3F7XA

Crystal structure of a putative polyketide cyclase (pp0894) from pseudomonas putida kt2440 at 1.24 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
GMTATELVNAYYAAFNAGDMPAFLALLSEDVIHDINQGERQMGKARFAAFMEKMNRCYRERLADIVVMQNADGSRAAAEFTVHGQYLADDEGLPTANGQTYVLPAGAFFYIHCGKIARVTNYYNLNDWVEQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative polyketide cyclase
publication title Crystal structure of Putative polyketide cyclase. (NP_743055.1) from PSEUDOMONAS PUTIDA KT2440 at 1.24 A resolution
rcsb
source organism Pseudomonas putida kt2440
total genus 40
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f7xA00
2R4IA 4J9AA 4OUQA 3ECFA 5CF1A 2BMQB 3F7SA 1OHPA 3H51A 3MKIA 2UX0A 3CU3A 1Z1SA 1QJGA 3JUOA 1OUNA 5KP3A 4HZ9B 3HZPA 2K54A 2GBWB 1ULJB 1OPYA 3HX8A 1E3RA 3EQQB 3JUMA 4R9KA 5AIFA 3CPOA 3F14A 3HK4A 5CXOA 1E3VA 4WYKA 4XM4A 1JB5A 3F40A 2PZVA 1NDOB 1K41A 3EHCA 3EJVA 3CNXA 1W01A 3EN1B 2HMLB 3F7XA 2XRXB 3B4OA 2F86B 3DZLA 3Q90A 1O7MB 3ER7A 1JB4A 1ASKA 1DMMA 4K1VA 1W02A 2OWPA 1OGZA 4X2HA 2Z77A 3MG2A 4XBYA 3GRDA 3EF8A 5D82A 3UJMA 4Q53A 4R1KA 2HMOB 3KKGA 3NHXA 3B8LA 3IPTA 3FKAA 2YFLB 2IMJA 5IF6A 3F8XA 5CLKA 3FF0A 4HM3B 1DMNA 3DXOA 4CDLA 1Q40A 1W00A 3GWRA 4HM4B 1OGXA 4XDWA 1NWWA 1DMQA 4H3UA 1VZZA 3EN8A 3G0KA 3T8UA 3WMDA 3LZAA 4HVNA 1C7HA 2HMJB 3VGNA 5IG0A 1SJWA 3T8NA 2GBXB 4I4KA 3EX9A 4LEHA 5G2GA 4L8OA 3FF2A 3BB9A 5BXQA 4XBXA 3I0YA 5D81A 1GYBA 1OHSA 4LMIA 3G16A 1JKGA 3K0ZA 5IEOA 1TP6A 4GB5A 5CF2A 3RGAA 5IEPA 2INXA 3OV4A 4R9LA 2F99A 1JN5A 3SEDA 4XDVA 3E99A 4MJDA 2Z76A 1OF5A 4K1UA 3B7CA 4HM7B 2BMRB 3OWSA 1O7PB 1Q42A 3NM2A 5AEUB 5D83A 3BLZA 1STDA 1NU3A 2YFJB 3B4PA 2HMKB 3MG1A 2I9WA 5AEWB 3DUKA 4KVHA 5IERA 1CQSA 3DM8A 5BVBA 4STDA 4N3VA 3RGRA 1E97A 4IIAA 1EA2A 4X2OA 4FCMA 1OHOA 2XSHB 1UUWB 4LGQA 1QMAA 3NV0B 2Z7AA 3OWYA 2F98A 3GZYB 3FLJA 1IDPA 5CK6A 3K7CA 5HGRA 5AI1A 3F9SA 4HKVB 1HKXA 5KP4A 3VSYA 1EG9B 3MHEA 4HJLB 3FH1A 4WWUC 3JUPA 4FCJA 5AIHA 2A15A 3S5CA 1ISKA 3LYGA 3MSOA 1UUVB 1O7HB 4PEJA 3F8HA 1ZX2A 1GY6A 4RZMA 5DREA 4WYKB 1O7GB 3JUQA 5AIGA 3NBRA 5IG4A 2QGUA 3FZWA 2HMNB 1ZO2A 4HM5B 5AIIA 2XR8B 4L7KA 1OH0A 5FW5A 2RFRA 5TGNA 1A2KA 1ULIB 4U13A 1GY7A 4WP5A 5DRVA 2BMOB 2RCDA 1AR0A 4HM1B 4XBTA 2GEYA 4ORLA 3MYTA 1Q40B 3GZRA 3GZBA 2JQ5A 3KZTA 4HM6B 1TUHA 4HM2B 3OXAA 4J8TA 3OX9A 2B24B 5JPUA 3FSDA 8CHOA 3KE7A 2RGQA 2XSOB 3M8CA 4HM0B 3SOYA 5STDA 3OWUA 4XB5A 3D9RA 3G8ZA 3DMCA 3NXJA 3JUNA 3KSPA 2B1XB 1BUQA 1GS3A 4OVMA 1W6YA 3CNMA 3FGYA 2HMMB 1JKGB 1O7NB 3A76A 3SOAA 1JB2A 1OCVA 2CHCA 5JPPA 4L8PA 1JN5B 3H3HA 3STDA 5KP1A 1S5AA 4HZBB 2CKFB 3NUVA 3UNLA 2GXFA 3EC9A 3GZXB 2QIYA 2GEXA 1U5OA 1OF5B 3EBTA 2BNGA 1GY5A 5IENA 5IG3A 3MG3A 7STDA 2W2CA 2STDA 3ROBA 4HM8B 5EVHA 5IG5A 2YFIB 1O7WB 3EBYA 3NV0A 1WQLB 6STDA
chains in the Genus database with same CATH superfamily
1RN7A 1VQQA 2R4IA 1YJW3 4J9AA 2OOVC 1UI7A 1LOWA 2WGQA 1JNQA 3S29A 1N9EA 2XEPA 4OUQA 3ECFA 5CF1A 1GSPA 2BMQB 3LMLA 3F7SA 1OHPA 3H51A 3WOEB 3FG1A 1R4CA 3MKIA 5LC7A 3CME3 2CFWA 1RJOA 2UX0A 3CU3A 3PZWA 4RNTA 1BSEA 1Z1SA 1QJGA 3JUOA 4AKZA 1B2XA 5RNTA 3G4S3 1GD4A 2PNCA 1QALA 1W6CA 2K0MA 1OUNA 2ML6A 5KP3A 3CPW2 4HZ9B 1VQ43 1C54A 3HZPA 1AY7A 1Y4KA 1JJ22 2SARA 5ELUA 3RNTA 2K54A 1YIJ3 2GBWB 1ULJB 1OPYA 1V74A 1X1WA 2C11A 4J5KA 3HX8A 1W6GA 1US1A 1IT7A 2Q07A 1D6YA 1G02A 1E3RA 2OCTA 4EXRA 3EQQB 3JUMA 1SARA 4BTXA 1RRHA 4R9KA 3K5TA 5AIFA 4BU4A 1M904 2IUJA 2KCDA 1VQ73 1G0TA 3CPOA 4EBGA 3F14A 4KFEA 2Y74A 2XGNA 3HK4A 1BNIA 3I553 5CXOA 2MF7A 3AHSA 1E3VA 4WYKA 5LC6A 3ZG5A 4XM4A 1VQ53 1JB5A 3F40A 2PZVA 1NDOB 3WODG 1BSAA 2CW9A 1K41A 2WO0A 3PS8A 4BIRA 3EHCA 3EJVA 1IT8A 1I2EA 1RGEA 3CNXA 4N6TA 3UB1A 1KC84 1FW7A 1BRKA 2KF3A 3Q2PA 1W01A 3EN1B 3N8BA 2HMLB 3F7XA 5EQLA 1LQGC 2XRXB 1VQP3 3B4OA 2F86B 3DZLA 3PGBA 3Q90A 1O7MB 1JBTA 3ER7A 1JB4A 3IMAB 1ASKA 1DMMA 1WNHA 4LZIA 4K1VA 1W02A 2OWPA 1OGZA 3WHOA 4X2HA 1LOYA 1EEJA 2Z77A 2FGTA 3MG2A 3LTCA 1MGWA 4XBYA 3GRDA 3EF8A 1DE3A 1RHLA 1TIJA 3X42A 3KN4A 2BO9B 1X1UA 3QK9A 1BRJA 2QA43 3D5GA 5D82A 3DGNA 1NJI4 1BNRA 3UJMA 4Q53A 4R1KA 1STFI 2HMOB 4AKYA 3NBBA 3KKGA 1YIT3 3NHXA 3B8LA 1YVSA 3IPTA 3FKAA 1BRNL 2YFLB 1GMPA 2IMJA 5IF6A 2WGOA 3F8XA 1HYFA 3CCQ3 5CLKA 3FF0A 4HM3B 1DMNA 3DXOA 2H0GA 1EUIC 1Q40A 2P0MA 4CDLA 1FA3A 4EV5A 1RGAA 1W00A 3GWRA 6GSPA 1VQN3 2F5WA 4HM4B 1OGXA 2LYXA 3CCR3 1PY3A 4FCZA 4XDWA 1QVG2 1IQXA 3G6E3 1J2BA 1NWWA 2CIUA 1TTOA 1DMQA 4H3UA 1BNGA 4ZM8A 3KCHA 4KT3B 3L0RA 1VZZA 1X1YA 3EN8A 1HZ1A 3UL6A 1TU5A 1BU4A 3G0KA 3S67A 5M18A 1Q864 3CD63 4R4KA 3T8UA 4O02B 3WMDA 3LZAA 2IYJA 3A5EA 4HVNA 2RSXA 1C7HA 1B20A 1I0VA 2HMJB 3FG4A 4I5QA 3CC73 1GOYA 2FNQA 3VGNA 5AYSC 5IG0A 1V57A 1FGQA 1SJWA 3T8NA 2GBXB 4I4KA 3S28A 3EX9A 3Q1CA 2W56A 4LEHA 5BIRA 5G2GA 2F56A 2XF3A 1M1K4 4RBNA 4JF8A 2KF5A 4L8OA 3K9MC 1U8CB 3BB9A 3FF2A 4WFOA 3V92A 4XBXA 5BXQA 3I0YA 5D81A 1VQ93 1GYBA 1OHSA 4LMIA 2XGLA 3G16A 1WMNA 5BU4A 4GL6A 4HOHA 4IT7A 4R80A 2SBLA 1D6ZA 2KAAA 1JKGA 3K0ZA 4CCVA 5IEOA 3BNCA 1TP6A 1EQKA 1TRQA 4GB5A 1VQL3 3NBJA 2CX1A 5CF2A 3HIIA 3RGAA 1RRLA 1GMQA 3PCSA 5IEPA 2INXA 3RDEA 3OV4A 1RCKA 2F99A 1HU9A 4R9LA 1JN5A 1SQWA 3HOHA 1UUGB 8RNTA 3CCL3 2KF6A 5G1LA 1Q9EA 2CWVA 3X3XA 1B2SA 4CJNA 1RN1A 1K9M4 4G1MB 5JBSA 2H0HA 3ALAA 3SEDA 5HOHA 4BTYA 4N6NB 1Q814 1M9GA 1IYYA 3BNBA 3SLUA 2CFKA 3DY5A 1CYVA 4XDVA 1MOLA 1W5ZA 3E99A 3CMA3 1IK3A 1MWTA 1KSIA 3D5IA 6RNTA 1YJN3 4MJDA 2Z76A 1OF5A 1A67A 3NQZA 4K1UA 4KFDA 3LOYA 3X41A 2CH9A 2LQVA 2OOVA 2E2TA 1AVLA 3B7CA 4HM7B 3UL5A 1WTHA 1RKYA 1F8NA 2O3OA 1IVUA 2BMRB 3OWSA 4RNYA 1O7PB 1Q42A 3NM2A 1RN4A 3ZG0A 5AEUB 5D83A 3BLZA 5FGOA 1STDA 1N5PA 1NU3A 4HBRA 2YFJB 4O2HA 3B4PA 3CCS3 1A90A 2HMKB 3MG1A 3AMOA 2I9WA 3NM7A 4N6LA 5G1KA 3V98A 3WOFB 2CX0A 3CCV3 1UCIA 2C4BA 1VQ63 1SPUA 1UCKA 2KXGA 3GAXA 3LTBA 5AEWB 3OW22 3DUKA 4KVHA 5IERA 1CQSA 1WMOA 3DM8A 1CEWI 5BVBA 4STDA 2W6JH 3PCRA 1BANA 4N3VA 4WHAA 1RNBA 2WOHA 3BNEA 1EKMA 3RGRA 3WDGB 1E97A 4IIAA 2K3DA 1EA2A 1RMSA 3G713 1DYUA 4X2OA 2CFDA 1SIHA 1TFKA 4FCMA 1W2ZA 1OHOA 2KF4A 5ELJA 2AAEA 2XSHB 1UUWB 1TJDA 4ILFA 3MPHA 3CC23 1DETA 3SYUA 4LGQA 2BHMA 4K90B 5M1AA 3WR2A 3J7Yd 3NX0A 1QMAA 3NV0B 3WA3A 2Z7AA 3OWYA 2F98A 2W9QA 2CG0A 4H61A 3BIRA 1FGTA 1LXEA 3GZYB 3DGOA 1DVDA 2CG1A 3FLJA 1IDPA 2OQEC 3HIGA 5CK6A 3N54B 1DVCA 3K7CA 3ZFZA 1I2FA 1RGFA 2AADA 2UUGC 3AHWA 1CYUA 2L4VA 5HGRA 1B27A 1BRHA 1M1XB 1V58A 2JDIH 2P09A 5AI1A 4TX4A 1ROVA 3F9SA 1BIRA 4HKVB 1HKXA 5KP4A 1JZDA 2W03A 2ZA4A 1JZOA 3VSYA 1SIIA 3HI7A 1BSBA 2GU3A 3BNDA 2F4YA 1YJ93 1EG9B 1G96A 1I3FA 2ZDJA 3MHEA 1ZS7A 1N8R4 4HJLB 9RNTA 1Q7HA 4MMYB 1BNSA 3FH1A 4WWUC 1BRSA 1FUSA 3JUPA 4FCJA 2Z6BA 5AIHA 1YI23 2A15A 3S5CA 7GSPA 1ISKA 3LYGA 3GSPA 1I70A 1R4YA 3MSOA 1UUVB 1GMRA 1IV7A 4K61A 1O7HB 4PEJA 1JBSA 3PXMA 3F8HA 3V99A 1K28A 1ZX2A 1GY6A 4RZMA 4BL3A 5DREA 1ZGXA 3Q3FA 1BSCA 1IQYA 4WYKB 1O7GB 3JUQA 4HYZA 5AIGA 3MWZA 3O8YA 3NBRA 4J5GA 1LRAA 1BNJA 1RTUA 5IG4A 4BTWA 3EE1A 4EYCA 2UGIA 1MWUA 1W4NA 3KIIA 1YNVX 2QGUA 3DGMA 3CCE3 2L1SA 3FZWA 1LOXA 2HMNB 1IQ8A 1ZO2A 1I0XA 1IVWA 4HM5B 3DH2A 3N9HA 5AIIA 2XR8B 1YHQ3 2GSPA 4L7KA 1NB3I 2D1WA 1MGRA 1OH0A 2HOHA 4RNZA 4GSPA 1WMPA 3U97A 2E2UA 3FCSB 1PFPA 5FW5A 1TFOA 2RFRA 5TGNA 1A2KA 2BT3A 1JBRA 1ULIB 1BSDA 2W04A 3CC43 2W9PA 4DKIA 1CH0A 3KFQC 3LH4A 3LTAA 1N8QA 4U13A 1IVXA 1GY7A 4N6OB 5EEOA 1NO3A 4MMZB 1QVF2 4WP5A 1UCJA 1BNEA 5DRVA 2BMOB 1IU7A 2RCDA 1JRQA 3TDGA 1AR0A 1T2IA 3K63A 4O3VA 1PU4A 3CXC2 2RBIA 1GD3A 1BUJA 3LTDA 4HM1B 1MWSA 4XBTA 3EB8A 3WA2X 1T5YA 1IVVA 1T3BA 2GEYA 4OK0A 4ORLA 5AYRB 1Q7Y4 3X3YA 1D6UA 1MNLA 1FZUA 1Q40B 3MYTA 1N5HA 1UW1A 3GZRA 4MEIA 1KWIA 3GZBA 1I2GA 3KSED 2P05A 3CCM3 1RGCA 1ROAA 2JQ5A 3D4AA 3X3ZA 1UGHI 4EW5A 1W7CA 3KZTA 4HM6B 2C10A 4MMXB 1TUHA 4HM2B 1KQS2 5I97A 1NB5I 3OXAA 4J8TA 3OX9A 1UCLA 2B24B 4FMDA 4FR9A 3VF1A 2BIRA 5JPUA 2WOFA 1I3IA 3FSDA 1QAFA 1YGWA 1YVBI 4FMBA 3D79A 8CHOA 1LOVA 3KE7A 2RGQA 2XSOB 4HAAA 4QWTA 3M8CA 1L5GB 1BAOA 4FMAA 3BU4A 4HM0B 1IV9A 1LVNA 1FGOA 1RGKA 1FYSA 2W0QA 4LYLB 3SOYA 4N6V0 2D42A 4FMCA 1QAKA 3CCU3 2FXTA 5STDA 2IY2A 4EC6A 1VQK3 4N6UA 3OWUA 4NHFA 5M19A 2P38A 3DGYA 1GOVA 4XB5A 1W2B2 1A2VA 3D9RA 3DMCA 3G8ZA 3NXJA 3JUNA 2BU4A 3CCJ3 2OTL3 2V1LA 1BGSA 1T2HA 3URPA 2W56B 1B2MA 1FGRA 1UDII 1VQM3 4LSOA 1RGHA 3KSPA 1RNTA 3LT9A 2B1XB 1RSNA 2XH9A 1S723 1RGLA 1BUQA 1A2PA 2Y73A 1GS3A 2ZHXB 4NPBA 4OVMA 3X40A 1W6YA 2YX9A 3CNMA 3FGYA 2HMMB 1JKGB 1O7NB 1LNHA 1AV4A 1TRPA 3A76A 5A0OB 3SOAA 1JB2A 1OCVA 2O9UX 2CHCA 2MC8A 1UGIA 5JPPA 4L8PA 1X1XA 4KFFA 1K8A4 1FUWA 1JN5B 3H3HA 3IJEB 1RLSA 3AGOA 2CWUA 3STDA 2CC3A 1B2UA 1S5AA 4HZBB 3SVAA 5KP1A 2CKFB 2H0IA 1K734 3NUVA 4O8SA 3S27A 3UNLA 1B3SA 3SXXA 1BNFA 1NNVA 2GXFA 3AGNA 1LQMB 2GU1A 3EC9A 3GZXB 2CFGA 3U1WA 2IA7A 2OTJ3 1RCLA 1Q824 2J8XB 2QIYA 4IPBA 2GEXA 1KD14 1U5OA 2XFSA 4N6MA 2KRTA 3LT8A 1OF5B 1UI8A 2ML5A 3DGLA 1I8VA 3I563 3LXUX 3EBTA 2BNGA 3FG3A 3NQYA 5IW9A 3QRDA 1GOUA 2IUKA 1GY5A 2OQEA 1LNIA 1MWRA 3T0UA 2XFTA 1VQO3 2RNTA 1YGEA 2CWTA 2F5MA 1N9JA 1FGMA 4KZ1A 5IENA 1RGGA 3AMOB 2CFLA 2ZL8A 4CPKA 1VQ83 1BOXA 2M7OA 1BRGA 1FUTA 1AVKA 5IG3A 3MG3A 1BRIA 2QEX3 7STDA 7RNTA 2W2CA 1AQZA 4JRFA 1JV2B 5GSPA 1PYLA 2CK3H 2STDA 4BL2A 3ROBA 4HM8B 2E2VA 5EVHA 1B2ZA 4GHOA 5IG5A 2YFIB 4AEQA 1RDSA 3JVCA 2R41A 1BVIA 4EV2A 1O7WB 3EBYA 3D3LA 3SX1A 2P0XA 1B21A 3NV0A 1WQLB 1OACA 6STDA 4NREA 3PYJA
chains in the Genus database with same CATH topology
1RN7A 2R4IA 1YJW3 4J9AA 2OOVC 1UI7A 2WGQA 1JNQA 3S29A 1N9EA 2XEPA 4OUQA 3ECFA 5CF1A 2BMQB 3LMLA 3F7SA 1OHPA 3H51A 3WOEB 3FG1A 1R4CA 3MKIA 5LC7A 3CME3 2CFWA 1RJOA 2UX0A 3CU3A 3PZWA 1Z1SA 1QJGA 3JUOA 4AKZA 3G4S3 1GD4A 2PNCA 1QALA 1W6CA 2K0MA 1OUNA 2ML6A 5KP3A 3CPW2 4HZ9B 1VQ43 3HZPA 1Y4KA 1JJ22 5ELUA 2K54A 1YIJ3 2GBWB 1ULJB 1OPYA 1V74A 2C11A 3HX8A 1W6GA 1US1A 1IT7A 2Q07A 1D6YA 2OCTA 1E3RA 4EXRA 3EQQB 3JUMA 4BTXA 1RRHA 4R9KA 3K5TA 5AIFA 1M904 2IUJA 2KCDA 1VQ73 3CPOA 4EBGA 3F14A 4KFEA 2Y74A 2XGNA 3HK4A 3I553 5CXOA 2MF7A 1E3VA 4WYKA 5LC6A 1VQ53 4XM4A 1JB5A 3F40A 2PZVA 1NDOB 3WODG 2CW9A 1K41A 2WO0A 3PS8A 3EHCA 3EJVA 1IT8A 3CNXA 4N6TA 3UB1A 1KC84 3Q2PA 1W01A 3EN1B 3N8BA 2HMLB 3F7XA 5EQLA 2XRXB 1VQP3 3B4OA 2F86B 3DZLA 3PGBA 3Q90A 1O7MB 3ER7A 1JB4A 3IMAB 1ASKA 1DMMA 1WNHA 4LZIA 4K1VA 1W02A 2OWPA 1OGZA 4X2HA 2Z77A 2FGTA 3MG2A 3LTCA 4XBYA 3GRDA 3EF8A 1TIJA 3X42A 3KN4A 2BO9B 3QK9A 1NJI4 2QA43 5D82A 3DGNA 3UJMA 4Q53A 4R1KA 1STFI 2HMOB 4AKYA 3NBBA 3KKGA 1YIT3 3NHXA 3B8LA 3IPTA 3FKAA 2YFLB 2IMJA 5IF6A 2WGOA 3F8XA 3CCQ3 5CLKA 3FF0A 4HM3B 1DMNA 3DXOA 1FA3A 4CDLA 1Q40A 2P0MA 4EV5A 1W00A 1VQN3 3GWRA 4HM4B 1OGXA 2LYXA 3CCR3 4FCZA 4XDWA 1QVG2 1IQXA 3G6E3 1J2BA 1NWWA 2CIUA 1DMQA 4H3UA 4ZM8A 3L0RA 1VZZA 3EN8A 3UL6A 1TU5A 3G0KA 3S67A 1Q864 3CD63 4R4KA 3T8UA 4O02B 3WMDA 3LZAA 4HVNA 2RSXA 1C7HA 2HMJB 3CC73 3FG4A 2FNQA 3VGNA 5AYSC 5IG0A 1FGQA 1SJWA 3T8NA 2GBXB 4I4KA 3S28A 3EX9A 3Q1CA 2W56A 4LEHA 5G2GA 1M1K4 2XF3A 4RBNA 4JF8A 4L8OA 3K9MC 1U8CB 3BB9A 3FF2A 4WFOA 3V92A 4XBXA 5BXQA 3I0YA 5D81A 1VQ93 1GYBA 1OHSA 4LMIA 2XGLA 3G16A 1WMNA 4GL6A 4IT7A 4R80A 2SBLA 1D6ZA 1JKGA 3K0ZA 4CCVA 5IEOA 3BNCA 1TP6A 1EQKA 4GB5A 1VQL3 3NBJA 5CF2A 3HIIA 3RGAA 1RRLA 3PCSA 5IEPA 2INXA 3RDEA 3OV4A 4R9LA 2F99A 1HU9A 1JN5A 1SQWA 3CCL3 2CWVA 3X3XA 1K9M4 4G1MB 5JBSA 1Q814 3ALAA 3SEDA 4BTYA 4N6NB 1M9GA 3BNBA 3SLUA 2CFKA 3DY5A 1CYVA 4XDVA 1MOLA 1W5ZA 3E99A 3CMA3 1IK3A 1KSIA 1YJN3 4MJDA 2Z76A 1OF5A 1A67A 3NQZA 4K1UA 4KFDA 3LOYA 3X41A 2LQVA 2CH9A 2OOVA 2E2TA 1AVLA 3B7CA 4HM7B 3UL5A 1WTHA 1RKYA 1F8NA 2O3OA 1IVUA 2BMRB 3OWSA 4RNYA 1O7PB 1Q42A 3NM2A 5AEUB 5D83A 3BLZA 5FGOA 1STDA 1N5PA 1NU3A 4HBRA 2YFJB 4O2HA 3B4PA 3CCS3 1A90A 2HMKB 3MG1A 3AMOA 2I9WA 3NM7A 4N6LA 3V98A 3WOFB 3CCV3 1VQ63 1SPUA 2KXGA 3GAXA 3LTBA 5AEWB 3OW22 3DUKA 4KVHA 5IERA 1CQSA 1WMOA 3DM8A 1CEWI 5BVBA 4STDA 2W6JH 3PCRA 4WHAA 4N3VA 2WOHA 3BNEA 1EKMA 3RGRA 3WDGB 1E97A 4IIAA 1EA2A 3G713 1DYUA 4X2OA 2CFDA 1SIHA 1TFKA 4FCMA 1W2ZA 1OHOA 5ELJA 2XSHB 1UUWB 3MPHA 3CC23 4LGQA 2BHMA 4K90B 3J7Yd 3NX0A 1QMAA 3NV0B 3WA3A 2Z7AA 3OWYA 2F98A 2W9QA 2CG0A 4H61A 1FGTA 1LXEA 3GZYB 3DGOA 1DVDA 2CG1A 3FLJA 1IDPA 2OQEC 3HIGA 5CK6A 3N54B 1DVCA 3K7CA 1CYUA 2L4VA 5HGRA 1M1XB 2JDIH 2P09A 5AI1A 4TX4A 1ROVA 3F9SA 4HKVB 1HKXA 5KP4A 2W03A 3VSYA 1SIIA 3HI7A 2GU3A 3BNDA 1YJ93 1EG9B 1G96A 2ZDJA 3MHEA 1N8R4 4HJLB 4MMYB 3FH1A 4WWUC 3JUPA 4FCJA 2Z6BA 5AIHA 1YI23 2A15A 3S5CA 1ISKA 3LYGA 3MSOA 1UUVB 1IV7A 4K61A 1O7HB 4PEJA 3PXMA 3F8HA 3V99A 1K28A 1ZX2A 1GY6A 4RZMA 5DREA 4WYKB 1IQYA 1O7GB 3JUQA 4HYZA 5AIGA 3MWZA 3O8YA 3NBRA 5IG4A 4BTWA 3EE1A 4EYCA 3KIIA 1W4NA 2QGUA 3DGMA 3CCE3 3FZWA 1LOXA 2HMNB 1IQ8A 1ZO2A 1IVWA 4HM5B 3N9HA 5AIIA 2XR8B 1YHQ3 4L7KA 1NB3I 2D1WA 1OH0A 4RNZA 3U97A 1WMPA 2E2UA 3FCSB 1PFPA 5FW5A 1TFOA 2RFRA 5TGNA 1A2KA 2BT3A 1ULIB 2W04A 3CC43 2W9PA 3KFQC 3LH4A 3LTAA 1N8QA 4U13A 1IVXA 1GY7A 4N6OB 5EEOA 1NO3A 4MMZB 1QVF2 4WP5A 5DRVA 2BMOB 1IU7A 2RCDA 1JRQA 3TDGA 1AR0A 3K63A 4O3VA 3CXC2 1PU4A 1GD3A 3LTDA 4HM1B 4XBTA 3EB8A 3WA2X 1T5YA 1IVVA 2GEYA 4ORLA 4OK0A 5AYRB 1Q7Y4 3X3YA 1D6UA 1MNLA 3MYTA 1Q40B 1N5HA 1UW1A 3GZRA 4MEIA 1KWIA 3GZBA 3KSED 3CCM3 2P05A 2JQ5A 1ROAA 3X3ZA 1W7CA 3KZTA 4HM6B 2C10A 4MMXB 1TUHA 4HM2B 1KQS2 5I97A 1NB5I 3OXAA 4J8TA 3OX9A 2B24B 4FMDA 4FR9A 3VF1A 5JPUA 2WOFA 3FSDA 1QAFA 1YVBI 4FMBA 8CHOA 3KE7A 2RGQA 2XSOB 4QWTA 3M8CA 1L5GB 4FMAA 4HM0B 1IV9A 1LVNA 1FGOA 3SOYA 2W0QA 4N6V0 2D42A 4FMCA 1QAKA 3CCU3 2FXTA 5STDA 4EC6A 1VQK3 4N6UA 3OWUA 4NHFA 2P38A 1W2B2 4XB5A 1A2VA 3D9RA 3DMCA 3G8ZA 3NXJA 3JUNA 3CCJ3 2OTL3 2V1LA 2W56B 1FGRA 1VQM3 4LSOA 3KSPA 3LT9A 2B1XB 2XH9A 1S723 1BUQA 2Y73A 1GS3A 4OVMA 3X40A 1W6YA 2YX9A 3CNMA 3FGYA 2HMMB 1JKGB 1O7NB 1LNHA 1AV4A 3A76A 5A0OB 3SOAA 1JB2A 1OCVA 2O9UX 2CHCA 2MC8A 5JPPA 4L8PA 4KFFA 1K8A4 1FUWA 1JN5B 3H3HA 3IJEB 2CWUA 3STDA 2CC3A 1S5AA 3SVAA 4HZBB 5KP1A 2CKFB 1K734 3NUVA 4O8SA 3S27A 3UNLA 3SXXA 2GXFA 2GU1A 3EC9A 3GZXB 2CFGA 3U1WA 2IA7A 2OTJ3 1Q824 2QIYA 4IPBA 1KD14 2GEXA 2XFSA 1U5OA 4N6MA 2KRTA 3LT8A 1OF5B 1UI8A 2ML5A 3DGLA 3I563 3LXUX 3EBTA 2BNGA 3FG3A 3NQYA 5IW9A 3QRDA 2IUKA 1GY5A 2OQEA 3T0UA 2XFTA 1VQO3 1YGEA 2CWTA 1N9JA 1FGMA 4KZ1A 5IENA 3AMOB 2CFLA 2ZL8A 1VQ83 2M7OA 1AVKA 5IG3A 3MG3A 2QEX3 7STDA 2W2CA 4JRFA 1JV2B 2CK3H 2STDA 3ROBA 4HM8B 2E2VA 5EVHA 5IG5A 2YFIB 4AEQA 3JVCA 4EV2A 1O7WB 3EBYA 3D3LA 3SX1A 2P0XA 3NV0A 1WQLB 1OACA 6STDA 4NREA 3PYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4I A;  4J9A A;  4OUQ A;  3ECF A;  5CF1 A;  2BMQ B;  3F7S A;  1OHP A;  3H51 A;  3MKI A;  2UX0 A;  3CU3 A;  1Z1S A;  1QJG A;  3JUO A;  1OUN A;  5KP3 A;  4HZ9 B;  3HZP A;  2K54 A;  2GBW B;  1ULJ B;  1OPY A;  3HX8 A;  1E3R A;  3EQQ B;  3JUM A;  4R9K A;  5AIF A;  3CPO A;  3F14 A;  3HK4 A;  5CXO A;  1E3V A;  4WYK A;  4XM4 A;  1JB5 A;  3F40 A;  2PZV A;  1NDO B;  1K41 A;  3EHC A;  3EJV A;  3CNX A;  1W01 A;  3EN1 B;  2HML B;  3F7X A;  2XRX B;  3B4O A;  2F86 B;  3DZL A;  3Q90 A;  1O7M B;  3ER7 A;  1JB4 A;  1ASK A;  1DMM A;  4K1V A;  1W02 A;  2OWP A;  1OGZ A;  4X2H A;  2Z77 A;  3MG2 A;  4XBY A;  3GRD A;  3EF8 A;  5D82 A;  3UJM A;  4Q53 A;  4R1K A;  2HMO B;  3KKG A;  3NHX A;  3B8L A;  3IPT A;  3FKA A;  2YFL B;  2IMJ A;  5IF6 A;  3F8X A;  5CLK A;  3FF0 A;  4HM3 B;  1DMN A;  3DXO A;  4CDL A;  1Q40 A;  1W00 A;  3GWR A;  4HM4 B;  1OGX A;  4XDW A;  1NWW A;  1DMQ A;  4H3U A;  1VZZ A;  3EN8 A;  3G0K A;  3T8U A;  3WMD A;  3LZA A;  4HVN A;  1C7H A;  2HMJ B;  3VGN A;  5IG0 A;  1SJW A;  3T8N A;  2GBX B;  4I4K A;  3EX9 A;  4LEH A;  5G2G A;  4L8O A;  3FF2 A;  3BB9 A;  5BXQ A;  4XBX A;  3I0Y A;  5D81 A;  1GYB A;  1OHS A;  4LMI A;  3G16 A;  1JKG A;  3K0Z A;  5IEO A;  1TP6 A;  4GB5 A;  5CF2 A;  3RGA A;  5IEP A;  2INX A;  3OV4 A;  4R9L A;  2F99 A;  1JN5 A;  3SED A;  4XDV A;  3E99 A;  4MJD A;  2Z76 A;  1OF5 A;  4K1U A;  3B7C A;  4HM7 B;  2BMR B;  3OWS A;  1O7P B;  1Q42 A;  3NM2 A;  5AEU B;  5D83 A;  3BLZ A;  1STD A;  1NU3 A;  2YFJ B;  3B4P A;  2HMK B;  3MG1 A;  2I9W A;  5AEW B;  3DUK A;  4KVH A;  5IER A;  1CQS A;  3DM8 A;  5BVB A;  4STD A;  4N3V A;  3RGR A;  1E97 A;  4IIA A;  1EA2 A;  4X2O A;  4FCM A;  1OHO A;  2XSH B;  1UUW B;  4LGQ A;  1QMA A;  3NV0 B;  2Z7A A;  3OWY A;  2F98 A;  3GZY B;  3FLJ A;  1IDP A;  5CK6 A;  3K7C A;  5HGR A;  5AI1 A;  3F9S A;  4HKV B;  1HKX A;  5KP4 A;  3VSY A;  1EG9 B;  3MHE A;  4HJL B;  3FH1 A;  4WWU C;  3JUP A;  4FCJ A;  5AIH A;  2A15 A;  3S5C A;  1ISK A;  3LYG A;  3MSO A;  1UUV B;  1O7H B;  4PEJ A;  3F8H A;  1ZX2 A;  1GY6 A;  4RZM A;  5DRE A;  4WYK B;  1O7G B;  3JUQ A;  5AIG A;  3NBR A;  5IG4 A;  2QGU A;  3FZW A;  2HMN B;  1ZO2 A;  4HM5 B;  5AII A;  2XR8 B;  4L7K A;  1OH0 A;  5FW5 A;  2RFR A;  5TGN A;  1A2K A;  1ULI B;  4U13 A;  1GY7 A;  4WP5 A;  5DRV A;  2BMO B;  2RCD A;  1AR0 A;  4HM1 B;  4XBT A;  2GEY A;  4ORL A;  3MYT A;  1Q40 B;  3GZR A;  3GZB A;  2JQ5 A;  3KZT A;  4HM6 B;  1TUH A;  4HM2 B;  3OXA A;  4J8T A;  3OX9 A;  2B24 B;  5JPU A;  3FSD A;  8CHO A;  3KE7 A;  2RGQ A;  2XSO B;  3M8C A;  4HM0 B;  3SOY A;  5STD A;  3OWU A;  4XB5 A;  3D9R A;  3G8Z A;  3DMC A;  3NXJ A;  3JUN A;  3KSP A;  2B1X B;  1BUQ A;  1GS3 A;  4OVM A;  1W6Y A;  3CNM A;  3FGY A;  2HMM B;  1JKG B;  1O7N B;  3A76 A;  3SOA A;  1JB2 A;  1OCV A;  2CHC A;  5JPP A;  4L8P A;  1JN5 B;  3H3H A;  3STD A;  5KP1 A;  1S5A A;  4HZB B;  2CKF B;  3NUV A;  3UNL A;  2GXF A;  3EC9 A;  3GZX B;  2QIY A;  2GEX A;  1U5O A;  1OF5 B;  3EBT A;  2BNG A;  1GY5 A;  5IEN A;  5IG3 A;  3MG3 A;  7STD A;  2W2C A;  2STD A;  3ROB A;  4HM8 B;  5EVH A;  5IG5 A;  2YFI B;  1O7W B;  3EBY A;  3NV0 A;  1WQL B;  6STD A; 
#chains in the Genus database with same CATH topology
 1RN7 A;  1VQQ A;  2R4I A;  1YJW 3;  4J9A A;  2OOV C;  1UI7 A;  1LOW A;  2WGQ A;  1JNQ A;  3S29 A;  1N9E A;  2XEP A;  4OUQ A;  3ECF A;  5CF1 A;  1GSP A;  2BMQ B;  3LML A;  3F7S A;  1OHP A;  3H51 A;  3WOE B;  3FG1 A;  1R4C A;  3MKI A;  5LC7 A;  3CME 3;  2CFW A;  1RJO A;  2UX0 A;  3CU3 A;  3PZW A;  4RNT A;  1BSE A;  1Z1S A;  1QJG A;  3JUO A;  4AKZ A;  1B2X A;  5RNT A;  3G4S 3;  1GD4 A;  2PNC A;  1QAL A;  1W6C A;  2K0M A;  1OUN A;  2ML6 A;  5KP3 A;  3CPW 2;  4HZ9 B;  1VQ4 3;  1C54 A;  3HZP A;  1AY7 A;  1Y4K A;  1JJ2 2;  2SAR A;  5ELU A;  3RNT A;  2K54 A;  1YIJ 3;  2GBW B;  1ULJ B;  1OPY A;  1V74 A;  1X1W A;  2C11 A;  4J5K A;  3HX8 A;  1W6G A;  1US1 A;  1IT7 A;  2Q07 A;  1D6Y A;  1G02 A;  1E3R A;  2OCT A;  4EXR A;  3EQQ B;  3JUM A;  1SAR A;  4BTX A;  1RRH A;  4R9K A;  3K5T A;  5AIF A;  4BU4 A;  1M90 4;  2IUJ A;  2KCD A;  1VQ7 3;  1G0T A;  3CPO A;  4EBG A;  3F14 A;  4KFE A;  2Y74 A;  2XGN A;  3HK4 A;  1BNI A;  3I55 3;  5CXO A;  2MF7 A;  3AHS A;  1E3V A;  4WYK A;  5LC6 A;  3ZG5 A;  4XM4 A;  1VQ5 3;  1JB5 A;  3F40 A;  2PZV A;  1NDO B;  3WOD G;  1BSA A;  2CW9 A;  1K41 A;  2WO0 A;  3PS8 A;  4BIR A;  3EHC A;  3EJV A;  1IT8 A;  1I2E A;  1RGE A;  3CNX A;  4N6T A;  3UB1 A;  1KC8 4;  1FW7 A;  1BRK A;  2KF3 A;  3Q2P A;  1W01 A;  3EN1 B;  3N8B A;  2HML B;  3F7X A;  5EQL A;  1LQG C;  2XRX B;  1VQP 3;  3B4O A;  2F86 B;  3DZL A;  3PGB A;  3Q90 A;  1O7M B;  1JBT A;  3ER7 A;  1JB4 A;  3IMA B;  1ASK A;  1DMM A;  1WNH A;  4LZI A;  4K1V A;  1W02 A;  2OWP A;  1OGZ A;  3WHO A;  4X2H A;  1LOY A;  1EEJ A;  2Z77 A;  2FGT A;  3MG2 A;  3LTC A;  1MGW A;  4XBY A;  3GRD A;  3EF8 A;  1DE3 A;  1RHL A;  1TIJ A;  3X42 A;  3KN4 A;  2BO9 B;  1X1U A;  3QK9 A;  1BRJ A;  2QA4 3;  3D5G A;  5D82 A;  3DGN A;  1NJI 4;  1BNR A;  3UJM A;  4Q53 A;  4R1K A;  1STF I;  2HMO B;  4AKY A;  3NBB A;  3KKG A;  1YIT 3;  3NHX A;  3B8L A;  1YVS A;  3IPT A;  3FKA A;  1BRN L;  2YFL B;  1GMP A;  2IMJ A;  5IF6 A;  2WGO A;  3F8X A;  1HYF A;  3CCQ 3;  5CLK A;  3FF0 A;  4HM3 B;  1DMN A;  3DXO A;  2H0G A;  1EUI C;  1Q40 A;  2P0M A;  4CDL A;  1FA3 A;  4EV5 A;  1RGA A;  1W00 A;  3GWR A;  6GSP A;  1VQN 3;  2F5W A;  4HM4 B;  1OGX A;  2LYX A;  3CCR 3;  1PY3 A;  4FCZ A;  4XDW A;  1QVG 2;  1IQX A;  3G6E 3;  1J2B A;  1NWW A;  2CIU A;  1TTO A;  1DMQ A;  4H3U A;  1BNG A;  4ZM8 A;  3KCH A;  4KT3 B;  3L0R A;  1VZZ A;  1X1Y A;  3EN8 A;  1HZ1 A;  3UL6 A;  1TU5 A;  1BU4 A;  3G0K A;  3S67 A;  5M18 A;  1Q86 4;  3CD6 3;  4R4K A;  3T8U A;  4O02 B;  3WMD A;  3LZA A;  2IYJ A;  3A5E A;  4HVN A;  2RSX A;  1C7H A;  1B20 A;  1I0V A;  2HMJ B;  3FG4 A;  4I5Q A;  3CC7 3;  1GOY A;  2FNQ A;  3VGN A;  5AYS C;  5IG0 A;  1V57 A;  1FGQ A;  1SJW A;  3T8N A;  2GBX B;  4I4K A;  3S28 A;  3EX9 A;  3Q1C A;  2W56 A;  4LEH A;  5BIR A;  5G2G A;  2F56 A;  2XF3 A;  1M1K 4;  4RBN A;  4JF8 A;  2KF5 A;  4L8O A;  3K9M C;  1U8C B;  3BB9 A;  3FF2 A;  4WFO A;  3V92 A;  4XBX A;  5BXQ A;  3I0Y A;  5D81 A;  1VQ9 3;  1GYB A;  1OHS A;  4LMI A;  2XGL A;  3G16 A;  1WMN A;  5BU4 A;  4GL6 A;  4HOH A;  4IT7 A;  4R80 A;  2SBL A;  1D6Z A;  2KAA A;  1JKG A;  3K0Z A;  4CCV A;  5IEO A;  3BNC A;  1TP6 A;  1EQK A;  1TRQ A;  4GB5 A;  1VQL 3;  3NBJ A;  2CX1 A;  5CF2 A;  3HII A;  3RGA A;  1RRL A;  1GMQ A;  3PCS A;  5IEP A;  2INX A;  3RDE A;  3OV4 A;  1RCK A;  2F99 A;  1HU9 A;  4R9L A;  1JN5 A;  1SQW A;  3HOH A;  1UUG B;  8RNT A;  3CCL 3;  2KF6 A;  5G1L A;  1Q9E A;  2CWV A;  3X3X A;  1B2S A;  4CJN A;  1RN1 A;  1K9M 4;  4G1M B;  5JBS A;  2H0H A;  3ALA A;  3SED A;  5HOH A;  4BTY A;  4N6N B;  1Q81 4;  1M9G A;  1IYY A;  3BNB A;  3SLU A;  2CFK A;  3DY5 A;  1CYV A;  4XDV A;  1MOL A;  1W5Z A;  3E99 A;  3CMA 3;  1IK3 A;  1MWT A;  1KSI A;  3D5I A;  6RNT A;  1YJN 3;  4MJD A;  2Z76 A;  1OF5 A;  1A67 A;  3NQZ A;  4K1U A;  4KFD A;  3LOY A;  3X41 A;  2CH9 A;  2LQV A;  2OOV A;  2E2T A;  1AVL A;  3B7C A;  4HM7 B;  3UL5 A;  1WTH A;  1RKY A;  1F8N A;  2O3O A;  1IVU A;  2BMR B;  3OWS A;  4RNY A;  1O7P B;  1Q42 A;  3NM2 A;  1RN4 A;  3ZG0 A;  5AEU B;  5D83 A;  3BLZ A;  5FGO A;  1STD A;  1N5P A;  1NU3 A;  4HBR A;  2YFJ B;  4O2H A;  3B4P A;  3CCS 3;  1A90 A;  2HMK B;  3MG1 A;  3AMO A;  2I9W A;  3NM7 A;  4N6L A;  5G1K A;  3V98 A;  3WOF B;  2CX0 A;  3CCV 3;  1UCI A;  2C4B A;  1VQ6 3;  1SPU A;  1UCK A;  2KXG A;  3GAX A;  3LTB A;  5AEW B;  3OW2 2;  3DUK A;  4KVH A;  5IER A;  1CQS A;  1WMO A;  3DM8 A;  1CEW I;  5BVB A;  4STD A;  2W6J H;  3PCR A;  1BAN A;  4N3V A;  4WHA A;  1RNB A;  2WOH A;  3BNE A;  1EKM A;  3RGR A;  3WDG B;  1E97 A;  4IIA A;  2K3D A;  1EA2 A;  1RMS A;  3G71 3;  1DYU A;  4X2O A;  2CFD A;  1SIH A;  1TFK A;  4FCM A;  1W2Z A;  1OHO A;  2KF4 A;  5ELJ A;  2AAE A;  2XSH B;  1UUW B;  1TJD A;  4ILF A;  3MPH A;  3CC2 3;  1DET A;  3SYU A;  4LGQ A;  2BHM A;  4K90 B;  5M1A A;  3WR2 A;  3J7Y d;  3NX0 A;  1QMA A;  3NV0 B;  3WA3 A;  2Z7A A;  3OWY A;  2F98 A;  2W9Q A;  2CG0 A;  4H61 A;  3BIR A;  1FGT A;  1LXE A;  3GZY B;  3DGO A;  1DVD A;  2CG1 A;  3FLJ A;  1IDP A;  2OQE C;  3HIG A;  5CK6 A;  3N54 B;  1DVC A;  3K7C A;  3ZFZ A;  1I2F A;  1RGF A;  2AAD A;  2UUG C;  3AHW A;  1CYU A;  2L4V A;  5HGR A;  1B27 A;  1BRH A;  1M1X B;  1V58 A;  2JDI H;  2P09 A;  5AI1 A;  4TX4 A;  1ROV A;  3F9S A;  1BIR A;  4HKV B;  1HKX A;  5KP4 A;  1JZD A;  2W03 A;  2ZA4 A;  1JZO A;  3VSY A;  1SII A;  3HI7 A;  1BSB A;  2GU3 A;  3BND A;  2F4Y A;  1YJ9 3;  1EG9 B;  1G96 A;  1I3F A;  2ZDJ A;  3MHE A;  1ZS7 A;  1N8R 4;  4HJL B;  9RNT A;  1Q7H A;  4MMY B;  1BNS A;  3FH1 A;  4WWU C;  1BRS A;  1FUS A;  3JUP A;  4FCJ A;  2Z6B A;  5AIH A;  1YI2 3;  2A15 A;  3S5C A;  7GSP A;  1ISK A;  3LYG A;  3GSP A;  1I70 A;  1R4Y A;  3MSO A;  1UUV B;  1GMR A;  1IV7 A;  4K61 A;  1O7H B;  4PEJ A;  1JBS A;  3PXM A;  3F8H A;  3V99 A;  1K28 A;  1ZX2 A;  1GY6 A;  4RZM A;  4BL3 A;  5DRE A;  1ZGX A;  3Q3F A;  1BSC A;  1IQY A;  4WYK B;  1O7G B;  3JUQ A;  4HYZ A;  5AIG A;  3MWZ A;  3O8Y A;  3NBR A;  4J5G A;  1LRA A;  1BNJ A;  1RTU A;  5IG4 A;  4BTW A;  3EE1 A;  4EYC A;  2UGI A;  1MWU A;  1W4N A;  3KII A;  1YNV X;  2QGU A;  3DGM A;  3CCE 3;  2L1S A;  3FZW A;  1LOX A;  2HMN B;  1IQ8 A;  1ZO2 A;  1I0X A;  1IVW A;  4HM5 B;  3DH2 A;  3N9H A;  5AII A;  2XR8 B;  1YHQ 3;  2GSP A;  4L7K A;  1NB3 I;  2D1W A;  1MGR A;  1OH0 A;  2HOH A;  4RNZ A;  4GSP A;  1WMP A;  3U97 A;  2E2U A;  3FCS B;  1PFP A;  5FW5 A;  1TFO A;  2RFR A;  5TGN A;  1A2K A;  2BT3 A;  1JBR A;  1ULI B;  1BSD A;  2W04 A;  3CC4 3;  2W9P A;  4DKI A;  1CH0 A;  3KFQ C;  3LH4 A;  3LTA A;  1N8Q A;  4U13 A;  1IVX A;  1GY7 A;  4N6O B;  5EEO A;  1NO3 A;  4MMZ B;  1QVF 2;  4WP5 A;  1UCJ A;  1BNE A;  5DRV A;  2BMO B;  1IU7 A;  2RCD A;  1JRQ A;  3TDG A;  1AR0 A;  1T2I A;  3K63 A;  4O3V A;  1PU4 A;  3CXC 2;  2RBI A;  1GD3 A;  1BUJ A;  3LTD A;  4HM1 B;  1MWS A;  4XBT A;  3EB8 A;  3WA2 X;  1T5Y A;  1IVV A;  1T3B A;  2GEY A;  4OK0 A;  4ORL A;  5AYR B;  1Q7Y 4;  3X3Y A;  1D6U A;  1MNL A;  1FZU A;  1Q40 B;  3MYT A;  1N5H A;  1UW1 A;  3GZR A;  4MEI A;  1KWI A;  3GZB A;  1I2G A;  3KSE D;  2P05 A;  3CCM 3;  1RGC A;  1ROA A;  2JQ5 A;  3D4A A;  3X3Z A;  1UGH I;  4EW5 A;  1W7C A;  3KZT A;  4HM6 B;  2C10 A;  4MMX B;  1TUH A;  4HM2 B;  1KQS 2;  5I97 A;  1NB5 I;  3OXA A;  4J8T A;  3OX9 A;  1UCL A;  2B24 B;  4FMD A;  4FR9 A;  3VF1 A;  2BIR A;  5JPU A;  2WOF A;  1I3I A;  3FSD A;  1QAF A;  1YGW A;  1YVB I;  4FMB A;  3D79 A;  8CHO A;  1LOV A;  3KE7 A;  2RGQ A;  2XSO B;  4HAA A;  4QWT A;  3M8C A;  1L5G B;  1BAO A;  4FMA A;  3BU4 A;  4HM0 B;  1IV9 A;  1LVN A;  1FGO A;  1RGK A;  1FYS A;  2W0Q A;  4LYL B;  3SOY A;  4N6V 0;  2D42 A;  4FMC A;  1QAK A;  3CCU 3;  2FXT A;  5STD A;  2IY2 A;  4EC6 A;  1VQK 3;  4N6U A;  3OWU A;  4NHF A;  5M19 A;  2P38 A;  3DGY A;  1GOV A;  4XB5 A;  1W2B 2;  1A2V A;  3D9R A;  3DMC A;  3G8Z A;  3NXJ A;  3JUN A;  2BU4 A;  3CCJ 3;  2OTL 3;  2V1L A;  1BGS A;  1T2H A;  3URP A;  2W56 B;  1B2M A;  1FGR A;  1UDI I;  1VQM 3;  4LSO A;  1RGH A;  3KSP A;  1RNT A;  3LT9 A;  2B1X B;  1RSN A;  2XH9 A;  1S72 3;  1RGL A;  1BUQ A;  1A2P A;  2Y73 A;  1GS3 A;  2ZHX B;  4NPB A;  4OVM A;  3X40 A;  1W6Y A;  2YX9 A;  3CNM A;  3FGY A;  2HMM B;  1JKG B;  1O7N B;  1LNH A;  1AV4 A;  1TRP A;  3A76 A;  5A0O B;  3SOA A;  1JB2 A;  1OCV A;  2O9U X;  2CHC A;  2MC8 A;  1UGI A;  5JPP A;  4L8P A;  1X1X A;  4KFF A;  1K8A 4;  1FUW A;  1JN5 B;  3H3H A;  3IJE B;  1RLS A;  3AGO A;  2CWU A;  3STD A;  2CC3 A;  1B2U A;  1S5A A;  4HZB B;  3SVA A;  5KP1 A;  2CKF B;  2H0I A;  1K73 4;  3NUV A;  4O8S A;  3S27 A;  3UNL A;  1B3S A;  3SXX A;  1BNF A;  1NNV A;  2GXF A;  3AGN A;  1LQM B;  2GU1 A;  3EC9 A;  3GZX B;  2CFG A;  3U1W A;  2IA7 A;  2OTJ 3;  1RCL A;  1Q82 4;  2J8X B;  2QIY A;  4IPB A;  2GEX A;  1KD1 4;  1U5O A;  2XFS A;  4N6M A;  2KRT A;  3LT8 A;  1OF5 B;  1UI8 A;  2ML5 A;  3DGL A;  1I8V A;  3I56 3;  3LXU X;  3EBT A;  2BNG A;  3FG3 A;  3NQY A;  5IW9 A;  3QRD A;  1GOU A;  2IUK A;  1GY5 A;  2OQE A;  1LNI A;  1MWR A;  3T0U A;  2XFT A;  1VQO 3;  2RNT A;  1YGE A;  2CWT A;  2F5M A;  1N9J A;  1FGM A;  4KZ1 A;  5IEN A;  1RGG A;  3AMO B;  2CFL A;  2ZL8 A;  4CPK A;  1VQ8 3;  1BOX A;  2M7O A;  1BRG A;  1FUT A;  1AVK A;  5IG3 A;  3MG3 A;  1BRI A;  2QEX 3;  7STD A;  7RNT A;  2W2C A;  1AQZ A;  4JRF A;  1JV2 B;  5GSP A;  1PYL A;  2CK3 H;  2STD A;  4BL2 A;  3ROB A;  4HM8 B;  2E2V A;  5EVH A;  1B2Z A;  4GHO A;  5IG5 A;  2YFI B;  4AEQ A;  1RDS A;  3JVC A;  2R41 A;  1BVI A;  4EV2 A;  1O7W B;  3EBY A;  3D3L A;  3SX1 A;  2P0X A;  1B21 A;  3NV0 A;  1WQL B;  1OAC A;  6STD A;  4NRE A;  3PYJ A; 
#chains in the Genus database with same CATH homology
 1RN7 A;  2R4I A;  1YJW 3;  4J9A A;  2OOV C;  1UI7 A;  2WGQ A;  1JNQ A;  3S29 A;  1N9E A;  2XEP A;  4OUQ A;  3ECF A;  5CF1 A;  2BMQ B;  3LML A;  3F7S A;  1OHP A;  3H51 A;  3WOE B;  3FG1 A;  1R4C A;  3MKI A;  5LC7 A;  3CME 3;  2CFW A;  1RJO A;  2UX0 A;  3CU3 A;  3PZW A;  1Z1S A;  1QJG A;  3JUO A;  4AKZ A;  3G4S 3;  1GD4 A;  2PNC A;  1QAL A;  1W6C A;  2K0M A;  1OUN A;  2ML6 A;  5KP3 A;  3CPW 2;  4HZ9 B;  1VQ4 3;  3HZP A;  1Y4K A;  1JJ2 2;  5ELU A;  2K54 A;  1YIJ 3;  2GBW B;  1ULJ B;  1OPY A;  1V74 A;  2C11 A;  3HX8 A;  1W6G A;  1US1 A;  1IT7 A;  2Q07 A;  1D6Y A;  2OCT A;  1E3R A;  4EXR A;  3EQQ B;  3JUM A;  4BTX A;  1RRH A;  4R9K A;  3K5T A;  5AIF A;  1M90 4;  2IUJ A;  2KCD A;  1VQ7 3;  3CPO A;  4EBG A;  3F14 A;  4KFE A;  2Y74 A;  2XGN A;  3HK4 A;  3I55 3;  5CXO A;  2MF7 A;  1E3V A;  4WYK A;  5LC6 A;  1VQ5 3;  4XM4 A;  1JB5 A;  3F40 A;  2PZV A;  1NDO B;  3WOD G;  2CW9 A;  1K41 A;  2WO0 A;  3PS8 A;  3EHC A;  3EJV A;  1IT8 A;  3CNX A;  4N6T A;  3UB1 A;  1KC8 4;  3Q2P A;  1W01 A;  3EN1 B;  3N8B A;  2HML B;  3F7X A;  5EQL A;  2XRX B;  1VQP 3;  3B4O A;  2F86 B;  3DZL A;  3PGB A;  3Q90 A;  1O7M B;  3ER7 A;  1JB4 A;  3IMA B;  1ASK A;  1DMM A;  1WNH A;  4LZI A;  4K1V A;  1W02 A;  2OWP A;  1OGZ A;  4X2H A;  2Z77 A;  2FGT A;  3MG2 A;  3LTC A;  4XBY A;  3GRD A;  3EF8 A;  1TIJ A;  3X42 A;  3KN4 A;  2BO9 B;  3QK9 A;  1NJI 4;  2QA4 3;  5D82 A;  3DGN A;  3UJM A;  4Q53 A;  4R1K A;  1STF I;  2HMO B;  4AKY A;  3NBB A;  3KKG A;  1YIT 3;  3NHX A;  3B8L A;  3IPT A;  3FKA A;  2YFL B;  2IMJ A;  5IF6 A;  2WGO A;  3F8X A;  3CCQ 3;  5CLK A;  3FF0 A;  4HM3 B;  1DMN A;  3DXO A;  1FA3 A;  4CDL A;  1Q40 A;  2P0M A;  4EV5 A;  1W00 A;  1VQN 3;  3GWR A;  4HM4 B;  1OGX A;  2LYX A;  3CCR 3;  4FCZ A;  4XDW A;  1QVG 2;  1IQX A;  3G6E 3;  1J2B A;  1NWW A;  2CIU A;  1DMQ A;  4H3U A;  4ZM8 A;  3L0R A;  1VZZ A;  3EN8 A;  3UL6 A;  1TU5 A;  3G0K A;  3S67 A;  1Q86 4;  3CD6 3;  4R4K A;  3T8U A;  4O02 B;  3WMD A;  3LZA A;  4HVN A;  2RSX A;  1C7H A;  2HMJ B;  3CC7 3;  3FG4 A;  2FNQ A;  3VGN A;  5AYS C;  5IG0 A;  1FGQ A;  1SJW A;  3T8N A;  2GBX B;  4I4K A;  3S28 A;  3EX9 A;  3Q1C A;  2W56 A;  4LEH A;  5G2G A;  1M1K 4;  2XF3 A;  4RBN A;  4JF8 A;  4L8O A;  3K9M C;  1U8C B;  3BB9 A;  3FF2 A;  4WFO A;  3V92 A;  4XBX A;  5BXQ A;  3I0Y A;  5D81 A;  1VQ9 3;  1GYB A;  1OHS A;  4LMI A;  2XGL A;  3G16 A;  1WMN A;  4GL6 A;  4IT7 A;  4R80 A;  2SBL A;  1D6Z A;  1JKG A;  3K0Z A;  4CCV A;  5IEO A;  3BNC A;  1TP6 A;  1EQK A;  4GB5 A;  1VQL 3;  3NBJ A;  5CF2 A;  3HII A;  3RGA A;  1RRL A;  3PCS A;  5IEP A;  2INX A;  3RDE A;  3OV4 A;  4R9L A;  2F99 A;  1HU9 A;  1JN5 A;  1SQW A;  3CCL 3;  2CWV A;  3X3X A;  1K9M 4;  4G1M B;  5JBS A;  1Q81 4;  3ALA A;  3SED A;  4BTY A;  4N6N B;  1M9G A;  3BNB A;  3SLU A;  2CFK A;  3DY5 A;  1CYV A;  4XDV A;  1MOL A;  1W5Z A;  3E99 A;  3CMA 3;  1IK3 A;  1KSI A;  1YJN 3;  4MJD A;  2Z76 A;  1OF5 A;  1A67 A;  3NQZ A;  4K1U A;  4KFD A;  3LOY A;  3X41 A;  2LQV A;  2CH9 A;  2OOV A;  2E2T A;  1AVL A;  3B7C A;  4HM7 B;  3UL5 A;  1WTH A;  1RKY A;  1F8N A;  2O3O A;  1IVU A;  2BMR B;  3OWS A;  4RNY A;  1O7P B;  1Q42 A;  3NM2 A;  5AEU B;  5D83 A;  3BLZ A;  5FGO A;  1STD A;  1N5P A;  1NU3 A;  4HBR A;  2YFJ B;  4O2H A;  3B4P A;  3CCS 3;  1A90 A;  2HMK B;  3MG1 A;  3AMO A;  2I9W A;  3NM7 A;  4N6L A;  3V98 A;  3WOF B;  3CCV 3;  1VQ6 3;  1SPU A;  2KXG A;  3GAX A;  3LTB A;  5AEW B;  3OW2 2;  3DUK A;  4KVH A;  5IER A;  1CQS A;  1WMO A;  3DM8 A;  1CEW I;  5BVB A;  4STD A;  2W6J H;  3PCR A;  4WHA A;  4N3V A;  2WOH A;  3BNE A;  1EKM A;  3RGR A;  3WDG B;  1E97 A;  4IIA A;  1EA2 A;  3G71 3;  1DYU A;  4X2O A;  2CFD A;  1SIH A;  1TFK A;  4FCM A;  1W2Z A;  1OHO A;  5ELJ A;  2XSH B;  1UUW B;  3MPH A;  3CC2 3;  4LGQ A;  2BHM A;  4K90 B;  3J7Y d;  3NX0 A;  1QMA A;  3NV0 B;  3WA3 A;  2Z7A A;  3OWY A;  2F98 A;  2W9Q A;  2CG0 A;  4H61 A;  1FGT A;  1LXE A;  3GZY B;  3DGO A;  1DVD A;  2CG1 A;  3FLJ A;  1IDP A;  2OQE C;  3HIG A;  5CK6 A;  3N54 B;  1DVC A;  3K7C A;  1CYU A;  2L4V A;  5HGR A;  1M1X B;  2JDI H;  2P09 A;  5AI1 A;  4TX4 A;  1ROV A;  3F9S A;  4HKV B;  1HKX A;  5KP4 A;  2W03 A;  3VSY A;  1SII A;  3HI7 A;  2GU3 A;  3BND A;  1YJ9 3;  1EG9 B;  1G96 A;  2ZDJ A;  3MHE A;  1N8R 4;  4HJL B;  4MMY B;  3FH1 A;  4WWU C;  3JUP A;  4FCJ A;  2Z6B A;  5AIH A;  1YI2 3;  2A15 A;  3S5C A;  1ISK A;  3LYG A;  3MSO A;  1UUV B;  1IV7 A;  4K61 A;  1O7H B;  4PEJ A;  3PXM A;  3F8H A;  3V99 A;  1K28 A;  1ZX2 A;  1GY6 A;  4RZM A;  5DRE A;  4WYK B;  1IQY A;  1O7G B;  3JUQ A;  4HYZ A;  5AIG A;  3MWZ A;  3O8Y A;  3NBR A;  5IG4 A;  4BTW A;  3EE1 A;  4EYC A;  3KII A;  1W4N A;  2QGU A;  3DGM A;  3CCE 3;  3FZW A;  1LOX A;  2HMN B;  1IQ8 A;  1ZO2 A;  1IVW A;  4HM5 B;  3N9H A;  5AII A;  2XR8 B;  1YHQ 3;  4L7K A;  1NB3 I;  2D1W A;  1OH0 A;  4RNZ A;  3U97 A;  1WMP A;  2E2U A;  3FCS B;  1PFP A;  5FW5 A;  1TFO A;  2RFR A;  5TGN A;  1A2K A;  2BT3 A;  1ULI B;  2W04 A;  3CC4 3;  2W9P A;  3KFQ C;  3LH4 A;  3LTA A;  1N8Q A;  4U13 A;  1IVX A;  1GY7 A;  4N6O B;  5EEO A;  1NO3 A;  4MMZ B;  1QVF 2;  4WP5 A;  5DRV A;  2BMO B;  1IU7 A;  2RCD A;  1JRQ A;  3TDG A;  1AR0 A;  3K63 A;  4O3V A;  3CXC 2;  1PU4 A;  1GD3 A;  3LTD A;  4HM1 B;  4XBT A;  3EB8 A;  3WA2 X;  1T5Y A;  1IVV A;  2GEY A;  4ORL A;  4OK0 A;  5AYR B;  1Q7Y 4;  3X3Y A;  1D6U A;  1MNL A;  3MYT A;  1Q40 B;  1N5H A;  1UW1 A;  3GZR A;  4MEI A;  1KWI A;  3GZB A;  3KSE D;  3CCM 3;  2P05 A;  2JQ5 A;  1ROA A;  3X3Z A;  1W7C A;  3KZT A;  4HM6 B;  2C10 A;  4MMX B;  1TUH A;  4HM2 B;  1KQS 2;  5I97 A;  1NB5 I;  3OXA A;  4J8T A;  3OX9 A;  2B24 B;  4FMD A;  4FR9 A;  3VF1 A;  5JPU A;  2WOF A;  3FSD A;  1QAF A;  1YVB I;  4FMB A;  8CHO A;  3KE7 A;  2RGQ A;  2XSO B;  4QWT A;  3M8C A;  1L5G B;  4FMA A;  4HM0 B;  1IV9 A;  1LVN A;  1FGO A;  3SOY A;  2W0Q A;  4N6V 0;  2D42 A;  4FMC A;  1QAK A;  3CCU 3;  2FXT A;  5STD A;  4EC6 A;  1VQK 3;  4N6U A;  3OWU A;  4NHF A;  2P38 A;  1W2B 2;  4XB5 A;  1A2V A;  3D9R A;  3DMC A;  3G8Z A;  3NXJ A;  3JUN A;  3CCJ 3;  2OTL 3;  2V1L A;  2W56 B;  1FGR A;  1VQM 3;  4LSO A;  3KSP A;  3LT9 A;  2B1X B;  2XH9 A;  1S72 3;  1BUQ A;  2Y73 A;  1GS3 A;  4OVM A;  3X40 A;  1W6Y A;  2YX9 A;  3CNM A;  3FGY A;  2HMM B;  1JKG B;  1O7N B;  1LNH A;  1AV4 A;  3A76 A;  5A0O B;  3SOA A;  1JB2 A;  1OCV A;  2O9U X;  2CHC A;  2MC8 A;  5JPP A;  4L8P A;  4KFF A;  1K8A 4;  1FUW A;  1JN5 B;  3H3H A;  3IJE B;  2CWU A;  3STD A;  2CC3 A;  1S5A A;  3SVA A;  4HZB B;  5KP1 A;  2CKF B;  1K73 4;  3NUV A;  4O8S A;  3S27 A;  3UNL A;  3SXX A;  2GXF A;  2GU1 A;  3EC9 A;  3GZX B;  2CFG A;  3U1W A;  2IA7 A;  2OTJ 3;  1Q82 4;  2QIY A;  4IPB A;  1KD1 4;  2GEX A;  2XFS A;  1U5O A;  4N6M A;  2KRT A;  3LT8 A;  1OF5 B;  1UI8 A;  2ML5 A;  3DGL A;  3I56 3;  3LXU X;  3EBT A;  2BNG A;  3FG3 A;  3NQY A;  5IW9 A;  3QRD A;  2IUK A;  1GY5 A;  2OQE A;  3T0U A;  2XFT A;  1VQO 3;  1YGE A;  2CWT A;  1N9J A;  1FGM A;  4KZ1 A;  5IEN A;  3AMO B;  2CFL A;  2ZL8 A;  1VQ8 3;  2M7O A;  1AVK A;  5IG3 A;  3MG3 A;  2QEX 3;  7STD A;  2W2C A;  4JRF A;  1JV2 B;  2CK3 H;  2STD A;  3ROB A;  4HM8 B;  2E2V A;  5EVH A;  5IG5 A;  2YFI B;  4AEQ A;  3JVC A;  4EV2 A;  1O7W B;  3EBY A;  3D3L A;  3SX1 A;  2P0X A;  3NV0 A;  1WQL B;  1OAC A;  6STD A;  4NRE A;  3PYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...