1NDOB

Naphthalene 1,2-dioxygenase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Non-heme iron dioxygenase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE
publication title Structure of an aromatic-ring-hydroxylating dioxygenase-naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 58
structure length 193
sequence length 193
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1998-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ndoB00
3EX9A 4J8TA 3FZWA 2W2CA 3BB9A 3GZBA 5AEWB 4FCMA 1EA2A 3EC9A 1GY7A 3K0ZA 3HZPA 3ER7A 5IG5A 3D9RA 4HM0B 1NWWA 3H3HA 3MYTA 2HMOB 1JB5A 3NXJA 3UNLA 3B7CA 3GWRA 5IENA 3EQQB 3F8HA 4XM4A 4MJDA 4IIAA 2GXFA 5CF1A 3OWYA 3Q90A 4H3UA 1JN5A 1OF5B 1OPYA 3FH1A 3OWUA 4XBYA 5CF2A 3LZAA 1DMNA 5D82A 3EJVA 4XBXA 1SJWA 2XRXB 1U5OA 2F98A 2RFRA 4XDWA 2GBWB 3B4OA 5DRVA 3DZLA 3F7SA 1JN5B 3MG2A 3IPTA 3EF8A 2GBXB 3M8CA 3VGNA 1O7WB 3EBTA 3KZTA 4R1KA 4ORLA 2R4IA 1AR0A 1OCVA 5IEPA 2GEXA 5G2GA 3KSPA 4Q53A 4HM2B 3I0YA 4HKVB 1NU3A 2YFIB 5KP3A 3OXAA 1OHOA 3NM2A 1O7NB 3T8UA 2F86B 1TUHA 1O7MB 3OV4A 3MKIA 5CXOA 2IMJA 2XSOB 2HMLB 7STDA 3HK4A 3MSOA 1E3VA 2BMOB 5HGRA 4HM8B 3CNXA 1ZO2A 5JPPA 2HMMB 2I9WA 3KE7A 1O7GB 2Z7AA 4LMIA 5IEOA 3NV0B 3FGYA 3EBYA 1W6YA 3F7XA 1C7HA 1DMQA 3G0KA 4PEJA 2BNGA 4J9AA 3GZRA 1NDOB 1OHPA 8CHOA 3DXOA 5IG4A 1JKGA 4CDLA 3MG3A 3SEDA 1OH0A 1O7HB 1GS3A 2HMKB 1W02A 4OVMA 5AEUB 4X2HA 3GZXB 3S5CA 1OUNA 1QMAA 3LYGA 5IG0A 4U13A 5FW5A 2BMQB 4HVNA 4LGQA 4WWUC 5TGNA 3NHXA 1JB4A 3FF2A 5KP4A 4I4KA 4X2OA 1Q42A 3SOYA 3ECFA 1IDPA 1BUQA 3DMCA 3F9SA 3RGAA 2CKFB 3A76A 4FCJA 2B1XB 3T8NA 5JPUA 3EN1B 1S5AA 1ZX2A 1HKXA 2B24B 5STDA 1UUWB 5BXQA 4OUQA 3GZYB 2YFJB 2RGQA 2Z76A 1K41A 4RZMA 1JB2A 2CHCA 3JUNA 1Q40A 4KVHA 3UJMA 5IF6A 1DMMA 3BLZA 3HX8A 3KKGA 4L7KA 1ULJB 1GY5A 4HM4B 3FF0A 3JUOA 1GY6A 2F99A 1Q40B 4WYKA 1VZZA 3JUMA 3OX9A 2YFLB 4XB5A 4HM7B 3EHCA 2JQ5A 5CK6A 3SOAA 1QJGA 1STDA 3JUQA 5KP1A 4HM1B 2HMJB 2XSHB 4HM5B 1ASKA 4K1VA 5AIHA 3MHEA 5D83A 2RCDA 4WYKB 5CLKA 3DUKA 1OF5A 3RGRA 1E3RA 1WQLB 2QGUA 3F40A 5AI1A 1JKGB 4L8PA 4WP5A 3STDA 4HM3B 1ISKA 3WMDA 1CQSA 3CU3A 1GYBA 4LEHA 2INXA 3E99A 6STDA 4HM6B 4XBTA 3NBRA 1OHSA 3F14A 3JUPA 1OGXA 2XR8B 1W00A 4STDA 5IG3A 1EG9B 3ROBA 2HMNB 3K7CA 2STDA 1OGZA 2OWPA 3FLJA 1UUVB 4K1UA 3F8XA 3CNMA 5AIIA 5AIGA 1A2KA 3OWSA 3B8LA 3G8ZA 2GEYA 4N3VA 5DREA 5IERA 1TP6A 4L8OA 4GB5A 2QIYA 5BVBA 5EVHA 2PZVA 3GRDA 1E97A 3DM8A 1W01A 3FKAA 3CPOA 2K54A 2UX0A 3EN8A 3G16A 3FSDA 4HZBB 3H51A 1ULIB 3B4PA 3MG1A 4HJLB 5AIFA 2Z77A 3VSYA 4R9LA 4HZ9B 5D81A 2BMRB 3NV0A 2A15A 1Z1SA 1O7PB 4R9KA 3NUVA 4XDVA
chains in the Genus database with same CATH superfamily
3EX9A 2CFLA 2K3DA 2Y73A 4J8TA 2W56A 3LMLA 3PS8A 1R4CA 3N9HA 3NX0A 3FZWA 3UL5A 1IK3A 1QAKA 4FMAA 2ZA4A 1F8NA 2W2CA 3N54B 4GL6A 1BNIA 1BRSA 3WOEB 3BB9A 1I2EA 3GZBA 3AMOB 5AEWB 1YJN3 4FCMA 1EA2A 1SQWA 2XF3A 3EC9A 3CC43 1GY7A 3K0ZA 3HZPA 1Q7Y4 4KFFA 1KWIA 4HBRA 2O3OA 3WHOA 1G02A 3ER7A 1B2SA 3L0RA 1N9JA 3D9RA 1M9GA 5IG5A 1VQ93 4BTYA 4HM0B 1IT7A 1NWWA 1X1XA 3H3HA 2HMOB 3MYTA 2CWVA 1BANA 1LNIA 2P05A 3K5TA 1L5GB 4EV5A 3BNEA 1RHLA 3HI7A 1JB5A 3D5GA 3NXJA 3Q2PA 3CCR3 2OQEA 2OTJ3 1JRQA 3U1WA 3UNLA 2H0IA 3B7CA 3GWRA 5IENA 1RGEA 1IT8A 3EQQB 3F8HA 1DVCA 3LH4A 4KZ1A 3CD63 1RNTA 2RSXA 4XM4A 4MJDA 3S27A 1B27A 4I5QA 4IIAA 1N5HA 2GXFA 2R41A 5CF1A 1B2XA 2F5MA 3OWYA 3AGNA 3Q90A 1RNBA 1R4YA 4H3UA 1JN5A 2LQVA 1OF5B 1I0XA 2OCTA 4NREA 1UCKA 3HIIA 3V92A 3V99A 3BIRA 1BNRA 3S67A 1OPYA 2CG1A 4CCVA 3KN4A 3FH1A 3OWUA 4XBYA 5CF2A 1RN4A 1CYUA 1BRHA 5GSPA 3NQYA 1X1WA 3IMAB 1FUSA 3LZAA 1DMNA 5D82A 5IW9A 3S28A 3EJVA 4XBXA 1SJWA 5HOHA 1BRKA 1TIJA 2XRXB 1U5OA 3LT8A 1BSCA 2F98A 3ALAA 1MWSA 1GOVA 2RFRA 4MMXB 1I2FA 1ZS7A 1YVSA 4XDWA 2BU4A 2GBWB 3B4OA 5DRVA 2W04A 3DGYA 1X1UA 3DZLA 2CFGA 1JN5B 3F7SA 1BSBA 4MMYB 3MG2A 2ZL8A 2BIRA 3EF8A 3IPTA 5LC7A 1LXEA 2GBXB 3M8CA 1Q864 3VGNA 1RCLA 3AHWA 1LOWA 1MGWA 1J2BA 1O7WB 2E2UA 1ROVA 1K734 1T2HA 3X40A 2KRTA 2CFWA 1DETA 2RNTA 3EBTA 3X42A 4TX4A 3KZTA 3G6E3 3SYUA 3K9MC 1FW7A 4O2HA 4R1KA 4ORLA 3MPHA 3UB1A 1RN1A 1ROAA 2R4IA 1AR0A 1JZOA 1LQMB 1JBSA 1A90A 1OCVA 1UUGB 1UI7A 1LOYA 2GEXA 2J8XB 5IEPA 3QK9A 5G2GA 3KSPA 4G1MB 3G4S3 3ZG0A 1FGTA 4Q53A 3EE1A 4HM2B 1PFPA 2IY2A 3I0YA 4HKVB 3BNCA 1NU3A 5ELJA 1QAFA 3WODG 3SVAA 3UL6A 4JF8A 2YFIB 1AVLA 2KF6A 1WMNA 2E2TA 3PCSA 1UCLA 5KP3A 3OXAA 1OHOA 1SARA 4EC6A 3NM2A 3QRDA 1W7CA 1O7NB 3T8UA 2F86B 1JZDA 1O7MB 1TUHA 2WGOA 3OV4A 1UGIA 3MKIA 1NB3I 1B2UA 1I3IA 1BU4A 2IMJA 2XSOB 1I3FA 5CXOA 4N6UA 2HMLB 1RGKA 4BU4A 3DY5A 3RDEA 3DGOA 2UUGC 2KF3A 3N8BA 1Q7HA 4KFDA 1GSPA 1DE3A 3DGLA 3BNDA 2AAEA 2C10A 3HK4A 7STDA 3G713 3KFQC 3MSOA 1U8CB 2CFKA 2KCDA 1RCKA 1E3VA 1RLSA 3PGBA 4ILFA 4CJNA 2H0HA 3CMA3 2BMOB 5HGRA 3S29A 3CC23 4HM8B 3I553 1BUJA 1WTHA 1LOXA 1CH0A 1N5PA 2XEPA 2SBLA 3LOYA 4BTWA 4EBGA 5BIRA 3CNXA 6GSPA 1RGLA 1W6GA 2XFSA 1M1K4 1ZO2A 1BNJA 4BTXA 5JPPA 1C54A 2HMMB 4GHOA 2I9WA 1BNFA 3KE7A 1IVXA 3WA2X 3CCJ3 1O7GB 3J7Yd 4KT3B 2Z7AA 2W0QA 1MNLA 3CCV3 1VQK3 4RBNA 3AGOA 4LMIA 1IYYA 5IEOA 1W2B2 1VQ73 3NV0B 3FGYA 1ZGXA 4RNYA 3EBYA 1W6YA 1RRHA 3F7XA 3D79A 1C7HA 3NBJA 1VQM3 1DMQA 3G0KA 4PEJA 2BNGA 3A5EA 4J9AA 1AQZA 1LOVA 1FGRA 3GZRA 2GU1A 1NDOB 1K28A 1OHPA 1RN7A 4AKZA 5LC6A 3DXOA 8CHOA 5IG4A 3FG1A 3V98A 1D6ZA 2WOHA 2W56B 2P09A 1A2VA 1JKGA 4CDLA 1JV2B 1M904 3MG3A 3SEDA 1VQL3 1OH0A 1HZ1A 1O7HB 1YIT3 1IQYA 1GS3A 2HMKB 5AYSC 2FNQA 1W02A 1UCJA 2GSPA 1GMQA 4OVMA 2P0MA 3GZXB 4X2HA 5AEUB 2OOVC 1KQS2 3S5CA 1OUNA 2XH9A 3FG4A 4RNTA 1QMAA 1AV4A 3LYGA 1IU7A 1AVKA 5IG0A 3X3YA 1TJDA 2QEX3 4U13A 1RTUA 1VQ63 5FW5A 2BMQB 1YGWA 4HVNA 4LGQA 4WWUC 3OW22 3PXMA 1MGRA 5TGNA 3NHXA 1KC84 1JB4A 1WMOA 3FF2A 3GAXA 4IT7A 5KP4A 1I70A 4I4KA 4FMDA 4X2OA 4NPBA 1Q42A 2MC8A 3SOYA 1UDII 2W9QA 4QWTA 4H61A 1HU9A 3ECFA 1IDPA 1BUQA 3FCSB 1VQN3 2W03A 3NQZA 2CG0A 3DMCA 3F9SA 3HOHA 3EB8A 3PYJA 4O3VA 3RGAA 2CKFB 3A76A 4FCJA 9RNTA 2XGLA 1YIJ3 4FMBA 2H0GA 2JDIH 4WFOA 1EUIC 1LRAA 1IQXA 1PYLA 2B1XB 3ZG5A 1M1XB 2CWUA 3D5IA 4N6V0 3T8NA 5BU4A 5JPUA 3IJEB 2CC3A 1GD4A 2CIUA 1US1A 4N6LA 3HIGA 3EN1B 1S5AA 1VQQA 1ZX2A 3WA3A 1GMPA 2IUJA 1B20A 3T0UA 1HKXA 4CPKA 3BNBA 5I97A 3KCHA 2CK3H 1W6CA 2B24B 4DKIA 3CCM3 1SIIA 3SLUA 2C4BA 5STDA 1UUWB 1LQGC 1GMRA 1S723 2OTL3 2V1LA 8RNTA 1SIHA 5BXQA 4OUQA 2P38A 3CPW2 1JBTA 3GZYB 2YFJB 2RGQA 2Z76A 1BSDA 1K41A 4EYCA 4RZMA 4O02B 1A67A 1JB2A 2CHCA 4HAAA 3JUNA 1Q40A 4KVHA 4N6MA 3K63A 3UJMA 3JVCA 5RNTA 1N9EA 1GOUA 1DMMA 3BLZA 2Z6BA 3HX8A 4RNZA 5IF6A 1BGSA 4EXRA 2CX1A 1W4NA 4LZIA 3U97A 3KKGA 4L7KA 1UW1A 5M1AA 3WR2A 1TTOA 2CW9A 1ULJB 1GY5A 1V57A 1RKYA 1IVWA 4HM4B 3FF0A 1B21A 1UGHI 3JUOA 1JBRA 1RDSA 1GY6A 1G0TA 2Q07A 1G96A 1STFI 1Y4KA 2D42A 2F99A 1IV7A 1Q40B 4WYKA 3Q1CA 1PU4A 4R4KA 3CCS3 1VZZA 1LNHA 5A0OB 3JUMA 2FGTA 3I563 1UI8A 3AMOA 3OX9A 1RGAA 1NO3A 2YFLB 3KIIA 3MWZA 1IQ8A 4HM7B 3EHCA 4XB5A 2JQ5A 5CK6A 2F5WA 3SOAA 4KFEA 1QJGA 1TFOA 2UGIA 1EQKA 4R80A 1BRNL 1STDA 3JUQA 2ZHXB 4HM1B 2OOVA 5KP1A 2HMJB 1Q9EA 7GSPA 4BL2A 1HYFA 2XSHB 3X3XA 2GU3A 6RNTA 3D3LA 1YVBI 4HM5B 1BNGA 2KF4A 1FGQA 1ASKA 4K61A 4K1VA 3X41A 5AIHA 1VQP3 3MHEA 3O8YA 5D83A 4OK0A 1WMPA 3CCL3 1QALA 2L1SA 2C11A 2RCDA 4WYKB 1N8QA 1FA3A 1BIRA 1RMSA 1BSEA 5CLKA 2IYJA 4LSOA 3DUKA 1Q814 1OF5A 4LYLB 1MWRA 1FUTA 4N6OB 3RGRA 1E3RA 4ZM8A 3DGNA 5FGOA 3KSED 3LTCA 3X3ZA 2KXGA 3CME3 3CCQ3 3D4AA 1YGEA 1TU5A 1RJOA 1WQLB 1RGHA 4HOHA 1T3BA 2BO9B 2QGUA 3F40A 5AI1A 4MEIA 4K90B 4NHFA 1CEWI 5AYRB 1T5YA 1KD14 1FGOA 1VQ53 4J5KA 1RGGA 1JKGB 4L8PA 4WP5A 3STDA 4HM3B 1K8A4 1ISKA 3WMDA 1CQSA 3CU3A 1GYBA 5ELUA 1MOLA 4LEHA 2INXA 2IA7A 4WHAA 1IV9A 1FYSA 3E99A 6STDA 3LXUX 3PZWA 3VF1A 2QA43 1VQO3 1NB5I 5G1LA 4JRFA 2F56A 1DVDA 4HM6B 4XBTA 1T2IA 1BVIA 1EEJA 1OHSA 1RSNA 1UCIA 2OQEC 2AADA 3NBRA 3Q3FA 1FUWA 3NM7A 4J5GA 3F14A 3JUPA 1Q824 1OGXA 2M7OA 2XR8B 1W00A 2ML5A 2LYXA 4STDA 2SARA 2CH9A 1KSIA 2WO0A 1CYVA 5IG3A 1YHQ3 7RNTA 3DGMA 4BIRA 1BRGA 2D1WA 3CXC2 2K0MA 2F4YA 2W9PA 2BHMA 1EG9B 3SX1A 1FZUA 3ROBA 4MMZB 3CCU3 3RNTA 1DYUA 2ZDJA 2HMNB 2P0XA 1X1YA 3AHSA 1YNVX 3K7CA 1QVF2 4O8SA 1RRLA 4GSPA 1YI23 5EQLA 2CWTA 2STDA 3DH2A 2CX0A 2PNCA 3TDGA 1OGZA 1GOYA 2W6JH 1VQ43 1VQ83 1NJI4 3LTAA 1LVNA 1YJ93 3LTDA 2OWPA 3FLJA 3CC73 4HYZA 3URPA 1JJ22 1UUVB 1PY3A 1IVVA 2HOHA 4FCZA 5G1KA 3WOFB 1B2ZA 4K1UA 5JBSA 3F8XA 1QVG2 1BOXA 3CNMA 1W5ZA 1BRIA 1EKMA 5AIIA 4IPBA 5AIGA 1BSAA 3BU4A 1A2KA 1D6YA 3OWSA 1N8R4 3B8LA 2FXTA 2CFDA 3FG3A 1K9M4 1MWUA 3G8ZA 3SXXA 2GEYA 1TFKA 1W2ZA 1RGCA 2IUKA 1BAOA 1NNVA 1I0VA 1I2GA 3GSPA 3LT9A 1AY7A 1SPUA 2L4VA 5EEOA 3WDGB 3CCE3 4N3VA 5DREA 1BRJA 2O9UX 5IERA 2RBIA 1TP6A 4EV2A 4L8OA 2XGNA 4GB5A 2MF7A 1V58A 2QIYA 2WGQA 5BVBA 1BNSA 2PZVA 3GRDA 5EVHA 1E97A 4AEQA 1I8VA 2WOFA 4N6NB 3DM8A 1W01A 1B2MA 1YJW3 4AKYA 2KAAA 1FGMA 1RGFA 3FKAA 2XFTA 3CPOA 1TRQA 1WNHA 2K54A 4FMCA 4N6TA 1GD3A 1D6UA 2UX0A 1A2PA 3EN8A 3G16A 1JNQA 1MWTA 3NBBA 3PCRA 2Y74A 3FSDA 4HZBB 3H51A 1ULIB 3B4PA 3LTBA 1IVUA 3MG1A 4HJLB 5AIFA 2Z77A 1OACA 1TRPA 4R9LA 3VSYA 2KF5A 4HZ9B 1B3SA 4EW5A 5D81A 2BMRB 3NV0A 2BT3A 2A15A 2YX9A 1Z1SA 2ML6A 4FR9A 3ZFZA 4BL3A 1O7PB 5M19A 2E2VA 5M18A 4R9KA 1V74A 1BNEA 3NUVA 4XDVA
chains in the Genus database with same CATH topology
3EX9A 2CFLA 2Y73A 4J8TA 2W56A 3LMLA 3PS8A 1R4CA 3N9HA 3NX0A 3FZWA 3UL5A 1IK3A 1QAKA 4FMAA 1F8NA 2W2CA 3N54B 4GL6A 3WOEB 3BB9A 3GZBA 3AMOB 5AEWB 1YJN3 4FCMA 1EA2A 1SQWA 2XF3A 3EC9A 1GY7A 3K0ZA 3HZPA 1Q7Y4 4KFFA 1KWIA 4HBRA 2O3OA 3ER7A 3L0RA 1N9JA 3D9RA 1M9GA 5IG5A 1VQ93 4BTYA 4HM0B 1IT7A 1NWWA 3H3HA 3MYTA 2HMOB 2CWVA 2P05A 3K5TA 1L5GB 4EV5A 3BNEA 3HI7A 1JB5A 3NXJA 3CCR3 3Q2PA 2OTJ3 2OQEA 1JRQA 3U1WA 3UNLA 3B7CA 3GWRA 5IENA 1IT8A 3EQQB 3F8HA 1DVCA 3LH4A 4KZ1A 3CD63 2RSXA 4XM4A 4MJDA 3S27A 4IIAA 1N5HA 2GXFA 5CF1A 3OWYA 3Q90A 4H3UA 1JN5A 2LQVA 1OF5B 2OCTA 4NREA 3HIIA 3V92A 3V99A 3S67A 1OPYA 2CG1A 4CCVA 3KN4A 3FH1A 3OWUA 4XBYA 5CF2A 1CYUA 3NQYA 3IMAB 3LZAA 1DMNA 5D82A 5IW9A 3S28A 3EJVA 4XBXA 1SJWA 1TIJA 2XRXB 1U5OA 3LT8A 2F98A 3ALAA 2RFRA 4MMXB 4XDWA 2GBWB 3B4OA 5DRVA 2W04A 3DZLA 2CFGA 1JN5B 3F7SA 4MMYB 3MG2A 2ZL8A 3EF8A 3IPTA 1Q864 5LC7A 1LXEA 2GBXB 3M8CA 3VGNA 1J2BA 1O7WB 2E2UA 1ROVA 1K734 3X40A 2KRTA 2CFWA 3EBTA 3X42A 4TX4A 3KZTA 3G6E3 3K9MC 4O2HA 4R1KA 4ORLA 3MPHA 3UB1A 1A90A 1ROAA 2R4IA 1AR0A 1OCVA 5IEPA 1UI7A 2GEXA 3QK9A 5G2GA 3KSPA 4G1MB 3G4S3 1FGTA 4Q53A 3EE1A 4HM2B 1PFPA 3I0YA 4HKVB 3BNCA 1NU3A 5ELJA 1QAFA 3WODG 3SVAA 3UL6A 4JF8A 2YFIB 1AVLA 1WMNA 2E2TA 3PCSA 5KP3A 3OXAA 1OHOA 4EC6A 3NM2A 3QRDA 1W7CA 1O7NB 3T8UA 2F86B 1TUHA 1O7MB 2WGOA 3OV4A 3MKIA 1NB3I 2IMJA 5CXOA 2XSOB 4N6UA 2HMLB 3DY5A 3RDEA 3DGOA 3N8BA 4KFDA 3DGLA 3BNDA 2C10A 7STDA 3HK4A 3G713 3KFQC 3MSOA 1U8CB 2CFKA 2KCDA 3PGBA 1E3VA 3CMA3 2BMOB 5HGRA 3S29A 3CC23 4HM8B 3I553 1WTHA 1LOXA 1N5PA 2XEPA 2SBLA 3LOYA 4BTWA 4EBGA 3CNXA 1W6GA 2XFSA 1M1K4 1ZO2A 4BTXA 5JPPA 2HMMB 2I9WA 3KE7A 1IVXA 3WA2X 3CCJ3 1O7GB 3J7Yd 2Z7AA 2W0QA 1MNLA 3CCV3 1VQK3 4RBNA 4LMIA 5IEOA 1W2B2 3NV0B 3FGYA 4RNYA 3EBYA 1W6YA 1RRHA 3F7XA 1C7HA 3NBJA 1VQM3 1DMQA 3G0KA 4PEJA 2BNGA 4J9AA 1FGRA 3GZRA 2GU1A 1NDOB 1K28A 1OHPA 1RN7A 4AKZA 5LC6A 3DXOA 8CHOA 5IG4A 3FG1A 3V98A 1D6ZA 2WOHA 2W56B 2P09A 1A2VA 1JKGA 4CDLA 1JV2B 1M904 3MG3A 3SEDA 1VQL3 1OH0A 1O7HB 1YIT3 1IQYA 1GS3A 2HMKB 5AYSC 2FNQA 1W02A 4OVMA 5AEUB 2P0MA 3GZXB 4X2HA 2OOVC 1KQS2 3S5CA 1OUNA 2XH9A 3FG4A 1QMAA 1AV4A 3LYGA 1IU7A 1AVKA 5IG0A 3X3YA 2QEX3 4U13A 1VQ63 5FW5A 2BMQB 4HVNA 4LGQA 4WWUC 3OW22 3PXMA 5TGNA 3NHXA 1KC84 1JB4A 1WMOA 3FF2A 3GAXA 4IT7A 5KP4A 4I4KA 4FMDA 4X2OA 1Q42A 2MC8A 3SOYA 2W9QA 4QWTA 4H61A 1HU9A 3ECFA 1IDPA 1BUQA 3FCSB 1VQN3 2W03A 3NQZA 2CG0A 3DMCA 3F9SA 3EB8A 3PYJA 4O3VA 3RGAA 2CKFB 3A76A 4FCJA 1YIJ3 2XGLA 4FMBA 2JDIH 4WFOA 1IQXA 2B1XB 1M1XB 2CWUA 4N6V0 3T8NA 5JPUA 3IJEB 2CC3A 1GD4A 2CIUA 1US1A 4N6LA 3HIGA 3EN1B 1S5AA 1ZX2A 3WA3A 2IUJA 3T0UA 1HKXA 3BNBA 5I97A 2CK3H 1W6CA 2B24B 3CCM3 1SIIA 3SLUA 5STDA 1UUWB 1S723 2OTL3 2V1LA 1SIHA 5BXQA 4OUQA 2P38A 3CPW2 3GZYB 2YFJB 2RGQA 2Z76A 4EYCA 1K41A 4RZMA 4O02B 1A67A 1JB2A 2CHCA 3JUNA 1Q40A 4KVHA 4N6MA 3K63A 3UJMA 3JVCA 1N9EA 5IF6A 1DMMA 3BLZA 2Z6BA 3HX8A 4RNZA 4EXRA 1W4NA 4LZIA 3U97A 3KKGA 4L7KA 1UW1A 2CW9A 1ULJB 1GY5A 1RKYA 1IVWA 4HM4B 3FF0A 3JUOA 1GY6A 2Q07A 1G96A 1STFI 1Y4KA 2D42A 2F99A 1IV7A 1Q40B 4WYKA 3Q1CA 1PU4A 4R4KA 3CCS3 1VZZA 1LNHA 5A0OB 3JUMA 2FGTA 3I563 1UI8A 3AMOA 3OX9A 1NO3A 2YFLB 3KIIA 3MWZA 1IQ8A 4HM7B 3EHCA 4XB5A 2JQ5A 5CK6A 3SOAA 4KFEA 1QJGA 1TFOA 1EQKA 4R80A 1STDA 3JUQA 5KP1A 4HM1B 2OOVA 2HMJB 2XSHB 3X3XA 2GU3A 1VQ73 3D3LA 1YVBI 4HM5B 3X41A 4K61A 1FGQA 1ASKA 1VQP3 4K1VA 5AIHA 3MHEA 3O8YA 5D83A 4OK0A 1WMPA 3CCL3 1QALA 2C11A 2RCDA 4WYKB 1N8QA 1FA3A 5CLKA 4LSOA 3DUKA 1Q814 1OF5A 4N6OB 3RGRA 1E3RA 4ZM8A 3DGNA 5FGOA 3KSED 3LTCA 3X3ZA 2KXGA 3CME3 3CCQ3 1YGEA 1TU5A 1RJOA 1WQLB 2BO9B 2QGUA 3F40A 5AI1A 4MEIA 4K90B 4NHFA 1CEWI 5AYRB 1T5YA 1KD14 1FGOA 1VQ53 1JKGB 4L8PA 4WP5A 3STDA 4HM3B 1K8A4 1ISKA 3WMDA 1CQSA 3CU3A 1GYBA 5ELUA 1MOLA 4LEHA 2INXA 2IA7A 4WHAA 1IV9A 3E99A 6STDA 3LXUX 3PZWA 3VF1A 2QA43 1VQO3 1NB5I 4JRFA 1DVDA 4HM6B 4XBTA 3NBRA 1OHSA 2OQEC 1FUWA 3NM7A 3F14A 3JUPA 1Q824 1OGXA 2M7OA 2XR8B 1W00A 2ML5A 2LYXA 4STDA 2CH9A 1KSIA 2WO0A 1CYVA 5IG3A 1YHQ3 3DGMA 2D1WA 3CXC2 2K0MA 2W9PA 2BHMA 1EG9B 3SX1A 3ROBA 3CCU3 4MMZB 1DYUA 2ZDJA 2HMNB 2P0XA 3K7CA 1QVF2 4O8SA 1RRLA 1YI23 5EQLA 2CWTA 2STDA 2PNCA 3TDGA 1OGZA 2W6JH 1VQ43 1VQ83 1NJI4 3LTAA 1LVNA 1YJ93 3LTDA 2OWPA 3FLJA 3CC73 4HYZA 1JJ22 1UUVB 1IVVA 4FCZA 3WOFB 5JBSA 1QVG2 4K1UA 3CC43 3F8XA 3CNMA 1EKMA 1W5ZA 5AIIA 4IPBA 5AIGA 1A2KA 1D6YA 3OWSA 1N8R4 3B8LA 2FXTA 2CFDA 3FG3A 1K9M4 3SXXA 3G8ZA 2GEYA 1TFKA 1W2ZA 2IUKA 5EEOA 3LT9A 1SPUA 2L4VA 3WDGB 3CCE3 4N3VA 5DREA 2O9UX 5IERA 1TP6A 4EV2A 4L8OA 2XGNA 4GB5A 2MF7A 2QIYA 2WGQA 5BVBA 5EVHA 2PZVA 3GRDA 1E97A 4AEQA 2WOFA 4N6NB 3DM8A 1W01A 1YJW3 4AKYA 1FGMA 3FKAA 2XFTA 3CPOA 1WNHA 2K54A 4FMCA 4N6TA 1GD3A 1D6UA 2UX0A 3EN8A 3G16A 3NBBA 1JNQA 3PCRA 2Y74A 3FSDA 4HZBB 3H51A 1ULIB 3B4PA 3LTBA 1IVUA 3MG1A 4HJLB 5AIFA 2Z77A 1OACA 4R9LA 3VSYA 4HZ9B 5D81A 2BMRB 3NV0A 2BT3A 2A15A 2YX9A 1Z1SA 2ML6A 4FR9A 1O7PB 2E2VA 4R9KA 1V74A 3NUVA 4XDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EX9 A;  4J8T A;  3FZW A;  2W2C A;  3BB9 A;  3GZB A;  5AEW B;  4FCM A;  1EA2 A;  3EC9 A;  1GY7 A;  3K0Z A;  3HZP A;  3ER7 A;  5IG5 A;  3D9R A;  4HM0 B;  1NWW A;  3H3H A;  3MYT A;  2HMO B;  1JB5 A;  3NXJ A;  3UNL A;  3B7C A;  3GWR A;  5IEN A;  3EQQ B;  3F8H A;  4XM4 A;  4MJD A;  4IIA A;  2GXF A;  5CF1 A;  3OWY A;  3Q90 A;  4H3U A;  1JN5 A;  1OF5 B;  1OPY A;  3FH1 A;  3OWU A;  4XBY A;  5CF2 A;  3LZA A;  1DMN A;  5D82 A;  3EJV A;  4XBX A;  1SJW A;  2XRX B;  1U5O A;  2F98 A;  2RFR A;  4XDW A;  2GBW B;  3B4O A;  5DRV A;  3DZL A;  3F7S A;  1JN5 B;  3MG2 A;  3IPT A;  3EF8 A;  2GBX B;  3M8C A;  3VGN A;  1O7W B;  3EBT A;  3KZT A;  4R1K A;  4ORL A;  2R4I A;  1AR0 A;  1OCV A;  5IEP A;  2GEX A;  5G2G A;  3KSP A;  4Q53 A;  4HM2 B;  3I0Y A;  4HKV B;  1NU3 A;  2YFI B;  5KP3 A;  3OXA A;  1OHO A;  3NM2 A;  1O7N B;  3T8U A;  2F86 B;  1TUH A;  1O7M B;  3OV4 A;  3MKI A;  5CXO A;  2IMJ A;  2XSO B;  2HML B;  7STD A;  3HK4 A;  3MSO A;  1E3V A;  2BMO B;  5HGR A;  4HM8 B;  3CNX A;  1ZO2 A;  5JPP A;  2HMM B;  2I9W A;  3KE7 A;  1O7G B;  2Z7A A;  4LMI A;  5IEO A;  3NV0 B;  3FGY A;  3EBY A;  1W6Y A;  3F7X A;  1C7H A;  1DMQ A;  3G0K A;  4PEJ A;  2BNG A;  4J9A A;  3GZR A;  1NDO B;  1OHP A;  8CHO A;  3DXO A;  5IG4 A;  1JKG A;  4CDL A;  3MG3 A;  3SED A;  1OH0 A;  1O7H B;  1GS3 A;  2HMK B;  1W02 A;  4OVM A;  5AEU B;  4X2H A;  3GZX B;  3S5C A;  1OUN A;  1QMA A;  3LYG A;  5IG0 A;  4U13 A;  5FW5 A;  2BMQ B;  4HVN A;  4LGQ A;  4WWU C;  5TGN A;  3NHX A;  1JB4 A;  3FF2 A;  5KP4 A;  4I4K A;  4X2O A;  1Q42 A;  3SOY A;  3ECF A;  1IDP A;  1BUQ A;  3DMC A;  3F9S A;  3RGA A;  2CKF B;  3A76 A;  4FCJ A;  2B1X B;  3T8N A;  5JPU A;  3EN1 B;  1S5A A;  1ZX2 A;  1HKX A;  2B24 B;  5STD A;  1UUW B;  5BXQ A;  4OUQ A;  3GZY B;  2YFJ B;  2RGQ A;  2Z76 A;  1K41 A;  4RZM A;  1JB2 A;  2CHC A;  3JUN A;  1Q40 A;  4KVH A;  3UJM A;  5IF6 A;  1DMM A;  3BLZ A;  3HX8 A;  3KKG A;  4L7K A;  1ULJ B;  1GY5 A;  4HM4 B;  3FF0 A;  3JUO A;  1GY6 A;  2F99 A;  1Q40 B;  4WYK A;  1VZZ A;  3JUM A;  3OX9 A;  2YFL B;  4XB5 A;  4HM7 B;  3EHC A;  2JQ5 A;  5CK6 A;  3SOA A;  1QJG A;  1STD A;  3JUQ A;  5KP1 A;  4HM1 B;  2HMJ B;  2XSH B;  4HM5 B;  1ASK A;  4K1V A;  5AIH A;  3MHE A;  5D83 A;  2RCD A;  4WYK B;  5CLK A;  3DUK A;  1OF5 A;  3RGR A;  1E3R A;  1WQL B;  2QGU A;  3F40 A;  5AI1 A;  1JKG B;  4L8P A;  4WP5 A;  3STD A;  4HM3 B;  1ISK A;  3WMD A;  1CQS A;  3CU3 A;  1GYB A;  4LEH A;  2INX A;  3E99 A;  6STD A;  4HM6 B;  4XBT A;  3NBR A;  1OHS A;  3F14 A;  3JUP A;  1OGX A;  2XR8 B;  1W00 A;  4STD A;  5IG3 A;  1EG9 B;  3ROB A;  2HMN B;  3K7C A;  2STD A;  1OGZ A;  2OWP A;  3FLJ A;  1UUV B;  4K1U A;  3F8X A;  3CNM A;  5AII A;  5AIG A;  1A2K A;  3OWS A;  3B8L A;  3G8Z A;  2GEY A;  4N3V A;  5DRE A;  5IER A;  1TP6 A;  4L8O A;  4GB5 A;  2QIY A;  5BVB A;  5EVH A;  2PZV A;  3GRD A;  1E97 A;  3DM8 A;  1W01 A;  3FKA A;  3CPO A;  2K54 A;  2UX0 A;  3EN8 A;  3G16 A;  3FSD A;  4HZB B;  3H51 A;  1ULI B;  3B4P A;  3MG1 A;  4HJL B;  5AIF A;  2Z77 A;  3VSY A;  4R9L A;  4HZ9 B;  5D81 A;  2BMR B;  3NV0 A;  2A15 A;  1Z1S A;  1O7P B;  4R9K A;  3NUV A;  4XDV A; 
#chains in the Genus database with same CATH topology
 3EX9 A;  2CFL A;  2K3D A;  2Y73 A;  4J8T A;  2W56 A;  3LML A;  3PS8 A;  1R4C A;  3N9H A;  3NX0 A;  3FZW A;  3UL5 A;  1IK3 A;  1QAK A;  4FMA A;  2ZA4 A;  1F8N A;  2W2C A;  3N54 B;  4GL6 A;  1BNI A;  1BRS A;  3WOE B;  3BB9 A;  1I2E A;  3GZB A;  3AMO B;  5AEW B;  1YJN 3;  4FCM A;  1EA2 A;  1SQW A;  2XF3 A;  3EC9 A;  3CC4 3;  1GY7 A;  3K0Z A;  3HZP A;  1Q7Y 4;  4KFF A;  1KWI A;  4HBR A;  2O3O A;  3WHO A;  1G02 A;  3ER7 A;  1B2S A;  3L0R A;  1N9J A;  3D9R A;  1M9G A;  5IG5 A;  1VQ9 3;  4BTY A;  4HM0 B;  1IT7 A;  1NWW A;  1X1X A;  3H3H A;  2HMO B;  3MYT A;  2CWV A;  1BAN A;  1LNI A;  2P05 A;  3K5T A;  1L5G B;  4EV5 A;  3BNE A;  1RHL A;  3HI7 A;  1JB5 A;  3D5G A;  3NXJ A;  3Q2P A;  3CCR 3;  2OQE A;  2OTJ 3;  1JRQ A;  3U1W A;  3UNL A;  2H0I A;  3B7C A;  3GWR A;  5IEN A;  1RGE A;  1IT8 A;  3EQQ B;  3F8H A;  1DVC A;  3LH4 A;  4KZ1 A;  3CD6 3;  1RNT A;  2RSX A;  4XM4 A;  4MJD A;  3S27 A;  1B27 A;  4I5Q A;  4IIA A;  1N5H A;  2GXF A;  2R41 A;  5CF1 A;  1B2X A;  2F5M A;  3OWY A;  3AGN A;  3Q90 A;  1RNB A;  1R4Y A;  4H3U A;  1JN5 A;  2LQV A;  1OF5 B;  1I0X A;  2OCT A;  4NRE A;  1UCK A;  3HII A;  3V92 A;  3V99 A;  3BIR A;  1BNR A;  3S67 A;  1OPY A;  2CG1 A;  4CCV A;  3KN4 A;  3FH1 A;  3OWU A;  4XBY A;  5CF2 A;  1RN4 A;  1CYU A;  1BRH A;  5GSP A;  3NQY A;  1X1W A;  3IMA B;  1FUS A;  3LZA A;  1DMN A;  5D82 A;  5IW9 A;  3S28 A;  3EJV A;  4XBX A;  1SJW A;  5HOH A;  1BRK A;  1TIJ A;  2XRX B;  1U5O A;  3LT8 A;  1BSC A;  2F98 A;  3ALA A;  1MWS A;  1GOV A;  2RFR A;  4MMX B;  1I2F A;  1ZS7 A;  1YVS A;  4XDW A;  2BU4 A;  2GBW B;  3B4O A;  5DRV A;  2W04 A;  3DGY A;  1X1U A;  3DZL A;  2CFG A;  1JN5 B;  3F7S A;  1BSB A;  4MMY B;  3MG2 A;  2ZL8 A;  2BIR A;  3EF8 A;  3IPT A;  5LC7 A;  1LXE A;  2GBX B;  3M8C A;  1Q86 4;  3VGN A;  1RCL A;  3AHW A;  1LOW A;  1MGW A;  1J2B A;  1O7W B;  2E2U A;  1ROV A;  1K73 4;  1T2H A;  3X40 A;  2KRT A;  2CFW A;  1DET A;  2RNT A;  3EBT A;  3X42 A;  4TX4 A;  3KZT A;  3G6E 3;  3SYU A;  3K9M C;  1FW7 A;  4O2H A;  4R1K A;  4ORL A;  3MPH A;  3UB1 A;  1RN1 A;  1ROA A;  2R4I A;  1AR0 A;  1JZO A;  1LQM B;  1JBS A;  1A90 A;  1OCV A;  1UUG B;  1UI7 A;  1LOY A;  2GEX A;  2J8X B;  5IEP A;  3QK9 A;  5G2G A;  3KSP A;  4G1M B;  3G4S 3;  3ZG0 A;  1FGT A;  4Q53 A;  3EE1 A;  4HM2 B;  1PFP A;  2IY2 A;  3I0Y A;  4HKV B;  3BNC A;  1NU3 A;  5ELJ A;  1QAF A;  3WOD G;  3SVA A;  3UL6 A;  4JF8 A;  2YFI B;  1AVL A;  2KF6 A;  1WMN A;  2E2T A;  3PCS A;  1UCL A;  5KP3 A;  3OXA A;  1OHO A;  1SAR A;  4EC6 A;  3NM2 A;  3QRD A;  1W7C A;  1O7N B;  3T8U A;  2F86 B;  1JZD A;  1O7M B;  1TUH A;  2WGO A;  3OV4 A;  1UGI A;  3MKI A;  1NB3 I;  1B2U A;  1I3I A;  1BU4 A;  2IMJ A;  2XSO B;  1I3F A;  5CXO A;  4N6U A;  2HML B;  1RGK A;  4BU4 A;  3DY5 A;  3RDE A;  3DGO A;  2UUG C;  2KF3 A;  3N8B A;  1Q7H A;  4KFD A;  1GSP A;  1DE3 A;  3DGL A;  3BND A;  2AAE A;  2C10 A;  3HK4 A;  7STD A;  3G71 3;  3KFQ C;  3MSO A;  1U8C B;  2CFK A;  2KCD A;  1RCK A;  1E3V A;  1RLS A;  3PGB A;  4ILF A;  4CJN A;  2H0H A;  3CMA 3;  2BMO B;  5HGR A;  3S29 A;  3CC2 3;  4HM8 B;  3I55 3;  1BUJ A;  1WTH A;  1LOX A;  1CH0 A;  1N5P A;  2XEP A;  2SBL A;  3LOY A;  4BTW A;  4EBG A;  5BIR A;  3CNX A;  6GSP A;  1RGL A;  1W6G A;  2XFS A;  1M1K 4;  1ZO2 A;  1BNJ A;  4BTX A;  5JPP A;  1C54 A;  2HMM B;  4GHO A;  2I9W A;  1BNF A;  3KE7 A;  1IVX A;  3WA2 X;  3CCJ 3;  1O7G B;  3J7Y d;  4KT3 B;  2Z7A A;  2W0Q A;  1MNL A;  3CCV 3;  1VQK 3;  4RBN A;  3AGO A;  4LMI A;  1IYY A;  5IEO A;  1W2B 2;  1VQ7 3;  3NV0 B;  3FGY A;  1ZGX A;  4RNY A;  3EBY A;  1W6Y A;  1RRH A;  3F7X A;  3D79 A;  1C7H A;  3NBJ A;  1VQM 3;  1DMQ A;  3G0K A;  4PEJ A;  2BNG A;  3A5E A;  4J9A A;  1AQZ A;  1LOV A;  1FGR A;  3GZR A;  2GU1 A;  1NDO B;  1K28 A;  1OHP A;  1RN7 A;  4AKZ A;  5LC6 A;  3DXO A;  8CHO A;  5IG4 A;  3FG1 A;  3V98 A;  1D6Z A;  2WOH A;  2W56 B;  2P09 A;  1A2V A;  1JKG A;  4CDL A;  1JV2 B;  1M90 4;  3MG3 A;  3SED A;  1VQL 3;  1OH0 A;  1HZ1 A;  1O7H B;  1YIT 3;  1IQY A;  1GS3 A;  2HMK B;  5AYS C;  2FNQ A;  1W02 A;  1UCJ A;  2GSP A;  1GMQ A;  4OVM A;  2P0M A;  3GZX B;  4X2H A;  5AEU B;  2OOV C;  1KQS 2;  3S5C A;  1OUN A;  2XH9 A;  3FG4 A;  4RNT A;  1QMA A;  1AV4 A;  3LYG A;  1IU7 A;  1AVK A;  5IG0 A;  3X3Y A;  1TJD A;  2QEX 3;  4U13 A;  1RTU A;  1VQ6 3;  5FW5 A;  2BMQ B;  1YGW A;  4HVN A;  4LGQ A;  4WWU C;  3OW2 2;  3PXM A;  1MGR A;  5TGN A;  3NHX A;  1KC8 4;  1JB4 A;  1WMO A;  3FF2 A;  3GAX A;  4IT7 A;  5KP4 A;  1I70 A;  4I4K A;  4FMD A;  4X2O A;  4NPB A;  1Q42 A;  2MC8 A;  3SOY A;  1UDI I;  2W9Q A;  4QWT A;  4H61 A;  1HU9 A;  3ECF A;  1IDP A;  1BUQ A;  3FCS B;  1VQN 3;  2W03 A;  3NQZ A;  2CG0 A;  3DMC A;  3F9S A;  3HOH A;  3EB8 A;  3PYJ A;  4O3V A;  3RGA A;  2CKF B;  3A76 A;  4FCJ A;  9RNT A;  2XGL A;  1YIJ 3;  4FMB A;  2H0G A;  2JDI H;  4WFO A;  1EUI C;  1LRA A;  1IQX A;  1PYL A;  2B1X B;  3ZG5 A;  1M1X B;  2CWU A;  3D5I A;  4N6V 0;  3T8N A;  5BU4 A;  5JPU A;  3IJE B;  2CC3 A;  1GD4 A;  2CIU A;  1US1 A;  4N6L A;  3HIG A;  3EN1 B;  1S5A A;  1VQQ A;  1ZX2 A;  3WA3 A;  1GMP A;  2IUJ A;  1B20 A;  3T0U A;  1HKX A;  4CPK A;  3BNB A;  5I97 A;  3KCH A;  2CK3 H;  1W6C A;  2B24 B;  4DKI A;  3CCM 3;  1SII A;  3SLU A;  2C4B A;  5STD A;  1UUW B;  1LQG C;  1GMR A;  1S72 3;  2OTL 3;  2V1L A;  8RNT A;  1SIH A;  5BXQ A;  4OUQ A;  2P38 A;  3CPW 2;  1JBT A;  3GZY B;  2YFJ B;  2RGQ A;  2Z76 A;  1BSD A;  1K41 A;  4EYC A;  4RZM A;  4O02 B;  1A67 A;  1JB2 A;  2CHC A;  4HAA A;  3JUN A;  1Q40 A;  4KVH A;  4N6M A;  3K63 A;  3UJM A;  3JVC A;  5RNT A;  1N9E A;  1GOU A;  1DMM A;  3BLZ A;  2Z6B A;  3HX8 A;  4RNZ A;  5IF6 A;  1BGS A;  4EXR A;  2CX1 A;  1W4N A;  4LZI A;  3U97 A;  3KKG A;  4L7K A;  1UW1 A;  5M1A A;  3WR2 A;  1TTO A;  2CW9 A;  1ULJ B;  1GY5 A;  1V57 A;  1RKY A;  1IVW A;  4HM4 B;  3FF0 A;  1B21 A;  1UGH I;  3JUO A;  1JBR A;  1RDS A;  1GY6 A;  1G0T A;  2Q07 A;  1G96 A;  1STF I;  1Y4K A;  2D42 A;  2F99 A;  1IV7 A;  1Q40 B;  4WYK A;  3Q1C A;  1PU4 A;  4R4K A;  3CCS 3;  1VZZ A;  1LNH A;  5A0O B;  3JUM A;  2FGT A;  3I56 3;  1UI8 A;  3AMO A;  3OX9 A;  1RGA A;  1NO3 A;  2YFL B;  3KII A;  3MWZ A;  1IQ8 A;  4HM7 B;  3EHC A;  4XB5 A;  2JQ5 A;  5CK6 A;  2F5W A;  3SOA A;  4KFE A;  1QJG A;  1TFO A;  2UGI A;  1EQK A;  4R80 A;  1BRN L;  1STD A;  3JUQ A;  2ZHX B;  4HM1 B;  2OOV A;  5KP1 A;  2HMJ B;  1Q9E A;  7GSP A;  4BL2 A;  1HYF A;  2XSH B;  3X3X A;  2GU3 A;  6RNT A;  3D3L A;  1YVB I;  4HM5 B;  1BNG A;  2KF4 A;  1FGQ A;  1ASK A;  4K61 A;  4K1V A;  3X41 A;  5AIH A;  1VQP 3;  3MHE A;  3O8Y A;  5D83 A;  4OK0 A;  1WMP A;  3CCL 3;  1QAL A;  2L1S A;  2C11 A;  2RCD A;  4WYK B;  1N8Q A;  1FA3 A;  1BIR A;  1RMS A;  1BSE A;  5CLK A;  2IYJ A;  4LSO A;  3DUK A;  1Q81 4;  1OF5 A;  4LYL B;  1MWR A;  1FUT A;  4N6O B;  3RGR A;  1E3R A;  4ZM8 A;  3DGN A;  5FGO A;  3KSE D;  3LTC A;  3X3Z A;  2KXG A;  3CME 3;  3CCQ 3;  3D4A A;  1YGE A;  1TU5 A;  1RJO A;  1WQL B;  1RGH A;  4HOH A;  1T3B A;  2BO9 B;  2QGU A;  3F40 A;  5AI1 A;  4MEI A;  4K90 B;  4NHF A;  1CEW I;  5AYR B;  1T5Y A;  1KD1 4;  1FGO A;  1VQ5 3;  4J5K A;  1RGG A;  1JKG B;  4L8P A;  4WP5 A;  3STD A;  4HM3 B;  1K8A 4;  1ISK A;  3WMD A;  1CQS A;  3CU3 A;  1GYB A;  5ELU A;  1MOL A;  4LEH A;  2INX A;  2IA7 A;  4WHA A;  1IV9 A;  1FYS A;  3E99 A;  6STD A;  3LXU X;  3PZW A;  3VF1 A;  2QA4 3;  1VQO 3;  1NB5 I;  5G1L A;  4JRF A;  2F56 A;  1DVD A;  4HM6 B;  4XBT A;  1T2I A;  1BVI A;  1EEJ A;  1OHS A;  1RSN A;  1UCI A;  2OQE C;  2AAD A;  3NBR A;  3Q3F A;  1FUW A;  3NM7 A;  4J5G A;  3F14 A;  3JUP A;  1Q82 4;  1OGX A;  2M7O A;  2XR8 B;  1W00 A;  2ML5 A;  2LYX A;  4STD A;  2SAR A;  2CH9 A;  1KSI A;  2WO0 A;  1CYV A;  5IG3 A;  1YHQ 3;  7RNT A;  3DGM A;  4BIR A;  1BRG A;  2D1W A;  3CXC 2;  2K0M A;  2F4Y A;  2W9P A;  2BHM A;  1EG9 B;  3SX1 A;  1FZU A;  3ROB A;  4MMZ B;  3CCU 3;  3RNT A;  1DYU A;  2ZDJ A;  2HMN B;  2P0X A;  1X1Y A;  3AHS A;  1YNV X;  3K7C A;  1QVF 2;  4O8S A;  1RRL A;  4GSP A;  1YI2 3;  5EQL A;  2CWT A;  2STD A;  3DH2 A;  2CX0 A;  2PNC A;  3TDG A;  1OGZ A;  1GOY A;  2W6J H;  1VQ4 3;  1VQ8 3;  1NJI 4;  3LTA A;  1LVN A;  1YJ9 3;  3LTD A;  2OWP A;  3FLJ A;  3CC7 3;  4HYZ A;  3URP A;  1JJ2 2;  1UUV B;  1PY3 A;  1IVV A;  2HOH A;  4FCZ A;  5G1K A;  3WOF B;  1B2Z A;  4K1U A;  5JBS A;  3F8X A;  1QVG 2;  1BOX A;  3CNM A;  1W5Z A;  1BRI A;  1EKM A;  5AII A;  4IPB A;  5AIG A;  1BSA A;  3BU4 A;  1A2K A;  1D6Y A;  3OWS A;  1N8R 4;  3B8L A;  2FXT A;  2CFD A;  3FG3 A;  1K9M 4;  1MWU A;  3G8Z A;  3SXX A;  2GEY A;  1TFK A;  1W2Z A;  1RGC A;  2IUK A;  1BAO A;  1NNV A;  1I0V A;  1I2G A;  3GSP A;  3LT9 A;  1AY7 A;  1SPU A;  2L4V A;  5EEO A;  3WDG B;  3CCE 3;  4N3V A;  5DRE A;  1BRJ A;  2O9U X;  5IER A;  2RBI A;  1TP6 A;  4EV2 A;  4L8O A;  2XGN A;  4GB5 A;  2MF7 A;  1V58 A;  2QIY A;  2WGQ A;  5BVB A;  1BNS A;  2PZV A;  3GRD A;  5EVH A;  1E97 A;  4AEQ A;  1I8V A;  2WOF A;  4N6N B;  3DM8 A;  1W01 A;  1B2M A;  1YJW 3;  4AKY A;  2KAA A;  1FGM A;  1RGF A;  3FKA A;  2XFT A;  3CPO A;  1TRQ A;  1WNH A;  2K54 A;  4FMC A;  4N6T A;  1GD3 A;  1D6U A;  2UX0 A;  1A2P A;  3EN8 A;  3G16 A;  1JNQ A;  1MWT A;  3NBB A;  3PCR A;  2Y74 A;  3FSD A;  4HZB B;  3H51 A;  1ULI B;  3B4P A;  3LTB A;  1IVU A;  3MG1 A;  4HJL B;  5AIF A;  2Z77 A;  1OAC A;  1TRP A;  4R9L A;  3VSY A;  2KF5 A;  4HZ9 B;  1B3S A;  4EW5 A;  5D81 A;  2BMR B;  3NV0 A;  2BT3 A;  2A15 A;  2YX9 A;  1Z1S A;  2ML6 A;  4FR9 A;  3ZFZ A;  4BL3 A;  1O7P B;  5M19 A;  2E2V A;  5M18 A;  4R9K A;  1V74 A;  1BNE A;  3NUV A;  4XDV A; 
#chains in the Genus database with same CATH homology
 3EX9 A;  2CFL A;  2Y73 A;  4J8T A;  2W56 A;  3LML A;  3PS8 A;  1R4C A;  3N9H A;  3NX0 A;  3FZW A;  3UL5 A;  1IK3 A;  1QAK A;  4FMA A;  1F8N A;  2W2C A;  3N54 B;  4GL6 A;  3WOE B;  3BB9 A;  3GZB A;  3AMO B;  5AEW B;  1YJN 3;  4FCM A;  1EA2 A;  1SQW A;  2XF3 A;  3EC9 A;  1GY7 A;  3K0Z A;  3HZP A;  1Q7Y 4;  4KFF A;  1KWI A;  4HBR A;  2O3O A;  3ER7 A;  3L0R A;  1N9J A;  3D9R A;  1M9G A;  5IG5 A;  1VQ9 3;  4BTY A;  4HM0 B;  1IT7 A;  1NWW A;  3H3H A;  3MYT A;  2HMO B;  2CWV A;  2P05 A;  3K5T A;  1L5G B;  4EV5 A;  3BNE A;  3HI7 A;  1JB5 A;  3NXJ A;  3CCR 3;  3Q2P A;  2OTJ 3;  2OQE A;  1JRQ A;  3U1W A;  3UNL A;  3B7C A;  3GWR A;  5IEN A;  1IT8 A;  3EQQ B;  3F8H A;  1DVC A;  3LH4 A;  4KZ1 A;  3CD6 3;  2RSX A;  4XM4 A;  4MJD A;  3S27 A;  4IIA A;  1N5H A;  2GXF A;  5CF1 A;  3OWY A;  3Q90 A;  4H3U A;  1JN5 A;  2LQV A;  1OF5 B;  2OCT A;  4NRE A;  3HII A;  3V92 A;  3V99 A;  3S67 A;  1OPY A;  2CG1 A;  4CCV A;  3KN4 A;  3FH1 A;  3OWU A;  4XBY A;  5CF2 A;  1CYU A;  3NQY A;  3IMA B;  3LZA A;  1DMN A;  5D82 A;  5IW9 A;  3S28 A;  3EJV A;  4XBX A;  1SJW A;  1TIJ A;  2XRX B;  1U5O A;  3LT8 A;  2F98 A;  3ALA A;  2RFR A;  4MMX B;  4XDW A;  2GBW B;  3B4O A;  5DRV A;  2W04 A;  3DZL A;  2CFG A;  1JN5 B;  3F7S A;  4MMY B;  3MG2 A;  2ZL8 A;  3EF8 A;  3IPT A;  1Q86 4;  5LC7 A;  1LXE A;  2GBX B;  3M8C A;  3VGN A;  1J2B A;  1O7W B;  2E2U A;  1ROV A;  1K73 4;  3X40 A;  2KRT A;  2CFW A;  3EBT A;  3X42 A;  4TX4 A;  3KZT A;  3G6E 3;  3K9M C;  4O2H A;  4R1K A;  4ORL A;  3MPH A;  3UB1 A;  1A90 A;  1ROA A;  2R4I A;  1AR0 A;  1OCV A;  5IEP A;  1UI7 A;  2GEX A;  3QK9 A;  5G2G A;  3KSP A;  4G1M B;  3G4S 3;  1FGT A;  4Q53 A;  3EE1 A;  4HM2 B;  1PFP A;  3I0Y A;  4HKV B;  3BNC A;  1NU3 A;  5ELJ A;  1QAF A;  3WOD G;  3SVA A;  3UL6 A;  4JF8 A;  2YFI B;  1AVL A;  1WMN A;  2E2T A;  3PCS A;  5KP3 A;  3OXA A;  1OHO A;  4EC6 A;  3NM2 A;  3QRD A;  1W7C A;  1O7N B;  3T8U A;  2F86 B;  1TUH A;  1O7M B;  2WGO A;  3OV4 A;  3MKI A;  1NB3 I;  2IMJ A;  5CXO A;  2XSO B;  4N6U A;  2HML B;  3DY5 A;  3RDE A;  3DGO A;  3N8B A;  4KFD A;  3DGL A;  3BND A;  2C10 A;  7STD A;  3HK4 A;  3G71 3;  3KFQ C;  3MSO A;  1U8C B;  2CFK A;  2KCD A;  3PGB A;  1E3V A;  3CMA 3;  2BMO B;  5HGR A;  3S29 A;  3CC2 3;  4HM8 B;  3I55 3;  1WTH A;  1LOX A;  1N5P A;  2XEP A;  2SBL A;  3LOY A;  4BTW A;  4EBG A;  3CNX A;  1W6G A;  2XFS A;  1M1K 4;  1ZO2 A;  4BTX A;  5JPP A;  2HMM B;  2I9W A;  3KE7 A;  1IVX A;  3WA2 X;  3CCJ 3;  1O7G B;  3J7Y d;  2Z7A A;  2W0Q A;  1MNL A;  3CCV 3;  1VQK 3;  4RBN A;  4LMI A;  5IEO A;  1W2B 2;  3NV0 B;  3FGY A;  4RNY A;  3EBY A;  1W6Y A;  1RRH A;  3F7X A;  1C7H A;  3NBJ A;  1VQM 3;  1DMQ A;  3G0K A;  4PEJ A;  2BNG A;  4J9A A;  1FGR A;  3GZR A;  2GU1 A;  1NDO B;  1K28 A;  1OHP A;  1RN7 A;  4AKZ A;  5LC6 A;  3DXO A;  8CHO A;  5IG4 A;  3FG1 A;  3V98 A;  1D6Z A;  2WOH A;  2W56 B;  2P09 A;  1A2V A;  1JKG A;  4CDL A;  1JV2 B;  1M90 4;  3MG3 A;  3SED A;  1VQL 3;  1OH0 A;  1O7H B;  1YIT 3;  1IQY A;  1GS3 A;  2HMK B;  5AYS C;  2FNQ A;  1W02 A;  4OVM A;  5AEU B;  2P0M A;  3GZX B;  4X2H A;  2OOV C;  1KQS 2;  3S5C A;  1OUN A;  2XH9 A;  3FG4 A;  1QMA A;  1AV4 A;  3LYG A;  1IU7 A;  1AVK A;  5IG0 A;  3X3Y A;  2QEX 3;  4U13 A;  1VQ6 3;  5FW5 A;  2BMQ B;  4HVN A;  4LGQ A;  4WWU C;  3OW2 2;  3PXM A;  5TGN A;  3NHX A;  1KC8 4;  1JB4 A;  1WMO A;  3FF2 A;  3GAX A;  4IT7 A;  5KP4 A;  4I4K A;  4FMD A;  4X2O A;  1Q42 A;  2MC8 A;  3SOY A;  2W9Q A;  4QWT A;  4H61 A;  1HU9 A;  3ECF A;  1IDP A;  1BUQ A;  3FCS B;  1VQN 3;  2W03 A;  3NQZ A;  2CG0 A;  3DMC A;  3F9S A;  3EB8 A;  3PYJ A;  4O3V A;  3RGA A;  2CKF B;  3A76 A;  4FCJ A;  1YIJ 3;  2XGL A;  4FMB A;  2JDI H;  4WFO A;  1IQX A;  2B1X B;  1M1X B;  2CWU A;  4N6V 0;  3T8N A;  5JPU A;  3IJE B;  2CC3 A;  1GD4 A;  2CIU A;  1US1 A;  4N6L A;  3HIG A;  3EN1 B;  1S5A A;  1ZX2 A;  3WA3 A;  2IUJ A;  3T0U A;  1HKX A;  3BNB A;  5I97 A;  2CK3 H;  1W6C A;  2B24 B;  3CCM 3;  1SII A;  3SLU A;  5STD A;  1UUW B;  1S72 3;  2OTL 3;  2V1L A;  1SIH A;  5BXQ A;  4OUQ A;  2P38 A;  3CPW 2;  3GZY B;  2YFJ B;  2RGQ A;  2Z76 A;  4EYC A;  1K41 A;  4RZM A;  4O02 B;  1A67 A;  1JB2 A;  2CHC A;  3JUN A;  1Q40 A;  4KVH A;  4N6M A;  3K63 A;  3UJM A;  3JVC A;  1N9E A;  5IF6 A;  1DMM A;  3BLZ A;  2Z6B A;  3HX8 A;  4RNZ A;  4EXR A;  1W4N A;  4LZI A;  3U97 A;  3KKG A;  4L7K A;  1UW1 A;  2CW9 A;  1ULJ B;  1GY5 A;  1RKY A;  1IVW A;  4HM4 B;  3FF0 A;  3JUO A;  1GY6 A;  2Q07 A;  1G96 A;  1STF I;  1Y4K A;  2D42 A;  2F99 A;  1IV7 A;  1Q40 B;  4WYK A;  3Q1C A;  1PU4 A;  4R4K A;  3CCS 3;  1VZZ A;  1LNH A;  5A0O B;  3JUM A;  2FGT A;  3I56 3;  1UI8 A;  3AMO A;  3OX9 A;  1NO3 A;  2YFL B;  3KII A;  3MWZ A;  1IQ8 A;  4HM7 B;  3EHC A;  4XB5 A;  2JQ5 A;  5CK6 A;  3SOA A;  4KFE A;  1QJG A;  1TFO A;  1EQK A;  4R80 A;  1STD A;  3JUQ A;  5KP1 A;  4HM1 B;  2OOV A;  2HMJ B;  2XSH B;  3X3X A;  2GU3 A;  1VQ7 3;  3D3L A;  1YVB I;  4HM5 B;  3X41 A;  4K61 A;  1FGQ A;  1ASK A;  1VQP 3;  4K1V A;  5AIH A;  3MHE A;  3O8Y A;  5D83 A;  4OK0 A;  1WMP A;  3CCL 3;  1QAL A;  2C11 A;  2RCD A;  4WYK B;  1N8Q A;  1FA3 A;  5CLK A;  4LSO A;  3DUK A;  1Q81 4;  1OF5 A;  4N6O B;  3RGR A;  1E3R A;  4ZM8 A;  3DGN A;  5FGO A;  3KSE D;  3LTC A;  3X3Z A;  2KXG A;  3CME 3;  3CCQ 3;  1YGE A;  1TU5 A;  1RJO A;  1WQL B;  2BO9 B;  2QGU A;  3F40 A;  5AI1 A;  4MEI A;  4K90 B;  4NHF A;  1CEW I;  5AYR B;  1T5Y A;  1KD1 4;  1FGO A;  1VQ5 3;  1JKG B;  4L8P A;  4WP5 A;  3STD A;  4HM3 B;  1K8A 4;  1ISK A;  3WMD A;  1CQS A;  3CU3 A;  1GYB A;  5ELU A;  1MOL A;  4LEH A;  2INX A;  2IA7 A;  4WHA A;  1IV9 A;  3E99 A;  6STD A;  3LXU X;  3PZW A;  3VF1 A;  2QA4 3;  1VQO 3;  1NB5 I;  4JRF A;  1DVD A;  4HM6 B;  4XBT A;  3NBR A;  1OHS A;  2OQE C;  1FUW A;  3NM7 A;  3F14 A;  3JUP A;  1Q82 4;  1OGX A;  2M7O A;  2XR8 B;  1W00 A;  2ML5 A;  2LYX A;  4STD A;  2CH9 A;  1KSI A;  2WO0 A;  1CYV A;  5IG3 A;  1YHQ 3;  3DGM A;  2D1W A;  3CXC 2;  2K0M A;  2W9P A;  2BHM A;  1EG9 B;  3SX1 A;  3ROB A;  3CCU 3;  4MMZ B;  1DYU A;  2ZDJ A;  2HMN B;  2P0X A;  3K7C A;  1QVF 2;  4O8S A;  1RRL A;  1YI2 3;  5EQL A;  2CWT A;  2STD A;  2PNC A;  3TDG A;  1OGZ A;  2W6J H;  1VQ4 3;  1VQ8 3;  1NJI 4;  3LTA A;  1LVN A;  1YJ9 3;  3LTD A;  2OWP A;  3FLJ A;  3CC7 3;  4HYZ A;  1JJ2 2;  1UUV B;  1IVV A;  4FCZ A;  3WOF B;  5JBS A;  1QVG 2;  4K1U A;  3CC4 3;  3F8X A;  3CNM A;  1EKM A;  1W5Z A;  5AII A;  4IPB A;  5AIG A;  1A2K A;  1D6Y A;  3OWS A;  1N8R 4;  3B8L A;  2FXT A;  2CFD A;  3FG3 A;  1K9M 4;  3SXX A;  3G8Z A;  2GEY A;  1TFK A;  1W2Z A;  2IUK A;  5EEO A;  3LT9 A;  1SPU A;  2L4V A;  3WDG B;  3CCE 3;  4N3V A;  5DRE A;  2O9U X;  5IER A;  1TP6 A;  4EV2 A;  4L8O A;  2XGN A;  4GB5 A;  2MF7 A;  2QIY A;  2WGQ A;  5BVB A;  5EVH A;  2PZV A;  3GRD A;  1E97 A;  4AEQ A;  2WOF A;  4N6N B;  3DM8 A;  1W01 A;  1YJW 3;  4AKY A;  1FGM A;  3FKA A;  2XFT A;  3CPO A;  1WNH A;  2K54 A;  4FMC A;  4N6T A;  1GD3 A;  1D6U A;  2UX0 A;  3EN8 A;  3G16 A;  3NBB A;  1JNQ A;  3PCR A;  2Y74 A;  3FSD A;  4HZB B;  3H51 A;  1ULI B;  3B4P A;  3LTB A;  1IVU A;  3MG1 A;  4HJL B;  5AIF A;  2Z77 A;  1OAC A;  4R9L A;  3VSY A;  4HZ9 B;  5D81 A;  2BMR B;  3NV0 A;  2BT3 A;  2A15 A;  2YX9 A;  1Z1S A;  2ML6 A;  4FR9 A;  1O7P B;  2E2V A;  4R9K A;  1V74 A;  3NUV A;  4XDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...