5TGNA

Crystal structure of protein sthe_2403 from sphaerobacter thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
AMAAIDLAREYISRVNGRDGSGAAALFAQDGEIIAPVGRVYRGWDAIAAFIEAAPPATTAQIAERTMGTHRVVLHGVVQTPRFAPAQIEWIFDVDGDRIRRLTINHLRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of protein Sthe_2403 from Sphaerobacter thermophilus
rcsb
source organism Sphaerobacter thermophilus
molecule tags Unknown function
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5tgnA00
5AIIA 1ZO2A 4R1KA 3OWSA 1STDA 3GZRA 1GY6A 2XR8B 1JB2A 2CHCA 3F8XA 4KVHA 3ECFA 2YFIB 1OPYA 2B24B 4HJLB 3EN8A 2PZVA 3CU3A 5TGNA 5AEWB 3B8LA 4GB5A 3Q90A 1W6YA 2INXA 2XRXB 1O7PB 5D83A 1W00A 5IERA 3JUNA 1VZZA 5AIFA 3CNXA 3EQQB 3DM8A 2HMKB 5IF6A 3B7CA 1O7MB 5CXOA 4FCJA 3EJVA 1WQLB 3M8CA 4I4KA 4L8OA 5JPUA 3BB9A 5AEUB 1JKGB 4WYKA 3UJMA 1OHPA 3GRDA 5IG0A 3LYGA 2BMRB 3DZLA 5CF2A 1Q40B 8CHOA 1JN5B 4HM1B 3EHCA 3HX8A 4XBXA 1IDPA 2F99A 3SOYA 1JB5A 3IPTA 4LGQA 1S5AA 4HZBB 3F7XA 3WMDA 5IG5A 2RCDA 1ASKA 3FKAA 3NV0B 4HM0B 1EG9B 4OVMA 4N3VA 3SEDA 5JPPA 5IENA 4HM5B 1CQSA 4K1UA 2Z7AA 2RFRA 3B4PA 2HMJB 3MSOA 1AR0A 5DREA 3G0KA 2GEXA 3BLZA 3DMCA 1TP6A 1JKGA 1UUWB 5EVHA 3G8ZA 5AIGA 1OHSA 1Q40A 3T8NA 1JN5A 3EF8A 4X2OA 4L8PA 3VGNA 2GEYA 1EA2A 1E97A 3EBYA 3HK4A 3FF0A 3NXJA 4HM6B 2HMNB 4HM4B 3DXOA 1O7GB 3KZTA 4XBTA 3ROBA 1OF5B 2GBWB 3RGRA 2STDA 2B1XB 3NV0A 4LMIA 5AI1A 5IG3A 3F40A 4ORLA 3FSDA 1NDOB 1U5OA 3VSYA 2XSOB 4OUQA 5DRVA 4HVNA 5D81A 3FZWA 1UUVB 3HZPA 3F9SA 3NUVA 5STDA 1K41A 1TUHA 4HM8B 3FF2A 1OH0A 3LZAA 3D9RA 3OXAA 3H3HA 5HGRA 1DMMA 1NU3A 3OX9A 5IEPA 3GZXB 4HM3B 3E99A 2I9WA 3KSPA 3JUMA 7STDA 5AIHA 4XM4A 3SOAA 2JQ5A 1QJGA 3GWRA 2K54A 1E3RA 4HM2B 5IG4A 2F86B 3STDA 1ULJB 3EN1B 1W02A 3FGYA 3F14A 2OWPA 2BMQB 1DMNA 3I0YA 3MG3A 5CF1A 3NM2A 3EC9A 4WWUC 3CPOA 3NHXA 1OF5A 2YFLB 4HKVB 4K1VA 2HMLB 4XDVA 2RGQA 2QGUA 1O7NB 3MKIA 1OGZA 2Z77A 1GYBA 4MJDA 1Q42A 3T8UA 2QIYA 1ZX2A 2GBXB 3OWYA 1O7HB 2XSHB 3OWUA 1Z1SA 2F98A 4CDLA 4XBYA 4R9KA 3GZYB 1E3VA 3MHEA 2CKFB 2GXFA 3NBRA 1DMQA 3B4OA 4FCMA 4STDA 3F7SA 3S5CA 4L7KA 1ULIB 1QMAA 5CK6A 2Z76A 3RGAA 3KE7A 1SJWA 4XB5A 2IMJA 6STDA 3ER7A 1HKXA 5G2GA 4J8TA 5IEOA 5BVBA 1BUQA 4HM7B 1JB4A 4J9AA 3MG1A 2YFJB 3K0ZA 3DUKA 4HZ9B 1W01A 4IIAA 3FH1A 1O7WB 4RZMA 5KP3A 3UNLA 3EBTA 4PEJA 4LEHA 3KKGA 1ISKA 5KP4A 2R4IA 4X2HA 4H3UA 3JUQA 4Q53A 1A2KA 4WP5A 3CNMA 2A15A 2HMOB 4XDWA 1OUNA 3OV4A 5FW5A 3FLJA 2HMMB 1GS3A 1GY7A 3G16A 3GZBA 5KP1A 2BMOB 2W2CA 3JUPA 2BNGA 4U13A 2UX0A 1C7HA 3JUOA 3MG2A 3A76A 3EX9A 1OHOA 3K7CA 1GY5A 1OCVA 1OGXA 3F8HA 3MYTA 5CLKA 4R9LA 4WYKB 5D82A 3H51A 1NWWA 5BXQA
chains in the Genus database with same CATH superfamily
1W4NA 5AIIA 3BNEA 1LRAA 2W56B 3KN4A 4KT3B 4QWTA 2CW9A 3I563 1ZO2A 3KFQC 4R1KA 1BIRA 2K0MA 3ZFZA 3OWSA 3IJEB 3WHOA 1STDA 3GZRA 1B2ZA 1FGQA 1SQWA 1GY6A 2CH9A 2FNQA 2XR8B 1RCKA 1KD14 1JB2A 3LXUX 3K63A 1TRPA 2CHCA 3F8XA 1X1WA 2F56A 4KVHA 3O8YA 3ECFA 5LC7A 2YFIB 3BNCA 1OPYA 2CX1A 2B24B 2OOVA 4HJLB 1IQYA 3EN8A 4CCVA 1CH0A 1I2GA 2PZVA 3CU3A 1IVWA 5TGNA 4EV2A 5AEWB 2CG0A 3B8LA 1YGEA 1W2ZA 4GB5A 1TU5A 1K734 2PNCA 3Q90A 1QVF2 4N6MA 1W6YA 2INXA 2XRXB 4EXRA 1AVKA 1L5GB 1O7PB 5D83A 1K28A 1W00A 4EW5A 4KZ1A 5IERA 1WNHA 1DVCA 1NB3I 3HI7A 3IMAB 4K90B 3SVAA 3JUNA 1W2B2 1EUIC 2CWVA 4N6LA 1VZZA 3SYUA 1VQ63 3DGOA 2QEX3 5AIFA 3CNXA 2GSPA 1IQXA 3EQQB 3DM8A 4IPBA 4N6NB 2HMKB 5IF6A 1W6CA 3B7CA 4LYLB 3WR2A 3HIIA 3NQYA 3OW22 1O7MB 1RRHA 4BTYA 5CXOA 1RN4A 1W5ZA 2IYJA 2MC8A 3MPHA 4OK0A 4FCJA 1N8R4 3EJVA 1WQLB 5GSPA 3M8CA 4I4KA 4L8OA 4N6V0 2OTL3 1Q7HA 3U97A 4KFDA 1OACA 5JPUA 1RKYA 3BB9A 5AEUB 2IA7A 1JKGB 2XEPA 4WYKA 1GOVA 2Q07A 3UJMA 1OHPA 1FGMA 3GRDA 1J2BA 1I8VA 4WHAA 5IG0A 3LYGA 1MWUA 2M7OA 2RNTA 2BMRB 3D79A 1Q9EA 3DZLA 5CF2A 1Q40B 8CHOA 2XGNA 5M19A 3X3XA 1JN5B 4HM1B 1Q7Y4 1K9M4 3EHCA 1BRIA 2CIUA 3AMOB 1AQZA 2WGOA 3HX8A 3CD63 3WA3A 1FGOA 2W56A 4XBXA 2OOVC 2ZHXB 1X1XA 1I2FA 2SBLA 1FUSA 1IDPA 2F99A 4RBNA 3DGMA 3SOYA 1BSBA 5G1LA 3FG4A 1MNLA 1UDII 6RNTA 1B2SA 1JB5A 3IPTA 1RNTA 1I0VA 1LQGC 1VQQA 1RGGA 1RGEA 1IT7A 4KFFA 4LGQA 1S5AA 1RMSA 1W7CA 2CFWA 1IVXA 3AHWA 1BRGA 5G1KA 3UB1A 4HZBB 3F7XA 1BSEA 1AVLA 1MWSA 2LYXA 3WMDA 1UI8A 1VQN3 1TRQA 5IG5A 1B2UA 3NBJA 2RCDA 2KF3A 1ASKA 3SXXA 7RNTA 2CK3H 2BU4A 2JDIH 3NQZA 4H61A 2CC3A 2XFSA 3FKAA 1LNHA 3NV0B 1RGFA 3VF1A 3AGNA 1M904 3CXC2 4FR9A 1LOWA 4HM0B 1KQS2 9RNTA 3CCM3 1BRHA 1EG9B 1V74A 3K5TA 4OVMA 1BNGA 4JF8A 1B21A 4TX4A 3CCS3 3BU4A 4LZIA 4N3VA 1JZDA 1BNIA 3SEDA 1DE3A 3WODG 1RJOA 5JPPA 3G713 5IENA 4FMCA 2BIRA 1TIJA 8RNTA 4HM5B 2OCTA 1WMNA 3J7Yd 1CQSA 1D6YA 2H0IA 2KF6A 1LOYA 1N9EA 4K1UA 1LQMB 4AEQA 7GSPA 3X41A 2Z7AA 1YJN3 2OTJ3 2WOHA 2RFRA 3B4PA 3I553 2HMJB 1UCLA 2E2TA 3MSOA 1AR0A 1I70A 1UUGB 2K3DA 1BNSA 3G0KA 5DREA 2GEXA 1S723 3BLZA 3CC23 3DMCA 3QK9A 1TFOA 1I2EA 1TP6A 1MWTA 1C54A 3BNDA 4GL6A 1N5PA 2H0HA 1DVDA 5IW9A 1JKGA 1UUWB 3D3LA 5EVHA 3JVCA 2CWTA 3CMA3 3G8ZA 1BOXA 5JBSA 5AIGA 2ML6A 5EQLA 1OHSA 1Q40A 3T8NA 1JN5A 1ROAA 2BT3A 3EF8A 2V1LA 4X2OA 1UW1A 3AMOA 1A90A 4L8PA 3N54B 4HAAA 1DYUA 3VGNA 2GEYA 1EA2A 2GU1A 2P38A 3L0RA 5M18A 1MGRA 1VQ73 4RNZA 3KIIA 2W6JH 1D6ZA 1JBTA 1E97A 1FUTA 1HZ1A 3EBYA 4G1MB 3HK4A 1SARA 3FF0A 3NXJA 1GMRA 3SX1A 2HOHA 1RSNA 4HM6B 1GOYA 4CPKA 2HMNB 2F5MA 3RNTA 4HM4B 2XF3A 4RNYA 2CFLA 2IUKA 3DXOA 1O7GB 1LXEA 1IVVA 1A2VA 5RNTA 1VQ53 5A0OB 3KZTA 4XBTA 1UGIA 2ML5A 3ROBA 1OF5B 2GBWB 3RGRA 1Q814 1MOLA 1FW7A 1PU4A 2STDA 1W6GA 2B1XB 3MWZA 2OQEA 3NV0A 3KSED 4LMIA 5AI1A 5IG3A 3F40A 4ORLA 3FSDA 1NDOB 1GOUA 1T3BA 2IUJA 2FXTA 4KFEA 3ZG5A 2W0QA 1U5OA 1KSIA 3VSYA 3WOFB 1ZS7A 2F5WA 3DY5A 2XSOB 3NX0A 1B3SA 1LOXA 4OUQA 5DRVA 3LT9A 1EKMA 2W03A 4HVNA 5D81A 1U8CB 3FZWA 3CC73 1UUVB 3HZPA 3SLUA 3F9SA 3NUVA 3GSPA 3NM7A 1VQ43 1G0TA 1R4YA 2RSXA 5STDA 1BVIA 1K41A 3N9HA 4NREA 1YVBI 1TUHA 4DKIA 4HM8B 1FYSA 3FF2A 4MMXB 2RBIA 2L4VA 1OH0A 3LZAA 3CCV3 3D9RA 3OXAA 2O3OA 3H3HA 5HGRA 1VQK3 1DMMA 1BUJA 2CFDA 2E2UA 1NU3A 3OX9A 2P09A 5IEPA 3GZXB 1BANA 4HM3B 3E99A 1RTUA 1UCIA 2Y73A 2I9WA 4BTXA 2ZA4A 2WGQA 3KSPA 1JJ22 3JUMA 7STDA 3PCSA 5M1AA 5AIHA 4XM4A 3SOAA 2JQ5A 1GSPA 1LOVA 3CCJ3 1G96A 1QJGA 1FGRA 3Q3FA 4EC6A 1QALA 3GWRA 4O2HA 1RCLA 1BSAA 3LMLA 1RGKA 1RDSA 1RRLA 1WMPA 2K54A 1E3RA 1D6UA 4LSOA 4HM2B 3X3YA 1K8A4 1NB5I 5IG4A 1RGAA 3WDGB 2F86B 4O3VA 3S67A 3STDA 1SPUA 2OQEC 2W04A 1ULJB 5EEOA 1PFPA 1BNJA 3EN1B 1QVG2 1BRKA 1R4CA 1GMQA 3URPA 1T2IA 1W02A 3FGYA 1I3IA 1TJDA 3F14A 4FCZA 3V92A 4RNTA 1BAOA 2OWPA 3PXMA 4WFOA 2BMQB 3Q2PA 1DMNA 3I0YA 3MG3A 1US1A 5CF1A 3NM2A 1YNVX 3EC9A 4WWUC 2WO0A 3CPOA 3NHXA 1M1XB 4ILFA 1Q864 1OF5A 4I5QA 1X1YA 2BHMA 1M1K4 2YFLB 1STFI 3T0UA 2AAEA 2GU3A 3DGNA 4FMDA 3D5IA 4HKVB 2XFTA 4K1VA 1ROVA 1CEWI 2HMLB 1GD3A 4GSPA 3D4AA 4XDVA 2RGQA 2C4BA 2KF5A 2CFGA 2QGUA 4MEIA 4R4KA 1RGHA 4J5GA 1NJI4 1O7NB 2C11A 3X42A 3MKIA 1VQ93 3CCR3 1OGZA 1CYVA 2W9QA 2Z77A 3N8BA 4HBRA 3WA2X 1NNVA 1BSDA 1GYBA 1IVUA 3A5EA 4HOHA 3ZG0A 1B2XA 1BNRA 1QAKA 4MJDA 3LTAA 1AY7A 4N6UA 1Q42A 3T8UA 2QIYA 1ZX2A 2FGTA 3WOEB 2QA43 2GBXB 1BU4A 6GSPA 3OWYA 1FA3A 1I3FA 1O7HB 1TFKA 2IY2A 2XSHB 3KCHA 3OWUA 1Z1SA 1RGCA 3PS8A 4K61A 3UL6A 3CCQ3 5HOHA 4BU4A 2YX9A 4MMYB 2F98A 4R80A 1NO3A 2KF4A 3EB8A 4FMBA 4CDLA 4XBYA 1RGLA 4R9KA 1YI23 1T2HA 3GZYB 1E3VA 4IT7A 3UL5A 1JV2B 3HIGA 3MHEA 1JBRA 4GHOA 3LTDA 2CKFB 1EQKA 2GXFA 3GAXA 1BRSA 1DMQA 1N8QA 3NBRA 4BL3A 5I97A 3B4OA 4FCMA 5AYSC 3S29A 1RNBA 1GMPA 4STDA 1HYFA 3F7SA 1BNFA 1YJW3 1F8NA 4AKYA 2F4YA 2J8XB 4O02B 3CC43 1MWRA 2MF7A 4L7KA 3S5CA 1RN1A 1ULIB 1QMAA 4N6OB 5AYRB 5CK6A 1AV4A 2Z76A 3RGAA 2D42A 4BIRA 3U1WA 1M9GA 1UGHI 1JBSA 3KE7A 1SJWA 2LQVA 4JRFA 4XB5A 3DGYA 3D5GA 2H0GA 1FGTA 2P05A 2IMJA 3CCE3 6STDA 1A67A 3ER7A 1HKXA 3PYJA 5G2GA 2KCDA 3BIRA 1KWIA 3RDEA 1VQM3 1HU9A 1WTHA 1RLSA 4J8TA 2XH9A 1SIIA 5IEOA 5ELJA 5BVBA 1LVNA 3FCSB 2CX0A 3V99A 3K9MC 5BU4A 3G4S3 3CCL3 1VQ83 1BUQA 4HM7B 1JB4A 4J9AA 4ZM8A 1B2MA 3MG1A 2YFJB 2ZL8A 3K0ZA 4AKZA 2D1WA 1IQ8A 1PYLA 1RHLA 3LTCA 3DUKA 4EBGA 4HZ9B 1N5HA 1A2PA 2W9PA 1W01A 4IIAA 3FH1A 1O7WB 4RZMA 4BTWA 1B20A 1IT8A 2Y74A 1MGWA 1YJ93 1BRJA 2UUGC 2KAAA 5KP3A 4EYCA 4BL2A 1ZGXA 1JNQA 3UNLA 1IK3A 1EEJA 1FUWA 1JRQA 2WOFA 3DGLA 1DETA 1X1UA 3AGOA 2CG1A 1IYYA 3EBTA 1TTOA 4PEJA 3X40A 4LEHA 3KKGA 3FG3A 1BNEA 5KP4A 2R4IA 1ISKA 3LTBA 4H3UA 4X2HA 2ZDJA 1G02A 3JUQA 3Q1CA 4Q53A 4EV5A 2CWUA 1YIT3 1A2KA 1BSCA 2BO9B 2O9UX 1UCKA 4WP5A 3CNMA 5ELUA 2A15A 3QRDA 1UCJA 3TDGA 2HMOB 1YHQ3 3ALAA 4XDWA 1BGSA 4HYZA 3AHSA 3S28A 1OUNA 2C10A 2CFKA 2P0XA 3OV4A 5FW5A 2SARA 2UGIA 3S27A 2P0MA 1VQP3 3FLJA 1Q824 1YIJ3 1RN7A 2XGLA 2HMMB 1B27A 1WMOA 1GS3A 1PY3A 2R41A 3LH4A 3CME3 1GY7A 1IV7A 1LNIA 3G16A 3GZBA 1KC84 1FZUA 2BMOB 3DH2A 2Z6BA 2W2CA 5KP1A 3JUPA 4NPBA 3BNBA 1BRNL 2BNGA 4U13A 1IU7A 2UX0A 2AADA 1V57A 1C7HA 2KRTA 3PZWA 3JUOA 3PGBA 4MMZB 1QAFA 3X3ZA 2E2VA 3V98A 2L1SA 3A76A 3MG2A 4FMAA 1VQL3 3EX9A 1OHOA 3G6E3 1CYUA 3HOHA 1JZOA 3K7CA 1VQO3 1GY5A 1OCVA 1I0XA 4CJNA 1T5YA 5FGOA 1OGXA 3F8HA 1GD4A 3MYTA 3FG1A 5CLKA 1N9JA 3PCRA 4R9LA 1UI7A 1V58A 1IV9A 4WYKB 3LT8A 4J5KA 1YVSA 5LC6A 3NBBA 3CCU3 4N6TA 5D82A 1YGWA 3EE1A 3LOYA 3CPW2 2KXGA 1NWWA 1Y4KA 3H51A 5BXQA 4NHFA 4O8SA 1SIHA 5BIRA
chains in the Genus database with same CATH topology
1W4NA 5AIIA 3BNEA 3I563 2W56B 3KN4A 4QWTA 2CW9A 1ZO2A 3KFQC 4R1KA 2K0MA 3OWSA 3IJEB 1STDA 3GZRA 1FGQA 1SQWA 1GY6A 2CH9A 2FNQA 2XR8B 1KD14 1JB2A 3LXUX 3K63A 2CHCA 3F8XA 4KVHA 3O8YA 3ECFA 5LC7A 2YFIB 3BNCA 1OPYA 2B24B 2OOVA 4HJLB 1IQYA 3EN8A 4CCVA 2PZVA 3CU3A 1IVWA 5TGNA 4EV2A 5AEWB 2CG0A 3B8LA 1YGEA 1W2ZA 4GB5A 1TU5A 1K734 2PNCA 3Q90A 1QVF2 4N6MA 1W6YA 2INXA 2XRXB 4EXRA 1AVKA 1L5GB 1O7PB 5D83A 1K28A 1W00A 4KZ1A 5IERA 1WNHA 1DVCA 1NB3I 3HI7A 3IMAB 4K90B 3SVAA 3JUNA 1W2B2 2CWVA 4N6LA 1VZZA 1VQ63 3DGOA 2QEX3 5AIFA 3CNXA 1IQXA 3EQQB 3DM8A 4IPBA 4N6NB 2HMKB 5IF6A 1W6CA 3B7CA 3HIIA 3NQYA 3OW22 1O7MB 1RRHA 4BTYA 5CXOA 1W5ZA 2MC8A 3MPHA 4OK0A 4FCJA 1N8R4 3EJVA 1WQLB 3M8CA 4I4KA 4L8OA 4N6V0 2OTL3 3U97A 4KFDA 1OACA 5JPUA 1RKYA 3BB9A 5AEUB 2IA7A 1JKGB 2XEPA 4WYKA 2Q07A 3UJMA 1OHPA 1FGMA 3GRDA 1J2BA 4WHAA 5IG0A 3LYGA 2M7OA 2BMRB 3DZLA 5CF2A 1Q40B 8CHOA 2XGNA 3X3XA 1JN5B 4HM1B 1Q7Y4 1K9M4 3EHCA 2CIUA 3AMOB 2WGOA 3HX8A 3CD63 3WA3A 1FGOA 2W56A 4XBXA 2OOVC 2SBLA 1IDPA 2F99A 4RBNA 3DGMA 3SOYA 3FG4A 1MNLA 1JB5A 3IPTA 1IT7A 4KFFA 4LGQA 1S5AA 1W7CA 2CFWA 1IVXA 3UB1A 4HZBB 3F7XA 1AVLA 2LYXA 3WMDA 1UI8A 1VQN3 5IG5A 3NBJA 2RCDA 3SXXA 1ASKA 2CK3H 2JDIH 3NQZA 4H61A 2CC3A 2XFSA 3FKAA 1LNHA 3NV0B 3VF1A 1M904 3CXC2 4FR9A 4HM0B 1KQS2 3CCM3 1EG9B 1V74A 3K5TA 4OVMA 4JF8A 4TX4A 3CCS3 4LZIA 4N3VA 3SEDA 3WODG 1RJOA 5JPPA 3G713 5IENA 4FMCA 1TIJA 4HM5B 2OCTA 1WMNA 3J7Yd 1CQSA 1D6YA 2OTJ3 1N9EA 4K1UA 4AEQA 1YJN3 3X41A 2Z7AA 2WOHA 2RFRA 3B4PA 3I553 2HMJB 2E2TA 3MSOA 1AR0A 5DREA 3G0KA 1S723 2GEXA 3BLZA 3CC23 3DMCA 3QK9A 1TFOA 1TP6A 3BNDA 4GL6A 1N5PA 1DVDA 5IW9A 1JKGA 1UUWB 3D3LA 5EVHA 3JVCA 2CWTA 3CMA3 3G8ZA 5JBSA 5AIGA 2ML6A 5EQLA 1OHSA 1Q40A 3T8NA 1JN5A 1ROAA 2BT3A 3EF8A 2V1LA 4X2OA 1UW1A 3AMOA 1A90A 4L8PA 3N54B 1DYUA 3VGNA 2GEYA 1EA2A 2GU1A 2P38A 3L0RA 1VQ73 4RNZA 3KIIA 2W6JH 1D6ZA 1E97A 4G1MB 3EBYA 3HK4A 3FF0A 3NXJA 3SX1A 4HM6B 2HMNB 4HM4B 2XF3A 4RNYA 2CFLA 2IUKA 3DXOA 1O7GB 1LXEA 1IVVA 1A2VA 1VQ53 5A0OB 3KZTA 4XBTA 2ML5A 3ROBA 1OF5B 2GBWB 3RGRA 1Q814 1MOLA 1PU4A 2STDA 1W6GA 2B1XB 3MWZA 2OQEA 3NV0A 3KSED 4LMIA 5AI1A 5IG3A 3F40A 4ORLA 3FSDA 1NDOB 2IUJA 2FXTA 4KFEA 2W0QA 1U5OA 1KSIA 3VSYA 3WOFB 3DY5A 2XSOB 3NX0A 4OUQA 1LOXA 5DRVA 3LT9A 1EKMA 2W03A 4HVNA 5D81A 1U8CB 3FZWA 3CC73 1UUVB 3HZPA 3SLUA 3F9SA 3NUVA 3NM7A 1VQ43 2RSXA 5STDA 1K41A 3N9HA 4NREA 1YVBI 1TUHA 4HM8B 3FF2A 4MMXB 2L4VA 1OH0A 3LZAA 3CCV3 3D9RA 3OXAA 2O3OA 3H3HA 5HGRA 1VQK3 1DMMA 2CFDA 2E2UA 1NU3A 3OX9A 2P09A 5IEPA 3GZXB 4HM3B 3E99A 2Y73A 2I9WA 4BTXA 3KSPA 2WGQA 1JJ22 3JUMA 7STDA 3PCSA 5AIHA 4XM4A 3SOAA 2JQ5A 3CCJ3 1G96A 1QJGA 1FGRA 4EC6A 1QALA 3GWRA 4O2HA 3LMLA 1RRLA 2K54A 1WMPA 3X3YA 1E3RA 1D6UA 4LSOA 4HM2B 1K8A4 1NB5I 5IG4A 3WDGB 2F86B 4O3VA 3S67A 3STDA 1SPUA 2OQEC 2W04A 1ULJB 5EEOA 1PFPA 3EN1B 1QVG2 1R4CA 1W02A 3FGYA 4FCZA 3F14A 3V92A 4WFOA 2OWPA 3PXMA 2BMQB 3Q2PA 1DMNA 3I0YA 3MG3A 1US1A 5CF1A 3NM2A 3EC9A 4WWUC 2WO0A 3CPOA 3NHXA 1M1XB 1Q864 1OF5A 2BHMA 1M1K4 2YFLB 1STFI 3T0UA 2GU3A 3DGNA 4FMDA 4HKVB 4K1VA 2XFTA 1ROVA 1CEWI 2HMLB 1GD3A 4XDVA 2RGQA 2CFGA 2QGUA 4MEIA 4R4KA 1NJI4 1O7NB 2C11A 3X42A 3MKIA 1VQ93 3CCR3 1OGZA 1CYVA 2W9QA 2Z77A 3N8BA 4HBRA 3WA2X 1GYBA 1IVUA 1QAKA 4MJDA 3LTAA 4N6UA 1Q42A 3T8UA 2QIYA 1ZX2A 2FGTA 3WOEB 2QA43 2GBXB 3OWYA 1FA3A 2XSHB 1O7HB 1TFKA 3OWUA 3PS8A 4K61A 1Z1SA 3UL6A 3CCQ3 2YX9A 4MMYB 2F98A 4R80A 1NO3A 3EB8A 4FMBA 4CDLA 4XBYA 4R9KA 1YI23 3GZYB 1E3VA 4IT7A 3UL5A 1JV2B 3HIGA 3MHEA 3LTDA 2CKFB 1EQKA 2GXFA 3GAXA 3NBRA 1DMQA 1N8QA 5I97A 3B4OA 4FCMA 5AYSC 3S29A 4STDA 3F7SA 1YJW3 1F8NA 4AKYA 4O02B 3CC43 3S5CA 2MF7A 4L7KA 1ULIB 1QMAA 4N6OB 5AYRB 5CK6A 1AV4A 2Z76A 3RGAA 2D42A 3U1WA 1M9GA 3KE7A 1SJWA 2LQVA 4JRFA 4XB5A 1FGTA 2P05A 2IMJA 3CCE3 6STDA 1A67A 3ER7A 1HKXA 3PYJA 5G2GA 2KCDA 1KWIA 3RDEA 1VQM3 1HU9A 1WTHA 4J8TA 2XH9A 1SIIA 5IEOA 5ELJA 5BVBA 1LVNA 3FCSB 3G4S3 3V99A 3K9MC 3CCL3 1VQ83 1BUQA 4HM7B 1JB4A 4J9AA 4ZM8A 3MG1A 2YFJB 2ZL8A 3K0ZA 4AKZA 2D1WA 1IQ8A 3LTCA 3DUKA 4EBGA 4HZ9B 1N5HA 2W9PA 1W01A 4IIAA 3FH1A 1O7WB 4RZMA 4BTWA 1IT8A 2Y74A 1YJ93 5KP3A 4EYCA 1JNQA 3UNLA 1IK3A 1FUWA 1JRQA 2WOFA 3DGLA 2CG1A 3EBTA 4PEJA 3X40A 4LEHA 3KKGA 3FG3A 1ISKA 5KP4A 2R4IA 3LTBA 4H3UA 4X2HA 2ZDJA 3Q1CA 3JUQA 4EV5A 4Q53A 2CWUA 1YIT3 1A2KA 2O9UX 2BO9B 4WP5A 3CNMA 5ELUA 2A15A 3QRDA 3TDGA 2HMOB 1YHQ3 3ALAA 4XDWA 4HYZA 3S28A 1OUNA 2C10A 2CFKA 2P0XA 3OV4A 5FW5A 3S27A 2P0MA 1VQP3 3FLJA 1Q824 1YIJ3 1RN7A 2XGLA 2HMMB 3CME3 1WMOA 1GS3A 3LH4A 1GY7A 1IV7A 3G16A 1KC84 3GZBA 5KP1A 2BMOB 2Z6BA 2W2CA 3JUPA 3BNBA 2BNGA 4U13A 1IU7A 2UX0A 1C7HA 2KRTA 3PZWA 3JUOA 3PGBA 4MMZB 1QAFA 3X3ZA 2E2VA 3V98A 3MG2A 3A76A 1VQL3 4FMAA 3EX9A 1OHOA 3G6E3 1CYUA 3K7CA 1VQO3 1GY5A 1OCVA 1T5YA 5FGOA 1OGXA 3F8HA 1GD4A 3MYTA 3FG1A 5CLKA 1N9JA 3PCRA 4R9LA 1UI7A 1IV9A 4WYKB 3LT8A 5LC6A 3NBBA 3CCU3 4N6TA 5D82A 3EE1A 3LOYA 3CPW2 2KXGA 1NWWA 1Y4KA 3H51A 5BXQA 4NHFA 4O8SA 1SIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AII A;  1ZO2 A;  4R1K A;  3OWS A;  1STD A;  3GZR A;  1GY6 A;  2XR8 B;  1JB2 A;  2CHC A;  3F8X A;  4KVH A;  3ECF A;  2YFI B;  1OPY A;  2B24 B;  4HJL B;  3EN8 A;  2PZV A;  3CU3 A;  5TGN A;  5AEW B;  3B8L A;  4GB5 A;  3Q90 A;  1W6Y A;  2INX A;  2XRX B;  1O7P B;  5D83 A;  1W00 A;  5IER A;  3JUN A;  1VZZ A;  5AIF A;  3CNX A;  3EQQ B;  3DM8 A;  2HMK B;  5IF6 A;  3B7C A;  1O7M B;  5CXO A;  4FCJ A;  3EJV A;  1WQL B;  3M8C A;  4I4K A;  4L8O A;  5JPU A;  3BB9 A;  5AEU B;  1JKG B;  4WYK A;  3UJM A;  1OHP A;  3GRD A;  5IG0 A;  3LYG A;  2BMR B;  3DZL A;  5CF2 A;  1Q40 B;  8CHO A;  1JN5 B;  4HM1 B;  3EHC A;  3HX8 A;  4XBX A;  1IDP A;  2F99 A;  3SOY A;  1JB5 A;  3IPT A;  4LGQ A;  1S5A A;  4HZB B;  3F7X A;  3WMD A;  5IG5 A;  2RCD A;  1ASK A;  3FKA A;  3NV0 B;  4HM0 B;  1EG9 B;  4OVM A;  4N3V A;  3SED A;  5JPP A;  5IEN A;  4HM5 B;  1CQS A;  4K1U A;  2Z7A A;  2RFR A;  3B4P A;  2HMJ B;  3MSO A;  1AR0 A;  5DRE A;  3G0K A;  2GEX A;  3BLZ A;  3DMC A;  1TP6 A;  1JKG A;  1UUW B;  5EVH A;  3G8Z A;  5AIG A;  1OHS A;  1Q40 A;  3T8N A;  1JN5 A;  3EF8 A;  4X2O A;  4L8P A;  3VGN A;  2GEY A;  1EA2 A;  1E97 A;  3EBY A;  3HK4 A;  3FF0 A;  3NXJ A;  4HM6 B;  2HMN B;  4HM4 B;  3DXO A;  1O7G B;  3KZT A;  4XBT A;  3ROB A;  1OF5 B;  2GBW B;  3RGR A;  2STD A;  2B1X B;  3NV0 A;  4LMI A;  5AI1 A;  5IG3 A;  3F40 A;  4ORL A;  3FSD A;  1NDO B;  1U5O A;  3VSY A;  2XSO B;  4OUQ A;  5DRV A;  4HVN A;  5D81 A;  3FZW A;  1UUV B;  3HZP A;  3F9S A;  3NUV A;  5STD A;  1K41 A;  1TUH A;  4HM8 B;  3FF2 A;  1OH0 A;  3LZA A;  3D9R A;  3OXA A;  3H3H A;  5HGR A;  1DMM A;  1NU3 A;  3OX9 A;  5IEP A;  3GZX B;  4HM3 B;  3E99 A;  2I9W A;  3KSP A;  3JUM A;  7STD A;  5AIH A;  4XM4 A;  3SOA A;  2JQ5 A;  1QJG A;  3GWR A;  2K54 A;  1E3R A;  4HM2 B;  5IG4 A;  2F86 B;  3STD A;  1ULJ B;  3EN1 B;  1W02 A;  3FGY A;  3F14 A;  2OWP A;  2BMQ B;  1DMN A;  3I0Y A;  3MG3 A;  5CF1 A;  3NM2 A;  3EC9 A;  4WWU C;  3CPO A;  3NHX A;  1OF5 A;  2YFL B;  4HKV B;  4K1V A;  2HML B;  4XDV A;  2RGQ A;  2QGU A;  1O7N B;  3MKI A;  1OGZ A;  2Z77 A;  1GYB A;  4MJD A;  1Q42 A;  3T8U A;  2QIY A;  1ZX2 A;  2GBX B;  3OWY A;  1O7H B;  2XSH B;  3OWU A;  1Z1S A;  2F98 A;  4CDL A;  4XBY A;  4R9K A;  3GZY B;  1E3V A;  3MHE A;  2CKF B;  2GXF A;  3NBR A;  1DMQ A;  3B4O A;  4FCM A;  4STD A;  3F7S A;  3S5C A;  4L7K A;  1ULI B;  1QMA A;  5CK6 A;  2Z76 A;  3RGA A;  3KE7 A;  1SJW A;  4XB5 A;  2IMJ A;  6STD A;  3ER7 A;  1HKX A;  5G2G A;  4J8T A;  5IEO A;  5BVB A;  1BUQ A;  4HM7 B;  1JB4 A;  4J9A A;  3MG1 A;  2YFJ B;  3K0Z A;  3DUK A;  4HZ9 B;  1W01 A;  4IIA A;  3FH1 A;  1O7W B;  4RZM A;  5KP3 A;  3UNL A;  3EBT A;  4PEJ A;  4LEH A;  3KKG A;  1ISK A;  5KP4 A;  2R4I A;  4X2H A;  4H3U A;  3JUQ A;  4Q53 A;  1A2K A;  4WP5 A;  3CNM A;  2A15 A;  2HMO B;  4XDW A;  1OUN A;  3OV4 A;  5FW5 A;  3FLJ A;  2HMM B;  1GS3 A;  1GY7 A;  3G16 A;  3GZB A;  5KP1 A;  2BMO B;  2W2C A;  3JUP A;  2BNG A;  4U13 A;  2UX0 A;  1C7H A;  3JUO A;  3MG2 A;  3A76 A;  3EX9 A;  1OHO A;  3K7C A;  1GY5 A;  1OCV A;  1OGX A;  3F8H A;  3MYT A;  5CLK A;  4R9L A;  4WYK B;  5D82 A;  3H51 A;  1NWW A;  5BXQ A; 
#chains in the Genus database with same CATH topology
 1W4N A;  5AII A;  3BNE A;  1LRA A;  2W56 B;  3KN4 A;  4KT3 B;  4QWT A;  2CW9 A;  3I56 3;  1ZO2 A;  3KFQ C;  4R1K A;  1BIR A;  2K0M A;  3ZFZ A;  3OWS A;  3IJE B;  3WHO A;  1STD A;  3GZR A;  1B2Z A;  1FGQ A;  1SQW A;  1GY6 A;  2CH9 A;  2FNQ A;  2XR8 B;  1RCK A;  1KD1 4;  1JB2 A;  3LXU X;  3K63 A;  1TRP A;  2CHC A;  3F8X A;  1X1W A;  2F56 A;  4KVH A;  3O8Y A;  3ECF A;  5LC7 A;  2YFI B;  3BNC A;  1OPY A;  2CX1 A;  2B24 B;  2OOV A;  4HJL B;  1IQY A;  3EN8 A;  4CCV A;  1CH0 A;  1I2G A;  2PZV A;  3CU3 A;  1IVW A;  5TGN A;  4EV2 A;  5AEW B;  2CG0 A;  3B8L A;  1YGE A;  1W2Z A;  4GB5 A;  1TU5 A;  1K73 4;  2PNC A;  3Q90 A;  1QVF 2;  4N6M A;  1W6Y A;  2INX A;  2XRX B;  4EXR A;  1AVK A;  1L5G B;  1O7P B;  5D83 A;  1K28 A;  1W00 A;  4EW5 A;  4KZ1 A;  5IER A;  1WNH A;  1DVC A;  1NB3 I;  3HI7 A;  3IMA B;  4K90 B;  3SVA A;  3JUN A;  1W2B 2;  1EUI C;  2CWV A;  4N6L A;  1VZZ A;  3SYU A;  1VQ6 3;  3DGO A;  2QEX 3;  5AIF A;  3CNX A;  2GSP A;  1IQX A;  3EQQ B;  3DM8 A;  4IPB A;  4N6N B;  2HMK B;  5IF6 A;  1W6C A;  3B7C A;  4LYL B;  3WR2 A;  3HII A;  3NQY A;  3OW2 2;  1O7M B;  1RRH A;  4BTY A;  5CXO A;  1RN4 A;  1W5Z A;  2IYJ A;  2MC8 A;  3MPH A;  4OK0 A;  4FCJ A;  1N8R 4;  3EJV A;  1WQL B;  5GSP A;  3M8C A;  4I4K A;  4L8O A;  4N6V 0;  2OTL 3;  1Q7H A;  3U97 A;  4KFD A;  1OAC A;  5JPU A;  1RKY A;  3BB9 A;  5AEU B;  2IA7 A;  1JKG B;  2XEP A;  4WYK A;  1GOV A;  2Q07 A;  3UJM A;  1OHP A;  1FGM A;  3GRD A;  1J2B A;  1I8V A;  4WHA A;  5IG0 A;  3LYG A;  1MWU A;  2M7O A;  2RNT A;  2BMR B;  3D79 A;  1Q9E A;  3DZL A;  5CF2 A;  1Q40 B;  8CHO A;  2XGN A;  5M19 A;  3X3X A;  1JN5 B;  4HM1 B;  1Q7Y 4;  1K9M 4;  3EHC A;  1BRI A;  2CIU A;  3AMO B;  1AQZ A;  2WGO A;  3HX8 A;  3CD6 3;  3WA3 A;  1FGO A;  2W56 A;  4XBX A;  2OOV C;  2ZHX B;  1X1X A;  1I2F A;  2SBL A;  1FUS A;  1IDP A;  2F99 A;  4RBN A;  3DGM A;  3SOY A;  1BSB A;  5G1L A;  3FG4 A;  1MNL A;  1UDI I;  6RNT A;  1B2S A;  1JB5 A;  3IPT A;  1RNT A;  1I0V A;  1LQG C;  1VQQ A;  1RGG A;  1RGE A;  1IT7 A;  4KFF A;  4LGQ A;  1S5A A;  1RMS A;  1W7C A;  2CFW A;  1IVX A;  3AHW A;  1BRG A;  5G1K A;  3UB1 A;  4HZB B;  3F7X A;  1BSE A;  1AVL A;  1MWS A;  2LYX A;  3WMD A;  1UI8 A;  1VQN 3;  1TRQ A;  5IG5 A;  1B2U A;  3NBJ A;  2RCD A;  2KF3 A;  1ASK A;  3SXX A;  7RNT A;  2CK3 H;  2BU4 A;  2JDI H;  3NQZ A;  4H61 A;  2CC3 A;  2XFS A;  3FKA A;  1LNH A;  3NV0 B;  1RGF A;  3VF1 A;  3AGN A;  1M90 4;  3CXC 2;  4FR9 A;  1LOW A;  4HM0 B;  1KQS 2;  9RNT A;  3CCM 3;  1BRH A;  1EG9 B;  1V74 A;  3K5T A;  4OVM A;  1BNG A;  4JF8 A;  1B21 A;  4TX4 A;  3CCS 3;  3BU4 A;  4LZI A;  4N3V A;  1JZD A;  1BNI A;  3SED A;  1DE3 A;  3WOD G;  1RJO A;  5JPP A;  3G71 3;  5IEN A;  4FMC A;  2BIR A;  1TIJ A;  8RNT A;  4HM5 B;  2OCT A;  1WMN A;  3J7Y d;  1CQS A;  1D6Y A;  2H0I A;  2KF6 A;  1LOY A;  1N9E A;  4K1U A;  1LQM B;  4AEQ A;  7GSP A;  3X41 A;  2Z7A A;  1YJN 3;  2OTJ 3;  2WOH A;  2RFR A;  3B4P A;  3I55 3;  2HMJ B;  1UCL A;  2E2T A;  3MSO A;  1AR0 A;  1I70 A;  1UUG B;  2K3D A;  1BNS A;  3G0K A;  5DRE A;  2GEX A;  1S72 3;  3BLZ A;  3CC2 3;  3DMC A;  3QK9 A;  1TFO A;  1I2E A;  1TP6 A;  1MWT A;  1C54 A;  3BND A;  4GL6 A;  1N5P A;  2H0H A;  1DVD A;  5IW9 A;  1JKG A;  1UUW B;  3D3L A;  5EVH A;  3JVC A;  2CWT A;  3CMA 3;  3G8Z A;  1BOX A;  5JBS A;  5AIG A;  2ML6 A;  5EQL A;  1OHS A;  1Q40 A;  3T8N A;  1JN5 A;  1ROA A;  2BT3 A;  3EF8 A;  2V1L A;  4X2O A;  1UW1 A;  3AMO A;  1A90 A;  4L8P A;  3N54 B;  4HAA A;  1DYU A;  3VGN A;  2GEY A;  1EA2 A;  2GU1 A;  2P38 A;  3L0R A;  5M18 A;  1MGR A;  1VQ7 3;  4RNZ A;  3KII A;  2W6J H;  1D6Z A;  1JBT A;  1E97 A;  1FUT A;  1HZ1 A;  3EBY A;  4G1M B;  3HK4 A;  1SAR A;  3FF0 A;  3NXJ A;  1GMR A;  3SX1 A;  2HOH A;  1RSN A;  4HM6 B;  1GOY A;  4CPK A;  2HMN B;  2F5M A;  3RNT A;  4HM4 B;  2XF3 A;  4RNY A;  2CFL A;  2IUK A;  3DXO A;  1O7G B;  1LXE A;  1IVV A;  1A2V A;  5RNT A;  1VQ5 3;  5A0O B;  3KZT A;  4XBT A;  1UGI A;  2ML5 A;  3ROB A;  1OF5 B;  2GBW B;  3RGR A;  1Q81 4;  1MOL A;  1FW7 A;  1PU4 A;  2STD A;  1W6G A;  2B1X B;  3MWZ A;  2OQE A;  3NV0 A;  3KSE D;  4LMI A;  5AI1 A;  5IG3 A;  3F40 A;  4ORL A;  3FSD A;  1NDO B;  1GOU A;  1T3B A;  2IUJ A;  2FXT A;  4KFE A;  3ZG5 A;  2W0Q A;  1U5O A;  1KSI A;  3VSY A;  3WOF B;  1ZS7 A;  2F5W A;  3DY5 A;  2XSO B;  3NX0 A;  1B3S A;  1LOX A;  4OUQ A;  5DRV A;  3LT9 A;  1EKM A;  2W03 A;  4HVN A;  5D81 A;  1U8C B;  3FZW A;  3CC7 3;  1UUV B;  3HZP A;  3SLU A;  3F9S A;  3NUV A;  3GSP A;  3NM7 A;  1VQ4 3;  1G0T A;  1R4Y A;  2RSX A;  5STD A;  1BVI A;  1K41 A;  3N9H A;  4NRE A;  1YVB I;  1TUH A;  4DKI A;  4HM8 B;  1FYS A;  3FF2 A;  4MMX B;  2RBI A;  2L4V A;  1OH0 A;  3LZA A;  3CCV 3;  3D9R A;  3OXA A;  2O3O A;  3H3H A;  5HGR A;  1VQK 3;  1DMM A;  1BUJ A;  2CFD A;  2E2U A;  1NU3 A;  3OX9 A;  2P09 A;  5IEP A;  3GZX B;  1BAN A;  4HM3 B;  3E99 A;  1RTU A;  1UCI A;  2Y73 A;  2I9W A;  4BTX A;  2ZA4 A;  2WGQ A;  3KSP A;  1JJ2 2;  3JUM A;  7STD A;  3PCS A;  5M1A A;  5AIH A;  4XM4 A;  3SOA A;  2JQ5 A;  1GSP A;  1LOV A;  3CCJ 3;  1G96 A;  1QJG A;  1FGR A;  3Q3F A;  4EC6 A;  1QAL A;  3GWR A;  4O2H A;  1RCL A;  1BSA A;  3LML A;  1RGK A;  1RDS A;  1RRL A;  1WMP A;  2K54 A;  1E3R A;  1D6U A;  4LSO A;  4HM2 B;  3X3Y A;  1K8A 4;  1NB5 I;  5IG4 A;  1RGA A;  3WDG B;  2F86 B;  4O3V A;  3S67 A;  3STD A;  1SPU A;  2OQE C;  2W04 A;  1ULJ B;  5EEO A;  1PFP A;  1BNJ A;  3EN1 B;  1QVG 2;  1BRK A;  1R4C A;  1GMQ A;  3URP A;  1T2I A;  1W02 A;  3FGY A;  1I3I A;  1TJD A;  3F14 A;  4FCZ A;  3V92 A;  4RNT A;  1BAO A;  2OWP A;  3PXM A;  4WFO A;  2BMQ B;  3Q2P A;  1DMN A;  3I0Y A;  3MG3 A;  1US1 A;  5CF1 A;  3NM2 A;  1YNV X;  3EC9 A;  4WWU C;  2WO0 A;  3CPO A;  3NHX A;  1M1X B;  4ILF A;  1Q86 4;  1OF5 A;  4I5Q A;  1X1Y A;  2BHM A;  1M1K 4;  2YFL B;  1STF I;  3T0U A;  2AAE A;  2GU3 A;  3DGN A;  4FMD A;  3D5I A;  4HKV B;  2XFT A;  4K1V A;  1ROV A;  1CEW I;  2HML B;  1GD3 A;  4GSP A;  3D4A A;  4XDV A;  2RGQ A;  2C4B A;  2KF5 A;  2CFG A;  2QGU A;  4MEI A;  4R4K A;  1RGH A;  4J5G A;  1NJI 4;  1O7N B;  2C11 A;  3X42 A;  3MKI A;  1VQ9 3;  3CCR 3;  1OGZ A;  1CYV A;  2W9Q A;  2Z77 A;  3N8B A;  4HBR A;  3WA2 X;  1NNV A;  1BSD A;  1GYB A;  1IVU A;  3A5E A;  4HOH A;  3ZG0 A;  1B2X A;  1BNR A;  1QAK A;  4MJD A;  3LTA A;  1AY7 A;  4N6U A;  1Q42 A;  3T8U A;  2QIY A;  1ZX2 A;  2FGT A;  3WOE B;  2QA4 3;  2GBX B;  1BU4 A;  6GSP A;  3OWY A;  1FA3 A;  1I3F A;  1O7H B;  1TFK A;  2IY2 A;  2XSH B;  3KCH A;  3OWU A;  1Z1S A;  1RGC A;  3PS8 A;  4K61 A;  3UL6 A;  3CCQ 3;  5HOH A;  4BU4 A;  2YX9 A;  4MMY B;  2F98 A;  4R80 A;  1NO3 A;  2KF4 A;  3EB8 A;  4FMB A;  4CDL A;  4XBY A;  1RGL A;  4R9K A;  1YI2 3;  1T2H A;  3GZY B;  1E3V A;  4IT7 A;  3UL5 A;  1JV2 B;  3HIG A;  3MHE A;  1JBR A;  4GHO A;  3LTD A;  2CKF B;  1EQK A;  2GXF A;  3GAX A;  1BRS A;  1DMQ A;  1N8Q A;  3NBR A;  4BL3 A;  5I97 A;  3B4O A;  4FCM A;  5AYS C;  3S29 A;  1RNB A;  1GMP A;  4STD A;  1HYF A;  3F7S A;  1BNF A;  1YJW 3;  1F8N A;  4AKY A;  2F4Y A;  2J8X B;  4O02 B;  3CC4 3;  1MWR A;  2MF7 A;  4L7K A;  3S5C A;  1RN1 A;  1ULI B;  1QMA A;  4N6O B;  5AYR B;  5CK6 A;  1AV4 A;  2Z76 A;  3RGA A;  2D42 A;  4BIR A;  3U1W A;  1M9G A;  1UGH I;  1JBS A;  3KE7 A;  1SJW A;  2LQV A;  4JRF A;  4XB5 A;  3DGY A;  3D5G A;  2H0G A;  1FGT A;  2P05 A;  2IMJ A;  3CCE 3;  6STD A;  1A67 A;  3ER7 A;  1HKX A;  3PYJ A;  5G2G A;  2KCD A;  3BIR A;  1KWI A;  3RDE A;  1VQM 3;  1HU9 A;  1WTH A;  1RLS A;  4J8T A;  2XH9 A;  1SII A;  5IEO A;  5ELJ A;  5BVB A;  1LVN A;  3FCS B;  2CX0 A;  3V99 A;  3K9M C;  5BU4 A;  3G4S 3;  3CCL 3;  1VQ8 3;  1BUQ A;  4HM7 B;  1JB4 A;  4J9A A;  4ZM8 A;  1B2M A;  3MG1 A;  2YFJ B;  2ZL8 A;  3K0Z A;  4AKZ A;  2D1W A;  1IQ8 A;  1PYL A;  1RHL A;  3LTC A;  3DUK A;  4EBG A;  4HZ9 B;  1N5H A;  1A2P A;  2W9P A;  1W01 A;  4IIA A;  3FH1 A;  1O7W B;  4RZM A;  4BTW A;  1B20 A;  1IT8 A;  2Y74 A;  1MGW A;  1YJ9 3;  1BRJ A;  2UUG C;  2KAA A;  5KP3 A;  4EYC A;  4BL2 A;  1ZGX A;  1JNQ A;  3UNL A;  1IK3 A;  1EEJ A;  1FUW A;  1JRQ A;  2WOF A;  3DGL A;  1DET A;  1X1U A;  3AGO A;  2CG1 A;  1IYY A;  3EBT A;  1TTO A;  4PEJ A;  3X40 A;  4LEH A;  3KKG A;  3FG3 A;  1BNE A;  5KP4 A;  2R4I A;  1ISK A;  3LTB A;  4H3U A;  4X2H A;  2ZDJ A;  1G02 A;  3JUQ A;  3Q1C A;  4Q53 A;  4EV5 A;  2CWU A;  1YIT 3;  1A2K A;  1BSC A;  2BO9 B;  2O9U X;  1UCK A;  4WP5 A;  3CNM A;  5ELU A;  2A15 A;  3QRD A;  1UCJ A;  3TDG A;  2HMO B;  1YHQ 3;  3ALA A;  4XDW A;  1BGS A;  4HYZ A;  3AHS A;  3S28 A;  1OUN A;  2C10 A;  2CFK A;  2P0X A;  3OV4 A;  5FW5 A;  2SAR A;  2UGI A;  3S27 A;  2P0M A;  1VQP 3;  3FLJ A;  1Q82 4;  1YIJ 3;  1RN7 A;  2XGL A;  2HMM B;  1B27 A;  1WMO A;  1GS3 A;  1PY3 A;  2R41 A;  3LH4 A;  3CME 3;  1GY7 A;  1IV7 A;  1LNI A;  3G16 A;  3GZB A;  1KC8 4;  1FZU A;  2BMO B;  3DH2 A;  2Z6B A;  2W2C A;  5KP1 A;  3JUP A;  4NPB A;  3BNB A;  1BRN L;  2BNG A;  4U13 A;  1IU7 A;  2UX0 A;  2AAD A;  1V57 A;  1C7H A;  2KRT A;  3PZW A;  3JUO A;  3PGB A;  4MMZ B;  1QAF A;  3X3Z A;  2E2V A;  3V98 A;  2L1S A;  3A76 A;  3MG2 A;  4FMA A;  1VQL 3;  3EX9 A;  1OHO A;  3G6E 3;  1CYU A;  3HOH A;  1JZO A;  3K7C A;  1VQO 3;  1GY5 A;  1OCV A;  1I0X A;  4CJN A;  1T5Y A;  5FGO A;  1OGX A;  3F8H A;  1GD4 A;  3MYT A;  3FG1 A;  5CLK A;  1N9J A;  3PCR A;  4R9L A;  1UI7 A;  1V58 A;  1IV9 A;  4WYK B;  3LT8 A;  4J5K A;  1YVS A;  5LC6 A;  3NBB A;  3CCU 3;  4N6T A;  5D82 A;  1YGW A;  3EE1 A;  3LOY A;  3CPW 2;  2KXG A;  1NWW A;  1Y4K A;  3H51 A;  5BXQ A;  4NHF A;  4O8S A;  1SIH A;  5BIR A; 
#chains in the Genus database with same CATH homology
 1W4N A;  5AII A;  3BNE A;  3I56 3;  2W56 B;  3KN4 A;  4QWT A;  2CW9 A;  1ZO2 A;  3KFQ C;  4R1K A;  2K0M A;  3OWS A;  3IJE B;  1STD A;  3GZR A;  1FGQ A;  1SQW A;  1GY6 A;  2CH9 A;  2FNQ A;  2XR8 B;  1KD1 4;  1JB2 A;  3LXU X;  3K63 A;  2CHC A;  3F8X A;  4KVH A;  3O8Y A;  3ECF A;  5LC7 A;  2YFI B;  3BNC A;  1OPY A;  2B24 B;  2OOV A;  4HJL B;  1IQY A;  3EN8 A;  4CCV A;  2PZV A;  3CU3 A;  1IVW A;  5TGN A;  4EV2 A;  5AEW B;  2CG0 A;  3B8L A;  1YGE A;  1W2Z A;  4GB5 A;  1TU5 A;  1K73 4;  2PNC A;  3Q90 A;  1QVF 2;  4N6M A;  1W6Y A;  2INX A;  2XRX B;  4EXR A;  1AVK A;  1L5G B;  1O7P B;  5D83 A;  1K28 A;  1W00 A;  4KZ1 A;  5IER A;  1WNH A;  1DVC A;  1NB3 I;  3HI7 A;  3IMA B;  4K90 B;  3SVA A;  3JUN A;  1W2B 2;  2CWV A;  4N6L A;  1VZZ A;  1VQ6 3;  3DGO A;  2QEX 3;  5AIF A;  3CNX A;  1IQX A;  3EQQ B;  3DM8 A;  4IPB A;  4N6N B;  2HMK B;  5IF6 A;  1W6C A;  3B7C A;  3HII A;  3NQY A;  3OW2 2;  1O7M B;  1RRH A;  4BTY A;  5CXO A;  1W5Z A;  2MC8 A;  3MPH A;  4OK0 A;  4FCJ A;  1N8R 4;  3EJV A;  1WQL B;  3M8C A;  4I4K A;  4L8O A;  4N6V 0;  2OTL 3;  3U97 A;  4KFD A;  1OAC A;  5JPU A;  1RKY A;  3BB9 A;  5AEU B;  2IA7 A;  1JKG B;  2XEP A;  4WYK A;  2Q07 A;  3UJM A;  1OHP A;  1FGM A;  3GRD A;  1J2B A;  4WHA A;  5IG0 A;  3LYG A;  2M7O A;  2BMR B;  3DZL A;  5CF2 A;  1Q40 B;  8CHO A;  2XGN A;  3X3X A;  1JN5 B;  4HM1 B;  1Q7Y 4;  1K9M 4;  3EHC A;  2CIU A;  3AMO B;  2WGO A;  3HX8 A;  3CD6 3;  3WA3 A;  1FGO A;  2W56 A;  4XBX A;  2OOV C;  2SBL A;  1IDP A;  2F99 A;  4RBN A;  3DGM A;  3SOY A;  3FG4 A;  1MNL A;  1JB5 A;  3IPT A;  1IT7 A;  4KFF A;  4LGQ A;  1S5A A;  1W7C A;  2CFW A;  1IVX A;  3UB1 A;  4HZB B;  3F7X A;  1AVL A;  2LYX A;  3WMD A;  1UI8 A;  1VQN 3;  5IG5 A;  3NBJ A;  2RCD A;  3SXX A;  1ASK A;  2CK3 H;  2JDI H;  3NQZ A;  4H61 A;  2CC3 A;  2XFS A;  3FKA A;  1LNH A;  3NV0 B;  3VF1 A;  1M90 4;  3CXC 2;  4FR9 A;  4HM0 B;  1KQS 2;  3CCM 3;  1EG9 B;  1V74 A;  3K5T A;  4OVM A;  4JF8 A;  4TX4 A;  3CCS 3;  4LZI A;  4N3V A;  3SED A;  3WOD G;  1RJO A;  5JPP A;  3G71 3;  5IEN A;  4FMC A;  1TIJ A;  4HM5 B;  2OCT A;  1WMN A;  3J7Y d;  1CQS A;  1D6Y A;  2OTJ 3;  1N9E A;  4K1U A;  4AEQ A;  1YJN 3;  3X41 A;  2Z7A A;  2WOH A;  2RFR A;  3B4P A;  3I55 3;  2HMJ B;  2E2T A;  3MSO A;  1AR0 A;  5DRE A;  3G0K A;  1S72 3;  2GEX A;  3BLZ A;  3CC2 3;  3DMC A;  3QK9 A;  1TFO A;  1TP6 A;  3BND A;  4GL6 A;  1N5P A;  1DVD A;  5IW9 A;  1JKG A;  1UUW B;  3D3L A;  5EVH A;  3JVC A;  2CWT A;  3CMA 3;  3G8Z A;  5JBS A;  5AIG A;  2ML6 A;  5EQL A;  1OHS A;  1Q40 A;  3T8N A;  1JN5 A;  1ROA A;  2BT3 A;  3EF8 A;  2V1L A;  4X2O A;  1UW1 A;  3AMO A;  1A90 A;  4L8P A;  3N54 B;  1DYU A;  3VGN A;  2GEY A;  1EA2 A;  2GU1 A;  2P38 A;  3L0R A;  1VQ7 3;  4RNZ A;  3KII A;  2W6J H;  1D6Z A;  1E97 A;  4G1M B;  3EBY A;  3HK4 A;  3FF0 A;  3NXJ A;  3SX1 A;  4HM6 B;  2HMN B;  4HM4 B;  2XF3 A;  4RNY A;  2CFL A;  2IUK A;  3DXO A;  1O7G B;  1LXE A;  1IVV A;  1A2V A;  1VQ5 3;  5A0O B;  3KZT A;  4XBT A;  2ML5 A;  3ROB A;  1OF5 B;  2GBW B;  3RGR A;  1Q81 4;  1MOL A;  1PU4 A;  2STD A;  1W6G A;  2B1X B;  3MWZ A;  2OQE A;  3NV0 A;  3KSE D;  4LMI A;  5AI1 A;  5IG3 A;  3F40 A;  4ORL A;  3FSD A;  1NDO B;  2IUJ A;  2FXT A;  4KFE A;  2W0Q A;  1U5O A;  1KSI A;  3VSY A;  3WOF B;  3DY5 A;  2XSO B;  3NX0 A;  4OUQ A;  1LOX A;  5DRV A;  3LT9 A;  1EKM A;  2W03 A;  4HVN A;  5D81 A;  1U8C B;  3FZW A;  3CC7 3;  1UUV B;  3HZP A;  3SLU A;  3F9S A;  3NUV A;  3NM7 A;  1VQ4 3;  2RSX A;  5STD A;  1K41 A;  3N9H A;  4NRE A;  1YVB I;  1TUH A;  4HM8 B;  3FF2 A;  4MMX B;  2L4V A;  1OH0 A;  3LZA A;  3CCV 3;  3D9R A;  3OXA A;  2O3O A;  3H3H A;  5HGR A;  1VQK 3;  1DMM A;  2CFD A;  2E2U A;  1NU3 A;  3OX9 A;  2P09 A;  5IEP A;  3GZX B;  4HM3 B;  3E99 A;  2Y73 A;  2I9W A;  4BTX A;  3KSP A;  2WGQ A;  1JJ2 2;  3JUM A;  7STD A;  3PCS A;  5AIH A;  4XM4 A;  3SOA A;  2JQ5 A;  3CCJ 3;  1G96 A;  1QJG A;  1FGR A;  4EC6 A;  1QAL A;  3GWR A;  4O2H A;  3LML A;  1RRL A;  2K54 A;  1WMP A;  3X3Y A;  1E3R A;  1D6U A;  4LSO A;  4HM2 B;  1K8A 4;  1NB5 I;  5IG4 A;  3WDG B;  2F86 B;  4O3V A;  3S67 A;  3STD A;  1SPU A;  2OQE C;  2W04 A;  1ULJ B;  5EEO A;  1PFP A;  3EN1 B;  1QVG 2;  1R4C A;  1W02 A;  3FGY A;  4FCZ A;  3F14 A;  3V92 A;  4WFO A;  2OWP A;  3PXM A;  2BMQ B;  3Q2P A;  1DMN A;  3I0Y A;  3MG3 A;  1US1 A;  5CF1 A;  3NM2 A;  3EC9 A;  4WWU C;  2WO0 A;  3CPO A;  3NHX A;  1M1X B;  1Q86 4;  1OF5 A;  2BHM A;  1M1K 4;  2YFL B;  1STF I;  3T0U A;  2GU3 A;  3DGN A;  4FMD A;  4HKV B;  4K1V A;  2XFT A;  1ROV A;  1CEW I;  2HML B;  1GD3 A;  4XDV A;  2RGQ A;  2CFG A;  2QGU A;  4MEI A;  4R4K A;  1NJI 4;  1O7N B;  2C11 A;  3X42 A;  3MKI A;  1VQ9 3;  3CCR 3;  1OGZ A;  1CYV A;  2W9Q A;  2Z77 A;  3N8B A;  4HBR A;  3WA2 X;  1GYB A;  1IVU A;  1QAK A;  4MJD A;  3LTA A;  4N6U A;  1Q42 A;  3T8U A;  2QIY A;  1ZX2 A;  2FGT A;  3WOE B;  2QA4 3;  2GBX B;  3OWY A;  1FA3 A;  2XSH B;  1O7H B;  1TFK A;  3OWU A;  3PS8 A;  4K61 A;  1Z1S A;  3UL6 A;  3CCQ 3;  2YX9 A;  4MMY B;  2F98 A;  4R80 A;  1NO3 A;  3EB8 A;  4FMB A;  4CDL A;  4XBY A;  4R9K A;  1YI2 3;  3GZY B;  1E3V A;  4IT7 A;  3UL5 A;  1JV2 B;  3HIG A;  3MHE A;  3LTD A;  2CKF B;  1EQK A;  2GXF A;  3GAX A;  3NBR A;  1DMQ A;  1N8Q A;  5I97 A;  3B4O A;  4FCM A;  5AYS C;  3S29 A;  4STD A;  3F7S A;  1YJW 3;  1F8N A;  4AKY A;  4O02 B;  3CC4 3;  3S5C A;  2MF7 A;  4L7K A;  1ULI B;  1QMA A;  4N6O B;  5AYR B;  5CK6 A;  1AV4 A;  2Z76 A;  3RGA A;  2D42 A;  3U1W A;  1M9G A;  3KE7 A;  1SJW A;  2LQV A;  4JRF A;  4XB5 A;  1FGT A;  2P05 A;  2IMJ A;  3CCE 3;  6STD A;  1A67 A;  3ER7 A;  1HKX A;  3PYJ A;  5G2G A;  2KCD A;  1KWI A;  3RDE A;  1VQM 3;  1HU9 A;  1WTH A;  4J8T A;  2XH9 A;  1SII A;  5IEO A;  5ELJ A;  5BVB A;  1LVN A;  3FCS B;  3G4S 3;  3V99 A;  3K9M C;  3CCL 3;  1VQ8 3;  1BUQ A;  4HM7 B;  1JB4 A;  4J9A A;  4ZM8 A;  3MG1 A;  2YFJ B;  2ZL8 A;  3K0Z A;  4AKZ A;  2D1W A;  1IQ8 A;  3LTC A;  3DUK A;  4EBG A;  4HZ9 B;  1N5H A;  2W9P A;  1W01 A;  4IIA A;  3FH1 A;  1O7W B;  4RZM A;  4BTW A;  1IT8 A;  2Y74 A;  1YJ9 3;  5KP3 A;  4EYC A;  1JNQ A;  3UNL A;  1IK3 A;  1FUW A;  1JRQ A;  2WOF A;  3DGL A;  2CG1 A;  3EBT A;  4PEJ A;  3X40 A;  4LEH A;  3KKG A;  3FG3 A;  1ISK A;  5KP4 A;  2R4I A;  3LTB A;  4H3U A;  4X2H A;  2ZDJ A;  3Q1C A;  3JUQ A;  4EV5 A;  4Q53 A;  2CWU A;  1YIT 3;  1A2K A;  2O9U X;  2BO9 B;  4WP5 A;  3CNM A;  5ELU A;  2A15 A;  3QRD A;  3TDG A;  2HMO B;  1YHQ 3;  3ALA A;  4XDW A;  4HYZ A;  3S28 A;  1OUN A;  2C10 A;  2CFK A;  2P0X A;  3OV4 A;  5FW5 A;  3S27 A;  2P0M A;  1VQP 3;  3FLJ A;  1Q82 4;  1YIJ 3;  1RN7 A;  2XGL A;  2HMM B;  3CME 3;  1WMO A;  1GS3 A;  3LH4 A;  1GY7 A;  1IV7 A;  3G16 A;  1KC8 4;  3GZB A;  5KP1 A;  2BMO B;  2Z6B A;  2W2C A;  3JUP A;  3BNB A;  2BNG A;  4U13 A;  1IU7 A;  2UX0 A;  1C7H A;  2KRT A;  3PZW A;  3JUO A;  3PGB A;  4MMZ B;  1QAF A;  3X3Z A;  2E2V A;  3V98 A;  3MG2 A;  3A76 A;  1VQL 3;  4FMA A;  3EX9 A;  1OHO A;  3G6E 3;  1CYU A;  3K7C A;  1VQO 3;  1GY5 A;  1OCV A;  1T5Y A;  5FGO A;  1OGX A;  3F8H A;  1GD4 A;  3MYT A;  3FG1 A;  5CLK A;  1N9J A;  3PCR A;  4R9L A;  1UI7 A;  1IV9 A;  4WYK B;  3LT8 A;  5LC6 A;  3NBB A;  3CCU 3;  4N6T A;  5D82 A;  3EE1 A;  3LOY A;  3CPW 2;  2KXG A;  1NWW A;  1Y4K A;  3H51 A;  5BXQ A;  4NHF A;  4O8S A;  1SIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...