2F5MA

Cross-linked barnase soaked in bromo-ethanol
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 27
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2f5mA00
5BU4A 1Q9EA 1RGGA 1BNEA 2KAAA 3DGYA 4HOHA 1JBTA 3DH2A 1AQZA 1BRIA 2F5WA 3AGNA 3AGOA 4GHOA 1R4YA 1BNRA 3D5GA 1FUTA 1BNIA 1JBSA 1RGHA 2KF6A 1YVSA 1UCKA 1B2MA 1GMRA 1B2XA 1RGCA 2BU4A 3GSPA 1BGSA 1MGRA 1GMQA 1GSPA 2AADA 1X1WA 1PY3A 4BIRA 3RNTA 1JBRA 1GOUA 1LOYA 1RTUA 1TRQA 1I2FA 1RCKA 3AHWA 7RNTA 1PYLA 2C4BA 1B21A 1CH0A 1FYSA 1IYYA 1GOVA 1BU4A 3AHSA 1UCJA 1T2IA 1I3FA 3URPA 1BRKA 1I0VA 1LNIA 6GSPA 1B3SA 1GOYA 1RSNA 1B2UA 1BRJA 2AAEA 3HOHA 1BSDA 1RCLA 1BSCA 4HAAA 1RGFA 1ZGXA 3BU4A 1BSEA 2KF4A 8RNTA 1BSAA 5GSPA 1TRPA 2F4YA 1FW7A 1RLSA 1BNSA 1TTOA 1BNGA 1GMPA 3WHOA 1RGLA 1BNFA 1BIRA 1YNVX 2BIRA 1G02A 1RGAA 9RNTA 1MGWA 6RNTA 2KF5A 4RNTA 1BRHA 1I2GA 1SARA 1BANA 1I8VA 3SYUA 1BAOA 3Q3FA 3KCHA 1RN1A 1A2PA 2RNTA 1RMSA 1T2HA 1I3IA 1RGEA 5HOHA 1DE3A 1X1XA 4J5GA 3BIRA 1BOXA 7GSPA 1I2EA 2F56A 3D4AA 1RNBA 1I0XA 1B20A 1B2ZA 1BRSA 1BUJA 1BNJA 1FUSA 1AY7A 1RHLA 2RBIA 1B2SA 1B27A 1HYFA 4J5KA 5BIRA 2HOHA 1RGKA 1X1UA 2F5MA 1X1YA 1RN4A 3A5EA 1LOVA 4GSPA 1HZ1A 3WR2A 1FZUA 1UCLA 1BRNL 1BVIA 5RNTA 1BSBA 1UCIA 1LRAA 1I70A 1BRGA 1LOWA 1C54A 1RNTA 2KF3A 2GSPA 1DETA 4BU4A 2ZA4A 3D5IA 1YGWA 2SARA 1RDSA
chains in the Genus database with same CATH superfamily
1TU5A 5BU4A 1FGRA 1IDPA 2L1SA 2RCDA 2XR8B 3OV4A 1VZZA 3CCM3 4NPBA 2YX9A 5AIGA 4MMYB 3BLZA 3CU3A 2QEX3 2WOHA 1GY5A 3LT9A 1GY7A 3AGNA 3DY5A 1IVXA 1R4YA 2ZHXB 2WO0A 4WFOA 1TFKA 1FUTA 1LXEA 1ULJB 1HU9A 1W02A 3PXMA 1W6YA 1QVF2 1UI8A 2K3DA 2Z76A 3KKGA 4HYZA 5AYSC 1N8R4 1YHQ3 1BUQA 1B2XA 1N5HA 1RGCA 2HMOB 4FR9A 3OWYA 4ILFA 1K734 3X42A 1SJWA 1MGRA 1G0TA 3JUOA 3I0YA 2AADA 4EXRA 1LVNA 2CX0A 1K28A 3F9SA 1RKYA 1WQLB 1X1WA 3B7CA 3A76A 3G0KA 3SOYA 1GOUA 3F7XA 3U1WA 1YJW3 1W2B2 2KXGA 1JB4A 3KZTA 3WOEB 2GU3A 3DGLA 1IYYA 5AIHA 1Q7Y4 1T2IA 1V74A 2IY2A 2IA7A 4GB5A 1I3FA 4RNZA 3NBJA 1YIJ3 4KZ1A 1B3SA 3IMAB 4HZ9B 4DKIA 1RSNA 4KFDA 1Q40A 1KC84 4XBXA 2AAEA 2K54A 1UGHI 1ASKA 3ALAA 4HAAA 4O8SA 1Q814 2CW9A 2CG0A 1RGFA 2O3OA 3ER7A 4EW5A 1FW7A 3GWRA 1WTHA 2FNQA 1RN7A 4O3VA 4XBTA 5AEWB 3NQZA 1GMPA 2BMQB 2J8XB 2GU1A 4H3UA 4HVNA 1AV4A 1ZX2A 5A0OB 1NWWA 1BNFA 2BIRA 4EBGA 3EC9A 4LZIA 4BL3A 1GY6A 1FGMA 3BNCA 1RJOA 4NREA 2W6JH 3LTCA 1SARA 3UL5A 1UUWB 3NM7A 2W0QA 4AKZA 3BNEA 3KSPA 3CCS3 3Q3FA 1STFI 2W04A 1RN1A 2BNGA 3EB8A 5IG0A 5KP3A 2UGIA 3EN8A 1JV2B 1M9GA 3CCV3 2CC3A 1J2BA 3PS8A 4O2HA 3CC73 5TGNA 4OUQA 1RGEA 2YFJB 1SIHA 2I9WA 1QALA 3K7CA 2CWUA 3Q2PA 1I2EA 1RNBA 3D4AA 3FG1A 2CK3H 1B2ZA 3IPTA 1BRSA 1FGOA 1BNJA 3NBRA 4Q53A 1AY7A 5ELUA 2RBIA 1B2SA 3V99A 1FUWA 2Y74A 5KP1A 1MWUA 3OXAA 5CK6A 2OOVA 3DMCA 3U97A 5BIRA 2HOHA 3SX1A 3EX9A 1VQ43 1W7CA 2YFLB 3HIIA 3N9HA 2WOFA 1MWSA 4HM8B 1HZ1A 3WR2A 3CXC2 3ECFA 1FZUA 1UCLA 1Q40B 3CNXA 5M19A 5LC7A 3T8NA 1BRGA 1DMMA 1CEWI 3PYJA 3EBYA 3PCRA 4BU4A 4N6V0 3G8ZA 4X2OA 1OPYA 4CCVA 1UUGB 3EN1B 2CFLA 3FG4A 3GZRA 1Y4KA 1O7MB 4HM0B 4FCMA 3EE1A 4MJDA 2W03A 5IF6A 1T3BA 2CHCA 2E2VA 4L8OA 2KAAA 2GEXA 4WWUC 4QWTA 3JUPA 1JBTA 3FG3A 3JUMA 1JZOA 1BNRA 3H51A 5IW9A 1VQK3 3X3ZA 2V1LA 3VSYA 4ZM8A 1BNIA 4IT7A 3F8XA 1SIIA 1SQWA 1AVLA 1Z1SA 3G16A 3RGAA 1UCKA 5ELJA 3FF2A 2CKFB 5EQLA 3LT8A 1BGSA 2CWTA 2GEYA 3QRDA 5EEOA 2ML5A 1GMQA 1NJI4 2PNCA 4R9LA 2HMJB 1GSPA 1YI23 3S67A 2R41A 3PZWA 3X41A 3BNBA 4HZBB 1F8NA 3FH1A 4HM3B 2XGLA 2PZVA 1RTUA 1TRQA 3CCR3 4GL6A 1D6YA 4CDLA 1NB5I 3HIGA 1K9M4 2E2UA 1TIJA 2BHMA 3HX8A 1RCKA 3AHWA 3N8BA 5G2GA 2C4BA 2CFWA 1GOVA 2CWVA 3AHSA 3JVCA 1UCJA 1IQXA 5M1AA 3FSDA 4HM5B 2A15A 2UX0A 3N54B 2SBLA 1D6ZA 1I0VA 6GSPA 1EKMA 1IK3A 1W00A 1JKGB 1W4NA 1QVG2 3NHXA 1BRJA 3Q1CA 5G1KA 1RRLA 1BSDA 2D42A 1RCLA 2GBXB 4H61A 5D83A 3LTAA 5IG4A 5M18A 1ZGXA 5IG5A 1VQ63 3GAXA 8RNTA 2Z7AA 3ZFZA 3SXXA 2RFRA 4KFFA 1KD14 1BNSA 2O9UX 3K9MC 1TTOA 1BNGA 1ULIB 4LGQA 1K8A4 4K90B 2P05A 1FA3A 1RGLA 3LZAA 1VQN3 3NUVA 1G02A 1CYUA 1UW1A 3DGNA 1UUVB 1A2KA 4R9KA 3EF8A 1KWIA 4R80A 3CD63 1MGWA 4OVMA 1BRHA 1I2GA 1JRQA 5LC6A 1I8VA 3KE7A 2IYJA 3ROBA 4N6MA 4X2HA 3NBBA 4AKYA 3KCHA 4IPBA 2R4IA 3V98A 1A2PA 2B24B 2RNTA 1YVBI 3EHCA 4CJNA 4FMAA 2W2CA 4KT3B 4BTYA 1E3RA 1T2HA 2XF3A 4FMCA 2P09A 1I3IA 1NO3A 2L4VA 1KSIA 5AYRB 3WMDA 3G4S3 1KQS2 1PU4A 3LTDA 1BOXA 1ROVA 3FKAA 4N6UA 1M1K4 4FMDA 1I0XA 3B4PA 3DGMA 4N6TA 4R1KA 2HMMB 1STDA 3CPW2 1R4CA 1HYFA 3MWZA 3MG1A 4J9AA 4I5QA 2C11A 1DMNA 3OWSA 2KRTA 2F5MA 1UGIA 1WMOA 1RN4A 1LOVA 4GSPA 3DM8A 3HZPA 1BRNL 1W01A 1MNLA 2W9PA 1LRAA 4HM7B 1O7HB 1I70A 4K1VA 3S29A 3S5CA 3CCL3 1C54A 2KF3A 3WA3A 1N9JA 1TJDA 3T0UA 1DETA 1JZDA 2HMKB 3AMOB 2MC8A 3D5IA 1VQQA 3FZWA 1U8CB 1YGWA 1UI7A 2P0XA 3NV0A 5HGRA 2BMRB 4N3VA 4BTWA 4CPKA 1OGXA 1ZO2A 2OCTA 2XEPA 1N5PA 3NX0A 3X40A 2XH9A 2IUJA 3JUQA 4RZMA 5JBSA 1UDII 1EG9B 1Q9EA 1RGGA 2CFGA 1BNEA 1CQSA 2OQEC 1OHSA 4U13A 1DVCA 1E3VA 1GD3A 3BB9A 2INXA 3CNMA 4HOHA 4NHFA 3KSED 1VQ93 1AQZA 1BRIA 1OF5B 1U5OA 3HK4A 5AIIA 4K1UA 4GHOA 3S28A 3G713 3EQQB 3WA2X 3GZXB 5KP4A 4LSOA 4HBRA 1HKXA 1QAKA 1JBSA 3LTBA 4N6LA 2GXFA 3CC23 4EV2A 1VQM3 3K63A 1B2MA 4EYCA 2F99A 3NQYA 2OTJ3 1Q864 1OH0A 4FMBA 1JKGA 1VQ53 2HMLB 4JRFA 2H0IA 3LOYA 1O7WB 3RGRA 4XDVA 3F14A 3STDA 1LNHA 3FLJA 3FGYA 3O8YA 1PY3A 1S5AA 4BIRA 4AEQA 1IVVA 1LOYA 3GRDA 1EA2A 4EV5A 2STDA 3PCSA 3D79A 4K61A 3S27A 2LQVA 2B1XB 4MMXB 1JJ22 7RNTA 1JN5B 4FCJA 1FYSA 4JF8A 1N9EA 3CCU3 4MEIA 3F8HA 1O7PB 3URPA 3ZG5A 3PGBA 1BRKA 1LNIA 1GOYA 3LYGA 2WGOA 1E97A 3MG3A 3J7Yd 2C10A 2Z77A 3NV0B 2WGQA 3HOHA 3MKIA 1BSCA 1GS3A 4XM4A 1IT8A 1VQ83 1BSEA 1BSAA 5GSPA 2F4YA 1RLSA 1YJ93 1A2VA 1TP6A 3E99A 2OQEA 5BXQA 1LQGC 1OGZA 3LXUX 1IVUA 4WYKA 2IUKA 3B4OA 1N8QA 2FGTA 1YNVX 3JUNA 2XFTA 1FGQA 3OWUA 2JQ5A 5G1LA 5STDA 2CX1A 5I97A 1NB3I 2CIUA 4RNTA 1W6CA 6RNTA 3WDGB 1MOLA 4PEJA 3SYUA 2W56B 5EVHA 3GZBA 5JPUA 4G1MB 1RMSA 4MMZB 3MHEA 8CHOA 5IEPA 3MPHA 3H3HA 4N6OB 1YGEA 4I4KA 5D81A 5IEOA 2MF7A 2CH9A 1S723 1X1XA 3AMOA 3BIRA 4R4KA 3VF1A 3WOFB 7GSPA 2F56A 4FCZA 2LYXA 3FF0A 3MYTA 4XB5A 5IENA 1BUJA 1FUSA 1PFPA 1W5ZA 3G6E3 1YIT3 2ZL8A 1T5YA 3T8UA 1FGTA 1EUIC 1EQKA 1OF5A 2XGNA 1BVIA 5RNTA 1BSBA 4KVHA 1K41A 1UCIA 4LEHA 4HM4B 4IIAA 3CMA3 3DXOA 1LOWA 2P38A 1ROAA 2Q07A 2GSPA 2JDIH 3V92A 3I563 3SVAA 5IG3A 1QJGA 3FCSB 6STDA 4HM2B 2F86B 1RDSA 1MWTA 1OACA 1VQO3 3OX9A 1GD4A 1Q42A 2H0HA 4LMIA 4WYKB 4BL2A 4J8TA 4XDWA 2BO9B 2IMJA 2K0MA 3DGYA 5AEUB 4OK0A 4LYLB 4KFEA 2CG1A 5JPPA 3UNLA 2OOVC 3I553 3DH2A 3CCE3 2F5WA 1C7HA 3WODG 3AGOA 3EBTA 3VGNA 1GYBA 1V58A 3D5GA 4HM6B 1JN5A 4STDA 1ISKA 4XBYA 2OWPA 3L0RA 1IV9A 1RGHA 2KF6A 5CF1A 1Q824 1YVSA 3F40A 1GMRA 2RSXA 3GSPA 2BU4A 3K5TA 5FGOA 1TUHA 2H0GA 7STDA 3LH4A 1L5GB 3CCQ3 5CF2A 5BVBA 1WNHA 3K0ZA 2E2TA 1M1XB 2CFKA 3X3XA 3IJEB 3QK9A 1AVKA 1YJN3 1AR0A 2M7OA 5D82A 3RNTA 1JBRA 3BNDA 1V57A 4L7KA 1JB2A 1OCVA 3OW22 1DMQA 3KN4A 1NU3A 1I2FA 3CME3 1JB5A 5AIFA 2QIYA 1PYLA 1B21A 2Z6BA 1CH0A 2D1WA 1VQL3 1BU4A 2GBWB 1CYVA 1JNQA 3GZYB 3SOAA 1IT7A 1IV7A 4WP5A 3SEDA 1B2UA 2CFDA 1W2ZA 1O7GB 2ZDJA 3Q90A 3DZLA 4BTXA 2W56A 3KFQC 4ORLA 3BU4A 2KF4A 3X3YA 2FXTA 1TRPA 2Y73A 1IVWA 3LMLA 4RBNA 2OTL3 2QA43 2KCDA 3CCJ3 1NDOB 3RDEA 3WHOA 4HKVB 2RGQA 3TDGA 1A90A 2W9QA 3NM2A 3UJMA 1BIRA 2XSOB 2F98A 4TX4A 1QMAA 1RGAA 5CLKA 3CPOA 9RNTA 5IERA 4HJLB 3D9RA 2KF5A 1EEJA 1WMNA 2UUGC 1MWRA 1BANA 1Q7HA 1DVDA 2YFIB 5FW5A 4EC6A 1BAOA 3UL6A 3B8LA 2BT3A 5DRVA 3NXJA 2ML6A 1NNVA 3DUKA 3UB1A 1VQ73 1RRHA 1O7NB 1SPUA 2QGUA 3D3LA 5HOHA 3CC43 1DE3A 4J5GA 4N6NB 2XSHB 4O02B 1OHOA 1B20A 3HI7A 2HMNB 1ZS7A 3DGOA 2P0MA 1DYUA 1RHLA 1LQMB 1B27A 1TFOA 3EJVA 4L8PA 4HM1B 1A67A 4J5KA 1G96A 1OUNA 3ZG0A 1RGKA 3KIIA 1US1A 1X1UA 1X1YA 1WMPA 3SLUA 1M904 1W6GA 3A5EA 3MSOA 1QAFA 5DREA 2XFSA 3F7SA 3M8CA 1D6UA 4WHAA 2BMOB 1LOXA 5AI1A 1RNTA 1IU7A 1OHPA 1VQP3 5CXOA 2ZA4A 1IQYA 3MG2A 2SARA 4RNYA 1IQ8A 2XRXB
chains in the Genus database with same CATH topology
5BU4A 1Q9EA 1RGGA 1BNEA 2KAAA 3DGYA 4HOHA 1JBTA 3DH2A 1AQZA 1BRIA 2F5WA 3AGNA 3AGOA 4GHOA 1R4YA 1BNRA 3D5GA 1FUTA 1BNIA 1JBSA 1RGHA 2KF6A 1YVSA 1UCKA 1B2MA 1GMRA 1B2XA 1RGCA 2BU4A 3GSPA 1BGSA 1MGRA 1GMQA 1GSPA 2AADA 1X1WA 1PY3A 4BIRA 3RNTA 1JBRA 1GOUA 1LOYA 1RTUA 1TRQA 1I2FA 1RCKA 3AHWA 7RNTA 1PYLA 2C4BA 1B21A 1CH0A 1FYSA 1IYYA 1GOVA 1BU4A 3AHSA 1UCJA 1T2IA 1I3FA 3URPA 1BRKA 1I0VA 1LNIA 6GSPA 1B3SA 1GOYA 1RSNA 1B2UA 1BRJA 2AAEA 3HOHA 1BSDA 1RCLA 1BSCA 4HAAA 1RGFA 1ZGXA 3BU4A 1BSEA 2KF4A 8RNTA 1BSAA 5GSPA 1TRPA 2F4YA 1FW7A 1RLSA 1BNSA 1TTOA 1BNGA 1GMPA 3WHOA 1RGLA 1BNFA 1BIRA 1YNVX 2BIRA 1G02A 1RGAA 9RNTA 1MGWA 6RNTA 2KF5A 4RNTA 1BRHA 1I2GA 1SARA 1BANA 1I8VA 3SYUA 1BAOA 3Q3FA 3KCHA 1RN1A 1A2PA 2RNTA 1RMSA 1T2HA 1I3IA 1RGEA 5HOHA 1DE3A 1X1XA 4J5GA 3BIRA 1BOXA 7GSPA 1I2EA 2F56A 3D4AA 1RNBA 1I0XA 1B20A 1B2ZA 1BRSA 1BUJA 1BNJA 1FUSA 1AY7A 1RHLA 2RBIA 1B2SA 1B27A 1HYFA 4J5KA 5BIRA 2HOHA 1RGKA 1X1UA 2F5MA 1X1YA 1RN4A 3A5EA 1LOVA 4GSPA 1HZ1A 3WR2A 1FZUA 1UCLA 1BRNL 1BVIA 5RNTA 1BSBA 1UCIA 1LRAA 1I70A 1BRGA 1LOWA 1C54A 1RNTA 2KF3A 2GSPA 1DETA 4BU4A 2ZA4A 3D5IA 1YGWA 2SARA 1RDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BU4 A;  1Q9E A;  1RGG A;  1BNE A;  2KAA A;  3DGY A;  4HOH A;  1JBT A;  3DH2 A;  1AQZ A;  1BRI A;  2F5W A;  3AGN A;  3AGO A;  4GHO A;  1R4Y A;  1BNR A;  3D5G A;  1FUT A;  1BNI A;  1JBS A;  1RGH A;  2KF6 A;  1YVS A;  1UCK A;  1B2M A;  1GMR A;  1B2X A;  1RGC A;  2BU4 A;  3GSP A;  1BGS A;  1MGR A;  1GMQ A;  1GSP A;  2AAD A;  1X1W A;  1PY3 A;  4BIR A;  3RNT A;  1JBR A;  1GOU A;  1LOY A;  1RTU A;  1TRQ A;  1I2F A;  1RCK A;  3AHW A;  7RNT A;  1PYL A;  2C4B A;  1B21 A;  1CH0 A;  1FYS A;  1IYY A;  1GOV A;  1BU4 A;  3AHS A;  1UCJ A;  1T2I A;  1I3F A;  3URP A;  1BRK A;  1I0V A;  1LNI A;  6GSP A;  1B3S A;  1GOY A;  1RSN A;  1B2U A;  1BRJ A;  2AAE A;  3HOH A;  1BSD A;  1RCL A;  1BSC A;  4HAA A;  1RGF A;  1ZGX A;  3BU4 A;  1BSE A;  2KF4 A;  8RNT A;  1BSA A;  5GSP A;  1TRP A;  2F4Y A;  1FW7 A;  1RLS A;  1BNS A;  1TTO A;  1BNG A;  1GMP A;  3WHO A;  1RGL A;  1BNF A;  1BIR A;  1YNV X;  2BIR A;  1G02 A;  1RGA A;  9RNT A;  1MGW A;  6RNT A;  2KF5 A;  4RNT A;  1BRH A;  1I2G A;  1SAR A;  1BAN A;  1I8V A;  3SYU A;  1BAO A;  3Q3F A;  3KCH A;  1RN1 A;  1A2P A;  2RNT A;  1RMS A;  1T2H A;  1I3I A;  1RGE A;  5HOH A;  1DE3 A;  1X1X A;  4J5G A;  3BIR A;  1BOX A;  7GSP A;  1I2E A;  2F56 A;  3D4A A;  1RNB A;  1I0X A;  1B20 A;  1B2Z A;  1BRS A;  1BUJ A;  1BNJ A;  1FUS A;  1AY7 A;  1RHL A;  2RBI A;  1B2S A;  1B27 A;  1HYF A;  4J5K A;  5BIR A;  2HOH A;  1RGK A;  1X1U A;  2F5M A;  1X1Y A;  1RN4 A;  3A5E A;  1LOV A;  4GSP A;  1HZ1 A;  3WR2 A;  1FZU A;  1UCL A;  1BRN L;  1BVI A;  5RNT A;  1BSB A;  1UCI A;  1LRA A;  1I70 A;  1BRG A;  1LOW A;  1C54 A;  1RNT A;  2KF3 A;  2GSP A;  1DET A;  4BU4 A;  2ZA4 A;  3D5I A;  1YGW A;  2SAR A;  1RDS A; 
#chains in the Genus database with same CATH topology
 1TU5 A;  5BU4 A;  1FGR A;  1IDP A;  2L1S A;  2RCD A;  2XR8 B;  3OV4 A;  1VZZ A;  3CCM 3;  4NPB A;  2YX9 A;  5AIG A;  4MMY B;  3BLZ A;  3CU3 A;  2QEX 3;  2WOH A;  1GY5 A;  3LT9 A;  1GY7 A;  3AGN A;  3DY5 A;  1IVX A;  1R4Y A;  2ZHX B;  2WO0 A;  4WFO A;  1TFK A;  1FUT A;  1LXE A;  1ULJ B;  1HU9 A;  1W02 A;  3PXM A;  1W6Y A;  1QVF 2;  1UI8 A;  2K3D A;  2Z76 A;  3KKG A;  4HYZ A;  5AYS C;  1N8R 4;  1YHQ 3;  1BUQ A;  1B2X A;  1N5H A;  1RGC A;  2HMO B;  4FR9 A;  3OWY A;  4ILF A;  1K73 4;  3X42 A;  1SJW A;  1MGR A;  1G0T A;  3JUO A;  3I0Y A;  2AAD A;  4EXR A;  1LVN A;  2CX0 A;  1K28 A;  3F9S A;  1RKY A;  1WQL B;  1X1W A;  3B7C A;  3A76 A;  3G0K A;  3SOY A;  1GOU A;  3F7X A;  3U1W A;  1YJW 3;  1W2B 2;  2KXG A;  1JB4 A;  3KZT A;  3WOE B;  2GU3 A;  3DGL A;  1IYY A;  5AIH A;  1Q7Y 4;  1T2I A;  1V74 A;  2IY2 A;  2IA7 A;  4GB5 A;  1I3F A;  4RNZ A;  3NBJ A;  1YIJ 3;  4KZ1 A;  1B3S A;  3IMA B;  4HZ9 B;  4DKI A;  1RSN A;  4KFD A;  1Q40 A;  1KC8 4;  4XBX A;  2AAE A;  2K54 A;  1UGH I;  1ASK A;  3ALA A;  4HAA A;  4O8S A;  1Q81 4;  2CW9 A;  2CG0 A;  1RGF A;  2O3O A;  3ER7 A;  4EW5 A;  1FW7 A;  3GWR A;  1WTH A;  2FNQ A;  1RN7 A;  4O3V A;  4XBT A;  5AEW B;  3NQZ A;  1GMP A;  2BMQ B;  2J8X B;  2GU1 A;  4H3U A;  4HVN A;  1AV4 A;  1ZX2 A;  5A0O B;  1NWW A;  1BNF A;  2BIR A;  4EBG A;  3EC9 A;  4LZI A;  4BL3 A;  1GY6 A;  1FGM A;  3BNC A;  1RJO A;  4NRE A;  2W6J H;  3LTC A;  1SAR A;  3UL5 A;  1UUW B;  3NM7 A;  2W0Q A;  4AKZ A;  3BNE A;  3KSP A;  3CCS 3;  3Q3F A;  1STF I;  2W04 A;  1RN1 A;  2BNG A;  3EB8 A;  5IG0 A;  5KP3 A;  2UGI A;  3EN8 A;  1JV2 B;  1M9G A;  3CCV 3;  2CC3 A;  1J2B A;  3PS8 A;  4O2H A;  3CC7 3;  5TGN A;  4OUQ A;  1RGE A;  2YFJ B;  1SIH A;  2I9W A;  1QAL A;  3K7C A;  2CWU A;  3Q2P A;  1I2E A;  1RNB A;  3D4A A;  3FG1 A;  2CK3 H;  1B2Z A;  3IPT A;  1BRS A;  1FGO A;  1BNJ A;  3NBR A;  4Q53 A;  1AY7 A;  5ELU A;  2RBI A;  1B2S A;  3V99 A;  1FUW A;  2Y74 A;  5KP1 A;  1MWU A;  3OXA A;  5CK6 A;  2OOV A;  3DMC A;  3U97 A;  5BIR A;  2HOH A;  3SX1 A;  3EX9 A;  1VQ4 3;  1W7C A;  2YFL B;  3HII A;  3N9H A;  2WOF A;  1MWS A;  4HM8 B;  1HZ1 A;  3WR2 A;  3CXC 2;  3ECF A;  1FZU A;  1UCL A;  1Q40 B;  3CNX A;  5M19 A;  5LC7 A;  3T8N A;  1BRG A;  1DMM A;  1CEW I;  3PYJ A;  3EBY A;  3PCR A;  4BU4 A;  4N6V 0;  3G8Z A;  4X2O A;  1OPY A;  4CCV A;  1UUG B;  3EN1 B;  2CFL A;  3FG4 A;  3GZR A;  1Y4K A;  1O7M B;  4HM0 B;  4FCM A;  3EE1 A;  4MJD A;  2W03 A;  5IF6 A;  1T3B A;  2CHC A;  2E2V A;  4L8O A;  2KAA A;  2GEX A;  4WWU C;  4QWT A;  3JUP A;  1JBT A;  3FG3 A;  3JUM A;  1JZO A;  1BNR A;  3H51 A;  5IW9 A;  1VQK 3;  3X3Z A;  2V1L A;  3VSY A;  4ZM8 A;  1BNI A;  4IT7 A;  3F8X A;  1SII A;  1SQW A;  1AVL A;  1Z1S A;  3G16 A;  3RGA A;  1UCK A;  5ELJ A;  3FF2 A;  2CKF B;  5EQL A;  3LT8 A;  1BGS A;  2CWT A;  2GEY A;  3QRD A;  5EEO A;  2ML5 A;  1GMQ A;  1NJI 4;  2PNC A;  4R9L A;  2HMJ B;  1GSP A;  1YI2 3;  3S67 A;  2R41 A;  3PZW A;  3X41 A;  3BNB A;  4HZB B;  1F8N A;  3FH1 A;  4HM3 B;  2XGL A;  2PZV A;  1RTU A;  1TRQ A;  3CCR 3;  4GL6 A;  1D6Y A;  4CDL A;  1NB5 I;  3HIG A;  1K9M 4;  2E2U A;  1TIJ A;  2BHM A;  3HX8 A;  1RCK A;  3AHW A;  3N8B A;  5G2G A;  2C4B A;  2CFW A;  1GOV A;  2CWV A;  3AHS A;  3JVC A;  1UCJ A;  1IQX A;  5M1A A;  3FSD A;  4HM5 B;  2A15 A;  2UX0 A;  3N54 B;  2SBL A;  1D6Z A;  1I0V A;  6GSP A;  1EKM A;  1IK3 A;  1W00 A;  1JKG B;  1W4N A;  1QVG 2;  3NHX A;  1BRJ A;  3Q1C A;  5G1K A;  1RRL A;  1BSD A;  2D42 A;  1RCL A;  2GBX B;  4H61 A;  5D83 A;  3LTA A;  5IG4 A;  5M18 A;  1ZGX A;  5IG5 A;  1VQ6 3;  3GAX A;  8RNT A;  2Z7A A;  3ZFZ A;  3SXX A;  2RFR A;  4KFF A;  1KD1 4;  1BNS A;  2O9U X;  3K9M C;  1TTO A;  1BNG A;  1ULI B;  4LGQ A;  1K8A 4;  4K90 B;  2P05 A;  1FA3 A;  1RGL A;  3LZA A;  1VQN 3;  3NUV A;  1G02 A;  1CYU A;  1UW1 A;  3DGN A;  1UUV B;  1A2K A;  4R9K A;  3EF8 A;  1KWI A;  4R80 A;  3CD6 3;  1MGW A;  4OVM A;  1BRH A;  1I2G A;  1JRQ A;  5LC6 A;  1I8V A;  3KE7 A;  2IYJ A;  3ROB A;  4N6M A;  4X2H A;  3NBB A;  4AKY A;  3KCH A;  4IPB A;  2R4I A;  3V98 A;  1A2P A;  2B24 B;  2RNT A;  1YVB I;  3EHC A;  4CJN A;  4FMA A;  2W2C A;  4KT3 B;  4BTY A;  1E3R A;  1T2H A;  2XF3 A;  4FMC A;  2P09 A;  1I3I A;  1NO3 A;  2L4V A;  1KSI A;  5AYR B;  3WMD A;  3G4S 3;  1KQS 2;  1PU4 A;  3LTD A;  1BOX A;  1ROV A;  3FKA A;  4N6U A;  1M1K 4;  4FMD A;  1I0X A;  3B4P A;  3DGM A;  4N6T A;  4R1K A;  2HMM B;  1STD A;  3CPW 2;  1R4C A;  1HYF A;  3MWZ A;  3MG1 A;  4J9A A;  4I5Q A;  2C11 A;  1DMN A;  3OWS A;  2KRT A;  2F5M A;  1UGI A;  1WMO A;  1RN4 A;  1LOV A;  4GSP A;  3DM8 A;  3HZP A;  1BRN L;  1W01 A;  1MNL A;  2W9P A;  1LRA A;  4HM7 B;  1O7H B;  1I70 A;  4K1V A;  3S29 A;  3S5C A;  3CCL 3;  1C54 A;  2KF3 A;  3WA3 A;  1N9J A;  1TJD A;  3T0U A;  1DET A;  1JZD A;  2HMK B;  3AMO B;  2MC8 A;  3D5I A;  1VQQ A;  3FZW A;  1U8C B;  1YGW A;  1UI7 A;  2P0X A;  3NV0 A;  5HGR A;  2BMR B;  4N3V A;  4BTW A;  4CPK A;  1OGX A;  1ZO2 A;  2OCT A;  2XEP A;  1N5P A;  3NX0 A;  3X40 A;  2XH9 A;  2IUJ A;  3JUQ A;  4RZM A;  5JBS A;  1UDI I;  1EG9 B;  1Q9E A;  1RGG A;  2CFG A;  1BNE A;  1CQS A;  2OQE C;  1OHS A;  4U13 A;  1DVC A;  1E3V A;  1GD3 A;  3BB9 A;  2INX A;  3CNM A;  4HOH A;  4NHF A;  3KSE D;  1VQ9 3;  1AQZ A;  1BRI A;  1OF5 B;  1U5O A;  3HK4 A;  5AII A;  4K1U A;  4GHO A;  3S28 A;  3G71 3;  3EQQ B;  3WA2 X;  3GZX B;  5KP4 A;  4LSO A;  4HBR A;  1HKX A;  1QAK A;  1JBS A;  3LTB A;  4N6L A;  2GXF A;  3CC2 3;  4EV2 A;  1VQM 3;  3K63 A;  1B2M A;  4EYC A;  2F99 A;  3NQY A;  2OTJ 3;  1Q86 4;  1OH0 A;  4FMB A;  1JKG A;  1VQ5 3;  2HML B;  4JRF A;  2H0I A;  3LOY A;  1O7W B;  3RGR A;  4XDV A;  3F14 A;  3STD A;  1LNH A;  3FLJ A;  3FGY A;  3O8Y A;  1PY3 A;  1S5A A;  4BIR A;  4AEQ A;  1IVV A;  1LOY A;  3GRD A;  1EA2 A;  4EV5 A;  2STD A;  3PCS A;  3D79 A;  4K61 A;  3S27 A;  2LQV A;  2B1X B;  4MMX B;  1JJ2 2;  7RNT A;  1JN5 B;  4FCJ A;  1FYS A;  4JF8 A;  1N9E A;  3CCU 3;  4MEI A;  3F8H A;  1O7P B;  3URP A;  3ZG5 A;  3PGB A;  1BRK A;  1LNI A;  1GOY A;  3LYG A;  2WGO A;  1E97 A;  3MG3 A;  3J7Y d;  2C10 A;  2Z77 A;  3NV0 B;  2WGQ A;  3HOH A;  3MKI A;  1BSC A;  1GS3 A;  4XM4 A;  1IT8 A;  1VQ8 3;  1BSE A;  1BSA A;  5GSP A;  2F4Y A;  1RLS A;  1YJ9 3;  1A2V A;  1TP6 A;  3E99 A;  2OQE A;  5BXQ A;  1LQG C;  1OGZ A;  3LXU X;  1IVU A;  4WYK A;  2IUK A;  3B4O A;  1N8Q A;  2FGT A;  1YNV X;  3JUN A;  2XFT A;  1FGQ A;  3OWU A;  2JQ5 A;  5G1L A;  5STD A;  2CX1 A;  5I97 A;  1NB3 I;  2CIU A;  4RNT A;  1W6C A;  6RNT A;  3WDG B;  1MOL A;  4PEJ A;  3SYU A;  2W56 B;  5EVH A;  3GZB A;  5JPU A;  4G1M B;  1RMS A;  4MMZ B;  3MHE A;  8CHO A;  5IEP A;  3MPH A;  3H3H A;  4N6O B;  1YGE A;  4I4K A;  5D81 A;  5IEO A;  2MF7 A;  2CH9 A;  1S72 3;  1X1X A;  3AMO A;  3BIR A;  4R4K A;  3VF1 A;  3WOF B;  7GSP A;  2F56 A;  4FCZ A;  2LYX A;  3FF0 A;  3MYT A;  4XB5 A;  5IEN A;  1BUJ A;  1FUS A;  1PFP A;  1W5Z A;  3G6E 3;  1YIT 3;  2ZL8 A;  1T5Y A;  3T8U A;  1FGT A;  1EUI C;  1EQK A;  1OF5 A;  2XGN A;  1BVI A;  5RNT A;  1BSB A;  4KVH A;  1K41 A;  1UCI A;  4LEH A;  4HM4 B;  4IIA A;  3CMA 3;  3DXO A;  1LOW A;  2P38 A;  1ROA A;  2Q07 A;  2GSP A;  2JDI H;  3V92 A;  3I56 3;  3SVA A;  5IG3 A;  1QJG A;  3FCS B;  6STD A;  4HM2 B;  2F86 B;  1RDS A;  1MWT A;  1OAC A;  1VQO 3;  3OX9 A;  1GD4 A;  1Q42 A;  2H0H A;  4LMI A;  4WYK B;  4BL2 A;  4J8T A;  4XDW A;  2BO9 B;  2IMJ A;  2K0M A;  3DGY A;  5AEU B;  4OK0 A;  4LYL B;  4KFE A;  2CG1 A;  5JPP A;  3UNL A;  2OOV C;  3I55 3;  3DH2 A;  3CCE 3;  2F5W A;  1C7H A;  3WOD G;  3AGO A;  3EBT A;  3VGN A;  1GYB A;  1V58 A;  3D5G A;  4HM6 B;  1JN5 A;  4STD A;  1ISK A;  4XBY A;  2OWP A;  3L0R A;  1IV9 A;  1RGH A;  2KF6 A;  5CF1 A;  1Q82 4;  1YVS A;  3F40 A;  1GMR A;  2RSX A;  3GSP A;  2BU4 A;  3K5T A;  5FGO A;  1TUH A;  2H0G A;  7STD A;  3LH4 A;  1L5G B;  3CCQ 3;  5CF2 A;  5BVB A;  1WNH A;  3K0Z A;  2E2T A;  1M1X B;  2CFK A;  3X3X A;  3IJE B;  3QK9 A;  1AVK A;  1YJN 3;  1AR0 A;  2M7O A;  5D82 A;  3RNT A;  1JBR A;  3BND A;  1V57 A;  4L7K A;  1JB2 A;  1OCV A;  3OW2 2;  1DMQ A;  3KN4 A;  1NU3 A;  1I2F A;  3CME 3;  1JB5 A;  5AIF A;  2QIY A;  1PYL A;  1B21 A;  2Z6B A;  1CH0 A;  2D1W A;  1VQL 3;  1BU4 A;  2GBW B;  1CYV A;  1JNQ A;  3GZY B;  3SOA A;  1IT7 A;  1IV7 A;  4WP5 A;  3SED A;  1B2U A;  2CFD A;  1W2Z A;  1O7G B;  2ZDJ A;  3Q90 A;  3DZL A;  4BTX A;  2W56 A;  3KFQ C;  4ORL A;  3BU4 A;  2KF4 A;  3X3Y A;  2FXT A;  1TRP A;  2Y73 A;  1IVW A;  3LML A;  4RBN A;  2OTL 3;  2QA4 3;  2KCD A;  3CCJ 3;  1NDO B;  3RDE A;  3WHO A;  4HKV B;  2RGQ A;  3TDG A;  1A90 A;  2W9Q A;  3NM2 A;  3UJM A;  1BIR A;  2XSO B;  2F98 A;  4TX4 A;  1QMA A;  1RGA A;  5CLK A;  3CPO A;  9RNT A;  5IER A;  4HJL B;  3D9R A;  2KF5 A;  1EEJ A;  1WMN A;  2UUG C;  1MWR A;  1BAN A;  1Q7H A;  1DVD A;  2YFI B;  5FW5 A;  4EC6 A;  1BAO A;  3UL6 A;  3B8L A;  2BT3 A;  5DRV A;  3NXJ A;  2ML6 A;  1NNV A;  3DUK A;  3UB1 A;  1VQ7 3;  1RRH A;  1O7N B;  1SPU A;  2QGU A;  3D3L A;  5HOH A;  3CC4 3;  1DE3 A;  4J5G A;  4N6N B;  2XSH B;  4O02 B;  1OHO A;  1B20 A;  3HI7 A;  2HMN B;  1ZS7 A;  3DGO A;  2P0M A;  1DYU A;  1RHL A;  1LQM B;  1B27 A;  1TFO A;  3EJV A;  4L8P A;  4HM1 B;  1A67 A;  4J5K A;  1G96 A;  1OUN A;  3ZG0 A;  1RGK A;  3KII A;  1US1 A;  1X1U A;  1X1Y A;  1WMP A;  3SLU A;  1M90 4;  1W6G A;  3A5E A;  3MSO A;  1QAF A;  5DRE A;  2XFS A;  3F7S A;  3M8C A;  1D6U A;  4WHA A;  2BMO B;  1LOX A;  5AI1 A;  1RNT A;  1IU7 A;  1OHP A;  1VQP 3;  5CXO A;  2ZA4 A;  1IQY A;  3MG2 A;  2SAR A;  4RNY A;  1IQ8 A;  2XRX B; 
#chains in the Genus database with same CATH homology
 5BU4 A;  1Q9E A;  1RGG A;  1BNE A;  2KAA A;  3DGY A;  4HOH A;  1JBT A;  3DH2 A;  1AQZ A;  1BRI A;  2F5W A;  3AGN A;  3AGO A;  4GHO A;  1R4Y A;  1BNR A;  3D5G A;  1FUT A;  1BNI A;  1JBS A;  1RGH A;  2KF6 A;  1YVS A;  1UCK A;  1B2M A;  1GMR A;  1B2X A;  1RGC A;  2BU4 A;  3GSP A;  1BGS A;  1MGR A;  1GMQ A;  1GSP A;  2AAD A;  1X1W A;  1PY3 A;  4BIR A;  3RNT A;  1JBR A;  1GOU A;  1LOY A;  1RTU A;  1TRQ A;  1I2F A;  1RCK A;  3AHW A;  7RNT A;  1PYL A;  2C4B A;  1B21 A;  1CH0 A;  1FYS A;  1IYY A;  1GOV A;  1BU4 A;  3AHS A;  1UCJ A;  1T2I A;  1I3F A;  3URP A;  1BRK A;  1I0V A;  1LNI A;  6GSP A;  1B3S A;  1GOY A;  1RSN A;  1B2U A;  1BRJ A;  2AAE A;  3HOH A;  1BSD A;  1RCL A;  1BSC A;  4HAA A;  1RGF A;  1ZGX A;  3BU4 A;  1BSE A;  2KF4 A;  8RNT A;  1BSA A;  5GSP A;  1TRP A;  2F4Y A;  1FW7 A;  1RLS A;  1BNS A;  1TTO A;  1BNG A;  1GMP A;  3WHO A;  1RGL A;  1BNF A;  1BIR A;  1YNV X;  2BIR A;  1G02 A;  1RGA A;  9RNT A;  1MGW A;  6RNT A;  2KF5 A;  4RNT A;  1BRH A;  1I2G A;  1SAR A;  1BAN A;  1I8V A;  3SYU A;  1BAO A;  3Q3F A;  3KCH A;  1RN1 A;  1A2P A;  2RNT A;  1RMS A;  1T2H A;  1I3I A;  1RGE A;  5HOH A;  1DE3 A;  1X1X A;  4J5G A;  3BIR A;  1BOX A;  7GSP A;  1I2E A;  2F56 A;  3D4A A;  1RNB A;  1I0X A;  1B20 A;  1B2Z A;  1BRS A;  1BUJ A;  1BNJ A;  1FUS A;  1AY7 A;  1RHL A;  2RBI A;  1B2S A;  1B27 A;  1HYF A;  4J5K A;  5BIR A;  2HOH A;  1RGK A;  1X1U A;  2F5M A;  1X1Y A;  1RN4 A;  3A5E A;  1LOV A;  4GSP A;  1HZ1 A;  3WR2 A;  1FZU A;  1UCL A;  1BRN L;  1BVI A;  5RNT A;  1BSB A;  1UCI A;  1LRA A;  1I70 A;  1BRG A;  1LOW A;  1C54 A;  1RNT A;  2KF3 A;  2GSP A;  1DET A;  4BU4 A;  2ZA4 A;  3D5I A;  1YGW A;  2SAR A;  1RDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...