1NDOB

Naphthalene 1,2-dioxygenase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
193
structure length
193
Chain Sequence
b'MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE
publication title Structure of an aromatic-ring-hydroxylating dioxygenase-naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Non-heme iron dioxygenase
total genus 58
structure length 193
sequence length 193
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1998-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ndoB00
1JB5A 5STDA 1GYBA 2RFRA 2B24B 3MSOA 5DRVA 1ULIB 3A76A 3BLZA 3F40A 5KP3A 2PZVA 5IF6A 7STDA 5IEPA 5IG3A 5IG0A 2YFIB 3JUNA 4HKVB 4LMIA 3DZLA 3EJVA 2BNGA 3NV0B 2F86B 4R1KA 4L8PA 1OHOA 2BMOB 4HM8B 3GZYB 4L7KA 1E3RA 3EN1B 2IMJA 1OPYA 4HM7B 3DMCA 1JN5A 1E97A 1O7HB 4FCMA 1STDA 4ORLA 4U13A 4L8OA 3CNXA 1JB4A 4XBYA 5D82A 3HZPA 1U5OA 3FGYA 6STDA 1OH0A 4K1UA 4XBXA 5EVHA 4CDLA 8CHOA 1UUWB 3EC9A 1O7GB 5BVBA 1TP6A 1O7NB 2RGQA 3HX8A 5AIFA 1OCVA 1S5AA 5D83A 3T8NA 1K41A 1GY6A 5G2GA 3SEDA 3UNLA 3KSPA 1OHSA 1GY7A 2GXFA 1JKGB 3LYGA 4X2OA 3ECFA 2Z76A 1Q40A 1VZZA 2HMMB 1BUQA 1Q42A 5CF1A 5CXOA 3EX9A 3GZBA 4MJDA 3CPOA 3SOAA 3MG1A 3MYTA 2GEYA 2K54A 4HJLB 2INXA 3NM2A 1GY5A 1W00A 3OWSA 1W01A 1NDOB 3VGNA 2Z77A 3WMDA 2XR8B 2GEXA 1O7WB 3H51A 4HM6B 1TUHA 3FF2A 3MG2A 4WWUC 3OWUA 4WYKA 3B7CA 1QMAA 4HM5B 3VSYA 4J8TA 5IEOA 4XDWA 3E99A 4I4KA 3FKAA 3F9SA 1DMMA 2F98A 2CKFB 3EQQB 1GS3A 5AEUB 3NBRA 1CQSA 1DMNA 4XM4A 2B1XB 1DMQA 4STDA 3FH1A 3HK4A 2I9WA 4OUQA 3T8UA 3F8XA 3NUVA 3DM8A 5CK6A 3DXOA 3EN8A 1E3VA 2CHCA 1OF5A 1EA2A 3KE7A 1UUVB 3NV0A 4RZMA 4HM2B 1OGXA 3OX9A 3KZTA 3RGAA 3I0YA 4HM0B 5TGNA 3JUPA 2GBXB 3EF8A 3MHEA 5D81A 4HM1B 4PEJA 5JPPA 2BMQB 3K7CA 5KP1A 2XSOB 2A15A 3M8CA 1OGZA 3FZWA 4R9LA 4K1VA 3S5CA 5IERA 4HM3B 1OHPA 1ZO2A 3NHXA 4N3VA 1IDPA 3LZAA 2HMJB 3OV4A 1Z1SA 4LEHA 3DUKA 3MKIA 1W02A 3F7XA 1JN5B 3EBYA 3OWYA 2HMKB 3JUOA 3F14A 1HKXA 2BMRB 5IENA 2XRXB 5IG4A 3JUMA 5AIIA 2QGUA 4GB5A 3JUQA 1EG9B 1WQLB 1SJWA 5KP4A 1OUNA 3ROBA 3CU3A 1JB2A 3B4OA 5FW5A 3SOYA 3G0KA 1JKGA 1OF5B 1QJGA 2JQ5A 3OXAA 5AIGA 3FF0A 4XBTA 1W6YA 3D9RA 2W2CA 3GRDA 3FSDA 3NXJA 4HZBB 2XSHB 5AEWB 3IPTA 3K0ZA 2OWPA 3H3HA 3F7SA 4Q53A 3GZXB 4HZ9B 4X2HA 4LGQA 3STDA 1Q40B 3G16A 4HM4B 3KKGA 4XB5A 5JPUA 3EHCA 1O7PB 2YFJB 2QIYA 2HMNB 4WP5A 1NU3A 3Q90A 1A2KA 4R9KA 5DREA 1O7MB 1AR0A 1ULJB 2HMLB 5CF2A 2R4IA 3B4PA 5AI1A 3UJMA 3CNMA 5IG5A 2HMOB 4IIAA 2YFLB 2F99A 2GBWB 3MG3A 1ISKA 4J9AA 4OVMA 5AIHA 3EBTA 5BXQA 4FCJA 3GZRA 1NWWA 3GWRA 4H3UA 3BB9A 2UX0A 3B8LA 5HGRA 3G8ZA 4WYKB 4XDVA 3F8HA 4KVHA 3FLJA 1C7HA 3RGRA 1ZX2A 2RCDA 5CLKA 1ASKA 2Z7AA 4HVNA 3ER7A 2STDA
chains in the Genus database with same CATH superfamily
1JB5A 2UGIA 1AY7A 3O8YA 5STDA 1GYBA 3SXXA 4EYCA 1BRJA 2YX9A 1IV7A 2QA43 2RFRA 1FA3A 2B24B 3OW22 2IA7A 3MSOA 5DRVA 1ULIB 1LOYA 2WGOA 3A76A 3WA3A 3FG3A 1IK3A 3D5GA 3HOHA 2CC3A 3BLZA 4BU4A 1M904 1BANA 1BSBA 2CH9A 3F40A 5KP3A 4BTYA 3URPA 4BTXA 1VQL3 1M9GA 1EKMA 1N8QA 2AADA 2BT3A 2F5WA 1MWSA 4TX4A 3SLUA 1RGCA 2PZVA 1SIHA 4K90B 2V1LA 2P38A 1BNFA 3D79A 5IF6A 1YI23 3LTAA 3X3XA 7STDA 2W9PA 3MPHA 5I97A 5IG3A 5IEPA 2F5MA 5IG0A 2YFIB 3JUNA 1W2B2 4JRFA 1DVCA 3CPW2 3PGBA 3I563 4HKVB 2OTL3 5ELJA 1JJ22 2WO0A 4LMIA 3KIIA 3DZLA 3EJVA 1W6GA 3BNDA 2BNGA 2WOHA 5JBSA 2KF4A 3NV0B 2F86B 1QVG2 1RN7A 2W04A 4R1KA 3NQYA 2H0IA 1T2HA 4N6UA 3N8BA 4L8PA 3CCU3 1WMPA 1OHOA 2BMOB 4HM8B 1N9EA 1R4YA 3GZYB 4L7KA 2F56A 1E3RA 2KRTA 5GSPA 1FGOA 3EN1B 3CME3 1VQ63 2IMJA 3LT9A 3IJEB 1OPYA 4HM7B 3BU4A 4CJNA 6RNTA 1VQ83 1RGLA 1LOWA 2CX0A 3GAXA 1GMQA 3CCE3 1R4CA 2JDIH 3DMCA 3JVCA 7RNTA 1BSCA 4N6V0 3NM7A 1FGRA 5ELUA 1JN5A 1E97A 1VQ73 1EUIC 1BRNL 3T0UA 1AQZA 1JZOA 2CWTA 3Q2PA 4MMYB 3QK9A 4MEIA 1TRQA 1KSIA 1O7HB 1WTHA 3K63A 1YGEA 4FCMA 2WGQA 3QRDA 2CFLA 1D6UA 2XF3A 1STDA 4ORLA 1BOXA 2W6JH 3CCS3 3NBBA 4U13A 2GU3A 1NJI4 1JV2B 2KCDA 1BNJA 3HIIA 4L8OA 2L1SA 4EW5A 3LOYA 1IYYA 1OACA 2K0MA 3PYJA 3CNXA 2CWVA 1JB4A 1FUSA 4XBYA 1YVSA 5D82A 2HOHA 1IU7A 3HZPA 1VQQA 1U5OA 3FGYA 6STDA 1OH0A 5A0OB 1B2SA 3KFQC 4IT7A 1QVF2 2R41A 4K1UA 4XBXA 4EC6A 1SIIA 5EVHA 4CDLA 3X40A 1ROVA 4OK0A 8CHOA 3CC73 1C54A 4FMDA 1UUWB 3EC9A 1O7GB 3RNTA 5BVBA 1TP6A 1YGWA 2C4BA 4R80A 3CXC2 1O7NB 1DVDA 3LXUX 9RNTA 2RGQA 3HX8A 5EEOA 3UB1A 1FYSA 4RBNA 5AYSC 1RHLA 5AIFA 4I5QA 1OCVA 1S5AA 3LT8A 5D83A 1JNQA 1HYFA 3T8NA 1K41A 1GY6A 1UUGB 1MWRA 1MWUA 5G2GA 2KAAA 3SEDA 3ZG5A 3UNLA 1BVIA 1UCLA 1OHSA 3KSPA 1GY7A 1I0VA 2GXFA 1JKGB 1T3BA 2OQEC 3LYGA 4X2OA 1RNBA 3CMA3 2L4VA 3N54B 3ECFA 2Z76A 1Q40A 1UCJA 1VQO3 1W2ZA 1US1A 1VZZA 1Q814 2HMMB 1BUQA 1Q42A 2E2UA 1VQM3 1BUJA 2KF3A 5CF1A 1STFI 1U8CB 3AGOA 3BNEA 3EX9A 5CXOA 4ZM8A 1W6CA 1RCLA 3GZBA 1K8A4 4O8SA 1RSNA 4GSPA 3LTDA 4MJDA 4FR9A 3CCR3 3CPOA 4BIRA 4WFOA 2BHMA 3SOAA 1PU4A 1L5GB 1I70A 5M1AA 4HOHA 1BNEA 3MG1A 3MYTA 1RJOA 1V58A 4H61A 2GEYA 1GD3A 1Y4KA 5IW9A 1NO3A 1X1UA 2K54A 5G1KA 1IT7A 1AVKA 1ZS7A 1BNSA 3EB8A 4HJLB 1IQ8A 1YHQ3 2INXA 3NM2A 1G96A 3I553 1GY5A 3WODG 1UGHI 1W00A 5G1LA 2Y74A 3IMAB 2RBIA 3OWSA 2KF6A 3FG4A 1A67A 1W01A 1NDOB 2RSXA 2W0QA 3VGNA 1M1K4 1UI8A 1DE3A 2Z77A 3WMDA 1RRHA 1TJDA 5FGOA 1YJ93 1FUWA 2CFDA 2PNCA 2XR8B 1NNVA 3PCSA 2GEXA 1FGQA 1FGMA 1LQMB 4N6MA 1O7WB 1LNIA 3H51A 3UL5A 4HM6B 1TUHA 1CH0A 1RDSA 3FF2A 2AAEA 4N6NB 2ML5A 1CYUA 3G713 2CFKA 1BNGA 3MG2A 2D42A 1GMPA 1LVNA 1MNLA 4AKZA 1YIT3 4WWUC 3OWUA 1K9M4 4NHFA 2C10A 1GD4A 3WOEB 1B2ZA 4WYKA 1B2MA 2W56A 1N5HA 1KWIA 3LTBA 3B7CA 1QMAA 2P09A 4HM5B 3VSYA 2CFGA 4J8TA 5IEOA 3NQZA 4XDWA 1G02A 3E99A 1RCKA 3HI7A 4I4KA 3CCQ3 1I0XA 3DGYA 1IQYA 3FKAA 3F9SA 1DMMA 2OTJ3 4KZ1A 1VQ93 4FMBA 1TU5A 1UCKA 1UW1A 2F98A 5HOHA 2Y73A 4O02B 4FMAA 3KN4A 2CKFB 3EQQB 1BSDA 4HAAA 1GS3A 1RKYA 1HZ1A 1JRQA 3SX1A 1RN4A 5AEUB 2XGNA 1LQGC 3NBRA 1LNHA 4BL3A 1BSEA 1CQSA 6GSPA 1DMNA 3Q3FA 4XM4A 3S67A 4EV2A 1K734 1A2PA 2B1XB 1DMQA 4STDA 3FH1A 4GL6A 3HK4A 1BRGA 2I9WA 4MMXB 4OUQA 1AV4A 2K3DA 1IVUA 3FCSB 3T8UA 2XFTA 2QEX3 1VQP3 1D6YA 3F8XA 3NUVA 5M18A 3LMLA 4N6OB 3DM8A 2FGTA 1BRHA 3AGNA 3AMOB 5CK6A 3DXOA 3CC43 3EN8A 4J5KA 1E3VA 2CHCA 2KXGA 3D3LA 1RGHA 2E2TA 1B3SA 1OF5A 2CK3H 1I3FA 1EA2A 1RNTA 1TFKA 1W7CA 4IPBA 1UCIA 1SPUA 3LH4A 2D1WA 3KCHA 4HBRA 1PY3A 3V98A 3KE7A 1IVWA 1UUVB 3NV0A 3N9HA 4HM2B 4RZMA 3WA2X 4CCVA 1OGXA 4N6TA 1VQ53 1QALA 5M19A 3OX9A 4EXRA 3KZTA 1JBSA 1FGTA 1I8VA 4FCZA 2P0XA 2XGLA 1RGEA 4KFDA 2J8XB 2XFSA 3RGAA 3I0YA 4HM0B 5TGNA 3JUPA 1YVBI 1RGGA 2GBXB 3EF8A 3MHEA 1I3IA 5D81A 1B21A 2OOVA 2IYJA 4HM1B 4PEJA 5JPPA 2BMQB 5RNTA 3HIGA 3K7CA 4G1MB 3VF1A 1T5YA 2XSOB 2A15A 5KP1A 1KQS2 3AHWA 1N9JA 3M8CA 3RDEA 1OGZA 1S723 3FZWA 4R9LA 4DKIA 3Q1CA 4K1VA 1VQ43 3S5CA 1PYLA 3LTCA 5IERA 3ZFZA 1YJW3 1EEJA 1BSAA 1RLSA 1Q864 4HM3B 4AKYA 1OHPA 1ZO2A 2W03A 3AHSA 3DY5A 1GMRA 3NHXA 1IDPA 2CFWA 4LZIA 4N3VA 1GOYA 3G4S3 3LZAA 1K28A 2HMJB 3OV4A 1Z1SA 1W4NA 4FMCA 1PFPA 1RN1A 2CG0A 1QAKA 1D6ZA 4LEHA 1I2GA 3SYUA 3DUKA 3MKIA 3BNCA 1B27A 3WR2A 3K5TA 3A5EA 1W02A 1W5ZA 1MGWA 3F7XA 1BRKA 1JN5B 3EBYA 3KSED 1BAOA 2OQEA 4J5GA 3DGLA 3X3ZA 3OWYA 1WMOA 2MF7A 2OCTA 2HMKB 3JUOA 4BL2A 1RTUA 1IQXA 1CEWI 1RRLA 1HKXA 3F14A 2BMRB 4N6LA 5IENA 2IUKA 2XRXB 3JUMA 3D5IA 5AIIA 5IG4A 3G6E3 1LXEA 4BTWA 3MWZA 1JZDA 1TTOA 2UUGC 4MMZB 1VQN3 2QGUA 4NPBA 4GB5A 1KC84 3EE1A 1BU4A 1A90A 2ML6A 4ILFA 1ROAA 3JUQA 2ZHXB 3D4AA 1EG9B 1WQLB 1SJWA 5LC6A 5KP4A 3V92A 1OUNA 3ROBA 3CU3A 1SARA 2O3OA 2W9QA 1JB2A 3B4OA 3PS8A 5FW5A 3SOYA 2H0HA 1WMNA 4JF8A 2GSPA 4NREA 3CCL3 4O3VA 2P05A 4RNZA 3G0KA 1TRPA 1TIJA 3NX0A 1JKGA 2Z6BA 4KT3B 3V99A 3X3YA 1OF5B 1RGAA 1BIRA 1X1XA 1QJGA 2CW9A 2E2VA 2JQ5A 3OXAA 3UL6A 2FXTA 5AIGA 3FF0A 4XBTA 1W6YA 3D9RA 4GHOA 1RMSA 2W2CA 3SVAA 2WOFA 3GRDA 3FSDA 3NXJA 1AVLA 4AEQA 2SARA 4HZBB 3DGMA 3WDGB 5AYRB 1I2EA 2XSHB 3S27A 3U97A 1BNIA 5AEWB 1VQK3 3J7Yd 3U1WA 1I2FA 1MWTA 4O2HA 1F8NA 2MC8A 3IPTA 4KFFA 3S28A 1X1YA 1WNHA 3K0ZA 4RNYA 1FUTA 2OWPA 3H3HA 1RGFA 1NB5I 2O9UX 1FW7A 2BIRA 1GOVA 1MOLA 3BNBA 3F7SA 4KFEA 2RNTA 4Q53A 3CC23 1UI7A 1FZUA 8RNTA 1Q824 2BU4A 3GZXB 4HZ9B 1UDII 4LSOA 3L0RA 4X2HA 4LGQA 3STDA 3CCJ3 1UGIA 1B2UA 1YJN3 2M7OA 2XEPA 2IUJA 1Q40B 3WHOA 1BRIA 3G16A 3X41A 4EBGA 1Q7HA 4HM4B 2KF5A 3K9MC 3TDGA 1DETA 2XH9A 3S29A 3KKGA 4XB5A 4R4KA 2BO9B 5JPUA 3EHCA 1O7PB 2YFJB 2QIYA 1BRSA 1V74A 3ALAA 2F4YA 2HMNB 3PZWA 1BGSA 1IT8A 1CYVA 4WP5A 1NU3A 3Q90A 1BNRA 1KD14 1A2KA 4R9KA 5DREA 1B20A 1O7MB 2Q07A 4LYLB 3CD63 1Q9EA 3GSPA 1AR0A 1LRAA 1ULJB 5BIRA 3CCV3 2OOVC 1B2XA 7GSPA 1RGKA 2HMLB 5CF2A 1GSPA 2R4IA 4K61A 3B4PA 4WHAA 5AI1A 2CG1A 2FNQA 4EV5A 3CCM3 3UJMA 3ZG0A 3CNMA 1JBTA 5IG5A 1V57A 2HMOB 2ZA4A 1HU9A 3NBJA 4IIAA 2YFLB 2F99A 1IVXA 1LOXA 2LQVA 2LYXA 2GBWB 1MGRA 3MG3A 3PCRA 1ISKA 1SQWA 4HYZA 4J9AA 4OVMA 1IVVA 3WOFB 1TFOA 1DYUA 3DH2A 3X42A 1YIJ3 5AIHA 3EBTA 1EQKA 1A2VA 1T2IA 3BIRA 1M1XB 5BXQA 4FCJA 2ZL8A 3GZRA 1NWWA 4CPKA 1JBRA 1QAFA 3GWRA 2ZDJA 4H3UA 4RNTA 3BB9A 1G0TA 4QWTA 5EQLA 2H0GA 2UX0A 2C11A 3DGNA 3B8LA 5HGRA 3G8ZA 4WYKB 5BU4A 4XDVA 2W56B 3FG1A 3PXMA 3F8HA 4KVHA 1N8R4 3FLJA 1J2BA 1LOVA 1C7HA 2CIUA 2GU1A 1NB3I 1YNVX 1GOUA 3RGRA 1ZX2A 2RCDA 5CLKA 1ASKA 1ZGXA 2Z7AA 4HVNA 3ER7A 2IY2A 2SBLA 1N5PA 3AMOA 2CX1A 1IV9A 5LC7A 2STDA 2CWUA 1X1WA 3DGOA 1Q7Y4 2P0MA
chains in the Genus database with same CATH topology
1JB5A 5STDA 3O8YA 3SXXA 4EYCA 1GYBA 2YX9A 1IV7A 2QA43 2RFRA 1FA3A 2B24B 3OW22 2IA7A 3MSOA 5DRVA 1ULIB 2WGOA 3A76A 3WA3A 3FG3A 1IK3A 2CC3A 3BLZA 1M904 3F40A 2CH9A 5KP3A 4BTYA 4BTXA 1VQL3 1M9GA 1EKMA 1N8QA 2BT3A 4TX4A 3SLUA 4K90B 2PZVA 1SIHA 2V1LA 2P38A 5IF6A 1YI23 3LTAA 3X3XA 7STDA 2W9PA 3MPHA 5I97A 5IG3A 5IEPA 5IG0A 2YFIB 3JUNA 1W2B2 4JRFA 1DVCA 3CPW2 3PGBA 3I563 4HKVB 2OTL3 5ELJA 1JJ22 2WO0A 4LMIA 3KIIA 3DZLA 3EJVA 1W6GA 3BNDA 2BNGA 2WOHA 5JBSA 3NV0B 2F86B 1QVG2 1RN7A 2W04A 4R1KA 3NQYA 4N6UA 3N8BA 4L8PA 3CCU3 1WMPA 1OHOA 2BMOB 4HM8B 1N9EA 3GZYB 4L7KA 1E3RA 2KRTA 1FGOA 3EN1B 3CME3 1VQ63 2IMJA 3LT9A 3IJEB 1OPYA 4HM7B 1VQ83 3GAXA 3CCE3 1R4CA 2JDIH 3DMCA 3JVCA 4N6V0 3NM7A 1FGRA 5ELUA 1JN5A 1E97A 1VQ73 3T0UA 2CWTA 3Q2PA 4MMYB 3QK9A 4MEIA 1KSIA 1O7HB 1WTHA 3K63A 1YGEA 4FCMA 2WGQA 3QRDA 2XF3A 1D6UA 2CFLA 1STDA 4ORLA 2W6JH 3CCS3 3NBBA 4U13A 2GU3A 1NJI4 1JV2B 2KCDA 3HIIA 4L8OA 3LOYA 1OACA 2K0MA 3PYJA 3CNXA 2CWVA 1JB4A 4XBYA 5D82A 3HZPA 1IU7A 1U5OA 3FGYA 6STDA 1OH0A 5A0OB 3KFQC 4IT7A 1QVF2 4K1UA 4XBXA 4EC6A 1SIIA 5EVHA 4CDLA 3X40A 1ROVA 4OK0A 8CHOA 3CC73 4FMDA 1UUWB 3EC9A 1O7GB 5BVBA 1TP6A 4R80A 3CXC2 1O7NB 1DVDA 3LXUX 2RGQA 3HX8A 5EEOA 3UB1A 4RBNA 5AYSC 5AIFA 1OCVA 1S5AA 3LT8A 5D83A 1JNQA 3T8NA 1K41A 1GY6A 5G2GA 3SEDA 3UNLA 3KSPA 1OHSA 1GY7A 2GXFA 1JKGB 3LYGA 2OQEC 4X2OA 3CMA3 2L4VA 3N54B 3ECFA 2Z76A 1Q40A 1VQO3 1W2ZA 1US1A 1VZZA 1Q814 2HMMB 1BUQA 1Q42A 2E2UA 1VQM3 5CF1A 1STFI 1U8CB 3BNEA 3EX9A 5CXOA 4ZM8A 1W6CA 3GZBA 1K8A4 4O8SA 3LTDA 4MJDA 4FR9A 3CCR3 3CPOA 4WFOA 2BHMA 3SOAA 1PU4A 1L5GB 3MG1A 3MYTA 1RJOA 4H61A 2GEYA 1GD3A 1Y4KA 5IW9A 1NO3A 2K54A 1IT7A 1AVKA 1YHQ3 3EB8A 4HJLB 1IQ8A 2INXA 3NM2A 1G96A 3I553 1GY5A 3WODG 1W00A 2Y74A 3IMAB 3OWSA 3FG4A 1A67A 1W01A 1NDOB 2RSXA 2W0QA 3VGNA 1M1K4 1UI8A 2Z77A 3WMDA 1RRHA 5FGOA 1YJ93 1FUWA 2CFDA 2PNCA 2XR8B 3PCSA 2GEXA 1FGQA 1FGMA 4N6MA 3UL5A 1O7WB 3H51A 4HM6B 1TUHA 3FF2A 4N6NB 1CYUA 2ML5A 3G713 2CFKA 3MG2A 2D42A 1LVNA 1MNLA 4AKZA 1YIT3 4WWUC 3OWUA 1K9M4 4NHFA 2C10A 1GD4A 3WOEB 4WYKA 2W56A 1N5HA 1KWIA 3LTBA 3B7CA 1QMAA 2P09A 4HM5B 3VSYA 2CFGA 4J8TA 5IEOA 3NQZA 4XDWA 3E99A 4I4KA 3HI7A 3CCQ3 1IQYA 3FKAA 3F9SA 1DMMA 2OTJ3 4KZ1A 1VQ93 4FMBA 1TU5A 1UW1A 2F98A 2Y73A 4O02B 4FMAA 3KN4A 2CKFB 3EQQB 1GS3A 1RKYA 1JRQA 3SX1A 5AEUB 2XGNA 3NBRA 1LNHA 1CQSA 1DMNA 1K734 4XM4A 3S67A 4EV2A 2B1XB 1DMQA 4STDA 3FH1A 4GL6A 3HK4A 2I9WA 4MMXB 4OUQA 1AV4A 1IVUA 3FCSB 3T8UA 2XFTA 2QEX3 1VQP3 1D6YA 3F8XA 3NUVA 3LMLA 4N6OB 3DM8A 2FGTA 3AMOB 5CK6A 3DXOA 3CC43 3EN8A 1E3VA 2CHCA 2KXGA 3D3LA 2E2TA 1OF5A 2CK3H 1EA2A 1TFKA 1W7CA 4IPBA 1SPUA 3LH4A 2D1WA 4HBRA 3V98A 3KE7A 1IVWA 1UUVB 3NV0A 3N9HA 4HM2B 4RZMA 3WA2X 4CCVA 1OGXA 4N6TA 1VQ53 1QALA 3OX9A 4EXRA 3KZTA 1FGTA 4FCZA 2P0XA 2XGLA 4KFDA 2XFSA 3RGAA 3I0YA 4HM0B 5TGNA 3JUPA 1YVBI 2GBXB 3EF8A 3MHEA 5D81A 2OOVA 4HM1B 4PEJA 5JPPA 2BMQB 3HIGA 3K7CA 4G1MB 3VF1A 1T5YA 2XSOB 2A15A 5KP1A 1KQS2 1N9JA 3M8CA 3RDEA 1OGZA 1S723 3FZWA 4R9LA 3Q1CA 4K1VA 1VQ43 3S5CA 3LTCA 5IERA 1YJW3 1Q864 4HM3B 4AKYA 1OHPA 1ZO2A 2W03A 3DY5A 3NHXA 4N3VA 1IDPA 2CFWA 4LZIA 3G4S3 3LZAA 1K28A 2HMJB 3OV4A 1Z1SA 1W4NA 4FMCA 1PFPA 2CG0A 1QAKA 1D6ZA 4LEHA 3DUKA 3MKIA 3BNCA 3K5TA 1W02A 1W5ZA 3F7XA 1JN5B 3EBYA 3KSED 2OQEA 3DGLA 3X3ZA 3OWYA 1WMOA 2MF7A 2OCTA 2HMKB 3JUOA 3F14A 1IQXA 1CEWI 1RRLA 1HKXA 2BMRB 4N6LA 5IENA 2IUKA 2XRXB 3JUMA 5AIIA 5IG4A 3G6E3 1LXEA 4BTWA 3MWZA 4MMZB 1VQN3 2QGUA 4GB5A 1KC84 3EE1A 1A90A 2ML6A 1ROAA 3JUQA 1EG9B 1WQLB 1SJWA 5LC6A 5KP4A 3V92A 1OUNA 3ROBA 3CU3A 2O3OA 2W9QA 1JB2A 3B4OA 3PS8A 5FW5A 3SOYA 1WMNA 4JF8A 4NREA 3CCL3 4O3VA 2P05A 4RNZA 3G0KA 1TIJA 3NX0A 3V99A 1JKGA 2Z6BA 3X3YA 1OF5B 2CW9A 2E2VA 1QJGA 2JQ5A 3OXAA 3UL6A 2FXTA 5AIGA 3FF0A 4XBTA 1W6YA 3D9RA 2W2CA 3SVAA 2WOFA 3GRDA 3FSDA 3NXJA 1AVLA 4AEQA 4HZBB 3DGMA 3WDGB 5AYRB 2XSHB 3S27A 3U97A 5AEWB 1VQK3 3J7Yd 3U1WA 4O2HA 1F8NA 2MC8A 3IPTA 4KFFA 3S28A 1WNHA 3K0ZA 4RNYA 2OWPA 3H3HA 1NB5I 2O9UX 1MOLA 3BNBA 3F7SA 4KFEA 4Q53A 3CC23 1UI7A 1Q824 3GZXB 4HZ9B 4LSOA 4X2HA 3L0RA 4LGQA 3STDA 3CCJ3 1YJN3 2M7OA 2XEPA 2IUJA 1Q40B 3X41A 3G16A 4EBGA 4HM4B 3K9MC 3TDGA 2XH9A 3S29A 3KKGA 4XB5A 4R4KA 2BO9B 5JPUA 3EHCA 1O7PB 2YFJB 2QIYA 1V74A 3ALAA 2HMNB 3PZWA 1IT8A 1CYVA 4WP5A 1NU3A 3Q90A 1KD14 1A2KA 4R9KA 5DREA 1O7MB 2Q07A 3CD63 1AR0A 1ULJB 3CCV3 2OOVC 2HMLB 5CF2A 2R4IA 4K61A 3B4PA 4WHAA 5AI1A 2CG1A 2FNQA 4EV5A 3CCM3 3UJMA 3CNMA 5IG5A 2HMOB 1HU9A 3NBJA 4IIAA 2YFLB 2F99A 1IVXA 1LOXA 2LQVA 2LYXA 2GBWB 3MG3A 3PCRA 1ISKA 1SQWA 4HYZA 4J9AA 4OVMA 1IVVA 3WOFB 1TFOA 1DYUA 3X42A 1YIJ3 1EQKA 5AIHA 3EBTA 1A2VA 1M1XB 5BXQA 4FCJA 2ZL8A 3GZRA 1NWWA 1QAFA 3GWRA 2ZDJA 4H3UA 3BB9A 5EQLA 4QWTA 2UX0A 2C11A 3DGNA 3B8LA 5HGRA 3G8ZA 4WYKB 4XDVA 2W56B 3FG1A 3PXMA 3F8HA 4KVHA 1N8R4 3FLJA 1J2BA 1C7HA 2CIUA 2GU1A 1NB3I 3RGRA 1ZX2A 2RCDA 5CLKA 1ASKA 2Z7AA 4HVNA 3ER7A 2SBLA 1N5PA 3AMOA 1IV9A 5LC7A 2STDA 2CWUA 3DGOA 1Q7Y4 2P0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB5 A;  5STD A;  1GYB A;  2RFR A;  2B24 B;  3MSO A;  5DRV A;  1ULI B;  3A76 A;  3BLZ A;  3F40 A;  5KP3 A;  2PZV A;  5IF6 A;  7STD A;  5IEP A;  5IG3 A;  5IG0 A;  2YFI B;  3JUN A;  4HKV B;  4LMI A;  3DZL A;  3EJV A;  2BNG A;  3NV0 B;  2F86 B;  4R1K A;  4L8P A;  1OHO A;  2BMO B;  4HM8 B;  3GZY B;  4L7K A;  1E3R A;  3EN1 B;  2IMJ A;  1OPY A;  4HM7 B;  3DMC A;  1JN5 A;  1E97 A;  1O7H B;  4FCM A;  1STD A;  4ORL A;  4U13 A;  4L8O A;  3CNX A;  1JB4 A;  4XBY A;  5D82 A;  3HZP A;  1U5O A;  3FGY A;  6STD A;  1OH0 A;  4K1U A;  4XBX A;  5EVH A;  4CDL A;  8CHO A;  1UUW B;  3EC9 A;  1O7G B;  5BVB A;  1TP6 A;  1O7N B;  2RGQ A;  3HX8 A;  5AIF A;  1OCV A;  1S5A A;  5D83 A;  3T8N A;  1K41 A;  1GY6 A;  5G2G A;  3SED A;  3UNL A;  3KSP A;  1OHS A;  1GY7 A;  2GXF A;  1JKG B;  3LYG A;  4X2O A;  3ECF A;  2Z76 A;  1Q40 A;  1VZZ A;  2HMM B;  1BUQ A;  1Q42 A;  5CF1 A;  5CXO A;  3EX9 A;  3GZB A;  4MJD A;  3CPO A;  3SOA A;  3MG1 A;  3MYT A;  2GEY A;  2K54 A;  4HJL B;  2INX A;  3NM2 A;  1GY5 A;  1W00 A;  3OWS A;  1W01 A;  1NDO B;  3VGN A;  2Z77 A;  3WMD A;  2XR8 B;  2GEX A;  1O7W B;  3H51 A;  4HM6 B;  1TUH A;  3FF2 A;  3MG2 A;  4WWU C;  3OWU A;  4WYK A;  3B7C A;  1QMA A;  4HM5 B;  3VSY A;  4J8T A;  5IEO A;  4XDW A;  3E99 A;  4I4K A;  3FKA A;  3F9S A;  1DMM A;  2F98 A;  2CKF B;  3EQQ B;  1GS3 A;  5AEU B;  3NBR A;  1CQS A;  1DMN A;  4XM4 A;  2B1X B;  1DMQ A;  4STD A;  3FH1 A;  3HK4 A;  2I9W A;  4OUQ A;  3T8U A;  3F8X A;  3NUV A;  3DM8 A;  5CK6 A;  3DXO A;  3EN8 A;  1E3V A;  2CHC A;  1OF5 A;  1EA2 A;  3KE7 A;  1UUV B;  3NV0 A;  4RZM A;  4HM2 B;  1OGX A;  3OX9 A;  3KZT A;  3RGA A;  3I0Y A;  4HM0 B;  5TGN A;  3JUP A;  2GBX B;  3EF8 A;  3MHE A;  5D81 A;  4HM1 B;  4PEJ A;  5JPP A;  2BMQ B;  3K7C A;  5KP1 A;  2XSO B;  2A15 A;  3M8C A;  1OGZ A;  3FZW A;  4R9L A;  4K1V A;  3S5C A;  5IER A;  4HM3 B;  1OHP A;  1ZO2 A;  3NHX A;  4N3V A;  1IDP A;  3LZA A;  2HMJ B;  3OV4 A;  1Z1S A;  4LEH A;  3DUK A;  3MKI A;  1W02 A;  3F7X A;  1JN5 B;  3EBY A;  3OWY A;  2HMK B;  3JUO A;  3F14 A;  1HKX A;  2BMR B;  5IEN A;  2XRX B;  5IG4 A;  3JUM A;  5AII A;  2QGU A;  4GB5 A;  3JUQ A;  1EG9 B;  1WQL B;  1SJW A;  5KP4 A;  1OUN A;  3ROB A;  3CU3 A;  1JB2 A;  3B4O A;  5FW5 A;  3SOY A;  3G0K A;  1JKG A;  1OF5 B;  1QJG A;  2JQ5 A;  3OXA A;  5AIG A;  3FF0 A;  4XBT A;  1W6Y A;  3D9R A;  2W2C A;  3GRD A;  3FSD A;  3NXJ A;  4HZB B;  2XSH B;  5AEW B;  3IPT A;  3K0Z A;  2OWP A;  3H3H A;  3F7S A;  4Q53 A;  3GZX B;  4HZ9 B;  4X2H A;  4LGQ A;  3STD A;  1Q40 B;  3G16 A;  4HM4 B;  3KKG A;  4XB5 A;  5JPU A;  3EHC A;  1O7P B;  2YFJ B;  2QIY A;  2HMN B;  4WP5 A;  1NU3 A;  3Q90 A;  1A2K A;  4R9K A;  5DRE A;  1O7M B;  1AR0 A;  1ULJ B;  2HML B;  5CF2 A;  2R4I A;  3B4P A;  5AI1 A;  3UJM A;  3CNM A;  5IG5 A;  2HMO B;  4IIA A;  2YFL B;  2F99 A;  2GBW B;  3MG3 A;  1ISK A;  4J9A A;  4OVM A;  5AIH A;  3EBT A;  5BXQ A;  4FCJ A;  3GZR A;  1NWW A;  3GWR A;  4H3U A;  3BB9 A;  2UX0 A;  3B8L A;  5HGR A;  3G8Z A;  4WYK B;  4XDV A;  3F8H A;  4KVH A;  3FLJ A;  1C7H A;  3RGR A;  1ZX2 A;  2RCD A;  5CLK A;  1ASK A;  2Z7A A;  4HVN A;  3ER7 A;  2STD A; 
#chains in the Genus database with same CATH topology
 1JB5 A;  2UGI A;  1AY7 A;  3O8Y A;  5STD A;  1GYB A;  3SXX A;  4EYC A;  1BRJ A;  2YX9 A;  1IV7 A;  2QA4 3;  2RFR A;  1FA3 A;  2B24 B;  3OW2 2;  2IA7 A;  3MSO A;  5DRV A;  1ULI B;  1LOY A;  2WGO A;  3A76 A;  3WA3 A;  3FG3 A;  1IK3 A;  3D5G A;  3HOH A;  2CC3 A;  3BLZ A;  4BU4 A;  1M90 4;  1BAN A;  1BSB A;  2CH9 A;  3F40 A;  5KP3 A;  4BTY A;  3URP A;  4BTX A;  1VQL 3;  1M9G A;  1EKM A;  1N8Q A;  2AAD A;  2BT3 A;  2F5W A;  1MWS A;  4TX4 A;  3SLU A;  1RGC A;  2PZV A;  1SIH A;  4K90 B;  2V1L A;  2P38 A;  1BNF A;  3D79 A;  5IF6 A;  1YI2 3;  3LTA A;  3X3X A;  7STD A;  2W9P A;  3MPH A;  5I97 A;  5IG3 A;  5IEP A;  2F5M A;  5IG0 A;  2YFI B;  3JUN A;  1W2B 2;  4JRF A;  1DVC A;  3CPW 2;  3PGB A;  3I56 3;  4HKV B;  2OTL 3;  5ELJ A;  1JJ2 2;  2WO0 A;  4LMI A;  3KII A;  3DZL A;  3EJV A;  1W6G A;  3BND A;  2BNG A;  2WOH A;  5JBS A;  2KF4 A;  3NV0 B;  2F86 B;  1QVG 2;  1RN7 A;  2W04 A;  4R1K A;  3NQY A;  2H0I A;  1T2H A;  4N6U A;  3N8B A;  4L8P A;  3CCU 3;  1WMP A;  1OHO A;  2BMO B;  4HM8 B;  1N9E A;  1R4Y A;  3GZY B;  4L7K A;  2F56 A;  1E3R A;  2KRT A;  5GSP A;  1FGO A;  3EN1 B;  3CME 3;  1VQ6 3;  2IMJ A;  3LT9 A;  3IJE B;  1OPY A;  4HM7 B;  3BU4 A;  4CJN A;  6RNT A;  1VQ8 3;  1RGL A;  1LOW A;  2CX0 A;  3GAX A;  1GMQ A;  3CCE 3;  1R4C A;  2JDI H;  3DMC A;  3JVC A;  7RNT A;  1BSC A;  4N6V 0;  3NM7 A;  1FGR A;  5ELU A;  1JN5 A;  1E97 A;  1VQ7 3;  1EUI C;  1BRN L;  3T0U A;  1AQZ A;  1JZO A;  2CWT A;  3Q2P A;  4MMY B;  3QK9 A;  4MEI A;  1TRQ A;  1KSI A;  1O7H B;  1WTH A;  3K63 A;  1YGE A;  4FCM A;  2WGQ A;  3QRD A;  2CFL A;  1D6U A;  2XF3 A;  1STD A;  4ORL A;  1BOX A;  2W6J H;  3CCS 3;  3NBB A;  4U13 A;  2GU3 A;  1NJI 4;  1JV2 B;  2KCD A;  1BNJ A;  3HII A;  4L8O A;  2L1S A;  4EW5 A;  3LOY A;  1IYY A;  1OAC A;  2K0M A;  3PYJ A;  3CNX A;  2CWV A;  1JB4 A;  1FUS A;  4XBY A;  1YVS A;  5D82 A;  2HOH A;  1IU7 A;  3HZP A;  1VQQ A;  1U5O A;  3FGY A;  6STD A;  1OH0 A;  5A0O B;  1B2S A;  3KFQ C;  4IT7 A;  1QVF 2;  2R41 A;  4K1U A;  4XBX A;  4EC6 A;  1SII A;  5EVH A;  4CDL A;  3X40 A;  1ROV A;  4OK0 A;  8CHO A;  3CC7 3;  1C54 A;  4FMD A;  1UUW B;  3EC9 A;  1O7G B;  3RNT A;  5BVB A;  1TP6 A;  1YGW A;  2C4B A;  4R80 A;  3CXC 2;  1O7N B;  1DVD A;  3LXU X;  9RNT A;  2RGQ A;  3HX8 A;  5EEO A;  3UB1 A;  1FYS A;  4RBN A;  5AYS C;  1RHL A;  5AIF A;  4I5Q A;  1OCV A;  1S5A A;  3LT8 A;  5D83 A;  1JNQ A;  1HYF A;  3T8N A;  1K41 A;  1GY6 A;  1UUG B;  1MWR A;  1MWU A;  5G2G A;  2KAA A;  3SED A;  3ZG5 A;  3UNL A;  1BVI A;  1UCL A;  1OHS A;  3KSP A;  1GY7 A;  1I0V A;  2GXF A;  1JKG B;  1T3B A;  2OQE C;  3LYG A;  4X2O A;  1RNB A;  3CMA 3;  2L4V A;  3N54 B;  3ECF A;  2Z76 A;  1Q40 A;  1UCJ A;  1VQO 3;  1W2Z A;  1US1 A;  1VZZ A;  1Q81 4;  2HMM B;  1BUQ A;  1Q42 A;  2E2U A;  1VQM 3;  1BUJ A;  2KF3 A;  5CF1 A;  1STF I;  1U8C B;  3AGO A;  3BNE A;  3EX9 A;  5CXO A;  4ZM8 A;  1W6C A;  1RCL A;  3GZB A;  1K8A 4;  4O8S A;  1RSN A;  4GSP A;  3LTD A;  4MJD A;  4FR9 A;  3CCR 3;  3CPO A;  4BIR A;  4WFO A;  2BHM A;  3SOA A;  1PU4 A;  1L5G B;  1I70 A;  5M1A A;  4HOH A;  1BNE A;  3MG1 A;  3MYT A;  1RJO A;  1V58 A;  4H61 A;  2GEY A;  1GD3 A;  1Y4K A;  5IW9 A;  1NO3 A;  1X1U A;  2K54 A;  5G1K A;  1IT7 A;  1AVK A;  1ZS7 A;  1BNS A;  3EB8 A;  4HJL B;  1IQ8 A;  1YHQ 3;  2INX A;  3NM2 A;  1G96 A;  3I55 3;  1GY5 A;  3WOD G;  1UGH I;  1W00 A;  5G1L A;  2Y74 A;  3IMA B;  2RBI A;  3OWS A;  2KF6 A;  3FG4 A;  1A67 A;  1W01 A;  1NDO B;  2RSX A;  2W0Q A;  3VGN A;  1M1K 4;  1UI8 A;  1DE3 A;  2Z77 A;  3WMD A;  1RRH A;  1TJD A;  5FGO A;  1YJ9 3;  1FUW A;  2CFD A;  2PNC A;  2XR8 B;  1NNV A;  3PCS A;  2GEX A;  1FGQ A;  1FGM A;  1LQM B;  4N6M A;  1O7W B;  1LNI A;  3H51 A;  3UL5 A;  4HM6 B;  1TUH A;  1CH0 A;  1RDS A;  3FF2 A;  2AAE A;  4N6N B;  2ML5 A;  1CYU A;  3G71 3;  2CFK A;  1BNG A;  3MG2 A;  2D42 A;  1GMP A;  1LVN A;  1MNL A;  4AKZ A;  1YIT 3;  4WWU C;  3OWU A;  1K9M 4;  4NHF A;  2C10 A;  1GD4 A;  3WOE B;  1B2Z A;  4WYK A;  1B2M A;  2W56 A;  1N5H A;  1KWI A;  3LTB A;  3B7C A;  1QMA A;  2P09 A;  4HM5 B;  3VSY A;  2CFG A;  4J8T A;  5IEO A;  3NQZ A;  4XDW A;  1G02 A;  3E99 A;  1RCK A;  3HI7 A;  4I4K A;  3CCQ 3;  1I0X A;  3DGY A;  1IQY A;  3FKA A;  3F9S A;  1DMM A;  2OTJ 3;  4KZ1 A;  1VQ9 3;  4FMB A;  1TU5 A;  1UCK A;  1UW1 A;  2F98 A;  5HOH A;  2Y73 A;  4O02 B;  4FMA A;  3KN4 A;  2CKF B;  3EQQ B;  1BSD A;  4HAA A;  1GS3 A;  1RKY A;  1HZ1 A;  1JRQ A;  3SX1 A;  1RN4 A;  5AEU B;  2XGN A;  1LQG C;  3NBR A;  1LNH A;  4BL3 A;  1BSE A;  1CQS A;  6GSP A;  1DMN A;  3Q3F A;  4XM4 A;  3S67 A;  4EV2 A;  1K73 4;  1A2P A;  2B1X B;  1DMQ A;  4STD A;  3FH1 A;  4GL6 A;  3HK4 A;  1BRG A;  2I9W A;  4MMX B;  4OUQ A;  1AV4 A;  2K3D A;  1IVU A;  3FCS B;  3T8U A;  2XFT A;  2QEX 3;  1VQP 3;  1D6Y A;  3F8X A;  3NUV A;  5M18 A;  3LML A;  4N6O B;  3DM8 A;  2FGT A;  1BRH A;  3AGN A;  3AMO B;  5CK6 A;  3DXO A;  3CC4 3;  3EN8 A;  4J5K A;  1E3V A;  2CHC A;  2KXG A;  3D3L A;  1RGH A;  2E2T A;  1B3S A;  1OF5 A;  2CK3 H;  1I3F A;  1EA2 A;  1RNT A;  1TFK A;  1W7C A;  4IPB A;  1UCI A;  1SPU A;  3LH4 A;  2D1W A;  3KCH A;  4HBR A;  1PY3 A;  3V98 A;  3KE7 A;  1IVW A;  1UUV B;  3NV0 A;  3N9H A;  4HM2 B;  4RZM A;  3WA2 X;  4CCV A;  1OGX A;  4N6T A;  1VQ5 3;  1QAL A;  5M19 A;  3OX9 A;  4EXR A;  3KZT A;  1JBS A;  1FGT A;  1I8V A;  4FCZ A;  2P0X A;  2XGL A;  1RGE A;  4KFD A;  2J8X B;  2XFS A;  3RGA A;  3I0Y A;  4HM0 B;  5TGN A;  3JUP A;  1YVB I;  1RGG A;  2GBX B;  3EF8 A;  3MHE A;  1I3I A;  5D81 A;  1B21 A;  2OOV A;  2IYJ A;  4HM1 B;  4PEJ A;  5JPP A;  2BMQ B;  5RNT A;  3HIG A;  3K7C A;  4G1M B;  3VF1 A;  1T5Y A;  2XSO B;  2A15 A;  5KP1 A;  1KQS 2;  3AHW A;  1N9J A;  3M8C A;  3RDE A;  1OGZ A;  1S72 3;  3FZW A;  4R9L A;  4DKI A;  3Q1C A;  4K1V A;  1VQ4 3;  3S5C A;  1PYL A;  3LTC A;  5IER A;  3ZFZ A;  1YJW 3;  1EEJ A;  1BSA A;  1RLS A;  1Q86 4;  4HM3 B;  4AKY A;  1OHP A;  1ZO2 A;  2W03 A;  3AHS A;  3DY5 A;  1GMR A;  3NHX A;  1IDP A;  2CFW A;  4LZI A;  4N3V A;  1GOY A;  3G4S 3;  3LZA A;  1K28 A;  2HMJ B;  3OV4 A;  1Z1S A;  1W4N A;  4FMC A;  1PFP A;  1RN1 A;  2CG0 A;  1QAK A;  1D6Z A;  4LEH A;  1I2G A;  3SYU A;  3DUK A;  3MKI A;  3BNC A;  1B27 A;  3WR2 A;  3K5T A;  3A5E A;  1W02 A;  1W5Z A;  1MGW A;  3F7X A;  1BRK A;  1JN5 B;  3EBY A;  3KSE D;  1BAO A;  2OQE A;  4J5G A;  3DGL A;  3X3Z A;  3OWY A;  1WMO A;  2MF7 A;  2OCT A;  2HMK B;  3JUO A;  4BL2 A;  1RTU A;  1IQX A;  1CEW I;  1RRL A;  1HKX A;  3F14 A;  2BMR B;  4N6L A;  5IEN A;  2IUK A;  2XRX B;  3JUM A;  3D5I A;  5AII A;  5IG4 A;  3G6E 3;  1LXE A;  4BTW A;  3MWZ A;  1JZD A;  1TTO A;  2UUG C;  4MMZ B;  1VQN 3;  2QGU A;  4NPB A;  4GB5 A;  1KC8 4;  3EE1 A;  1BU4 A;  1A90 A;  2ML6 A;  4ILF A;  1ROA A;  3JUQ A;  2ZHX B;  3D4A A;  1EG9 B;  1WQL B;  1SJW A;  5LC6 A;  5KP4 A;  3V92 A;  1OUN A;  3ROB A;  3CU3 A;  1SAR A;  2O3O A;  2W9Q A;  1JB2 A;  3B4O A;  3PS8 A;  5FW5 A;  3SOY A;  2H0H A;  1WMN A;  4JF8 A;  2GSP A;  4NRE A;  3CCL 3;  4O3V A;  2P05 A;  4RNZ A;  3G0K A;  1TRP A;  1TIJ A;  3NX0 A;  1JKG A;  2Z6B A;  4KT3 B;  3V99 A;  3X3Y A;  1OF5 B;  1RGA A;  1BIR A;  1X1X A;  1QJG A;  2CW9 A;  2E2V A;  2JQ5 A;  3OXA A;  3UL6 A;  2FXT A;  5AIG A;  3FF0 A;  4XBT A;  1W6Y A;  3D9R A;  4GHO A;  1RMS A;  2W2C A;  3SVA A;  2WOF A;  3GRD A;  3FSD A;  3NXJ A;  1AVL A;  4AEQ A;  2SAR A;  4HZB B;  3DGM A;  3WDG B;  5AYR B;  1I2E A;  2XSH B;  3S27 A;  3U97 A;  1BNI A;  5AEW B;  1VQK 3;  3J7Y d;  3U1W A;  1I2F A;  1MWT A;  4O2H A;  1F8N A;  2MC8 A;  3IPT A;  4KFF A;  3S28 A;  1X1Y A;  1WNH A;  3K0Z A;  4RNY A;  1FUT A;  2OWP A;  3H3H A;  1RGF A;  1NB5 I;  2O9U X;  1FW7 A;  2BIR A;  1GOV A;  1MOL A;  3BNB A;  3F7S A;  4KFE A;  2RNT A;  4Q53 A;  3CC2 3;  1UI7 A;  1FZU A;  8RNT A;  1Q82 4;  2BU4 A;  3GZX B;  4HZ9 B;  1UDI I;  4LSO A;  3L0R A;  4X2H A;  4LGQ A;  3STD A;  3CCJ 3;  1UGI A;  1B2U A;  1YJN 3;  2M7O A;  2XEP A;  2IUJ A;  1Q40 B;  3WHO A;  1BRI A;  3G16 A;  3X41 A;  4EBG A;  1Q7H A;  4HM4 B;  2KF5 A;  3K9M C;  3TDG A;  1DET A;  2XH9 A;  3S29 A;  3KKG A;  4XB5 A;  4R4K A;  2BO9 B;  5JPU A;  3EHC A;  1O7P B;  2YFJ B;  2QIY A;  1BRS A;  1V74 A;  3ALA A;  2F4Y A;  2HMN B;  3PZW A;  1BGS A;  1IT8 A;  1CYV A;  4WP5 A;  1NU3 A;  3Q90 A;  1BNR A;  1KD1 4;  1A2K A;  4R9K A;  5DRE A;  1B20 A;  1O7M B;  2Q07 A;  4LYL B;  3CD6 3;  1Q9E A;  3GSP A;  1AR0 A;  1LRA A;  1ULJ B;  5BIR A;  3CCV 3;  2OOV C;  1B2X A;  7GSP A;  1RGK A;  2HML B;  5CF2 A;  1GSP A;  2R4I A;  4K61 A;  3B4P A;  4WHA A;  5AI1 A;  2CG1 A;  2FNQ A;  4EV5 A;  3CCM 3;  3UJM A;  3ZG0 A;  3CNM A;  1JBT A;  5IG5 A;  1V57 A;  2HMO B;  2ZA4 A;  1HU9 A;  3NBJ A;  4IIA A;  2YFL B;  2F99 A;  1IVX A;  1LOX A;  2LQV A;  2LYX A;  2GBW B;  1MGR A;  3MG3 A;  3PCR A;  1ISK A;  1SQW A;  4HYZ A;  4J9A A;  4OVM A;  1IVV A;  3WOF B;  1TFO A;  1DYU A;  3DH2 A;  3X42 A;  1YIJ 3;  5AIH A;  3EBT A;  1EQK A;  1A2V A;  1T2I A;  3BIR A;  1M1X B;  5BXQ A;  4FCJ A;  2ZL8 A;  3GZR A;  1NWW A;  4CPK A;  1JBR A;  1QAF A;  3GWR A;  2ZDJ A;  4H3U A;  4RNT A;  3BB9 A;  1G0T A;  4QWT A;  5EQL A;  2H0G A;  2UX0 A;  2C11 A;  3DGN A;  3B8L A;  5HGR A;  3G8Z A;  4WYK B;  5BU4 A;  4XDV A;  2W56 B;  3FG1 A;  3PXM A;  3F8H A;  4KVH A;  1N8R 4;  3FLJ A;  1J2B A;  1LOV A;  1C7H A;  2CIU A;  2GU1 A;  1NB3 I;  1YNV X;  1GOU A;  3RGR A;  1ZX2 A;  2RCD A;  5CLK A;  1ASK A;  1ZGX A;  2Z7A A;  4HVN A;  3ER7 A;  2IY2 A;  2SBL A;  1N5P A;  3AMO A;  2CX1 A;  1IV9 A;  5LC7 A;  2STD A;  2CWU A;  1X1W A;  3DGO A;  1Q7Y 4;  2P0M A; 
#chains in the Genus database with same CATH homology
 1JB5 A;  5STD A;  3O8Y A;  3SXX A;  4EYC A;  1GYB A;  2YX9 A;  1IV7 A;  2QA4 3;  2RFR A;  1FA3 A;  2B24 B;  3OW2 2;  2IA7 A;  3MSO A;  5DRV A;  1ULI B;  2WGO A;  3A76 A;  3WA3 A;  3FG3 A;  1IK3 A;  2CC3 A;  3BLZ A;  1M90 4;  3F40 A;  2CH9 A;  5KP3 A;  4BTY A;  4BTX A;  1VQL 3;  1M9G A;  1EKM A;  1N8Q A;  2BT3 A;  4TX4 A;  3SLU A;  4K90 B;  2PZV A;  1SIH A;  2V1L A;  2P38 A;  5IF6 A;  1YI2 3;  3LTA A;  3X3X A;  7STD A;  2W9P A;  3MPH A;  5I97 A;  5IG3 A;  5IEP A;  5IG0 A;  2YFI B;  3JUN A;  1W2B 2;  4JRF A;  1DVC A;  3CPW 2;  3PGB A;  3I56 3;  4HKV B;  2OTL 3;  5ELJ A;  1JJ2 2;  2WO0 A;  4LMI A;  3KII A;  3DZL A;  3EJV A;  1W6G A;  3BND A;  2BNG A;  2WOH A;  5JBS A;  3NV0 B;  2F86 B;  1QVG 2;  1RN7 A;  2W04 A;  4R1K A;  3NQY A;  4N6U A;  3N8B A;  4L8P A;  3CCU 3;  1WMP A;  1OHO A;  2BMO B;  4HM8 B;  1N9E A;  3GZY B;  4L7K A;  1E3R A;  2KRT A;  1FGO A;  3EN1 B;  3CME 3;  1VQ6 3;  2IMJ A;  3LT9 A;  3IJE B;  1OPY A;  4HM7 B;  1VQ8 3;  3GAX A;  3CCE 3;  1R4C A;  2JDI H;  3DMC A;  3JVC A;  4N6V 0;  3NM7 A;  1FGR A;  5ELU A;  1JN5 A;  1E97 A;  1VQ7 3;  3T0U A;  2CWT A;  3Q2P A;  4MMY B;  3QK9 A;  4MEI A;  1KSI A;  1O7H B;  1WTH A;  3K63 A;  1YGE A;  4FCM A;  2WGQ A;  3QRD A;  2XF3 A;  1D6U A;  2CFL A;  1STD A;  4ORL A;  2W6J H;  3CCS 3;  3NBB A;  4U13 A;  2GU3 A;  1NJI 4;  1JV2 B;  2KCD A;  3HII A;  4L8O A;  3LOY A;  1OAC A;  2K0M A;  3PYJ A;  3CNX A;  2CWV A;  1JB4 A;  4XBY A;  5D82 A;  3HZP A;  1IU7 A;  1U5O A;  3FGY A;  6STD A;  1OH0 A;  5A0O B;  3KFQ C;  4IT7 A;  1QVF 2;  4K1U A;  4XBX A;  4EC6 A;  1SII A;  5EVH A;  4CDL A;  3X40 A;  1ROV A;  4OK0 A;  8CHO A;  3CC7 3;  4FMD A;  1UUW B;  3EC9 A;  1O7G B;  5BVB A;  1TP6 A;  4R80 A;  3CXC 2;  1O7N B;  1DVD A;  3LXU X;  2RGQ A;  3HX8 A;  5EEO A;  3UB1 A;  4RBN A;  5AYS C;  5AIF A;  1OCV A;  1S5A A;  3LT8 A;  5D83 A;  1JNQ A;  3T8N A;  1K41 A;  1GY6 A;  5G2G A;  3SED A;  3UNL A;  3KSP A;  1OHS A;  1GY7 A;  2GXF A;  1JKG B;  3LYG A;  2OQE C;  4X2O A;  3CMA 3;  2L4V A;  3N54 B;  3ECF A;  2Z76 A;  1Q40 A;  1VQO 3;  1W2Z A;  1US1 A;  1VZZ A;  1Q81 4;  2HMM B;  1BUQ A;  1Q42 A;  2E2U A;  1VQM 3;  5CF1 A;  1STF I;  1U8C B;  3BNE A;  3EX9 A;  5CXO A;  4ZM8 A;  1W6C A;  3GZB A;  1K8A 4;  4O8S A;  3LTD A;  4MJD A;  4FR9 A;  3CCR 3;  3CPO A;  4WFO A;  2BHM A;  3SOA A;  1PU4 A;  1L5G B;  3MG1 A;  3MYT A;  1RJO A;  4H61 A;  2GEY A;  1GD3 A;  1Y4K A;  5IW9 A;  1NO3 A;  2K54 A;  1IT7 A;  1AVK A;  1YHQ 3;  3EB8 A;  4HJL B;  1IQ8 A;  2INX A;  3NM2 A;  1G96 A;  3I55 3;  1GY5 A;  3WOD G;  1W00 A;  2Y74 A;  3IMA B;  3OWS A;  3FG4 A;  1A67 A;  1W01 A;  1NDO B;  2RSX A;  2W0Q A;  3VGN A;  1M1K 4;  1UI8 A;  2Z77 A;  3WMD A;  1RRH A;  5FGO A;  1YJ9 3;  1FUW A;  2CFD A;  2PNC A;  2XR8 B;  3PCS A;  2GEX A;  1FGQ A;  1FGM A;  4N6M A;  3UL5 A;  1O7W B;  3H51 A;  4HM6 B;  1TUH A;  3FF2 A;  4N6N B;  1CYU A;  2ML5 A;  3G71 3;  2CFK A;  3MG2 A;  2D42 A;  1LVN A;  1MNL A;  4AKZ A;  1YIT 3;  4WWU C;  3OWU A;  1K9M 4;  4NHF A;  2C10 A;  1GD4 A;  3WOE B;  4WYK A;  2W56 A;  1N5H A;  1KWI A;  3LTB A;  3B7C A;  1QMA A;  2P09 A;  4HM5 B;  3VSY A;  2CFG A;  4J8T A;  5IEO A;  3NQZ A;  4XDW A;  3E99 A;  4I4K A;  3HI7 A;  3CCQ 3;  1IQY A;  3FKA A;  3F9S A;  1DMM A;  2OTJ 3;  4KZ1 A;  1VQ9 3;  4FMB A;  1TU5 A;  1UW1 A;  2F98 A;  2Y73 A;  4O02 B;  4FMA A;  3KN4 A;  2CKF B;  3EQQ B;  1GS3 A;  1RKY A;  1JRQ A;  3SX1 A;  5AEU B;  2XGN A;  3NBR A;  1LNH A;  1CQS A;  1DMN A;  1K73 4;  4XM4 A;  3S67 A;  4EV2 A;  2B1X B;  1DMQ A;  4STD A;  3FH1 A;  4GL6 A;  3HK4 A;  2I9W A;  4MMX B;  4OUQ A;  1AV4 A;  1IVU A;  3FCS B;  3T8U A;  2XFT A;  2QEX 3;  1VQP 3;  1D6Y A;  3F8X A;  3NUV A;  3LML A;  4N6O B;  3DM8 A;  2FGT A;  3AMO B;  5CK6 A;  3DXO A;  3CC4 3;  3EN8 A;  1E3V A;  2CHC A;  2KXG A;  3D3L A;  2E2T A;  1OF5 A;  2CK3 H;  1EA2 A;  1TFK A;  1W7C A;  4IPB A;  1SPU A;  3LH4 A;  2D1W A;  4HBR A;  3V98 A;  3KE7 A;  1IVW A;  1UUV B;  3NV0 A;  3N9H A;  4HM2 B;  4RZM A;  3WA2 X;  4CCV A;  1OGX A;  4N6T A;  1VQ5 3;  1QAL A;  3OX9 A;  4EXR A;  3KZT A;  1FGT A;  4FCZ A;  2P0X A;  2XGL A;  4KFD A;  2XFS A;  3RGA A;  3I0Y A;  4HM0 B;  5TGN A;  3JUP A;  1YVB I;  2GBX B;  3EF8 A;  3MHE A;  5D81 A;  2OOV A;  4HM1 B;  4PEJ A;  5JPP A;  2BMQ B;  3HIG A;  3K7C A;  4G1M B;  3VF1 A;  1T5Y A;  2XSO B;  2A15 A;  5KP1 A;  1KQS 2;  1N9J A;  3M8C A;  3RDE A;  1OGZ A;  1S72 3;  3FZW A;  4R9L A;  3Q1C A;  4K1V A;  1VQ4 3;  3S5C A;  3LTC A;  5IER A;  1YJW 3;  1Q86 4;  4HM3 B;  4AKY A;  1OHP A;  1ZO2 A;  2W03 A;  3DY5 A;  3NHX A;  4N3V A;  1IDP A;  2CFW A;  4LZI A;  3G4S 3;  3LZA A;  1K28 A;  2HMJ B;  3OV4 A;  1Z1S A;  1W4N A;  4FMC A;  1PFP A;  2CG0 A;  1QAK A;  1D6Z A;  4LEH A;  3DUK A;  3MKI A;  3BNC A;  3K5T A;  1W02 A;  1W5Z A;  3F7X A;  1JN5 B;  3EBY A;  3KSE D;  2OQE A;  3DGL A;  3X3Z A;  3OWY A;  1WMO A;  2MF7 A;  2OCT A;  2HMK B;  3JUO A;  3F14 A;  1IQX A;  1CEW I;  1RRL A;  1HKX A;  2BMR B;  4N6L A;  5IEN A;  2IUK A;  2XRX B;  3JUM A;  5AII A;  5IG4 A;  3G6E 3;  1LXE A;  4BTW A;  3MWZ A;  4MMZ B;  1VQN 3;  2QGU A;  4GB5 A;  1KC8 4;  3EE1 A;  1A90 A;  2ML6 A;  1ROA A;  3JUQ A;  1EG9 B;  1WQL B;  1SJW A;  5LC6 A;  5KP4 A;  3V92 A;  1OUN A;  3ROB A;  3CU3 A;  2O3O A;  2W9Q A;  1JB2 A;  3B4O A;  3PS8 A;  5FW5 A;  3SOY A;  1WMN A;  4JF8 A;  4NRE A;  3CCL 3;  4O3V A;  2P05 A;  4RNZ A;  3G0K A;  1TIJ A;  3NX0 A;  3V99 A;  1JKG A;  2Z6B A;  3X3Y A;  1OF5 B;  2CW9 A;  2E2V A;  1QJG A;  2JQ5 A;  3OXA A;  3UL6 A;  2FXT A;  5AIG A;  3FF0 A;  4XBT A;  1W6Y A;  3D9R A;  2W2C A;  3SVA A;  2WOF A;  3GRD A;  3FSD A;  3NXJ A;  1AVL A;  4AEQ A;  4HZB B;  3DGM A;  3WDG B;  5AYR B;  2XSH B;  3S27 A;  3U97 A;  5AEW B;  1VQK 3;  3J7Y d;  3U1W A;  4O2H A;  1F8N A;  2MC8 A;  3IPT A;  4KFF A;  3S28 A;  1WNH A;  3K0Z A;  4RNY A;  2OWP A;  3H3H A;  1NB5 I;  2O9U X;  1MOL A;  3BNB A;  3F7S A;  4KFE A;  4Q53 A;  3CC2 3;  1UI7 A;  1Q82 4;  3GZX B;  4HZ9 B;  4LSO A;  4X2H A;  3L0R A;  4LGQ A;  3STD A;  3CCJ 3;  1YJN 3;  2M7O A;  2XEP A;  2IUJ A;  1Q40 B;  3X41 A;  3G16 A;  4EBG A;  4HM4 B;  3K9M C;  3TDG A;  2XH9 A;  3S29 A;  3KKG A;  4XB5 A;  4R4K A;  2BO9 B;  5JPU A;  3EHC A;  1O7P B;  2YFJ B;  2QIY A;  1V74 A;  3ALA A;  2HMN B;  3PZW A;  1IT8 A;  1CYV A;  4WP5 A;  1NU3 A;  3Q90 A;  1KD1 4;  1A2K A;  4R9K A;  5DRE A;  1O7M B;  2Q07 A;  3CD6 3;  1AR0 A;  1ULJ B;  3CCV 3;  2OOV C;  2HML B;  5CF2 A;  2R4I A;  4K61 A;  3B4P A;  4WHA A;  5AI1 A;  2CG1 A;  2FNQ A;  4EV5 A;  3CCM 3;  3UJM A;  3CNM A;  5IG5 A;  2HMO B;  1HU9 A;  3NBJ A;  4IIA A;  2YFL B;  2F99 A;  1IVX A;  1LOX A;  2LQV A;  2LYX A;  2GBW B;  3MG3 A;  3PCR A;  1ISK A;  1SQW A;  4HYZ A;  4J9A A;  4OVM A;  1IVV A;  3WOF B;  1TFO A;  1DYU A;  3X42 A;  1YIJ 3;  1EQK A;  5AIH A;  3EBT A;  1A2V A;  1M1X B;  5BXQ A;  4FCJ A;  2ZL8 A;  3GZR A;  1NWW A;  1QAF A;  3GWR A;  2ZDJ A;  4H3U A;  3BB9 A;  5EQL A;  4QWT A;  2UX0 A;  2C11 A;  3DGN A;  3B8L A;  5HGR A;  3G8Z A;  4WYK B;  4XDV A;  2W56 B;  3FG1 A;  3PXM A;  3F8H A;  4KVH A;  1N8R 4;  3FLJ A;  1J2B A;  1C7H A;  2CIU A;  2GU1 A;  1NB3 I;  3RGR A;  1ZX2 A;  2RCD A;  5CLK A;  1ASK A;  2Z7A A;  4HVN A;  3ER7 A;  2SBL A;  1N5P A;  3AMO A;  1IV9 A;  5LC7 A;  2STD A;  2CWU A;  3DGO A;  1Q7Y 4;  2P0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...