN4A 4ORLA 1W6GA 3JUPA 4PEJA 2F5MA 1ROVA 1FGTA 3N54B 1HKXA 2P0XA 7GSPA 4ILFA 1FYSA 3AMOB 3NV0A 1VQN3 4OK0A 3KE7A 5IG4A 1A2KA 2YFLB 1GMRA 2CW9A 5DREA 4AKYA 1WQLB 3GZYB 5JPPA 1RNTA 3JUQA 4KFDA 5KP3A 2RCDA 3PCSA 5IERA 5IG0A 1TIJA 1JKGB 3HIIA 1KSIA 1T2HA 1V58A 1PU4A 1BUJA 3MYTA 4MMXB 1BU4A 1GOYA 5GSPA 2CK3H 2OOVC 3OV4A 4STDA 5G1LA 4ZM8A 1OH0A 3WHOA 1NNVA 2OCTA 1N8QA 3F7SA 4BTYA 3WODG 1LQMB 1UUGB 1FA3A 2MF7A 1UUWB 5IEPA 1FUWA 4EYCA 2IUKA 3EN1B 4I4KA 5CF1A 2Z7AA 3LTBA 7RNTA 5D83A 1J2BA 1CYVA 1W2ZA 3CPOA 1A2PA 1Q9EA 4MMZB 3STDA 3PXMA 2YFJB 4FMAA 1BAOA 3EBTA 3HIGA 1NB5I 2Z6BA 1BRIA 5D81A 5M19A 2K3DA 3S67A 4XBXA 1YJW3 2XGLA 3B8LA 3F9SA 3B4OA 3B7CA 3RNTA 1DVDA 3ZG0A 4J5KA 1VQQA 4IIAA 3MPHA 2F5WA 1RRHA 3PZWA 3LYGA 1JBRA 1ZO2A 5AYRB 3LZAA 3NV0B 2KF6A 2UUGC 1RGHA 1SIIA 1BNIA 4N6UA 4IT7A 3EJVA 1RDSA 2XRXB 3WOFB 2CWTA 4FCMA 2IMJA 2ZL8A 4K1UA 3CCJ3 1YIJ3 4NPBA 3K63A 1I2GA 2O9UX 3OWSA 4N6NB 1AVKA 3DGNA 3DGMA 2WO0A 1B2SA 4HM3B 5IW9A 2CH9A 5G1KA 1N8R4 3CCU3 2CFWA 2JDIH 1AR0A 2HMLB 4WP5A 1VQ43 4FMDA 1VQL3 1UGIA 1OHOA 3OWYA 2E2UA 1BNJA 1IVVA 1I2EA 3HZPA 1I3IA 2Z76A 1JBSA 2STDA 5ELJA 2XF3A 1W6CA 3IJEB 4L7KA 3F7XA 3Q1CA 2HMNB 3V99A 1YIT3 1BIRA 1VZZA 3WA2X 3K5TA 2CWUA 1BSCA 2W04A 3MHEA 1EKMA 1GSPA 2OWPA 1FW7A 4XM4A 3CNMA 4H61A 4NREA 3MG3A 4X2HA 5AIFA 2SBLA 4XDWA 2QIYA 1LOWA 1CH0A 1W2B2 3LXUX 1I0XA 3AHSA 1LNHA 2XH9A 2J8XB 1Q824 1NU3A 3DM8A 2HMOB 1OGXA 3GWRA 4HYZA 2FNQA 3VSYA 1Q40A 4K61A 3NHXA 4BTXA 6RNTA 1UDII 4KT3B 1EQKA 2XEPA 3T8UA 1N9JA 4R9LA 4GB5A 3KIIA 5EQLA 3S27A 1TUHA 2P05A 7STDA 2ML5A 3NUVA 1IV7A 1LXEA 2HOHA 3Q2PA 4KVHA 3QRDA 1T3BA 1WMOA 1TJDA 1OHPA 1LNIA 2CFKA 5CF2A 2L4VA 4O02B 5HGRA 2KF4A 3N8BA 3CPW2 3RGRA 4TX4A 1STFI 2M7OA 1QALA 1PYLA 3G6E3 3HX8A 5BXQA 1V57A 1DYUA 1BGSA 1US1A 4R1KA 4CDLA 3K0ZA 1B2XA 1TU5A 3D79A 1IT8A 1YGWA 1YGEA 4N6OB 1BNEA 1DMQA 3SLUA 3T0UA 1X1UA 4HZ9B 3LTAA 3G713 2OOVA 3T8NA 1VQO3 4HZBB 2OTL3 1VQ63 4FMBA 1A2VA 3CCS3 4N3VA 4KFFA 3S28A 1U5OA 5ELUA 5IG3A 2XFSA 2LQVA 2YX9A 1X1YA 1O7WB 3D9RA 4I5QA 1NJI4 1Q40B 3FZWA 3FF2A 3ECFA 1HU9A 1UUVB 1YJ93 6GSPA 1DE3A 1PY3A 1O7HB 1Z1SA 3I0YA 4LGQA 4MMYB 3X3XA 4Q53A 3G4S3 3CCV3 4AEQA 1QVF2 1LRAA 1GOUA 1Q42A 2YFIB 1BNGA 1TRQA 1RHLA 3SYUA 2ZHXB 1AVLA 4LSOA 1RLSA 1UCLA 3LMLA 2CKFB 4H3UA 1GY5A 3LTCA 3D5GA 3F8HA 5CK6A 2H0HA 3EC9A 1NWWA 3SVAA 1GMPA 4L8PA 1ASKA 1VQ93 4WWUC 3IMAB 3ROBA 2GBXB 3WDGB 1LOYA 3WOEB 4FMCA 2Y73A 5JBSA 1CYUA 1KWIA 1MWUA 1GOVA 5IG5A 3JUNA 3KFQC 3TDGA 1GY6A 4U13A 1BRKA 2E2TA 2KAAA 3JUMA 2O3OA 3K9MC 2BMQB 1RN1A 1YVSA 1B20A 1AY7A 1LOXA 2H0GA 5KP4A 3JUOA 1K9M4 3X42A 5FW5A 1ULIB 2Z77A 3BNDA 4DKIA 1YHQ3 1MWTA 2RFRA 2ZDJA 2I9WA 1IQXA 1G96A 4XBTA 2QA43 3U1WA 3G16A 1I0VA 2JQ5A 1R4CA 2RNTA 3JVCA 2HMJB 4HM2B 4HM8B 1UI7A 1BRJA 3VF1A 2BMOB 1NO3A 5M18A 1B3SA 3B4PA 3FH1A 3KKGA 4O8SA 2B24B 1RTUA 3BU4A 1IYYA 2GU1A 2P0MA 1RSNA 1TP6A 1U8CB 2BU4A 2C11A 3KZTA 3E99A 3EE1A 4HVNA 3MG1A 5BU4A 1GY7A 3DGLA 1EUIC 4GL6A 1C7HA 3EBYA 5STDA 3SOYA 3OXAA 1YJN3 2C10A 4J5GA 3D5IA 4N6V0 1V74A 2C4BA 5AIGA 2HMKB 5BIRA 1JRQA 1GD4A 2CG1A 1M1XB 1HYFA 4HKVB 1IQ8A 3WR2A 1E97A 1FGMA 1FGQA 3UL5A 3BNEA 1KQS2 1WMPA 4EXRA 3DH2A 3S5CA 1MWRA 1CQSA 3GAXA 5LC6A 3X40A 1BNRA 1ISKA 1AV4A 1VQK3 1YVBI 2IY2A 3D3LA 1A67A 3CCR3 2W6JH 4IPBA 3D4AA 3LT8A 1K734 1M904 1WMNA 3HK4A 3MG2A 3L0RA 4J8TA 5EVHA 8RNTA 3EHCA 4CPKA 3CU3A 1D6ZA 4N6MA 3N9HA 1OACA 6STDA 1TRPA 1GS3A 3A5EA 3KSPA 2GXFA 1IK3A 3DXOA 5FGOA 4EC6A 1RCKA 2F56A 2KRTA 1FGRA 1RGFA 2AADA 3LOYA 3PYJA 2CX1A 4HAAA 2GEYA 1BNSA 4HOHA 1WTHA 1DVCA 2MC8A 2CG0A 3ALAA 4HM1B 4KZ1A 2IUJA 3CC23 5LC7A 1VQ73 8CHOA 4GSPA 3NX0A 3PGBA 3BNBA 3ZG5A 3V98A 3GSPA 1GD3A 1L5GB 2R4IA 1RGAA 2F4YA 3F14A 1QVG2 4GHOA 1FUSA 1R4YA 1M9GA 3FG1A 4R4KA 2QEX3 4R9KA 4OUQA 5AIIA 3X3ZA 1VQ83 3NQYA 4N6TA 1JN5A 1Q814 1F8NA 1WNHA 4BL2A 2CHCA 1JV2B 2K0MA 2BHMA 1PFPA 2GU3A 3FF0A 4HM5B 1N9EA 1W4NA 2XFTA 4LZIA 4MJDA 1UCKA 2RSXA 3CCQ3 1ZS7A 1BSAA 5AEWB 4J9AA 3AGOA 3GZRA 3J7Yd 3I553 1JJ22 2AAEA 1BSEA 3KSED 4RNZA 3EN8A 1X1WA 3FCSB 4NHFA 3CCM3 2D42A 3RDEA 1GYBA 3VGNA 3LTDA 1W7CA 3EX9A 2W2CA 1BUQA 2L1SA 1FUTA 1ZGXA 2PZVA 3GZBA 1VQM3 1BNFA 4EV2A 3LH4A 4CJNA 2RBIA 3X41A 3G8ZA 2F99A 2W9PA 4FCJA 4L8OA 1QJGA 1SJWA 2W0QA 5A0OB 2HMMB 4XDVA 2XSHB 1ROAA 5TGNA 1EA2A 1IDPA 2OQEC 1B21A 3S29A 1RKYA 1EG9B 3IPTA 3QK9A 3CCE3 1JN5B 1CEWI 1I3FA 1RRLA 2BT3A 3GZXB 5AIHA 5BVBA 3H3HA 2Y74A 4EV5A 1JB2A 1UI8A 3MWZA 4O3VA 1LQGC 2WGQA 3KCHA 4OVMA 1OF5A 1DMMA 5M1AA 1BSDA 3BIRA 2RGQA 4LYLB 1BRNL 2PNCA 2BNGA 4XB5A 1Q864 2ML6A 3DUKA 1IVUA 1D6YA 4HM0B 3DY5A 1BSBA 2UGIA 4LEHA 2KF5A 4HM7B 2W9QA 4K90B 3UNLA 1RJOA 3Q3FA 5AI1A 1FGOA 3I563 3CCL3 5HOHA 2WOFA 3CNXA 4CCVA 2CWVA 3ZFZA 1W5ZA 2ZA4A 1S723 1DMNA 2IA7A 1T5YA 1O7GB 3CC43 3A76A 3PCRA 1E3VA 1IV9A 2GSPA 4HJLB 1KD14 1M1K4 1BVIA 3Q90A 1K8A4 3MKIA 3OX9A 1JZOA 1RN7A 1OPYA 3NBRA 1TFOA
chains in the Genus database with same CATH topology
1O7PB 1O7NB 4WYKA 3NBBA 3WA3A 3X3YA 3BB9A 2WGOA 2CC3A 1OF5B 1LVNA 3NM2A 3UJMA 3SOAA 2KCDA 1TFKA 1SQWA 1W02A 2XGNA 3K7CA 3RGAA 3FG3A 2XSOB 3FSDA 3PS8A 1SPUA 2FGTA 4KFEA 5IF6A 1Y4KA 1OUNA 3F40A 1S5AA 3NM7A 4R80A 1JB5A 2QGUA 2UX0A 3BNCA 5I97A 1MOLA 1W00A 3NBJA 1NDOB 3F8XA 2XR8B 3FKAA 2BO9B 3CD63 3EF8A 2CFLA 1VQP3 3HI7A 1QMAA 2F98A 2GBWB 2WOHA 5CLKA 3M8CA 2B1XB 2K54A 3UL6A 2LYXA 4O2HA 4AKZA 3CMA3 3U97A 1N5HA 1UW1A 4HM6B 1QAFA 3NXJA 5EEOA 1N5PA 3ER7A 1OHSA 4WYKB 3O8YA 1QAKA 3DMCA 4N6LA 3CME3 1D6UA 5D82A 4LMIA 3BLZA 5AEUB 1MNLA 4RBNA 4WHAA 5CXOA 1K41A 4HM4B 1Q7Y4 5IEOA 5AYSC 2D1WA 2INXA 1A90A 2KXGA 4JF8A 3UB1A 1W6YA 3FG4A 1IVWA 5KP1A 1E3RA 2CFGA 4EBGA 4FR9A 4X2OA 2OQEA 1ULJB 4K1VA 1KC84 1YI23 2Q07A 2W56A 2OTJ3 1VQ53 3CC73 2FXTA 1JNQA 2P09A 3MSOA 3G0KA 3DGOA 4MEIA 2W03A 3FGYA 3AMOA 2A15A 3OW22 1K28A 4HBRA 3CXC2 5DRVA 1IQYA 2CFDA 2F86B 1ZX2A 1O7MB 5G2GA 3SXXA 1IU7A 1JKGA 2V1LA 1OCVA 3SX1A 2BMRB 5JPUA 3FLJA 3H51A 1NB3I 4XBYA 1IVXA 4BTWA 5IENA 2E2VA 3LT9A 3NQZA 3EB8A 4RZMA 4RNYA 3OWUA 3V92A 3EQQB 4QWTA 3SEDA 4G1MB 1STDA 1W01A 3GRDA 4WFOA 1SIHA 2P38A 2W56B 4FCZA 3WMDA 1JB4A 2CIUA 1OGZA 4JRFA 3DZLA 2GEXA 1IT7A 3KN4A 4ORLA 1W6GA 3JUPA 4PEJA 1ROVA 1FGTA 3N54B 1HKXA 2P0XA 3AMOB 3NV0A 1VQN3 4OK0A 3KE7A 5IG4A 1A2KA 2YFLB 2CW9A 5DREA 4AKYA 1WQLB 3GZYB 5JPPA 3JUQA 4KFDA 5KP3A 2RCDA 3PCSA 5IERA 5IG0A 1TIJA 1JKGB 3HIIA 1KSIA 1PU4A 3MYTA 4MMXB 2CK3H 2OOVC 3OV4A 4STDA 4ZM8A 1OH0A 2OCTA 3F7SA 1N8QA 4BTYA 3WODG 1FA3A 2MF7A 1UUWB 5IEPA 1FUWA 4EYCA 2IUKA 3EN1B 4I4KA 5CF1A 2Z7AA 3LTBA 5D83A 1J2BA 1CYVA 1W2ZA 3CPOA 4MMZB 3STDA 3PXMA 2YFJB 4FMAA 3EBTA 3HIGA 1NB5I 2Z6BA 5D81A 3S67A 4XBXA 1YJW3 2XGLA 3B8LA 3F9SA 3B4OA 3B7CA 1DVDA 4IIAA 3MPHA 1RRHA 3PZWA 3LYGA 1ZO2A 5AYRB 3LZAA 3NV0B 1SIIA 4N6UA 4IT7A 3EJVA 2XRXB 3WOFB 2CWTA 4FCMA 2IMJA 2ZL8A 4K1UA 3CCJ3 1YIJ3 3K63A 2O9UX 3OWSA 4N6NB 1AVKA 3DGNA 3DGMA 2WO0A 4HM3B 5IW9A 2CH9A 1N8R4 3CCU3 2CFWA 2JDIH 1AR0A 2HMLB 4WP5A 1VQ43 4FMDA 1VQL3 1OHOA 3OWYA 2E2UA 1IVVA 3HZPA 2Z76A 2STDA 5ELJA 2XF3A 1W6CA 3IJEB 4L7KA 3F7XA 3Q1CA 2HMNB 3V99A 1YIT3 1VZZA 3WA2X 3K5TA 2CWUA 2W04A 3MHEA 1EKMA 2OWPA 4XM4A 3CNMA 4H61A 4NREA 3MG3A 4X2HA 5AIFA 2SBLA 4XDWA 2QIYA 1W2B2 3LXUX 1LNHA 2XH9A 1Q824 1NU3A 3DM8A 2HMOB 1OGXA 3GWRA 4HYZA 2FNQA 3VSYA 1Q40A 4K61A 3NHXA 4BTXA 1EQKA 2XEPA 3T8UA 1N9JA 4R9LA 4GB5A 3KIIA 5EQLA 3S27A 1TUHA 2P05A 7STDA 2ML5A 3NUVA 1IV7A 1LXEA 3Q2PA 4KVHA 5TGNA 3QRDA 1WMOA 1OHPA 2CFKA 5CF2A 2L4VA 4O02B 5HGRA 3N8BA 3CPW2 3RGRA 4TX4A 1STFI 2M7OA 1QALA 3G6E3 3HX8A 5BXQA 1DYUA 1US1A 4R1KA 4CDLA 3K0ZA 1TU5A 1IT8A 1YGEA 4N6OB 1DMQA 3SLUA 3T0UA 4HZ9B 3LTAA 3G713 2OOVA 3T8NA 1VQO3 4HZBB 2OTL3 1VQ63 4FMBA 1A2VA 3CCS3 4N3VA 4KFFA 3S28A 1U5OA 5ELUA 5IG3A 2XFSA 2LQVA 2YX9A 1NJI4 1O7WB 3D9RA 1Q40B 3FZWA 3FF2A 3ECFA 1HU9A 1UUVB 1YJ93 1O7HB 1Z1SA 3I0YA 4LGQA 4MMYB 3X3XA 4Q53A 3G4S3 3CCV3 4AEQA 1QVF2 1Q42A 2YFIB 1AVLA 4LSOA 3LMLA 2CKFB 4H3UA 1GY5A 3LTCA 3F8HA 5CK6A 3EC9A 1NWWA 3SVAA 4L8PA 1ASKA 1VQ93 4WWUC 3IMAB 3ROBA 2GBXB 3WDGB 3WOEB 4FMCA 2Y73A 5JBSA 1CYUA 1KWIA 5IG5A 3JUNA 3KFQC 3TDGA 1GY6A 4U13A 2E2TA 3JUMA 2O3OA 3K9MC 2BMQB 1LOXA 5KP4A 3JUOA 1K9M4 3X42A 5FW5A 1ULIB 2Z77A 3BNDA 1YHQ3 2RFRA 2ZDJA 4XBTA 2I9WA 1IQXA 1G96A 2QA43 3U1WA 3G16A 2JQ5A 1R4CA 3JVCA 2HMJB 4HM2B 4HM8B 1UI7A 3VF1A 2BMOB 1NO3A 3B4PA 3FH1A 3KKGA 4O8SA 2B24B 2GU1A 2P0MA 1TP6A 1U8CB 2C11A 3KZTA 3E99A 3EE1A 4HVNA 3MG1A 1GY7A 3DGLA 4GL6A 1C7HA 3EBYA 5STDA 3SOYA 3OXAA 1YJN3 2C10A 4N6V0 1V74A 5AIGA 2HMKB 1JRQA 1GD4A 2CG1A 1M1XB 4HKVB 1IQ8A 1E97A 1FGMA 1FGQA 3UL5A 3BNEA 1KQS2 1WMPA 4EXRA 3S5CA 1CQSA 3GAXA 5LC6A 3X40A 1ISKA 1AV4A 1VQK3 1YVBI 3D3LA 1A67A 3CCR3 2W6JH 4IPBA 3LT8A 1K734 1M904 1WMNA 3HK4A 3MG2A 3L0RA 4J8TA 5EVHA 3EHCA 3CU3A 1D6ZA 4N6MA 3N9HA 1OACA 6STDA 1GS3A 3KSPA 2GXFA 1IK3A 3DXOA 5FGOA 4EC6A 2KRTA 1FGRA 3LOYA 3PYJA 2GEYA 1WTHA 1DVCA 2MC8A 2CG0A 3ALAA 4HM1B 4KZ1A 2IUJA 3CC23 5LC7A 1VQ73 8CHOA 3NX0A 3PGBA 3BNBA 3V98A 1GD3A 1L5GB 2R4IA 3F14A 1QVG2 1M9GA 3FG1A 4R4KA 2QEX3 4R9KA 4OUQA 5AIIA 3X3ZA 1VQ83 3NQYA 4N6TA 1JN5A 1Q814 1F8NA 1WNHA 2CHCA 1JV2B 2K0MA 2BHMA 1PFPA 2GU3A 3FF0A 4HM5B 1N9EA 1W4NA 2XFTA 4LZIA 4MJDA 2RSXA 3CCQ3 5AEWB 4J9AA 3GZRA 3J7Yd 3I553 1JJ22 3KSED 4RNZA 3EN8A 3FCSB 4NHFA 3CCM3 2D42A 3RDEA 1GYBA 3VGNA 3LTDA 1W7CA 3EX9A 2W2CA 1BUQA 2PZVA 3GZBA 1VQM3 4EV2A 3LH4A 3X41A 3G8ZA 2F99A 2W9PA 4FCJA 4L8OA 1QJGA 1SJWA 2W0QA 5A0OB 2HMMB 4XDVA 2XSHB 1ROAA 1EA2A 1IDPA 2OQEC 3S29A 1RKYA 1EG9B 3IPTA 3QK9A 3CCE3 1JN5B 1CEWI 2BT3A 1RRLA 3GZXB 5AIHA 5BVBA 3H3HA 2Y74A 4EV5A 1JB2A 1UI8A 3MWZA 4O3VA 2WGQA 4OVMA 1OF5A 1DMMA 2RGQA 2PNCA 2BNGA 4XB5A 1Q864 2ML6A 3DUKA 1IVUA 1D6YA 4HM0B 3DY5A 4LEHA 4HM7B 2W9QA 4K90B 3UNLA 1RJOA 5AI1A 3I563 1FGOA 3CCL3 2WOFA 3CNXA 4CCVA 2CWVA 1W5ZA 1S723 1DMNA 2IA7A 1T5YA 1O7GB 3CC43 3A76A 3PCRA 1E3VA 1IV9A 4HJLB 1KD14 1M1K4 3Q90A 1K8A4 3MKIA 3OX9A 1RN7A 1OPYA 3NBRA 1TFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7P B;  1O7N B;  4WYK A;  3BB9 A;  1OF5 B;  3NM2 A;  3UJM A;  3SOA A;  1W02 A;  3K7C A;  3RGA A;  2XSO B;  3FSD A;  5IF6 A;  1OUN A;  3F40 A;  1S5A A;  1JB5 A;  2QGU A;  2UX0 A;  1W00 A;  1NDO B;  3F8X A;  2XR8 B;  3FKA A;  3EF8 A;  1QMA A;  2F98 A;  2GBW B;  5CLK A;  3M8C A;  2B1X B;  2K54 A;  4HM6 B;  3NXJ A;  3ER7 A;  1OHS A;  4WYK B;  3DMC A;  5D82 A;  4LMI A;  3BLZ A;  5AEU B;  5CXO A;  1K41 A;  4HM4 B;  5IEO A;  2INX A;  1W6Y A;  5KP1 A;  1E3R A;  4X2O A;  1ULJ B;  4K1V A;  3MSO A;  3G0K A;  3FGY A;  2A15 A;  5DRV A;  2F86 B;  1ZX2 A;  1O7M B;  5G2G A;  1JKG A;  1OCV A;  2BMR B;  5JPU A;  3FLJ A;  3H51 A;  4XBY A;  5IEN A;  4RZM A;  3OWU A;  3EQQ B;  3SED A;  1STD A;  1W01 A;  3GRD A;  3WMD A;  1JB4 A;  1OGZ A;  3DZL A;  2GEX A;  4ORL A;  3JUP A;  4PEJ A;  1HKX A;  3NV0 A;  3KE7 A;  5IG4 A;  1A2K A;  2YFL B;  5DRE A;  1WQL B;  3GZY B;  5JPP A;  3JUQ A;  5KP3 A;  2RCD A;  5IER A;  5IG0 A;  1JKG B;  3MYT A;  3OV4 A;  4STD A;  1OH0 A;  3F7S A;  1UUW B;  5IEP A;  3EN1 B;  4I4K A;  5CF1 A;  2Z7A A;  5D83 A;  3CPO A;  3STD A;  2YFJ B;  3EBT A;  5D81 A;  4XBX A;  3B8L A;  3F9S A;  3B4O A;  3B7C A;  4IIA A;  3LYG A;  1ZO2 A;  3LZA A;  3NV0 B;  3EJV A;  2XRX B;  4FCM A;  2IMJ A;  4K1U A;  3OWS A;  4HM3 B;  4WP5 A;  1AR0 A;  2HML B;  1OHO A;  3OWY A;  3HZP A;  2Z76 A;  2STD A;  4L7K A;  3F7X A;  2HMN B;  1VZZ A;  3MHE A;  2OWP A;  4XM4 A;  3CNM A;  3MG3 A;  4X2H A;  5AIF A;  4XDW A;  2QIY A;  1NU3 A;  3DM8 A;  2HMO B;  1OGX A;  3GWR A;  3VSY A;  1Q40 A;  3NHX A;  3T8U A;  4R9L A;  4GB5 A;  1TUH A;  7STD A;  5TGN A;  3NUV A;  4KVH A;  1OHP A;  5CF2 A;  5HGR A;  3RGR A;  3HX8 A;  5BXQ A;  4R1K A;  4CDL A;  3K0Z A;  1DMQ A;  4HZ9 B;  3T8N A;  4HZB B;  4N3V A;  1U5O A;  5IG3 A;  1O7W B;  3D9R A;  1Q40 B;  3FZW A;  3FF2 A;  3ECF A;  1UUV B;  1O7H B;  1Z1S A;  3I0Y A;  4LGQ A;  4Q53 A;  1Q42 A;  2YFI B;  4H3U A;  2CKF B;  1GY5 A;  3F8H A;  5CK6 A;  3EC9 A;  1NWW A;  4L8P A;  1ASK A;  4WWU C;  3ROB A;  2GBX B;  5IG5 A;  3JUN A;  1GY6 A;  4U13 A;  3JUM A;  2BMQ B;  5KP4 A;  3JUO A;  5FW5 A;  1ULI B;  2Z77 A;  2RFR A;  4XBT A;  2I9W A;  3G16 A;  2JQ5 A;  2HMJ B;  4HM2 B;  4HM8 B;  2BMO B;  3B4P A;  3FH1 A;  3KKG A;  2B24 B;  1TP6 A;  3KZT A;  3E99 A;  4HVN A;  3MG1 A;  1GY7 A;  1C7H A;  3EBY A;  5STD A;  3SOY A;  3OXA A;  5AIG A;  2HMK B;  4HKV B;  1E97 A;  3S5C A;  1CQS A;  1ISK A;  3HK4 A;  3MG2 A;  4J8T A;  5EVH A;  3EHC A;  3CU3 A;  6STD A;  1GS3 A;  3KSP A;  2GXF A;  3DXO A;  2GEY A;  4HM1 B;  8CHO A;  2R4I A;  3F14 A;  4R9K A;  4OUQ A;  5AII A;  1JN5 A;  2CHC A;  4HM5 B;  3FF0 A;  4MJD A;  5AEW B;  4J9A A;  3GZR A;  3EN8 A;  1GYB A;  3VGN A;  1BUQ A;  3EX9 A;  2W2C A;  2PZV A;  3GZB A;  3G8Z A;  2F99 A;  4FCJ A;  4L8O A;  1QJG A;  1SJW A;  2HMM B;  4XDV A;  2XSH B;  1EA2 A;  1IDP A;  1EG9 B;  3IPT A;  1JN5 B;  5AIH A;  3GZX B;  5BVB A;  3H3H A;  1JB2 A;  4OVM A;  1OF5 A;  1DMM A;  2RGQ A;  2BNG A;  4XB5 A;  3DUK A;  4HM0 B;  4LEH A;  4HM7 B;  3UNL A;  5AI1 A;  3CNX A;  1DMN A;  1O7G B;  3A76 A;  1E3V A;  4HJL B;  3Q90 A;  3MKI A;  3OX9 A;  1OPY A;  3NBR A; 
#chains in the Genus database with same CATH topology
 1O7P B;  9RNT A;  1O7N B;  4WYK A;  3NBB A;  3WA3 A;  1C54 A;  3X3Y A;  1JZD A;  1MGR A;  3BB9 A;  2WGO A;  2CC3 A;  1OF5 B;  1LVN A;  3NM2 A;  3UJM A;  3SOA A;  1BRH A;  2KCD A;  1TFK A;  1SQW A;  1W02 A;  2XGN A;  3K7C A;  3RGA A;  3DGY A;  3FG3 A;  2XSO B;  3FSD A;  1UGH I;  1SPU A;  3PS8 A;  2FGT A;  4KFE A;  5IF6 A;  2KF3 A;  1Y4K A;  1OUN A;  3F40 A;  4EW5 A;  1S5A A;  3AHW A;  3NM7 A;  1JB5 A;  2QGU A;  2UX0 A;  3BNC A;  4R80 A;  1MOL A;  4BL3 A;  1W00 A;  5I97 A;  2SAR A;  5RNT A;  3NBJ A;  1FZU A;  1NDO B;  1TTO A;  3F8X A;  2XR8 B;  3FKA A;  1B2U A;  2BO9 B;  3CD6 3;  3EF8 A;  2CFL A;  1VQP 3;  3HI7 A;  1QMA A;  2F98 A;  2GBW B;  2WOH A;  5CLK A;  3M8C A;  2B1X B;  2CX0 A;  2K54 A;  1UCI A;  3UL6 A;  1BOX A;  2LYX A;  1B27 A;  4O2H A;  4AKZ A;  3CMA 3;  3U97 A;  1RGE A;  1N5H A;  1UW1 A;  1SAR A;  3AGN A;  4BU4 A;  1EEJ A;  4HM6 B;  1QAF A;  3NXJ A;  5EEO A;  1B2M A;  1N5P A;  3ER7 A;  1OHS A;  2R41 A;  4WYK B;  3O8Y A;  1QAK A;  3DMC A;  4N6L A;  4RNT A;  1D6U A;  1I70 A;  3CME 3;  1T2I A;  5D82 A;  4LMI A;  3BLZ A;  5AEU B;  1MNL A;  4RBN A;  4WHA A;  5CXO A;  1K41 A;  4HM4 B;  1Q7Y 4;  5IEO A;  1YNV X;  5AYS C;  2D1W A;  2INX A;  1I8V A;  1RCL A;  1A90 A;  2KXG A;  4JF8 A;  3UB1 A;  1HZ1 A;  1W6Y A;  2BIR A;  3FG4 A;  1IVW A;  1RGG A;  5KP1 A;  1E3R A;  1RGL A;  2CFG A;  4EBG A;  4FR9 A;  4X2O A;  2OQE A;  1ULJ B;  4K1V A;  1KC8 4;  1YI2 3;  1Q7H A;  2Q07 A;  3HOH A;  1JBT A;  1GMQ A;  1LOV A;  2H0I A;  2W56 A;  1VQ5 3;  2OTJ 3;  4BIR A;  1MWS A;  3CC7 3;  2FXT A;  1JNQ A;  2P09 A;  3MSO A;  3G0K A;  3DGO A;  4MEI A;  1I2F A;  1UCJ A;  1BRS A;  2W03 A;  2IYJ A;  3FGY A;  3AMO A;  2A15 A;  3OW2 2;  1K28 A;  4HBR A;  3CXC 2;  1RGC A;  5DRV A;  1IQY A;  2CFD A;  2F86 B;  1ZX2 A;  1O7M B;  5G2G A;  1BAN A;  1RN4 A;  3SXX A;  1IU7 A;  1JKG A;  2V1L A;  1OCV A;  3SX1 A;  2BMR B;  5JPU A;  3FLJ A;  3H51 A;  1NB3 I;  4XBY A;  1IVX A;  1RGK A;  4BTW A;  5IEN A;  2E2V A;  3LT9 A;  1RNB A;  1RMS A;  3NQZ A;  3URP A;  3EB8 A;  4RZM A;  4RNY A;  3OWU A;  3V92 A;  1G0T A;  3EQQ B;  4QWT A;  3SED A;  4G1M B;  1STD A;  1B2Z A;  1W01 A;  1G02 A;  3GRD A;  4WFO A;  1SIH A;  2P38 A;  2W56 B;  4FCZ A;  1AQZ A;  1MGW A;  3WMD A;  1JB4 A;  2CIU A;  1OGZ A;  4JRF A;  3DZL A;  1DET A;  2GEX A;  1IT7 A;  1BRG A;  1X1X A;  3KN4 A;  4ORL A;  1W6G A;  3JUP A;  4PEJ A;  2F5M A;  1ROV A;  1FGT A;  3N54 B;  1HKX A;  2P0X A;  7GSP A;  4ILF A;  1FYS A;  3AMO B;  3NV0 A;  1VQN 3;  4OK0 A;  3KE7 A;  5IG4 A;  1A2K A;  2YFL B;  1GMR A;  2CW9 A;  5DRE A;  4AKY A;  1WQL B;  3GZY B;  5JPP A;  1RNT A;  3JUQ A;  4KFD A;  5KP3 A;  2RCD A;  3PCS A;  5IER A;  5IG0 A;  1TIJ A;  1JKG B;  3HII A;  1KSI A;  1T2H A;  1V58 A;  1PU4 A;  1BUJ A;  3MYT A;  4MMX B;  1BU4 A;  1GOY A;  5GSP A;  2CK3 H;  2OOV C;  3OV4 A;  4STD A;  5G1L A;  4ZM8 A;  1OH0 A;  3WHO A;  1NNV A;  2OCT A;  1N8Q A;  3F7S A;  4BTY A;  3WOD G;  1LQM B;  1UUG B;  1FA3 A;  2MF7 A;  1UUW B;  5IEP A;  1FUW A;  4EYC A;  2IUK A;  3EN1 B;  4I4K A;  5CF1 A;  2Z7A A;  3LTB A;  7RNT A;  5D83 A;  1J2B A;  1CYV A;  1W2Z A;  3CPO A;  1A2P A;  1Q9E A;  4MMZ B;  3STD A;  3PXM A;  2YFJ B;  4FMA A;  1BAO A;  3EBT A;  3HIG A;  1NB5 I;  2Z6B A;  1BRI A;  5D81 A;  5M19 A;  2K3D A;  3S67 A;  4XBX A;  1YJW 3;  2XGL A;  3B8L A;  3F9S A;  3B4O A;  3B7C A;  3RNT A;  1DVD A;  3ZG0 A;  4J5K A;  1VQQ A;  4IIA A;  3MPH A;  2F5W A;  1RRH A;  3PZW A;  3LYG A;  1JBR A;  1ZO2 A;  5AYR B;  3LZA A;  3NV0 B;  2KF6 A;  2UUG C;  1RGH A;  1SII A;  1BNI A;  4N6U A;  4IT7 A;  3EJV A;  1RDS A;  2XRX B;  3WOF B;  2CWT A;  4FCM A;  2IMJ A;  2ZL8 A;  4K1U A;  3CCJ 3;  1YIJ 3;  4NPB A;  3K63 A;  1I2G A;  2O9U X;  3OWS A;  4N6N B;  1AVK A;  3DGN A;  3DGM A;  2WO0 A;  1B2S A;  4HM3 B;  5IW9 A;  2CH9 A;  5G1K A;  1N8R 4;  3CCU 3;  2CFW A;  2JDI H;  1AR0 A;  2HML B;  4WP5 A;  1VQ4 3;  4FMD A;  1VQL 3;  1UGI A;  1OHO A;  3OWY A;  2E2U A;  1BNJ A;  1IVV A;  1I2E A;  3HZP A;  1I3I A;  2Z76 A;  1JBS A;  2STD A;  5ELJ A;  2XF3 A;  1W6C A;  3IJE B;  4L7K A;  3F7X A;  3Q1C A;  2HMN B;  3V99 A;  1YIT 3;  1BIR A;  1VZZ A;  3WA2 X;  3K5T A;  2CWU A;  1BSC A;  2W04 A;  3MHE A;  1EKM A;  1GSP A;  2OWP A;  1FW7 A;  4XM4 A;  3CNM A;  4H61 A;  4NRE A;  3MG3 A;  4X2H A;  5AIF A;  2SBL A;  4XDW A;  2QIY A;  1LOW A;  1CH0 A;  1W2B 2;  3LXU X;  1I0X A;  3AHS A;  1LNH A;  2XH9 A;  2J8X B;  1Q82 4;  1NU3 A;  3DM8 A;  2HMO B;  1OGX A;  3GWR A;  4HYZ A;  2FNQ A;  3VSY A;  1Q40 A;  4K61 A;  3NHX A;  4BTX A;  6RNT A;  1UDI I;  4KT3 B;  1EQK A;  2XEP A;  3T8U A;  1N9J A;  4R9L A;  4GB5 A;  3KII A;  5EQL A;  3S27 A;  1TUH A;  2P05 A;  7STD A;  2ML5 A;  3NUV A;  1IV7 A;  1LXE A;  2HOH A;  3Q2P A;  4KVH A;  3QRD A;  1T3B A;  1WMO A;  1TJD A;  1OHP A;  1LNI A;  2CFK A;  5CF2 A;  2L4V A;  4O02 B;  5HGR A;  2KF4 A;  3N8B A;  3CPW 2;  3RGR A;  4TX4 A;  1STF I;  2M7O A;  1QAL A;  1PYL A;  3G6E 3;  3HX8 A;  5BXQ A;  1V57 A;  1DYU A;  1BGS A;  1US1 A;  4R1K A;  4CDL A;  3K0Z A;  1B2X A;  1TU5 A;  3D79 A;  1IT8 A;  1YGW A;  1YGE A;  4N6O B;  1BNE A;  1DMQ A;  3SLU A;  3T0U A;  1X1U A;  4HZ9 B;  3LTA A;  3G71 3;  2OOV A;  3T8N A;  1VQO 3;  4HZB B;  2OTL 3;  1VQ6 3;  4FMB A;  1A2V A;  3CCS 3;  4N3V A;  4KFF A;  3S28 A;  1U5O A;  5ELU A;  5IG3 A;  2XFS A;  2LQV A;  2YX9 A;  1X1Y A;  1O7W B;  3D9R A;  4I5Q A;  1NJI 4;  1Q40 B;  3FZW A;  3FF2 A;  3ECF A;  1HU9 A;  1UUV B;  1YJ9 3;  6GSP A;  1DE3 A;  1PY3 A;  1O7H B;  1Z1S A;  3I0Y A;  4LGQ A;  4MMY B;  3X3X A;  4Q53 A;  3G4S 3;  3CCV 3;  4AEQ A;  1QVF 2;  1LRA A;  1GOU A;  1Q42 A;  2YFI B;  1BNG A;  1TRQ A;  1RHL A;  3SYU A;  2ZHX B;  1AVL A;  4LSO A;  1RLS A;  1UCL A;  3LML A;  2CKF B;  4H3U A;  1GY5 A;  3LTC A;  3D5G A;  3F8H A;  5CK6 A;  2H0H A;  3EC9 A;  1NWW A;  3SVA A;  1GMP A;  4L8P A;  1ASK A;  1VQ9 3;  4WWU C;  3IMA B;  3ROB A;  2GBX B;  3WDG B;  1LOY A;  3WOE B;  4FMC A;  2Y73 A;  5JBS A;  1CYU A;  1KWI A;  1MWU A;  1GOV A;  5IG5 A;  3JUN A;  3KFQ C;  3TDG A;  1GY6 A;  4U13 A;  1BRK A;  2E2T A;  2KAA A;  3JUM A;  2O3O A;  3K9M C;  2BMQ B;  1RN1 A;  1YVS A;  1B20 A;  1AY7 A;  1LOX A;  2H0G A;  5KP4 A;  3JUO A;  1K9M 4;  3X42 A;  5FW5 A;  1ULI B;  2Z77 A;  3BND A;  4DKI A;  1YHQ 3;  1MWT A;  2RFR A;  2ZDJ A;  2I9W A;  1IQX A;  1G96 A;  4XBT A;  2QA4 3;  3U1W A;  3G16 A;  1I0V A;  2JQ5 A;  1R4C A;  2RNT A;  3JVC A;  2HMJ B;  4HM2 B;  4HM8 B;  1UI7 A;  1BRJ A;  3VF1 A;  2BMO B;  1NO3 A;  5M18 A;  1B3S A;  3B4P A;  3FH1 A;  3KKG A;  4O8S A;  2B24 B;  1RTU A;  3BU4 A;  1IYY A;  2GU1 A;  2P0M A;  1RSN A;  1TP6 A;  1U8C B;  2BU4 A;  2C11 A;  3KZT A;  3E99 A;  3EE1 A;  4HVN A;  3MG1 A;  5BU4 A;  1GY7 A;  3DGL A;  1EUI C;  4GL6 A;  1C7H A;  3EBY A;  5STD A;  3SOY A;  3OXA A;  1YJN 3;  2C10 A;  4J5G A;  3D5I A;  4N6V 0;  1V74 A;  2C4B A;  5AIG A;  2HMK B;  5BIR A;  1JRQ A;  1GD4 A;  2CG1 A;  1M1X B;  1HYF A;  4HKV B;  1IQ8 A;  3WR2 A;  1E97 A;  1FGM A;  1FGQ A;  3UL5 A;  3BNE A;  1KQS 2;  1WMP A;  4EXR A;  3DH2 A;  3S5C A;  1MWR A;  1CQS A;  3GAX A;  5LC6 A;  3X40 A;  1BNR A;  1ISK A;  1AV4 A;  1VQK 3;  1YVB I;  2IY2 A;  3D3L A;  1A67 A;  3CCR 3;  2W6J H;  4IPB A;  3D4A A;  3LT8 A;  1K73 4;  1M90 4;  1WMN A;  3HK4 A;  3MG2 A;  3L0R A;  4J8T A;  5EVH A;  8RNT A;  3EHC A;  4CPK A;  3CU3 A;  1D6Z A;  4N6M A;  3N9H A;  1OAC A;  6STD A;  1TRP A;  1GS3 A;  3A5E A;  3KSP A;  2GXF A;  1IK3 A;  3DXO A;  5FGO A;  4EC6 A;  1RCK A;  2F56 A;  2KRT A;  1FGR A;  1RGF A;  2AAD A;  3LOY A;  3PYJ A;  2CX1 A;  4HAA A;  2GEY A;  1BNS A;  4HOH A;  1WTH A;  1DVC A;  2MC8 A;  2CG0 A;  3ALA A;  4HM1 B;  4KZ1 A;  2IUJ A;  3CC2 3;  5LC7 A;  1VQ7 3;  8CHO A;  4GSP A;  3NX0 A;  3PGB A;  3BNB A;  3ZG5 A;  3V98 A;  3GSP A;  1GD3 A;  1L5G B;  2R4I A;  1RGA A;  2F4Y A;  3F14 A;  1QVG 2;  4GHO A;  1FUS A;  1R4Y A;  1M9G A;  3FG1 A;  4R4K A;  2QEX 3;  4R9K A;  4OUQ A;  5AII A;  3X3Z A;  1VQ8 3;  3NQY A;  4N6T A;  1JN5 A;  1Q81 4;  1F8N A;  1WNH A;  4BL2 A;  2CHC A;  1JV2 B;  2K0M A;  2BHM A;  1PFP A;  2GU3 A;  3FF0 A;  4HM5 B;  1N9E A;  1W4N A;  2XFT A;  4LZI A;  4MJD A;  1UCK A;  2RSX A;  3CCQ 3;  1ZS7 A;  1BSA A;  5AEW B;  4J9A A;  3AGO A;  3GZR A;  3J7Y d;  3I55 3;  1JJ2 2;  2AAE A;  1BSE A;  3KSE D;  4RNZ A;  3EN8 A;  1X1W A;  3FCS B;  4NHF A;  3CCM 3;  2D42 A;  3RDE A;  1GYB A;  3VGN A;  3LTD A;  1W7C A;  3EX9 A;  2W2C A;  1BUQ A;  2L1S A;  1FUT A;  1ZGX A;  2PZV A;  3GZB A;  1VQM 3;  1BNF A;  4EV2 A;  3LH4 A;  4CJN A;  2RBI A;  3X41 A;  3G8Z A;  2F99 A;  2W9P A;  4FCJ A;  4L8O A;  1QJG A;  1SJW A;  2W0Q A;  5A0O B;  2HMM B;  4XDV A;  2XSH B;  1ROA A;  5TGN A;  1EA2 A;  1IDP A;  2OQE C;  1B21 A;  3S29 A;  1RKY A;  1EG9 B;  3IPT A;  3QK9 A;  3CCE 3;  1JN5 B;  1CEW I;  1I3F A;  1RRL A;  2BT3 A;  3GZX B;  5AIH A;  5BVB A;  3H3H A;  2Y74 A;  4EV5 A;  1JB2 A;  1UI8 A;  3MWZ A;  4O3V A;  1LQG C;  2WGQ A;  3KCH A;  4OVM A;  1OF5 A;  1DMM A;  5M1A A;  1BSD A;  3BIR A;  2RGQ A;  4LYL B;  1BRN L;  2PNC A;  2BNG A;  4XB5 A;  1Q86 4;  2ML6 A;  3DUK A;  1IVU A;  1D6Y A;  4HM0 B;  3DY5 A;  1BSB A;  2UGI A;  4LEH A;  2KF5 A;  4HM7 B;  2W9Q A;  4K90 B;  3UNL A;  1RJO A;  3Q3F A;  5AI1 A;  1FGO A;  3I56 3;  3CCL 3;  5HOH A;  2WOF A;  3CNX A;  4CCV A;  2CWV A;  3ZFZ A;  1W5Z A;  2ZA4 A;  1S72 3;  1DMN A;  2IA7 A;  1T5Y A;  1O7G B;  3CC4 3;  3A76 A;  3PCR A;  1E3V A;  1IV9 A;  2GSP A;  4HJL B;  1KD1 4;  1M1K 4;  1BVI A;  3Q90 A;  1K8A 4;  3MKI A;  3OX9 A;  1JZO A;  1RN7 A;  1OPY A;  3NBR A;  1TFO A; 
#chains in the Genus database with same CATH homology
 1O7P B;  1O7N B;  4WYK A;  3NBB A;  3WA3 A;  3X3Y A;  3BB9 A;  2WGO A;  2CC3 A;  1OF5 B;  1LVN A;  3NM2 A;  3UJM A;  3SOA A;  2KCD A;  1TFK A;  1SQW A;  1W02 A;  2XGN A;  3K7C A;  3RGA A;  3FG3 A;  2XSO B;  3FSD A;  3PS8 A;  1SPU A;  2FGT A;  4KFE A;  5IF6 A;  1Y4K A;  1OUN A;  3F40 A;  1S5A A;  3NM7 A;  4R80 A;  1JB5 A;  2QGU A;  2UX0 A;  3BNC A;  5I97 A;  1MOL A;  1W00 A;  3NBJ A;  1NDO B;  3F8X A;  2XR8 B;  3FKA A;  2BO9 B;  3CD6 3;  3EF8 A;  2CFL A;  1VQP 3;  3HI7 A;  1QMA A;  2F98 A;  2GBW B;  2WOH A;  5CLK A;  3M8C A;  2B1X B;  2K54 A;  3UL6 A;  2LYX A;  4O2H A;  4AKZ A;  3CMA 3;  3U97 A;  1N5H A;  1UW1 A;  4HM6 B;  1QAF A;  3NXJ A;  5EEO A;  1N5P A;  3ER7 A;  1OHS A;  4WYK B;  3O8Y A;  1QAK A;  3DMC A;  4N6L A;  3CME 3;  1D6U A;  5D82 A;  4LMI A;  3BLZ A;  5AEU B;  1MNL A;  4RBN A;  4WHA A;  5CXO A;  1K41 A;  4HM4 B;  1Q7Y 4;  5IEO A;  5AYS C;  2D1W A;  2INX A;  1A90 A;  2KXG A;  4JF8 A;  3UB1 A;  1W6Y A;  3FG4 A;  1IVW A;  5KP1 A;  1E3R A;  2CFG A;  4EBG A;  4FR9 A;  4X2O A;  2OQE A;  1ULJ B;  4K1V A;  1KC8 4;  1YI2 3;  2Q07 A;  2W56 A;  2OTJ 3;  1VQ5 3;  3CC7 3;  2FXT A;  1JNQ A;  2P09 A;  3MSO A;  3G0K A;  3DGO A;  4MEI A;  2W03 A;  3FGY A;  3AMO A;  2A15 A;  3OW2 2;  1K28 A;  4HBR A;  3CXC 2;  5DRV A;  1IQY A;  2CFD A;  2F86 B;  1ZX2 A;  1O7M B;  5G2G A;  3SXX A;  1IU7 A;  1JKG A;  2V1L A;  1OCV A;  3SX1 A;  2BMR B;  5JPU A;  3FLJ A;  3H51 A;  1NB3 I;  4XBY A;  1IVX A;  4BTW A;  5IEN A;  2E2V A;  3LT9 A;  3NQZ A;  3EB8 A;  4RZM A;  4RNY A;  3OWU A;  3V92 A;  3EQQ B;  4QWT A;  3SED A;  4G1M B;  1STD A;  1W01 A;  3GRD A;  4WFO A;  1SIH A;  2P38 A;  2W56 B;  4FCZ A;  3WMD A;  1JB4 A;  2CIU A;  1OGZ A;  4JRF A;  3DZL A;  2GEX A;  1IT7 A;  3KN4 A;  4ORL A;  1W6G A;  3JUP A;  4PEJ A;  1ROV A;  1FGT A;  3N54 B;  1HKX A;  2P0X A;  3AMO B;  3NV0 A;  1VQN 3;  4OK0 A;  3KE7 A;  5IG4 A;  1A2K A;  2YFL B;  2CW9 A;  5DRE A;  4AKY A;  1WQL B;  3GZY B;  5JPP A;  3JUQ A;  4KFD A;  5KP3 A;  2RCD A;  3PCS A;  5IER A;  5IG0 A;  1TIJ A;  1JKG B;  3HII A;  1KSI A;  1PU4 A;  3MYT A;  4MMX B;  2CK3 H;  2OOV C;  3OV4 A;  4STD A;  4ZM8 A;  1OH0 A;  2OCT A;  3F7S A;  1N8Q A;  4BTY A;  3WOD G;  1FA3 A;  2MF7 A;  1UUW B;  5IEP A;  1FUW A;  4EYC A;  2IUK A;  3EN1 B;  4I4K A;  5CF1 A;  2Z7A A;  3LTB A;  5D83 A;  1J2B A;  1CYV A;  1W2Z A;  3CPO A;  4MMZ B;  3STD A;  3PXM A;  2YFJ B;  4FMA A;  3EBT A;  3HIG A;  1NB5 I;  2Z6B A;  5D81 A;  3S67 A;  4XBX A;  1YJW 3;  2XGL A;  3B8L A;  3F9S A;  3B4O A;  3B7C A;  1DVD A;  4IIA A;  3MPH A;  1RRH A;  3PZW A;  3LYG A;  1ZO2 A;  5AYR B;  3LZA A;  3NV0 B;  1SII A;  4N6U A;  4IT7 A;  3EJV A;  2XRX B;  3WOF B;  2CWT A;  4FCM A;  2IMJ A;  2ZL8 A;  4K1U A;  3CCJ 3;  1YIJ 3;  3K63 A;  2O9U X;  3OWS A;  4N6N B;  1AVK A;  3DGN A;  3DGM A;  2WO0 A;  4HM3 B;  5IW9 A;  2CH9 A;  1N8R 4;  3CCU 3;  2CFW A;  2JDI H;  1AR0 A;  2HML B;  4WP5 A;  1VQ4 3;  4FMD A;  1VQL 3;  1OHO A;  3OWY A;  2E2U A;  1IVV A;  3HZP A;  2Z76 A;  2STD A;  5ELJ A;  2XF3 A;  1W6C A;  3IJE B;  4L7K A;  3F7X A;  3Q1C A;  2HMN B;  3V99 A;  1YIT 3;  1VZZ A;  3WA2 X;  3K5T A;  2CWU A;  2W04 A;  3MHE A;  1EKM A;  2OWP A;  4XM4 A;  3CNM A;  4H61 A;  4NRE A;  3MG3 A;  4X2H A;  5AIF A;  2SBL A;  4XDW A;  2QIY A;  1W2B 2;  3LXU X;  1LNH A;  2XH9 A;  1Q82 4;  1NU3 A;  3DM8 A;  2HMO B;  1OGX A;  3GWR A;  4HYZ A;  2FNQ A;  3VSY A;  1Q40 A;  4K61 A;  3NHX A;  4BTX A;  1EQK A;  2XEP A;  3T8U A;  1N9J A;  4R9L A;  4GB5 A;  3KII A;  5EQL A;  3S27 A;  1TUH A;  2P05 A;  7STD A;  2ML5 A;  3NUV A;  1IV7 A;  1LXE A;  3Q2P A;  4KVH A;  5TGN A;  3QRD A;  1WMO A;  1OHP A;  2CFK A;  5CF2 A;  2L4V A;  4O02 B;  5HGR A;  3N8B A;  3CPW 2;  3RGR A;  4TX4 A;  1STF I;  2M7O A;  1QAL A;  3G6E 3;  3HX8 A;  5BXQ A;  1DYU A;  1US1 A;  4R1K A;  4CDL A;  3K0Z A;  1TU5 A;  1IT8 A;  1YGE A;  4N6O B;  1DMQ A;  3SLU A;  3T0U A;  4HZ9 B;  3LTA A;  3G71 3;  2OOV A;  3T8N A;  1VQO 3;  4HZB B;  2OTL 3;  1VQ6 3;  4FMB A;  1A2V A;  3CCS 3;  4N3V A;  4KFF A;  3S28 A;  1U5O A;  5ELU A;  5IG3 A;  2XFS A;  2LQV A;  2YX9 A;  1NJI 4;  1O7W B;  3D9R A;  1Q40 B;  3FZW A;  3FF2 A;  3ECF A;  1HU9 A;  1UUV B;  1YJ9 3;  1O7H B;  1Z1S A;  3I0Y A;  4LGQ A;  4MMY B;  3X3X A;  4Q53 A;  3G4S 3;  3CCV 3;  4AEQ A;  1QVF 2;  1Q42 A;  2YFI B;  1AVL A;  4LSO A;  3LML A;  2CKF B;  4H3U A;  1GY5 A;  3LTC A;  3F8H A;  5CK6 A;  3EC9 A;  1NWW A;  3SVA A;  4L8P A;  1ASK A;  1VQ9 3;  4WWU C;  3IMA B;  3ROB A;  2GBX B;  3WDG B;  3WOE B;  4FMC A;  2Y73 A;  5JBS A;  1CYU A;  1KWI A;  5IG5 A;  3JUN A;  3KFQ C;  3TDG A;  1GY6 A;  4U13 A;  2E2T A;  3JUM A;  2O3O A;  3K9M C;  2BMQ B;  1LOX A;  5KP4 A;  3JUO A;  1K9M 4;  3X42 A;  5FW5 A;  1ULI B;  2Z77 A;  3BND A;  1YHQ 3;  2RFR A;  2ZDJ A;  4XBT A;  2I9W A;  1IQX A;  1G96 A;  2QA4 3;  3U1W A;  3G16 A;  2JQ5 A;  1R4C A;  3JVC A;  2HMJ B;  4HM2 B;  4HM8 B;  1UI7 A;  3VF1 A;  2BMO B;  1NO3 A;  3B4P A;  3FH1 A;  3KKG A;  4O8S A;  2B24 B;  2GU1 A;  2P0M A;  1TP6 A;  1U8C B;  2C11 A;  3KZT A;  3E99 A;  3EE1 A;  4HVN A;  3MG1 A;  1GY7 A;  3DGL A;  4GL6 A;  1C7H A;  3EBY A;  5STD A;  3SOY A;  3OXA A;  1YJN 3;  2C10 A;  4N6V 0;  1V74 A;  5AIG A;  2HMK B;  1JRQ A;  1GD4 A;  2CG1 A;  1M1X B;  4HKV B;  1IQ8 A;  1E97 A;  1FGM A;  1FGQ A;  3UL5 A;  3BNE A;  1KQS 2;  1WMP A;  4EXR A;  3S5C A;  1CQS A;  3GAX A;  5LC6 A;  3X40 A;  1ISK A;  1AV4 A;  1VQK 3;  1YVB I;  3D3L A;  1A67 A;  3CCR 3;  2W6J H;  4IPB A;  3LT8 A;  1K73 4;  1M90 4;  1WMN A;  3HK4 A;  3MG2 A;  3L0R A;  4J8T A;  5EVH A;  3EHC A;  3CU3 A;  1D6Z A;  4N6M A;  3N9H A;  1OAC A;  6STD A;  1GS3 A;  3KSP A;  2GXF A;  1IK3 A;  3DXO A;  5FGO A;  4EC6 A;  2KRT A;  1FGR A;  3LOY A;  3PYJ A;  2GEY A;  1WTH A;  1DVC A;  2MC8 A;  2CG0 A;  3ALA A;  4HM1 B;  4KZ1 A;  2IUJ A;  3CC2 3;  5LC7 A;  1VQ7 3;  8CHO A;  3NX0 A;  3PGB A;  3BNB A;  3V98 A;  1GD3 A;  1L5G B;  2R4I A;  3F14 A;  1QVG 2;  1M9G A;  3FG1 A;  4R4K A;  2QEX 3;  4R9K A;  4OUQ A;  5AII A;  3X3Z A;  1VQ8 3;  3NQY A;  4N6T A;  1JN5 A;  1Q81 4;  1F8N A;  1WNH A;  2CHC A;  1JV2 B;  2K0M A;  2BHM A;  1PFP A;  2GU3 A;  3FF0 A;  4HM5 B;  1N9E A;  1W4N A;  2XFT A;  4LZI A;  4MJD A;  2RSX A;  3CCQ 3;  5AEW B;  4J9A A;  3GZR A;  3J7Y d;  3I55 3;  1JJ2 2;  3KSE D;  4RNZ A;  3EN8 A;  3FCS B;  4NHF A;  3CCM 3;  2D42 A;  3RDE A;  1GYB A;  3VGN A;  3LTD A;  1W7C A;  3EX9 A;  2W2C A;  1BUQ A;  2PZV A;  3GZB A;  1VQM 3;  4EV2 A;  3LH4 A;  3X41 A;  3G8Z A;  2F99 A;  2W9P A;  4FCJ A;  4L8O A;  1QJG A;  1SJW A;  2W0Q A;  5A0O B;  2HMM B;  4XDV A;  2XSH B;  1ROA A;  1EA2 A;  1IDP A;  2OQE C;  3S29 A;  1RKY A;  1EG9 B;  3IPT A;  3QK9 A;  3CCE 3;  1JN5 B;  1CEW I;  2BT3 A;  1RRL A;  3GZX B;  5AIH A;  5BVB A;  3H3H A;  2Y74 A;  4EV5 A;  1JB2 A;  1UI8 A;  3MWZ A;  4O3V A;  2WGQ A;  4OVM A;  1OF5 A;  1DMM A;  2RGQ A;  2PNC A;  2BNG A;  4XB5 A;  1Q86 4;  2ML6 A;  3DUK A;  1IVU A;  1D6Y A;  4HM0 B;  3DY5 A;  4LEH A;  4HM7 B;  2W9Q A;  4K90 B;  3UNL A;  1RJO A;  5AI1 A;  3I56 3;  1FGO A;  3CCL 3;  2WOF A;  3CNX A;  4CCV A;  2CWV A;  1W5Z A;  1S72 3;  1DMN A;  2IA7 A;  1T5Y A;  1O7G B;  3CC4 3;  3A76 A;  3PCR A;  1E3V A;  1IV9 A;  4HJL B;  1KD1 4;  1M1K 4;  3Q90 A;  1K8A 4;  3MKI A;  3OX9 A;  1RN7 A;  1OPY A;  3NBR A;  1TFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...