2F5MA

Cross-linked barnase soaked in bromo-ethanol
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 27
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2f5mA00
1B27A 1BANA 3SYUA 3WHOA 1FUSA 2KF4A 1LOYA 1RCKA 1BRNL 1GOUA 1B2MA 1RGFA 1RDSA 1RHLA 3D4AA 1BRHA 2F56A 1FW7A 2C4BA 8RNTA 1TRQA 9RNTA 1RGLA 1BRJA 1DETA 1HZ1A 1BRSA 1BSBA 1RLSA 1JBSA 1Q9EA 3AGOA 3BU4A 1BSDA 1BOXA 1RGEA 2ZA4A 1G02A 3DGYA 1BAOA 5GSPA 5BU4A 1BRIA 3URPA 1MGRA 4BU4A 1X1YA 1I3FA 1FZUA 1BNSA 3D5GA 1LNIA 6GSPA 1RGAA 4GHOA 4HAAA 1LRAA 3WR2A 4GSPA 1YGWA 2BIRA 2HOHA 3A5EA 4HOHA 1YNVX 1UCJA 4J5GA 2KF5A 3RNTA 1I8VA 2AADA 5RNTA 1IYYA 2BU4A 1RGKA 7RNTA 1GMRA 2F5WA 1JBTA 1RGCA 1RMSA 1RNTA 1I0VA 2RBIA 1BU4A 1YVSA 1LOVA 1RN4A 2AAEA 3Q3FA 3GSPA 1X1UA 1GOVA 1PYLA 3AHWA 4RNTA 1I2FA 1T2HA 1MGWA 1T2IA 4BIRA 1UCIA 1BNEA 1I0XA 1GOYA 1SARA 6RNTA 1TTOA 1UCKA 2GSPA 1BNFA 2F5MA 1I2GA 2KF3A 1RCLA 1RN1A 1TRPA 2SARA 1UCLA 1RGGA 3AHSA 5BIRA 1BNJA 1BSAA 1BGSA 1RTUA 1I3IA 1A2PA 2KF6A 1B21A 2RNTA 3DH2A 1PY3A 2KAAA 1DE3A 1FYSA 1GMQA 1FUTA 1ZGXA 1I70A 3KCHA 1BVIA 1RNBA 1AY7A 1CH0A 1BSCA 1HYFA 1BRKA 4J5KA 1BNGA 1C54A 1BRGA 1GSPA 1AQZA 5HOHA 1B2ZA 3BIRA 1R4YA 1BSEA 3AGNA 7GSPA 1BNIA 1B3SA 1BIRA 1B2SA 1JBRA 1I2EA 1X1WA 1BNRA 3HOHA 1B20A 1X1XA 1GMPA 1BUJA 2F4YA 1B2XA 3D5IA 1LOWA 1B2UA 1RSNA 1RGHA
chains in the Genus database with same CATH superfamily
5ELUA 1E97A 5IEOA 3FH1A 3CCJ3 1BUQA 1FUSA 1LNHA 1LOYA 2IY2A 1M1K4 1BRNL 1FA3A 2YFIB 3NV0B 1RGFA 3KZTA 3MPHA 1T3BA 2Z77A 8RNTA 2Y74A 3WDGB 1MNLA 3OWYA 1YIT3 1DMMA 4RZMA 1BRJA 1Q42A 3Q1CA 1W2ZA 1K734 3EN1B 6STDA 3NUVA 2FXTA 1JBSA 5ELJA 4WFOA 1F8NA 2D1WA 5D81A 3G6E3 3LTAA 5JPPA 3I563 1RGEA 2YX9A 3K5TA 4MMZB 3LXUX 2ZA4A 3DGYA 4QWTA 1N5PA 5GSPA 5BU4A 1BRIA 1MWRA 3URPA 3PZWA 1OUNA 4WWUC 1VQ53 1I3FA 1FZUA 1WMOA 3B4PA 3SOAA 4BTWA 3ECFA 3DY5A 5AYSC 2LQVA 1YI23 3WR2A 4J5GA 4HOHA 4PEJA 2E2TA 3UNLA 1IV9A 1Q814 3H51A 4HJLB 5IENA 1SIHA 3G16A 5AIIA 3DGNA 3MG1A 4HM7B 4LZIA 4J9AA 2MF7A 1W01A 2QEX3 1NB3I 1FGQA 1RGKA 3BNBA 3GZRA 3WODG 1ASKA 3NQYA 4FR9A 3U1WA 1RMSA 1MWUA 2IA7A 3S67A 2GBWB 1MOLA 1TP6A 2P0XA 1UW1A 2R41A 3JVCA 4EV2A 2RBIA 2W0QA 1BU4A 5G1KA 2XR8B 3K0ZA 3GSPA 1X1UA 4WHAA 4EBGA 3ZFZA 1K28A 2OQEC 3NM2A 4N3VA 3OV4A 3RGRA 2XGNA 3HIGA 1I2FA 1OH0A 1RN7A 4FCZA 4ILFA 1VQ73 3LTBA 1VZZA 4R4KA 1JZDA 2OWPA 1T2IA 4TX4A 1W2B2 2WO0A 3V98A 1GOYA 3X41A 3D9RA 4H61A 1UCKA 3B4OA 1UCLA 2CWTA 1YHQ3 1DVDA 1AV4A 2W9PA 1N5HA 3EHCA 1US1A 1RRLA 1WNHA 2WGQA 1RTUA 2ZHXB 1TFKA 2XH9A 4L8OA 3CC73 3CMA3 1B21A 2W6JH 3DXOA 3GWRA 5EQLA 2KAAA 3VSYA 5LC7A 4JRFA 1QAKA 3KCHA 1QAFA 1JV2B 2XSHB 1A2VA 2OOVC 4J8TA 2HMJB 3I0YA 1IT7A 1HYFA 2WGOA 2HMOB 2BMOB 3MSOA 1Q864 2CWVA 1C54A 1N9EA 2BT3A 3LTCA 3MG2A 3S27A 3UB1A 5HOHA 3H3HA 1R4YA 2UUGC 3K63A 3AGNA 1W6YA 3OWSA 5M18A 3GZXB 1BIRA 3LT9A 4L8PA 4U13A 5IG4A 4N6OB 1OCVA 1SPUA 2Q07A 1Q40A 2JDIH 3EF8A 1SQWA 3B8LA 1JRQA 1X1XA 2XEPA 1BUJA 1W5ZA 3D5IA 1JNQA 4L7KA 2GU1A 1N8R4 2P05A 1YIJ3 3GZYB 1RGHA 3GZBA 3N9HA 3KSPA 4R9KA 4GL6A 4Q53A 1K41A 1ZO2A 1RCKA 1B2MA 3EBTA 3FKAA 3PYJA 3DUKA 4EV5A 3CCE3 1QMAA 2CX0A 1Q7Y4 1E3RA 4NHFA 4GB5A 3JUMA 1IT8A 3X3XA 1A90A 3NBBA 1TRQA 1AR0A 3U97A 1UUVB 2OCTA 2KCDA 1RGLA 3GRDA 3KN4A 4CPKA 9RNTA 3G713 2E2UA 1LVNA 1BSBA 1Q9EA 3N8BA 2OTL3 2RFRA 4OUQA 1BOXA 1OGZA 1W6GA 3FG1A 1IU7A 3BNEA 2K3DA 1TJDA 4WP5A 1KQS2 1QVF2 1SJWA 2BO9B 1MGRA 5KP3A 4BU4A 2MC8A 2A15A 4LSOA 2STDA 4O8SA 1VQ83 4XBYA 7STDA 3NM7A 1ROAA 1DYUA 1A67A 4XBTA 3CXC2 3KFQC 3PCRA 4KVHA 1VQ63 3T8NA 1UDII 2WOHA 6GSPA 1JKGB 5AIGA 4GHOA 4XM4A 2HMNB 1M904 1WMNA 4HAAA 4GSPA 2GEXA 3UL5A 1YGWA 2BIRA 3KIIA 1YNVX 1UCJA 2P09A 3EN8A 1N8QA 2KF5A 5I97A 5IW9A 3D3LA 2ZDJA 7RNTA 1FGTA 3STDA 1GY5A 4K1VA 3X3ZA 2XSOB 3A76A 1RNTA 3DMCA 1U5OA 3FLJA 3GAXA 5BVBA 1YVSA 1LOVA 1U8CB 5G1LA 3IPTA 3N54B 4RNTA 3X40A 3EE1A 1OPYA 2PZVA 2QA43 2IUKA 2CFGA 3F9SA 1JKGA 2BNGA 4BIRA 1UCIA 3HX8A 1GD3A 5JPUA 1BNEA 3NV0A 3F8HA 6RNTA 5CF1A 2GSPA 1BNFA 1KWIA 2F5MA 1V74A 1LXEA 3PXMA 1RN1A 3FF0A 4O02B 1OGXA 3ZG5A 4X2HA 3LOYA 3AHSA 2PNCA 1BSAA 2E2VA 2RSXA 5A0OB 1I3IA 3X3YA 1A2PA 5AEUB 2KF6A 3QRDA 2RNTA 2CFWA 3DH2A 4OVMA 3UL6A 3FZWA 1Q824 1GMQA 4RNZA 5CF2A 2QIYA 1I70A 2B1XB 3ALAA 1IK3A 1AY7A 1CH0A 1IVUA 3MWZA 1VQ93 1BNGA 1SIIA 3DM8A 3JUNA 1BRGA 3KSED 4R80A 3BNCA 4XDVA 5EVHA 3EQQB 2Z7AA 5STDA 1VQ43 3BB9A 3KKGA 1CYUA 3BLZA 2W03A 1TUHA 4NREA 5CLKA 7GSPA 1BNIA 4N6LA 5IG0A 5EEOA 1K9M4 4XB5A 1MWSA 4X2OA 1NJI4 3HOHA 3CC43 3DZLA 2XGLA 1VQP3 1NNVA 3CCU3 1GD4A 2F4YA 4IIAA 2OTJ3 3Q90A 4HM1B 2D42A 1RSNA 1UI8A 1O7NB 1GY6A 3CCL3 1OF5B 3G4S3 1BANA 3Q2PA 1IQXA 3WHOA 2CG0A 1D6ZA 4HZ9B 5BXQA 2IUJA 1T5YA 1JB2A 2UGIA 1EEJA 1LQMB 2M7OA 1WQLB 2F56A 4K1UA 1FW7A 2C4BA 4STDA 3PS8A 2I9WA 3LZAA 3CME3 1HZ1A 5IG3A 4XDWA 4HM4B 1G0TA 1BRSA 4LMIA 5AYRB 2GBXB 1RLSA 2F86B 3BU4A 2CFLA 1BSDA 1W4NA 2H0HA 1K8A4 4BL3A 3TDGA 3S29A 3F40A 3HIIA 4OK0A 2RCDA 1BAOA 4N6UA 4HM3B 2W56B 4HYZA 4HM0B 2Z76A 2UX0A 1NDOB 1OACA 1M9GA 3UJMA 4JF8A 1Y4KA 1BNSA 3D5GA 4NPBA 5CXOA 1VQK3 3HZPA 3X42A 1RGAA 1RJOA 3AMOB 4N6NB 2BMQB 2Y73A 4IT7A 1LRAA 3S28A 2V1LA 2CW9A 3HI7A 2CK3H 4FMAA 1IV7A 3A5EA 3V99A 5CK6A 5IEPA 3OW22 1VQO3 5LC6A 4HZBB 1O7MB 3EC9A 3RNTA 3O8YA 1I8VA 2B24B 1ZS7A 1NU3A 1OHOA 1Q7HA 2O3OA 3MYTA 5RNTA 2CIUA 3SOYA 2BU4A 2L1SA 1J2BA 3J7Yd 2F5WA 5IF6A 3E99A 4HBRA 5JBSA 1GYBA 1VQM3 5TGNA 1JBTA 2YFJB 1YJ93 4FMDA 1M1XB 1NO3A 2XFTA 1FGOA 2CC3A 2XF3A 1RN4A 3JUOA 2ML6A 3B7CA 1N9JA 1HKXA 3LT8A 1T2HA 2SBLA 3FCSB 1Z1SA 3JUPA 3WA3A 1MGWA 3DGMA 5KP1A 3NHXA 3BNDA 4XBXA 1RRHA 2L4VA 5G2GA 5FGOA 2CFKA 2KF3A 3CCV3 1RCLA 1EG9B 1TRPA 1STFI 3F7XA 3FF2A 1AVLA 3K7CA 4ORLA 3WOEB 4EW5A 1EQKA 5BIRA 3T8UA 8CHOA 3RGAA 3S5CA 1YVBI 1TU5A 4BTYA 1LOXA 1UI7A 2QGUA 2WOFA 1GS3A 3SLUA 4O2HA 3VGNA 3SEDA 3SX1A 3CD63 1YGEA 1DE3A 1FYSA 5AEWB 1ZGXA 1VQQA 3CCQ3 1BVIA 2CFDA 2J8XB 1EUIC 3FG3A 3JUQA 1RNBA 5D82A 4I4KA 2ZL8A 4I5QA 1BRKA 4J5KA 1GSPA 1QJGA 1O7WB 3MG3A 4N6V0 3LTDA 1BSEA 1W6CA 3L0RA 3RDEA 3ZG0A 4G1MB 1V58A 1B3SA 3DGLA 1JN5B 1B2SA 1JBRA 5HGRA 1V57A 3HK4A 4BTXA 1X1WA 4MJDA 5KP4A 1BNRA 2GU3A 3SVAA 4MMYB 3D79A 2GXFA 3FGYA 2OQEA 3ER7A 4LYLB 3T0UA 1CQSA 2H0GA 5IERA 1B2XA 3MHEA 2IMJA 1OHSA 4N6MA 4CDLA 2C11A 1RKYA 4RNYA 1B27A 1ROVA 2BMRB 3SYUA 2CG1A 2KF4A 1GOUA 1QALA 1AVKA 5AIHA 3CU3A 1RDSA 3EJVA 3PCSA 1A2KA 1RHLA 1UGHI 3D4AA 2K54A 1BRHA 5FW5A 4KT3B 1IDPA 1CYVA 1L5GB 3NBRA 4EXRA 1IVWA 4LEHA 1ISKA 2W04A 2INXA 2Z6BA 3K9MC 3M8CA 3WMDA 1DETA 4K90B 1DVCA 1GY7A 2BHMA 4CCVA 1DMQA 4LGQA 3AGOA 3PGBA 1JN5A 1YJN3 4HM2B 1STDA 1EA2A 1G96A 3FSDA 3G8ZA 3NQZA 3WOFB 3QK9A 1G02A 3F14A 2OOVA 1S723 3V92A 1C7HA 4MEIA 5M1AA 1W02A 1FGMA 1X1YA 2FGTA 5DREA 3NX0A 3CPW2 2ML5A 3F8XA 1O7HB 3ROBA 3EX9A 1LNIA 2F99A 4HM8B 1HU9A 1W00A 4DKIA 1FGRA 3VF1A 1JZOA 3CCS3 2GEYA 4IPBA 1KSIA 4KZ1A 2HOHA 4BL2A 1IQYA 3I553 4H3UA 4KFEA 1ULJB 5D83A 5IG5A 1OHPA 2AADA 3KE7A 3OWUA 4CJNA 1Q40B 4MMXB 4ZM8A 3MKIA 1IYYA 1WMPA 2KRTA 3G0KA 3OXAA 1GMRA 4R9LA 2F98A 3CCR3 5AIFA 2LYXA 3LMLA 1RGCA 4N6TA 1W7CA 4FCMA 3LYGA 1JJ22 1O7PB 1S5AA 5M19A 3F7SA 3CPOA 4FCJA 1IVXA 1I0VA 1EKMA 2W9QA 3Q3FA 2AAEA 1IVVA 1WTHA 4O3VA 1GOVA 1PYLA 2IYJA 3AHWA 3SXXA 4EYCA 1OF5A 2CX1A 1R4CA 1IQ8A 1ZX2A 2CWUA 4AEQA 1LQGC 1I0XA 1UUGB 4WYKB 1SARA 1MWTA 1TTOA 2XFSA 4RBNA 3CC23 4HVNA 1I2GA 1E3VA 1KC84 2SARA 1RGGA 1O7GB 2CHCA 2P0MA 1BNJA 3NXJA 1BGSA 1JB5A 3EB8A 3IMAB 4KFDA 3CNMA 2JQ5A 2W2CA 4R1KA 3NBJA 1PY3A 1CEWI 1FUWA 1QVG2 2YFLB 2CH9A 1FUTA 2W56A 2HMKB 1KD14 4KFFA 1DMNA 3FG4A 3EBYA 2CKFB 4HKVB 3OX9A 4EC6A 1BSCA 1UGIA 2RGQA 5AI1A 3AMOA 3CNXA 1AQZA 1B2ZA 3BIRA 4WYKA 2HMMB 1NWWA 4AKZA 2XRXB 4HM5B 1VQN3 3WA2X 1TIJA 2R4IA 1D6YA 2FNQA 1YJW3 1NB5I 2P38A 4FMCA 3DGOA 1I2EA 5DRVA 1PU4A 1PFPA 2O9UX 3IJEB 1VQL3 1TFOA 1B20A 1ULIB 2C10A 3CCM3 1GMPA 2HMLB 4HM6B 1D6UA 4K61A 3LH4A 2H0IA 1JB4A 2KXGA 2K0MA 1LOWA 1B2UA 4AKYA 4FMBA 1UUWB
chains in the Genus database with same CATH topology
1B27A 1BANA 3SYUA 3WHOA 1FUSA 2KF4A 1LOYA 1RCKA 1BRNL 1GOUA 1B2MA 1RGFA 1RDSA 1RHLA 3D4AA 1BRHA 2F56A 1FW7A 2C4BA 8RNTA 1TRQA 9RNTA 1RGLA 1BRJA 1DETA 1HZ1A 1BRSA 1BSBA 1RLSA 1JBSA 1Q9EA 3AGOA 3BU4A 1BSDA 1BOXA 1RGEA 2ZA4A 1G02A 3DGYA 1BAOA 5GSPA 5BU4A 1BRIA 3URPA 1MGRA 4BU4A 1X1YA 1I3FA 1FZUA 1BNSA 3D5GA 1LNIA 6GSPA 1RGAA 4GHOA 4HAAA 1LRAA 3WR2A 4GSPA 1YGWA 2BIRA 2HOHA 3A5EA 4HOHA 1YNVX 1UCJA 4J5GA 2KF5A 3RNTA 1I8VA 2AADA 5RNTA 1IYYA 2BU4A 1RGKA 7RNTA 1GMRA 2F5WA 1JBTA 1RGCA 1RMSA 1RNTA 1I0VA 2RBIA 1BU4A 1YVSA 1LOVA 1RN4A 2AAEA 3Q3FA 3GSPA 1X1UA 1GOVA 1PYLA 3AHWA 4RNTA 1I2FA 1T2HA 1MGWA 1T2IA 4BIRA 1UCIA 1BNEA 1I0XA 1GOYA 1SARA 6RNTA 1TTOA 1UCKA 2GSPA 1BNFA 2F5MA 1I2GA 2KF3A 1RCLA 1RN1A 1TRPA 2SARA 1UCLA 1RGGA 3AHSA 5BIRA 1BNJA 1BSAA 1BGSA 1RTUA 1I3IA 1A2PA 2KF6A 1B21A 2RNTA 3DH2A 1PY3A 2KAAA 1DE3A 1FYSA 1GMQA 1FUTA 1ZGXA 1I70A 3KCHA 1BVIA 1RNBA 1AY7A 1CH0A 1BSCA 1HYFA 1BRKA 4J5KA 1BNGA 1C54A 1BRGA 1GSPA 1AQZA 5HOHA 1B2ZA 3BIRA 1R4YA 1BSEA 3AGNA 7GSPA 1BNIA 1B3SA 1BIRA 1B2SA 1JBRA 1I2EA 1X1WA 1BNRA 3HOHA 1B20A 1X1XA 1GMPA 1BUJA 2F4YA 1B2XA 3D5IA 1LOWA 1B2UA 1RSNA 1RGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B27 A;  1BAN A;  3SYU A;  3WHO A;  1FUS A;  2KF4 A;  1LOY A;  1RCK A;  1BRN L;  1GOU A;  1B2M A;  1RGF A;  1RDS A;  1RHL A;  3D4A A;  1BRH A;  2F56 A;  1FW7 A;  2C4B A;  8RNT A;  1TRQ A;  9RNT A;  1RGL A;  1BRJ A;  1DET A;  1HZ1 A;  1BRS A;  1BSB A;  1RLS A;  1JBS A;  1Q9E A;  3AGO A;  3BU4 A;  1BSD A;  1BOX A;  1RGE A;  2ZA4 A;  1G02 A;  3DGY A;  1BAO A;  5GSP A;  5BU4 A;  1BRI A;  3URP A;  1MGR A;  4BU4 A;  1X1Y A;  1I3F A;  1FZU A;  1BNS A;  3D5G A;  1LNI A;  6GSP A;  1RGA A;  4GHO A;  4HAA A;  1LRA A;  3WR2 A;  4GSP A;  1YGW A;  2BIR A;  2HOH A;  3A5E A;  4HOH A;  1YNV X;  1UCJ A;  4J5G A;  2KF5 A;  3RNT A;  1I8V A;  2AAD A;  5RNT A;  1IYY A;  2BU4 A;  1RGK A;  7RNT A;  1GMR A;  2F5W A;  1JBT A;  1RGC A;  1RMS A;  1RNT A;  1I0V A;  2RBI A;  1BU4 A;  1YVS A;  1LOV A;  1RN4 A;  2AAE A;  3Q3F A;  3GSP A;  1X1U A;  1GOV A;  1PYL A;  3AHW A;  4RNT A;  1I2F A;  1T2H A;  1MGW A;  1T2I A;  4BIR A;  1UCI A;  1BNE A;  1I0X A;  1GOY A;  1SAR A;  6RNT A;  1TTO A;  1UCK A;  2GSP A;  1BNF A;  2F5M A;  1I2G A;  2KF3 A;  1RCL A;  1RN1 A;  1TRP A;  2SAR A;  1UCL A;  1RGG A;  3AHS A;  5BIR A;  1BNJ A;  1BSA A;  1BGS A;  1RTU A;  1I3I A;  1A2P A;  2KF6 A;  1B21 A;  2RNT A;  3DH2 A;  1PY3 A;  2KAA A;  1DE3 A;  1FYS A;  1GMQ A;  1FUT A;  1ZGX A;  1I70 A;  3KCH A;  1BVI A;  1RNB A;  1AY7 A;  1CH0 A;  1BSC A;  1HYF A;  1BRK A;  4J5K A;  1BNG A;  1C54 A;  1BRG A;  1GSP A;  1AQZ A;  5HOH A;  1B2Z A;  3BIR A;  1R4Y A;  1BSE A;  3AGN A;  7GSP A;  1BNI A;  1B3S A;  1BIR A;  1B2S A;  1JBR A;  1I2E A;  1X1W A;  1BNR A;  3HOH A;  1B20 A;  1X1X A;  1GMP A;  1BUJ A;  2F4Y A;  1B2X A;  3D5I A;  1LOW A;  1B2U A;  1RSN A;  1RGH A; 
#chains in the Genus database with same CATH topology
 5ELU A;  1E97 A;  5IEO A;  3FH1 A;  3CCJ 3;  1BUQ A;  1FUS A;  1LNH A;  1LOY A;  2IY2 A;  1M1K 4;  1BRN L;  1FA3 A;  2YFI B;  3NV0 B;  1RGF A;  3KZT A;  3MPH A;  1T3B A;  2Z77 A;  8RNT A;  2Y74 A;  3WDG B;  1MNL A;  3OWY A;  1YIT 3;  1DMM A;  4RZM A;  1BRJ A;  1Q42 A;  3Q1C A;  1W2Z A;  1K73 4;  3EN1 B;  6STD A;  3NUV A;  2FXT A;  1JBS A;  5ELJ A;  4WFO A;  1F8N A;  2D1W A;  5D81 A;  3G6E 3;  3LTA A;  5JPP A;  3I56 3;  1RGE A;  2YX9 A;  3K5T A;  4MMZ B;  3LXU X;  2ZA4 A;  3DGY A;  4QWT A;  1N5P A;  5GSP A;  5BU4 A;  1BRI A;  1MWR A;  3URP A;  3PZW A;  1OUN A;  4WWU C;  1VQ5 3;  1I3F A;  1FZU A;  1WMO A;  3B4P A;  3SOA A;  4BTW A;  3ECF A;  3DY5 A;  5AYS C;  2LQV A;  1YI2 3;  3WR2 A;  4J5G A;  4HOH A;  4PEJ A;  2E2T A;  3UNL A;  1IV9 A;  1Q81 4;  3H51 A;  4HJL B;  5IEN A;  1SIH A;  3G16 A;  5AII A;  3DGN A;  3MG1 A;  4HM7 B;  4LZI A;  4J9A A;  2MF7 A;  1W01 A;  2QEX 3;  1NB3 I;  1FGQ A;  1RGK A;  3BNB A;  3GZR A;  3WOD G;  1ASK A;  3NQY A;  4FR9 A;  3U1W A;  1RMS A;  1MWU A;  2IA7 A;  3S67 A;  2GBW B;  1MOL A;  1TP6 A;  2P0X A;  1UW1 A;  2R41 A;  3JVC A;  4EV2 A;  2RBI A;  2W0Q A;  1BU4 A;  5G1K A;  2XR8 B;  3K0Z A;  3GSP A;  1X1U A;  4WHA A;  4EBG A;  3ZFZ A;  1K28 A;  2OQE C;  3NM2 A;  4N3V A;  3OV4 A;  3RGR A;  2XGN A;  3HIG A;  1I2F A;  1OH0 A;  1RN7 A;  4FCZ A;  4ILF A;  1VQ7 3;  3LTB A;  1VZZ A;  4R4K A;  1JZD A;  2OWP A;  1T2I A;  4TX4 A;  1W2B 2;  2WO0 A;  3V98 A;  1GOY A;  3X41 A;  3D9R A;  4H61 A;  1UCK A;  3B4O A;  1UCL A;  2CWT A;  1YHQ 3;  1DVD A;  1AV4 A;  2W9P A;  1N5H A;  3EHC A;  1US1 A;  1RRL A;  1WNH A;  2WGQ A;  1RTU A;  2ZHX B;  1TFK A;  2XH9 A;  4L8O A;  3CC7 3;  3CMA 3;  1B21 A;  2W6J H;  3DXO A;  3GWR A;  5EQL A;  2KAA A;  3VSY A;  5LC7 A;  4JRF A;  1QAK A;  3KCH A;  1QAF A;  1JV2 B;  2XSH B;  1A2V A;  2OOV C;  4J8T A;  2HMJ B;  3I0Y A;  1IT7 A;  1HYF A;  2WGO A;  2HMO B;  2BMO B;  3MSO A;  1Q86 4;  2CWV A;  1C54 A;  1N9E A;  2BT3 A;  3LTC A;  3MG2 A;  3S27 A;  3UB1 A;  5HOH A;  3H3H A;  1R4Y A;  2UUG C;  3K63 A;  3AGN A;  1W6Y A;  3OWS A;  5M18 A;  3GZX B;  1BIR A;  3LT9 A;  4L8P A;  4U13 A;  5IG4 A;  4N6O B;  1OCV A;  1SPU A;  2Q07 A;  1Q40 A;  2JDI H;  3EF8 A;  1SQW A;  3B8L A;  1JRQ A;  1X1X A;  2XEP A;  1BUJ A;  1W5Z A;  3D5I A;  1JNQ A;  4L7K A;  2GU1 A;  1N8R 4;  2P05 A;  1YIJ 3;  3GZY B;  1RGH A;  3GZB A;  3N9H A;  3KSP A;  4R9K A;  4GL6 A;  4Q53 A;  1K41 A;  1ZO2 A;  1RCK A;  1B2M A;  3EBT A;  3FKA A;  3PYJ A;  3DUK A;  4EV5 A;  3CCE 3;  1QMA A;  2CX0 A;  1Q7Y 4;  1E3R A;  4NHF A;  4GB5 A;  3JUM A;  1IT8 A;  3X3X A;  1A90 A;  3NBB A;  1TRQ A;  1AR0 A;  3U97 A;  1UUV B;  2OCT A;  2KCD A;  1RGL A;  3GRD A;  3KN4 A;  4CPK A;  9RNT A;  3G71 3;  2E2U A;  1LVN A;  1BSB A;  1Q9E A;  3N8B A;  2OTL 3;  2RFR A;  4OUQ A;  1BOX A;  1OGZ A;  1W6G A;  3FG1 A;  1IU7 A;  3BNE A;  2K3D A;  1TJD A;  4WP5 A;  1KQS 2;  1QVF 2;  1SJW A;  2BO9 B;  1MGR A;  5KP3 A;  4BU4 A;  2MC8 A;  2A15 A;  4LSO A;  2STD A;  4O8S A;  1VQ8 3;  4XBY A;  7STD A;  3NM7 A;  1ROA A;  1DYU A;  1A67 A;  4XBT A;  3CXC 2;  3KFQ C;  3PCR A;  4KVH A;  1VQ6 3;  3T8N A;  1UDI I;  2WOH A;  6GSP A;  1JKG B;  5AIG A;  4GHO A;  4XM4 A;  2HMN B;  1M90 4;  1WMN A;  4HAA A;  4GSP A;  2GEX A;  3UL5 A;  1YGW A;  2BIR A;  3KII A;  1YNV X;  1UCJ A;  2P09 A;  3EN8 A;  1N8Q A;  2KF5 A;  5I97 A;  5IW9 A;  3D3L A;  2ZDJ A;  7RNT A;  1FGT A;  3STD A;  1GY5 A;  4K1V A;  3X3Z A;  2XSO B;  3A76 A;  1RNT A;  3DMC A;  1U5O A;  3FLJ A;  3GAX A;  5BVB A;  1YVS A;  1LOV A;  1U8C B;  5G1L A;  3IPT A;  3N54 B;  4RNT A;  3X40 A;  3EE1 A;  1OPY A;  2PZV A;  2QA4 3;  2IUK A;  2CFG A;  3F9S A;  1JKG A;  2BNG A;  4BIR A;  1UCI A;  3HX8 A;  1GD3 A;  5JPU A;  1BNE A;  3NV0 A;  3F8H A;  6RNT A;  5CF1 A;  2GSP A;  1BNF A;  1KWI A;  2F5M A;  1V74 A;  1LXE A;  3PXM A;  1RN1 A;  3FF0 A;  4O02 B;  1OGX A;  3ZG5 A;  4X2H A;  3LOY A;  3AHS A;  2PNC A;  1BSA A;  2E2V A;  2RSX A;  5A0O B;  1I3I A;  3X3Y A;  1A2P A;  5AEU B;  2KF6 A;  3QRD A;  2RNT A;  2CFW A;  3DH2 A;  4OVM A;  3UL6 A;  3FZW A;  1Q82 4;  1GMQ A;  4RNZ A;  5CF2 A;  2QIY A;  1I70 A;  2B1X B;  3ALA A;  1IK3 A;  1AY7 A;  1CH0 A;  1IVU A;  3MWZ A;  1VQ9 3;  1BNG A;  1SII A;  3DM8 A;  3JUN A;  1BRG A;  3KSE D;  4R80 A;  3BNC A;  4XDV A;  5EVH A;  3EQQ B;  2Z7A A;  5STD A;  1VQ4 3;  3BB9 A;  3KKG A;  1CYU A;  3BLZ A;  2W03 A;  1TUH A;  4NRE A;  5CLK A;  7GSP A;  1BNI A;  4N6L A;  5IG0 A;  5EEO A;  1K9M 4;  4XB5 A;  1MWS A;  4X2O A;  1NJI 4;  3HOH A;  3CC4 3;  3DZL A;  2XGL A;  1VQP 3;  1NNV A;  3CCU 3;  1GD4 A;  2F4Y A;  4IIA A;  2OTJ 3;  3Q90 A;  4HM1 B;  2D42 A;  1RSN A;  1UI8 A;  1O7N B;  1GY6 A;  3CCL 3;  1OF5 B;  3G4S 3;  1BAN A;  3Q2P A;  1IQX A;  3WHO A;  2CG0 A;  1D6Z A;  4HZ9 B;  5BXQ A;  2IUJ A;  1T5Y A;  1JB2 A;  2UGI A;  1EEJ A;  1LQM B;  2M7O A;  1WQL B;  2F56 A;  4K1U A;  1FW7 A;  2C4B A;  4STD A;  3PS8 A;  2I9W A;  3LZA A;  3CME 3;  1HZ1 A;  5IG3 A;  4XDW A;  4HM4 B;  1G0T A;  1BRS A;  4LMI A;  5AYR B;  2GBX B;  1RLS A;  2F86 B;  3BU4 A;  2CFL A;  1BSD A;  1W4N A;  2H0H A;  1K8A 4;  4BL3 A;  3TDG A;  3S29 A;  3F40 A;  3HII A;  4OK0 A;  2RCD A;  1BAO A;  4N6U A;  4HM3 B;  2W56 B;  4HYZ A;  4HM0 B;  2Z76 A;  2UX0 A;  1NDO B;  1OAC A;  1M9G A;  3UJM A;  4JF8 A;  1Y4K A;  1BNS A;  3D5G A;  4NPB A;  5CXO A;  1VQK 3;  3HZP A;  3X42 A;  1RGA A;  1RJO A;  3AMO B;  4N6N B;  2BMQ B;  2Y73 A;  4IT7 A;  1LRA A;  3S28 A;  2V1L A;  2CW9 A;  3HI7 A;  2CK3 H;  4FMA A;  1IV7 A;  3A5E A;  3V99 A;  5CK6 A;  5IEP A;  3OW2 2;  1VQO 3;  5LC6 A;  4HZB B;  1O7M B;  3EC9 A;  3RNT A;  3O8Y A;  1I8V A;  2B24 B;  1ZS7 A;  1NU3 A;  1OHO A;  1Q7H A;  2O3O A;  3MYT A;  5RNT A;  2CIU A;  3SOY A;  2BU4 A;  2L1S A;  1J2B A;  3J7Y d;  2F5W A;  5IF6 A;  3E99 A;  4HBR A;  5JBS A;  1GYB A;  1VQM 3;  5TGN A;  1JBT A;  2YFJ B;  1YJ9 3;  4FMD A;  1M1X B;  1NO3 A;  2XFT A;  1FGO A;  2CC3 A;  2XF3 A;  1RN4 A;  3JUO A;  2ML6 A;  3B7C A;  1N9J A;  1HKX A;  3LT8 A;  1T2H A;  2SBL A;  3FCS B;  1Z1S A;  3JUP A;  3WA3 A;  1MGW A;  3DGM A;  5KP1 A;  3NHX A;  3BND A;  4XBX A;  1RRH A;  2L4V A;  5G2G A;  5FGO A;  2CFK A;  2KF3 A;  3CCV 3;  1RCL A;  1EG9 B;  1TRP A;  1STF I;  3F7X A;  3FF2 A;  1AVL A;  3K7C A;  4ORL A;  3WOE B;  4EW5 A;  1EQK A;  5BIR A;  3T8U A;  8CHO A;  3RGA A;  3S5C A;  1YVB I;  1TU5 A;  4BTY A;  1LOX A;  1UI7 A;  2QGU A;  2WOF A;  1GS3 A;  3SLU A;  4O2H A;  3VGN A;  3SED A;  3SX1 A;  3CD6 3;  1YGE A;  1DE3 A;  1FYS A;  5AEW B;  1ZGX A;  1VQQ A;  3CCQ 3;  1BVI A;  2CFD A;  2J8X B;  1EUI C;  3FG3 A;  3JUQ A;  1RNB A;  5D82 A;  4I4K A;  2ZL8 A;  4I5Q A;  1BRK A;  4J5K A;  1GSP A;  1QJG A;  1O7W B;  3MG3 A;  4N6V 0;  3LTD A;  1BSE A;  1W6C A;  3L0R A;  3RDE A;  3ZG0 A;  4G1M B;  1V58 A;  1B3S A;  3DGL A;  1JN5 B;  1B2S A;  1JBR A;  5HGR A;  1V57 A;  3HK4 A;  4BTX A;  1X1W A;  4MJD A;  5KP4 A;  1BNR A;  2GU3 A;  3SVA A;  4MMY B;  3D79 A;  2GXF A;  3FGY A;  2OQE A;  3ER7 A;  4LYL B;  3T0U A;  1CQS A;  2H0G A;  5IER A;  1B2X A;  3MHE A;  2IMJ A;  1OHS A;  4N6M A;  4CDL A;  2C11 A;  1RKY A;  4RNY A;  1B27 A;  1ROV A;  2BMR B;  3SYU A;  2CG1 A;  2KF4 A;  1GOU A;  1QAL A;  1AVK A;  5AIH A;  3CU3 A;  1RDS A;  3EJV A;  3PCS A;  1A2K A;  1RHL A;  1UGH I;  3D4A A;  2K54 A;  1BRH A;  5FW5 A;  4KT3 B;  1IDP A;  1CYV A;  1L5G B;  3NBR A;  4EXR A;  1IVW A;  4LEH A;  1ISK A;  2W04 A;  2INX A;  2Z6B A;  3K9M C;  3M8C A;  3WMD A;  1DET A;  4K90 B;  1DVC A;  1GY7 A;  2BHM A;  4CCV A;  1DMQ A;  4LGQ A;  3AGO A;  3PGB A;  1JN5 A;  1YJN 3;  4HM2 B;  1STD A;  1EA2 A;  1G96 A;  3FSD A;  3G8Z A;  3NQZ A;  3WOF B;  3QK9 A;  1G02 A;  3F14 A;  2OOV A;  1S72 3;  3V92 A;  1C7H A;  4MEI A;  5M1A A;  1W02 A;  1FGM A;  1X1Y A;  2FGT A;  5DRE A;  3NX0 A;  3CPW 2;  2ML5 A;  3F8X A;  1O7H B;  3ROB A;  3EX9 A;  1LNI A;  2F99 A;  4HM8 B;  1HU9 A;  1W00 A;  4DKI A;  1FGR A;  3VF1 A;  1JZO A;  3CCS 3;  2GEY A;  4IPB A;  1KSI A;  4KZ1 A;  2HOH A;  4BL2 A;  1IQY A;  3I55 3;  4H3U A;  4KFE A;  1ULJ B;  5D83 A;  5IG5 A;  1OHP A;  2AAD A;  3KE7 A;  3OWU A;  4CJN A;  1Q40 B;  4MMX B;  4ZM8 A;  3MKI A;  1IYY A;  1WMP A;  2KRT A;  3G0K A;  3OXA A;  1GMR A;  4R9L A;  2F98 A;  3CCR 3;  5AIF A;  2LYX A;  3LML A;  1RGC A;  4N6T A;  1W7C A;  4FCM A;  3LYG A;  1JJ2 2;  1O7P B;  1S5A A;  5M19 A;  3F7S A;  3CPO A;  4FCJ A;  1IVX A;  1I0V A;  1EKM A;  2W9Q A;  3Q3F A;  2AAE A;  1IVV A;  1WTH A;  4O3V A;  1GOV A;  1PYL A;  2IYJ A;  3AHW A;  3SXX A;  4EYC A;  1OF5 A;  2CX1 A;  1R4C A;  1IQ8 A;  1ZX2 A;  2CWU A;  4AEQ A;  1LQG C;  1I0X A;  1UUG B;  4WYK B;  1SAR A;  1MWT A;  1TTO A;  2XFS A;  4RBN A;  3CC2 3;  4HVN A;  1I2G A;  1E3V A;  1KC8 4;  2SAR A;  1RGG A;  1O7G B;  2CHC A;  2P0M A;  1BNJ A;  3NXJ A;  1BGS A;  1JB5 A;  3EB8 A;  3IMA B;  4KFD A;  3CNM A;  2JQ5 A;  2W2C A;  4R1K A;  3NBJ A;  1PY3 A;  1CEW I;  1FUW A;  1QVG 2;  2YFL B;  2CH9 A;  1FUT A;  2W56 A;  2HMK B;  1KD1 4;  4KFF A;  1DMN A;  3FG4 A;  3EBY A;  2CKF B;  4HKV B;  3OX9 A;  4EC6 A;  1BSC A;  1UGI A;  2RGQ A;  5AI1 A;  3AMO A;  3CNX A;  1AQZ A;  1B2Z A;  3BIR A;  4WYK A;  2HMM B;  1NWW A;  4AKZ A;  2XRX B;  4HM5 B;  1VQN 3;  3WA2 X;  1TIJ A;  2R4I A;  1D6Y A;  2FNQ A;  1YJW 3;  1NB5 I;  2P38 A;  4FMC A;  3DGO A;  1I2E A;  5DRV A;  1PU4 A;  1PFP A;  2O9U X;  3IJE B;  1VQL 3;  1TFO A;  1B20 A;  1ULI B;  2C10 A;  3CCM 3;  1GMP A;  2HML B;  4HM6 B;  1D6U A;  4K61 A;  3LH4 A;  2H0I A;  1JB4 A;  2KXG A;  2K0M A;  1LOW A;  1B2U A;  4AKY A;  4FMB A;  1UUW B; 
#chains in the Genus database with same CATH homology
 1B27 A;  1BAN A;  3SYU A;  3WHO A;  1FUS A;  2KF4 A;  1LOY A;  1RCK A;  1BRN L;  1GOU A;  1B2M A;  1RGF A;  1RDS A;  1RHL A;  3D4A A;  1BRH A;  2F56 A;  1FW7 A;  2C4B A;  8RNT A;  1TRQ A;  9RNT A;  1RGL A;  1BRJ A;  1DET A;  1HZ1 A;  1BRS A;  1BSB A;  1RLS A;  1JBS A;  1Q9E A;  3AGO A;  3BU4 A;  1BSD A;  1BOX A;  1RGE A;  2ZA4 A;  1G02 A;  3DGY A;  1BAO A;  5GSP A;  5BU4 A;  1BRI A;  3URP A;  1MGR A;  4BU4 A;  1X1Y A;  1I3F A;  1FZU A;  1BNS A;  3D5G A;  1LNI A;  6GSP A;  1RGA A;  4GHO A;  4HAA A;  1LRA A;  3WR2 A;  4GSP A;  1YGW A;  2BIR A;  2HOH A;  3A5E A;  4HOH A;  1YNV X;  1UCJ A;  4J5G A;  2KF5 A;  3RNT A;  1I8V A;  2AAD A;  5RNT A;  1IYY A;  2BU4 A;  1RGK A;  7RNT A;  1GMR A;  2F5W A;  1JBT A;  1RGC A;  1RMS A;  1RNT A;  1I0V A;  2RBI A;  1BU4 A;  1YVS A;  1LOV A;  1RN4 A;  2AAE A;  3Q3F A;  3GSP A;  1X1U A;  1GOV A;  1PYL A;  3AHW A;  4RNT A;  1I2F A;  1T2H A;  1MGW A;  1T2I A;  4BIR A;  1UCI A;  1BNE A;  1I0X A;  1GOY A;  1SAR A;  6RNT A;  1TTO A;  1UCK A;  2GSP A;  1BNF A;  2F5M A;  1I2G A;  2KF3 A;  1RCL A;  1RN1 A;  1TRP A;  2SAR A;  1UCL A;  1RGG A;  3AHS A;  5BIR A;  1BNJ A;  1BSA A;  1BGS A;  1RTU A;  1I3I A;  1A2P A;  2KF6 A;  1B21 A;  2RNT A;  3DH2 A;  1PY3 A;  2KAA A;  1DE3 A;  1FYS A;  1GMQ A;  1FUT A;  1ZGX A;  1I70 A;  3KCH A;  1BVI A;  1RNB A;  1AY7 A;  1CH0 A;  1BSC A;  1HYF A;  1BRK A;  4J5K A;  1BNG A;  1C54 A;  1BRG A;  1GSP A;  1AQZ A;  5HOH A;  1B2Z A;  3BIR A;  1R4Y A;  1BSE A;  3AGN A;  7GSP A;  1BNI A;  1B3S A;  1BIR A;  1B2S A;  1JBR A;  1I2E A;  1X1W A;  1BNR A;  3HOH A;  1B20 A;  1X1X A;  1GMP A;  1BUJ A;  2F4Y A;  1B2X A;  3D5I A;  1LOW A;  1B2U A;  1RSN A;  1RGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...