2F5MA

Cross-linked barnase soaked in bromo-ethanol
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease
publication title On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 27
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2f5mA00
1BSDA 2SARA 1UCLA 3URPA 1TTOA 2RBIA 1LOYA 1RDSA 3D5GA 3Q3FA 1GMRA 3A5EA 8RNTA 1B2MA 1B2SA 2KF4A 1BRSA 3AHSA 1BGSA 1BAOA 1GMPA 1RGEA 1X1YA 1LNIA 2BIRA 6GSPA 1I2GA 3GSPA 3AGOA 1BNJA 4RNTA 2RNTA 1BIRA 3D5IA 1BNIA 1C54A 3BU4A 1GSPA 1UCKA 1SARA 1GOVA 2C4BA 2GSPA 5BU4A 1GOUA 3WR2A 5HOHA 1MGRA 1BSCA 1T2HA 7GSPA 1JBSA 1B21A 2F4YA 3DGYA 1DETA 1I3FA 1JBRA 1I0VA 1RN1A 1A2PA 1RCKA 1RGGA 1BRJA 1BNRA 1RNTA 2ZA4A 3AHWA 4BIRA 1BANA 3D4AA 4HAAA 1CH0A 2AADA 1AY7A 1BRNL 1R4YA 1DE3A 1G02A 1TRQA 1T2IA 1BSAA 1Q9EA 1PY3A 3RNTA 4J5GA 5BIRA 1BSBA 1BRHA 1B20A 1I3IA 2BU4A 1BRIA 1GOYA 4J5KA 1FW7A 1RGAA 3HOHA 1RGKA 7RNTA 1RN4A 1BRKA 2KF5A 2F5MA 1BNSA 1UCIA 1LOWA 1BRGA 1BOXA 1RNBA 1B3SA 1GMQA 1HZ1A 1BU4A 2F5WA 2HOHA 1B2UA 1RMSA 4GHOA 1BSEA 1LRAA 1BNGA 1I0XA 6RNTA 1UCJA 3DH2A 2KF6A 4HOHA 1PYLA 1IYYA 1AQZA 1X1UA 1RLSA 1FYSA 1HYFA 1FUTA 2KF3A 3WHOA 1BNEA 1I2FA 2F56A 1FZUA 4BU4A 3SYUA 1YGWA 1I2EA 1RGLA 1TRPA 1I70A 1I8VA 1RGHA 5GSPA 1MGWA 3KCHA 1X1XA 1BUJA 1YNVX 5RNTA 2KAAA 1B2ZA 1RTUA 1BVIA 1B27A 1RCLA 3AGNA 1YVSA 3BIRA 1JBTA 1LOVA 1FUSA 1B2XA 1X1WA 1RSNA 1RGCA 1ZGXA 2AAEA 4GSPA 9RNTA 1BNFA 1RHLA 1RGFA
chains in the Genus database with same CATH superfamily
2Z77A 1W6YA 1QVF2 3PGBA 1O7GB 1E3VA 3LH4A 4N6V0 1M1XB 1JKGA 3FG4A 3GRDA 4KFEA 4L8PA 5AIGA 3VSYA 3X3YA 3NBBA 3OV4A 4KFDA 3B4PA 5KP4A 2WGQA 1ZX2A 3K63A 2B24B 1BRSA 4WYKB 3PXMA 2O3OA 3MG1A 2BNGA 3OW22 1W7CA 2YFJB 3DM8A 3JUMA 1X1YA 2BMRB 2HMJB 2W56B 3K0ZA 3SEDA 1VQ43 2CX1A 2IY2A 3CXC2 2O9UX 5M19A 1OF5A 2W04A 1ZO2A 3GWRA 3NM2A 3ZFZA 1BIRA 3NXJA 1UUVB 5BVBA 1BNIA 2Z6BA 3CNXA 1HKXA 2LYXA 1IVVA 3LXUX 2ML5A 2RCDA 1UCKA 2C4BA 1UGHI 4TX4A 4FMDA 2PNCA 3N9HA 2UGIA 3BNCA 2KRTA 4FMCA 3AMOB 3A76A 2XR8B 3OXAA 1JBSA 1LXEA 1O7WB 1M904 1GD4A 2F4YA 3DGYA 4FR9A 1I3FA 3CCU3 4R9LA 3D79A 3F7SA 1NWWA 3N8BA 1UUGB 4MMZB 2RGQA 5DREA 1RGGA 1BRJA 2ZA4A 3AHWA 3DGLA 8CHOA 4HAAA 1DMQA 3X40A 1WMOA 1DE3A 1R4YA 1S723 3CME3 1TRQA 3CCL3 4N6MA 3I563 1U8CB 1Q864 1OHOA 1VQP3 3WODG 3NX0A 4CPKA 3LTAA 3RNTA 4J5GA 3OWSA 2XEPA 4HM1B 4IIAA 3RGRA 1BSBA 4HYZA 1B20A 4DKIA 1W01A 1JB5A 1LQMB 1LQGC 3GZRA 2KXGA 3O8YA 1QVG2 2D1WA 1RRHA 4HM4B 1YJW3 2CWUA 2STDA 3HOHA 1MWRA 1E97A 4N6LA 5CXOA 3KFQC 2KF5A 1UUWB 5CF2A 2F5MA 2HMNB 1K8A4 1UCIA 1LOWA 1TUHA 1E3RA 1C7HA 1B3SA 3SOAA 4L7KA 4XB5A 1UDII 1HZ1A 1BU4A 2HOHA 4EXRA 2Y73A 4MMXB 3CC23 4GHOA 1BSEA 1LRAA 2CH9A 3DXOA 4X2OA 1FA3A 1LNHA 1A90A 1OUNA 1N5PA 2CW9A 3DH2A 2INXA 1VQ53 1AVKA 1UGIA 3B7CA 4HJLB 1PYLA 5AIFA 2CK3H 3FF2A 1ULIB 2UUGC 1RLSA 1GY6A 2KF3A 3NV0B 4CDLA 2F56A 1I2FA 1O7MB 2D42A 5M1AA 1M1K4 1Q7Y4 2GBWB 3LZAA 2CFWA 3DMCA 2JQ5A 3CCE3 6STDA 3D9RA 2WOHA 5GSPA 3EX9A 1A2KA 4O02B 1QJGA 1B2ZA 1SJWA 3FLJA 3LT8A 4WFOA 4EC6A 1G0TA 1B27A 3BIRA 3FF0A 3X41A 1NB5I 1FUSA 1OH0A 4BL2A 1B2XA 1K9M4 1ROAA 1RSNA 2AAEA 2OQEC 3D3LA 2L4VA 9RNTA 1GYBA 1O7PB 2FNQA 5IF6A 3KE7A 1RGFA 5G1LA 1BSDA 2K0MA 3NUVA 2SARA 3V92A 4BL3A 4EV5A 1NO3A 1W2B2 2RBIA 2OTL3 3F7XA 1S5AA 1RDSA 2RFRA 1Q40B 3MYTA 3FG3A 1IVXA 2YFLB 4N6OB 1UW1A 5D81A 4WHAA 8RNTA 3RDEA 1B2MA 3UJMA 3DGOA 2H0GA 3JUPA 4GL6A 1FGOA 2MF7A 5CK6A 2Z76A 2XSOB 3AHSA 4K1VA 4N3VA 3S27A 2GEXA 1K28A 2Q07A 3G16A 1BGSA 1BAOA 3FCSB 3CPW2 2IA7A 3CD63 4K90B 1TFKA 4N6TA 1EQKA 5AIHA 6GSPA 3BNEA 1I2GA 1SIHA 3AGOA 4RNTA 3CCV3 1NJI4 4K1UA 1CYUA 2V1LA 3D5IA 1C54A 1Z1SA 1JRQA 2CIUA 1GSPA 3LTDA 2QA43 2CX0A 1SARA 3FKAA 3WMDA 1GS3A 3QK9A 2HMMB 3Q90A 2HMKB 2CFLA 1L5GB 2K54A 1JB2A 1GOUA 2ML6A 2FGTA 1W02A 5HOHA 1N8R4 4MMYB 2ZDJA 2BT3A 1Q7HA 3LTCA 1LVNA 3PS8A 1RN1A 1RCKA 2P09A 4FCMA 1BNRA 3G0KA 1AV4A 3D4AA 3EE1A 1CH0A 5IG4A 5DRVA 1BRNL 1O7HB 3DGNA 3NQYA 1JNQA 2R4IA 3PCSA 3ROBA 1WQLB 5BIRA 2BU4A 2F98A 1FGRA 1N5HA 5IG0A 5AYSC 1W5ZA 1WMNA 1DMMA 3LYGA 1V57A 2HMOB 3BB9A 1RGKA 2IYJA 2KCDA 3FG1A 1KD14 4HM3B 1BRKA 2CKFB 2PZVA 2CFKA 2CWTA 4HBRA 1YIT3 1FUWA 1VQL3 2JDIH 1BOXA 1VQ93 3GZBA 3NV0A 4HZBB 4JF8A 5JPPA 1UI8A 1CEWI 2W9PA 3F8XA 1KQS2 7GSPA 2WO0A 1I0XA 6RNTA 1CYVA 3MKIA 2W6JH 1UCJA 1OHSA 2CWVA 1HU9A 4FCJA 4R9KA 3U97A 2OOVC 5A0OB 1N9JA 3NQZA 2H0IA 4LGQA 1X1UA 4FMBA 1FYSA 1HYFA 1FUTA 3CNMA 3K5TA 3WHOA 1BNEA 1TJDA 1WTHA 2XGNA 3T8UA 3HX8A 4HM7B 1FZUA 4RNYA 1SIIA 1W6CA 3SYUA 1YGWA 1I2EA 4PEJA 1RGLA 3JUQA 4NPBA 3G713 1I70A 1I8VA 1RGHA 3IJEB 3RGAA 2HMLB 1F8NA 5IG5A 1UI7A 3G4S3 3KSPA 1NU3A 5RNTA 1BUJA 2P0MA 1YIJ3 1RTUA 3KZTA 1BVIA 1MNLA 3WOFB 2L1SA 3X3XA 3CCJ3 1Q40A 1JBTA 1EG9B 2XSHB 4RZMA 3UL6A 3STDA 1RHLA 3IMAB 3DUKA 4LMIA 5KP1A 2RSXA 1IVUA 4R4KA 1FGTA 2C10A 1TTOA 3URPA 1JJ22 3HK4A 3D5GA 2LQVA 3B8LA 3Q3FA 2C11A 1GMRA 1ULJB 3A5EA 3EN8A 3LTBA 5ELUA 2IUJA 1OHPA 4O2HA 5KP3A 4H61A 4STDA 5ELJA 2KF4A 3BNBA 3SVAA 3I553 4ZM8A 2XFSA 4HM5B 2OTJ3 2Y74A 1IK3A 5D82A 4HKVB 3GSPA 3N54B 3ZG5A 1A2VA 4J9AA 1EA2A 2OQEA 4I4KA 5I97A 1VQ63 5IW9A 4NHFA 1WMPA 1JZDA 1GY7A 5AEWB 2P0XA 3BU4A 2CG1A 1JV2B 3EBTA 3F9SA 1T3BA 3K7CA 3KIIA 1ZS7A 1R4CA 3MWZA 1JN5B 3EF8A 4X2HA 3NM7A 3S5CA 4LZIA 1OPYA 4WWUC 5BU4A 3WR2A 1TU5A 1T2HA 2CFDA 1MOLA 4MJDA 1MWTA 3NHXA 4KVHA 5M18A 3FSDA 1G96A 1JBRA 1M9GA 1I0VA 1W4NA 3JUOA 3ECFA 4Q53A 4BIRA 3E99A 3LOYA 2BO9B 1Y4KA 1PFPA 3UL5A 4EBGA 3CCS3 4OK0A 2GEYA 2W03A 2I9WA 2YX9A 2GBXB 3ALAA 5FW5A 4AKYA 1YI23 1DVCA 1T2IA 5LC6A 4GB5A 4EYCA 1PY3A 4G1MB 4KFFA 3MHEA 5AYRB 1MWUA 1I3IA 3MPHA 2W2CA 3SOYA 1BRIA 4EV2A 1T5YA 3OWUA 2E2VA 3EHCA 3LMLA 1US1A 3S29A 4HM2B 1FW7A 1RGAA 2W0QA 2A15A 3ER7A 1RN4A 5TGNA 3DGMA 7RNTA 1DMNA 4HVNA 4LYLB 3G8ZA 4ILFA 1BNSA 5LC7A 5IG3A 1JZOA 2UX0A 1TFOA 3TDGA 3CC73 5EEOA 2XGLA 3BNDA 1N8QA 4O3VA 3X3ZA 1KSIA 2YFIB 5JPUA 2SBLA 3PCRA 1QMAA 1D6YA 1B2UA 3G6E3 1DVDA 1RMSA 1YVBI 5EVHA 5G2GA 3LT9A 1BNGA 1MWSA 4N6NB 3NBJA 4J8TA 1KC84 3K9MC 1AR0A 2E2UA 4WP5A 1PU4A 3J7Yd 2KF6A 5BXQA 5IEOA 1V58A 3FZWA 4OUQA 1IU7A 5D83A 3GAXA 5STDA 1YJN3 4EW5A 3CMA3 2MC8A 1YGEA 2P05A 1NNVA 1IQYA 3HIGA 1RKYA 3NBRA 2F86B 5IEPA 5JBSA 1TRPA 1A67A 1OACA 1MGWA 1W00A 3T8NA 1NDOB 1X1XA 1IVWA 2FXTA 4RNZA 1N9EA 1LOXA 2E2TA 2M7OA 3AGNA 1YVSA 3S67A 3MG3A 1LOVA 1WNHA 4XM4A 3B4OA 1STDA 1OGZA 2GU1A 4LSOA 2OOVA 3F14A 2K3DA 4CJNA 3EJVA 3EC9A 4OVMA 5CLKA 1RN7A 1KWIA 1BUQA 1UCLA 1AVLA 1U5OA 5FGOA 1OCVA 1LOYA 1VQM3 1IQ8A 1W2ZA 3JVCA 4FMAA 3WA2X 4AEQA 4LEHA 4CCVA 2BMQB 2QEX3 4XBXA 1B2SA 1TIJA 1GD3A 1ASKA 1GY5A 1SQWA 2CHCA 4KZ1A 3S28A 4N6UA 2W9QA 1GMPA 1JN5A 1RGEA 1LNIA 2BIRA 2IUKA 2WGOA 4K61A 2IMJA 3KN4A 3MG2A 1IQXA 1BNJA 1JKGB 3U1WA 1QALA 2RNTA 1IT7A 2GU3A 2CFGA 5AI1A 5AIIA 1IT8A 2Z7AA 1VQ73 4R80A 5G1KA 3WDGB 4H3UA 1D6ZA 3KSED 1GOVA 2GSPA 3H51A 3VGNA 2R41A 1W6GA 1EKMA 4U13A 3QRDA 1MGRA 1BSCA 1QAFA 1OF5B 1SPUA 1B21A 1STFI 3F40A 3SX1A 3X42A 1DETA 2B1XB 3GZXB 4AKZA 1DYUA 2XFTA 2CC3A 4QWTA 1VQ83 1A2PA 4FCZA 4JRFA 2OWPA 4XDWA 1FGQA 1RNTA 1BANA 1IV7A 3PYJA 4XDVA 1ISKA 2AADA 1AY7A 3FGYA 3Q2PA 1CQSA 2WOFA 1G02A 2H0HA 3H3HA 3EB8A 1IV9A 1BSAA 3EBYA 2ZL8A 2QIYA 3SXXA 4XBYA 1Q9EA 3CCQ3 4HZ9B 1TP6A 3OX9A 3IPTA 4IPBA 1BRHA 1GOYA 4J5KA 4I5QA 1Q42A 3CU3A 4KT3B 3T0UA 3UNLA 3KKGA 4IT7A 2OCTA 1QAKA 3DZLA 2XRXB 1OGXA 1BRGA 3V98A 2ZHXB 3CCR3 2BHMA 1RNBA 1VZZA 1Q824 1GMQA 1K41A 2F5WA 4ORLA 1NB3I 4R1KA 3ZG0A 4O8SA 4XBTA 3WOEB 3CCM3 1YHQ3 3PZWA 1FGMA 7STDA 1RRLA 3HIIA 5CF1A 1Q814 5AEUB 4WYKA 3MSOA 3WA3A 1EEJA 4BTWA 3SLUA 4HOHA 3VF1A 1D6UA 1AQZA 2F99A 1IYYA 1JB4A 2W56A 3OWYA 3F8HA 1J2BA 4HM6B 5EQLA 3FH1A 5IENA 3EN1B 3Q1CA 4HM8B 1VQK3 4BU4A 1VQO3 1ROVA 2P38A 4BTXA 3HI7A 4L8OA 3GZYB 3KCHA 3JUNA 3M8CA 5IERA 2XH9A 2GXFA 3DY5A 1K734 1YNVX 3HZPA 2KAAA 1VQN3 2CG0A 3CC43 4MEIA 1RCLA 2BMOB 1RJOA 4BTYA 3AMOA 3EQQB 4HM0B 4NREA 3UB1A 2QGUA 1O7NB 3V99A 1IDPA 1VQQA 1YJ93 1X1WA 1ZGXA 1RGCA 3BLZA 3I0YA 4RBNA 2J8XB 4GSPA 1EUIC 1V74A 5HGRA 3CPOA 1BNFA 3L0RA 2XF3A
chains in the Genus database with same CATH topology
1BSDA 2SARA 1UCLA 3URPA 1TTOA 2RBIA 1LOYA 1RDSA 3D5GA 3Q3FA 1GMRA 3A5EA 8RNTA 1B2MA 1B2SA 2KF4A 1BRSA 3AHSA 1BGSA 1BAOA 1GMPA 1RGEA 1X1YA 1LNIA 2BIRA 6GSPA 1I2GA 3GSPA 3AGOA 1BNJA 4RNTA 2RNTA 1BIRA 3D5IA 1BNIA 1C54A 3BU4A 1GSPA 1UCKA 1SARA 1GOVA 2C4BA 2GSPA 5BU4A 1GOUA 3WR2A 5HOHA 1MGRA 1BSCA 1T2HA 7GSPA 1JBSA 1B21A 2F4YA 3DGYA 1DETA 1I3FA 1JBRA 1I0VA 1RN1A 1A2PA 1RCKA 1RGGA 1BRJA 1BNRA 1RNTA 2ZA4A 3AHWA 4BIRA 1BANA 3D4AA 4HAAA 1CH0A 2AADA 1AY7A 1BRNL 1R4YA 1DE3A 1G02A 1TRQA 1T2IA 1BSAA 1Q9EA 1PY3A 3RNTA 4J5GA 5BIRA 1BSBA 1BRHA 1B20A 1I3IA 2BU4A 1BRIA 1GOYA 4J5KA 1FW7A 1RGAA 3HOHA 1RGKA 7RNTA 1RN4A 1BRKA 2KF5A 2F5MA 1BNSA 1UCIA 1LOWA 1BRGA 1BOXA 1RNBA 1B3SA 1GMQA 1HZ1A 1BU4A 2F5WA 2HOHA 1B2UA 1RMSA 4GHOA 1BSEA 1LRAA 1BNGA 1I0XA 6RNTA 1UCJA 3DH2A 2KF6A 4HOHA 1PYLA 1IYYA 1AQZA 1X1UA 1RLSA 1FYSA 1HYFA 1FUTA 2KF3A 3WHOA 1BNEA 1I2FA 2F56A 1FZUA 4BU4A 3SYUA 1YGWA 1I2EA 1RGLA 1TRPA 1I70A 1I8VA 1RGHA 5GSPA 1MGWA 3KCHA 1X1XA 1BUJA 1YNVX 5RNTA 2KAAA 1B2ZA 1RTUA 1BVIA 1B27A 1RCLA 3AGNA 1YVSA 3BIRA 1JBTA 1LOVA 1FUSA 1B2XA 1X1WA 1RSNA 1RGCA 1ZGXA 2AAEA 4GSPA 9RNTA 1BNFA 1RHLA 1RGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSD A;  2SAR A;  1UCL A;  3URP A;  1TTO A;  2RBI A;  1LOY A;  1RDS A;  3D5G A;  3Q3F A;  1GMR A;  3A5E A;  8RNT A;  1B2M A;  1B2S A;  2KF4 A;  1BRS A;  3AHS A;  1BGS A;  1BAO A;  1GMP A;  1RGE A;  1X1Y A;  1LNI A;  2BIR A;  6GSP A;  1I2G A;  3GSP A;  3AGO A;  1BNJ A;  4RNT A;  2RNT A;  1BIR A;  3D5I A;  1BNI A;  1C54 A;  3BU4 A;  1GSP A;  1UCK A;  1SAR A;  1GOV A;  2C4B A;  2GSP A;  5BU4 A;  1GOU A;  3WR2 A;  5HOH A;  1MGR A;  1BSC A;  1T2H A;  7GSP A;  1JBS A;  1B21 A;  2F4Y A;  3DGY A;  1DET A;  1I3F A;  1JBR A;  1I0V A;  1RN1 A;  1A2P A;  1RCK A;  1RGG A;  1BRJ A;  1BNR A;  1RNT A;  2ZA4 A;  3AHW A;  4BIR A;  1BAN A;  3D4A A;  4HAA A;  1CH0 A;  2AAD A;  1AY7 A;  1BRN L;  1R4Y A;  1DE3 A;  1G02 A;  1TRQ A;  1T2I A;  1BSA A;  1Q9E A;  1PY3 A;  3RNT A;  4J5G A;  5BIR A;  1BSB A;  1BRH A;  1B20 A;  1I3I A;  2BU4 A;  1BRI A;  1GOY A;  4J5K A;  1FW7 A;  1RGA A;  3HOH A;  1RGK A;  7RNT A;  1RN4 A;  1BRK A;  2KF5 A;  2F5M A;  1BNS A;  1UCI A;  1LOW A;  1BRG A;  1BOX A;  1RNB A;  1B3S A;  1GMQ A;  1HZ1 A;  1BU4 A;  2F5W A;  2HOH A;  1B2U A;  1RMS A;  4GHO A;  1BSE A;  1LRA A;  1BNG A;  1I0X A;  6RNT A;  1UCJ A;  3DH2 A;  2KF6 A;  4HOH A;  1PYL A;  1IYY A;  1AQZ A;  1X1U A;  1RLS A;  1FYS A;  1HYF A;  1FUT A;  2KF3 A;  3WHO A;  1BNE A;  1I2F A;  2F56 A;  1FZU A;  4BU4 A;  3SYU A;  1YGW A;  1I2E A;  1RGL A;  1TRP A;  1I70 A;  1I8V A;  1RGH A;  5GSP A;  1MGW A;  3KCH A;  1X1X A;  1BUJ A;  1YNV X;  5RNT A;  2KAA A;  1B2Z A;  1RTU A;  1BVI A;  1B27 A;  1RCL A;  3AGN A;  1YVS A;  3BIR A;  1JBT A;  1LOV A;  1FUS A;  1B2X A;  1X1W A;  1RSN A;  1RGC A;  1ZGX A;  2AAE A;  4GSP A;  9RNT A;  1BNF A;  1RHL A;  1RGF A; 
#chains in the Genus database with same CATH topology
 2Z77 A;  1W6Y A;  1QVF 2;  3PGB A;  1O7G B;  1E3V A;  3LH4 A;  4N6V 0;  1M1X B;  1JKG A;  3FG4 A;  3GRD A;  4KFE A;  4L8P A;  5AIG A;  3VSY A;  3X3Y A;  3NBB A;  3OV4 A;  4KFD A;  3B4P A;  5KP4 A;  2WGQ A;  1ZX2 A;  3K63 A;  2B24 B;  1BRS A;  4WYK B;  3PXM A;  2O3O A;  3MG1 A;  2BNG A;  3OW2 2;  1W7C A;  2YFJ B;  3DM8 A;  3JUM A;  1X1Y A;  2BMR B;  2HMJ B;  2W56 B;  3K0Z A;  3SED A;  1VQ4 3;  2CX1 A;  2IY2 A;  3CXC 2;  2O9U X;  5M19 A;  1OF5 A;  2W04 A;  1ZO2 A;  3GWR A;  3NM2 A;  3ZFZ A;  1BIR A;  3NXJ A;  1UUV B;  5BVB A;  1BNI A;  2Z6B A;  3CNX A;  1HKX A;  2LYX A;  1IVV A;  3LXU X;  2ML5 A;  2RCD A;  1UCK A;  2C4B A;  1UGH I;  4TX4 A;  4FMD A;  2PNC A;  3N9H A;  2UGI A;  3BNC A;  2KRT A;  4FMC A;  3AMO B;  3A76 A;  2XR8 B;  3OXA A;  1JBS A;  1LXE A;  1O7W B;  1M90 4;  1GD4 A;  2F4Y A;  3DGY A;  4FR9 A;  1I3F A;  3CCU 3;  4R9L A;  3D79 A;  3F7S A;  1NWW A;  3N8B A;  1UUG B;  4MMZ B;  2RGQ A;  5DRE A;  1RGG A;  1BRJ A;  2ZA4 A;  3AHW A;  3DGL A;  8CHO A;  4HAA A;  1DMQ A;  3X40 A;  1WMO A;  1DE3 A;  1R4Y A;  1S72 3;  3CME 3;  1TRQ A;  3CCL 3;  4N6M A;  3I56 3;  1U8C B;  1Q86 4;  1OHO A;  1VQP 3;  3WOD G;  3NX0 A;  4CPK A;  3LTA A;  3RNT A;  4J5G A;  3OWS A;  2XEP A;  4HM1 B;  4IIA A;  3RGR A;  1BSB A;  4HYZ A;  1B20 A;  4DKI A;  1W01 A;  1JB5 A;  1LQM B;  1LQG C;  3GZR A;  2KXG A;  3O8Y A;  1QVG 2;  2D1W A;  1RRH A;  4HM4 B;  1YJW 3;  2CWU A;  2STD A;  3HOH A;  1MWR A;  1E97 A;  4N6L A;  5CXO A;  3KFQ C;  2KF5 A;  1UUW B;  5CF2 A;  2F5M A;  2HMN B;  1K8A 4;  1UCI A;  1LOW A;  1TUH A;  1E3R A;  1C7H A;  1B3S A;  3SOA A;  4L7K A;  4XB5 A;  1UDI I;  1HZ1 A;  1BU4 A;  2HOH A;  4EXR A;  2Y73 A;  4MMX B;  3CC2 3;  4GHO A;  1BSE A;  1LRA A;  2CH9 A;  3DXO A;  4X2O A;  1FA3 A;  1LNH A;  1A90 A;  1OUN A;  1N5P A;  2CW9 A;  3DH2 A;  2INX A;  1VQ5 3;  1AVK A;  1UGI A;  3B7C A;  4HJL B;  1PYL A;  5AIF A;  2CK3 H;  3FF2 A;  1ULI B;  2UUG C;  1RLS A;  1GY6 A;  2KF3 A;  3NV0 B;  4CDL A;  2F56 A;  1I2F A;  1O7M B;  2D42 A;  5M1A A;  1M1K 4;  1Q7Y 4;  2GBW B;  3LZA A;  2CFW A;  3DMC A;  2JQ5 A;  3CCE 3;  6STD A;  3D9R A;  2WOH A;  5GSP A;  3EX9 A;  1A2K A;  4O02 B;  1QJG A;  1B2Z A;  1SJW A;  3FLJ A;  3LT8 A;  4WFO A;  4EC6 A;  1G0T A;  1B27 A;  3BIR A;  3FF0 A;  3X41 A;  1NB5 I;  1FUS A;  1OH0 A;  4BL2 A;  1B2X A;  1K9M 4;  1ROA A;  1RSN A;  2AAE A;  2OQE C;  3D3L A;  2L4V A;  9RNT A;  1GYB A;  1O7P B;  2FNQ A;  5IF6 A;  3KE7 A;  1RGF A;  5G1L A;  1BSD A;  2K0M A;  3NUV A;  2SAR A;  3V92 A;  4BL3 A;  4EV5 A;  1NO3 A;  1W2B 2;  2RBI A;  2OTL 3;  3F7X A;  1S5A A;  1RDS A;  2RFR A;  1Q40 B;  3MYT A;  3FG3 A;  1IVX A;  2YFL B;  4N6O B;  1UW1 A;  5D81 A;  4WHA A;  8RNT A;  3RDE A;  1B2M A;  3UJM A;  3DGO A;  2H0G A;  3JUP A;  4GL6 A;  1FGO A;  2MF7 A;  5CK6 A;  2Z76 A;  2XSO B;  3AHS A;  4K1V A;  4N3V A;  3S27 A;  2GEX A;  1K28 A;  2Q07 A;  3G16 A;  1BGS A;  1BAO A;  3FCS B;  3CPW 2;  2IA7 A;  3CD6 3;  4K90 B;  1TFK A;  4N6T A;  1EQK A;  5AIH A;  6GSP A;  3BNE A;  1I2G A;  1SIH A;  3AGO A;  4RNT A;  3CCV 3;  1NJI 4;  4K1U A;  1CYU A;  2V1L A;  3D5I A;  1C54 A;  1Z1S A;  1JRQ A;  2CIU A;  1GSP A;  3LTD A;  2QA4 3;  2CX0 A;  1SAR A;  3FKA A;  3WMD A;  1GS3 A;  3QK9 A;  2HMM B;  3Q90 A;  2HMK B;  2CFL A;  1L5G B;  2K54 A;  1JB2 A;  1GOU A;  2ML6 A;  2FGT A;  1W02 A;  5HOH A;  1N8R 4;  4MMY B;  2ZDJ A;  2BT3 A;  1Q7H A;  3LTC A;  1LVN A;  3PS8 A;  1RN1 A;  1RCK A;  2P09 A;  4FCM A;  1BNR A;  3G0K A;  1AV4 A;  3D4A A;  3EE1 A;  1CH0 A;  5IG4 A;  5DRV A;  1BRN L;  1O7H B;  3DGN A;  3NQY A;  1JNQ A;  2R4I A;  3PCS A;  3ROB A;  1WQL B;  5BIR A;  2BU4 A;  2F98 A;  1FGR A;  1N5H A;  5IG0 A;  5AYS C;  1W5Z A;  1WMN A;  1DMM A;  3LYG A;  1V57 A;  2HMO B;  3BB9 A;  1RGK A;  2IYJ A;  2KCD A;  3FG1 A;  1KD1 4;  4HM3 B;  1BRK A;  2CKF B;  2PZV A;  2CFK A;  2CWT A;  4HBR A;  1YIT 3;  1FUW A;  1VQL 3;  2JDI H;  1BOX A;  1VQ9 3;  3GZB A;  3NV0 A;  4HZB B;  4JF8 A;  5JPP A;  1UI8 A;  1CEW I;  2W9P A;  3F8X A;  1KQS 2;  7GSP A;  2WO0 A;  1I0X A;  6RNT A;  1CYV A;  3MKI A;  2W6J H;  1UCJ A;  1OHS A;  2CWV A;  1HU9 A;  4FCJ A;  4R9K A;  3U97 A;  2OOV C;  5A0O B;  1N9J A;  3NQZ A;  2H0I A;  4LGQ A;  1X1U A;  4FMB A;  1FYS A;  1HYF A;  1FUT A;  3CNM A;  3K5T A;  3WHO A;  1BNE A;  1TJD A;  1WTH A;  2XGN A;  3T8U A;  3HX8 A;  4HM7 B;  1FZU A;  4RNY A;  1SII A;  1W6C A;  3SYU A;  1YGW A;  1I2E A;  4PEJ A;  1RGL A;  3JUQ A;  4NPB A;  3G71 3;  1I70 A;  1I8V A;  1RGH A;  3IJE B;  3RGA A;  2HML B;  1F8N A;  5IG5 A;  1UI7 A;  3G4S 3;  3KSP A;  1NU3 A;  5RNT A;  1BUJ A;  2P0M A;  1YIJ 3;  1RTU A;  3KZT A;  1BVI A;  1MNL A;  3WOF B;  2L1S A;  3X3X A;  3CCJ 3;  1Q40 A;  1JBT A;  1EG9 B;  2XSH B;  4RZM A;  3UL6 A;  3STD A;  1RHL A;  3IMA B;  3DUK A;  4LMI A;  5KP1 A;  2RSX A;  1IVU A;  4R4K A;  1FGT A;  2C10 A;  1TTO A;  3URP A;  1JJ2 2;  3HK4 A;  3D5G A;  2LQV A;  3B8L A;  3Q3F A;  2C11 A;  1GMR A;  1ULJ B;  3A5E A;  3EN8 A;  3LTB A;  5ELU A;  2IUJ A;  1OHP A;  4O2H A;  5KP3 A;  4H61 A;  4STD A;  5ELJ A;  2KF4 A;  3BNB A;  3SVA A;  3I55 3;  4ZM8 A;  2XFS A;  4HM5 B;  2OTJ 3;  2Y74 A;  1IK3 A;  5D82 A;  4HKV B;  3GSP A;  3N54 B;  3ZG5 A;  1A2V A;  4J9A A;  1EA2 A;  2OQE A;  4I4K A;  5I97 A;  1VQ6 3;  5IW9 A;  4NHF A;  1WMP A;  1JZD A;  1GY7 A;  5AEW B;  2P0X A;  3BU4 A;  2CG1 A;  1JV2 B;  3EBT A;  3F9S A;  1T3B A;  3K7C A;  3KII A;  1ZS7 A;  1R4C A;  3MWZ A;  1JN5 B;  3EF8 A;  4X2H A;  3NM7 A;  3S5C A;  4LZI A;  1OPY A;  4WWU C;  5BU4 A;  3WR2 A;  1TU5 A;  1T2H A;  2CFD A;  1MOL A;  4MJD A;  1MWT A;  3NHX A;  4KVH A;  5M18 A;  3FSD A;  1G96 A;  1JBR A;  1M9G A;  1I0V A;  1W4N A;  3JUO A;  3ECF A;  4Q53 A;  4BIR A;  3E99 A;  3LOY A;  2BO9 B;  1Y4K A;  1PFP A;  3UL5 A;  4EBG A;  3CCS 3;  4OK0 A;  2GEY A;  2W03 A;  2I9W A;  2YX9 A;  2GBX B;  3ALA A;  5FW5 A;  4AKY A;  1YI2 3;  1DVC A;  1T2I A;  5LC6 A;  4GB5 A;  4EYC A;  1PY3 A;  4G1M B;  4KFF A;  3MHE A;  5AYR B;  1MWU A;  1I3I A;  3MPH A;  2W2C A;  3SOY A;  1BRI A;  4EV2 A;  1T5Y A;  3OWU A;  2E2V A;  3EHC A;  3LML A;  1US1 A;  3S29 A;  4HM2 B;  1FW7 A;  1RGA A;  2W0Q A;  2A15 A;  3ER7 A;  1RN4 A;  5TGN A;  3DGM A;  7RNT A;  1DMN A;  4HVN A;  4LYL B;  3G8Z A;  4ILF A;  1BNS A;  5LC7 A;  5IG3 A;  1JZO A;  2UX0 A;  1TFO A;  3TDG A;  3CC7 3;  5EEO A;  2XGL A;  3BND A;  1N8Q A;  4O3V A;  3X3Z A;  1KSI A;  2YFI B;  5JPU A;  2SBL A;  3PCR A;  1QMA A;  1D6Y A;  1B2U A;  3G6E 3;  1DVD A;  1RMS A;  1YVB I;  5EVH A;  5G2G A;  3LT9 A;  1BNG A;  1MWS A;  4N6N B;  3NBJ A;  4J8T A;  1KC8 4;  3K9M C;  1AR0 A;  2E2U A;  4WP5 A;  1PU4 A;  3J7Y d;  2KF6 A;  5BXQ A;  5IEO A;  1V58 A;  3FZW A;  4OUQ A;  1IU7 A;  5D83 A;  3GAX A;  5STD A;  1YJN 3;  4EW5 A;  3CMA 3;  2MC8 A;  1YGE A;  2P05 A;  1NNV A;  1IQY A;  3HIG A;  1RKY A;  3NBR A;  2F86 B;  5IEP A;  5JBS A;  1TRP A;  1A67 A;  1OAC A;  1MGW A;  1W00 A;  3T8N A;  1NDO B;  1X1X A;  1IVW A;  2FXT A;  4RNZ A;  1N9E A;  1LOX A;  2E2T A;  2M7O A;  3AGN A;  1YVS A;  3S67 A;  3MG3 A;  1LOV A;  1WNH A;  4XM4 A;  3B4O A;  1STD A;  1OGZ A;  2GU1 A;  4LSO A;  2OOV A;  3F14 A;  2K3D A;  4CJN A;  3EJV A;  3EC9 A;  4OVM A;  5CLK A;  1RN7 A;  1KWI A;  1BUQ A;  1UCL A;  1AVL A;  1U5O A;  5FGO A;  1OCV A;  1LOY A;  1VQM 3;  1IQ8 A;  1W2Z A;  3JVC A;  4FMA A;  3WA2 X;  4AEQ A;  4LEH A;  4CCV A;  2BMQ B;  2QEX 3;  4XBX A;  1B2S A;  1TIJ A;  1GD3 A;  1ASK A;  1GY5 A;  1SQW A;  2CHC A;  4KZ1 A;  3S28 A;  4N6U A;  2W9Q A;  1GMP A;  1JN5 A;  1RGE A;  1LNI A;  2BIR A;  2IUK A;  2WGO A;  4K61 A;  2IMJ A;  3KN4 A;  3MG2 A;  1IQX A;  1BNJ A;  1JKG B;  3U1W A;  1QAL A;  2RNT A;  1IT7 A;  2GU3 A;  2CFG A;  5AI1 A;  5AII A;  1IT8 A;  2Z7A A;  1VQ7 3;  4R80 A;  5G1K A;  3WDG B;  4H3U A;  1D6Z A;  3KSE D;  1GOV A;  2GSP A;  3H51 A;  3VGN A;  2R41 A;  1W6G A;  1EKM A;  4U13 A;  3QRD A;  1MGR A;  1BSC A;  1QAF A;  1OF5 B;  1SPU A;  1B21 A;  1STF I;  3F40 A;  3SX1 A;  3X42 A;  1DET A;  2B1X B;  3GZX B;  4AKZ A;  1DYU A;  2XFT A;  2CC3 A;  4QWT A;  1VQ8 3;  1A2P A;  4FCZ A;  4JRF A;  2OWP A;  4XDW A;  1FGQ A;  1RNT A;  1BAN A;  1IV7 A;  3PYJ A;  4XDV A;  1ISK A;  2AAD A;  1AY7 A;  3FGY A;  3Q2P A;  1CQS A;  2WOF A;  1G02 A;  2H0H A;  3H3H A;  3EB8 A;  1IV9 A;  1BSA A;  3EBY A;  2ZL8 A;  2QIY A;  3SXX A;  4XBY A;  1Q9E A;  3CCQ 3;  4HZ9 B;  1TP6 A;  3OX9 A;  3IPT A;  4IPB A;  1BRH A;  1GOY A;  4J5K A;  4I5Q A;  1Q42 A;  3CU3 A;  4KT3 B;  3T0U A;  3UNL A;  3KKG A;  4IT7 A;  2OCT A;  1QAK A;  3DZL A;  2XRX B;  1OGX A;  1BRG A;  3V98 A;  2ZHX B;  3CCR 3;  2BHM A;  1RNB A;  1VZZ A;  1Q82 4;  1GMQ A;  1K41 A;  2F5W A;  4ORL A;  1NB3 I;  4R1K A;  3ZG0 A;  4O8S A;  4XBT A;  3WOE B;  3CCM 3;  1YHQ 3;  3PZW A;  1FGM A;  7STD A;  1RRL A;  3HII A;  5CF1 A;  1Q81 4;  5AEU B;  4WYK A;  3MSO A;  3WA3 A;  1EEJ A;  4BTW A;  3SLU A;  4HOH A;  3VF1 A;  1D6U A;  1AQZ A;  2F99 A;  1IYY A;  1JB4 A;  2W56 A;  3OWY A;  3F8H A;  1J2B A;  4HM6 B;  5EQL A;  3FH1 A;  5IEN A;  3EN1 B;  3Q1C A;  4HM8 B;  1VQK 3;  4BU4 A;  1VQO 3;  1ROV A;  2P38 A;  4BTX A;  3HI7 A;  4L8O A;  3GZY B;  3KCH A;  3JUN A;  3M8C A;  5IER A;  2XH9 A;  2GXF A;  3DY5 A;  1K73 4;  1YNV X;  3HZP A;  2KAA A;  1VQN 3;  2CG0 A;  3CC4 3;  4MEI A;  1RCL A;  2BMO B;  1RJO A;  4BTY A;  3AMO A;  3EQQ B;  4HM0 B;  4NRE A;  3UB1 A;  2QGU A;  1O7N B;  3V99 A;  1IDP A;  1VQQ A;  1YJ9 3;  1X1W A;  1ZGX A;  1RGC A;  3BLZ A;  3I0Y A;  4RBN A;  2J8X B;  4GSP A;  1EUI C;  1V74 A;  5HGR A;  3CPO A;  1BNF A;  3L0R A;  2XF3 A; 
#chains in the Genus database with same CATH homology
 1BSD A;  2SAR A;  1UCL A;  3URP A;  1TTO A;  2RBI A;  1LOY A;  1RDS A;  3D5G A;  3Q3F A;  1GMR A;  3A5E A;  8RNT A;  1B2M A;  1B2S A;  2KF4 A;  1BRS A;  3AHS A;  1BGS A;  1BAO A;  1GMP A;  1RGE A;  1X1Y A;  1LNI A;  2BIR A;  6GSP A;  1I2G A;  3GSP A;  3AGO A;  1BNJ A;  4RNT A;  2RNT A;  1BIR A;  3D5I A;  1BNI A;  1C54 A;  3BU4 A;  1GSP A;  1UCK A;  1SAR A;  1GOV A;  2C4B A;  2GSP A;  5BU4 A;  1GOU A;  3WR2 A;  5HOH A;  1MGR A;  1BSC A;  1T2H A;  7GSP A;  1JBS A;  1B21 A;  2F4Y A;  3DGY A;  1DET A;  1I3F A;  1JBR A;  1I0V A;  1RN1 A;  1A2P A;  1RCK A;  1RGG A;  1BRJ A;  1BNR A;  1RNT A;  2ZA4 A;  3AHW A;  4BIR A;  1BAN A;  3D4A A;  4HAA A;  1CH0 A;  2AAD A;  1AY7 A;  1BRN L;  1R4Y A;  1DE3 A;  1G02 A;  1TRQ A;  1T2I A;  1BSA A;  1Q9E A;  1PY3 A;  3RNT A;  4J5G A;  5BIR A;  1BSB A;  1BRH A;  1B20 A;  1I3I A;  2BU4 A;  1BRI A;  1GOY A;  4J5K A;  1FW7 A;  1RGA A;  3HOH A;  1RGK A;  7RNT A;  1RN4 A;  1BRK A;  2KF5 A;  2F5M A;  1BNS A;  1UCI A;  1LOW A;  1BRG A;  1BOX A;  1RNB A;  1B3S A;  1GMQ A;  1HZ1 A;  1BU4 A;  2F5W A;  2HOH A;  1B2U A;  1RMS A;  4GHO A;  1BSE A;  1LRA A;  1BNG A;  1I0X A;  6RNT A;  1UCJ A;  3DH2 A;  2KF6 A;  4HOH A;  1PYL A;  1IYY A;  1AQZ A;  1X1U A;  1RLS A;  1FYS A;  1HYF A;  1FUT A;  2KF3 A;  3WHO A;  1BNE A;  1I2F A;  2F56 A;  1FZU A;  4BU4 A;  3SYU A;  1YGW A;  1I2E A;  1RGL A;  1TRP A;  1I70 A;  1I8V A;  1RGH A;  5GSP A;  1MGW A;  3KCH A;  1X1X A;  1BUJ A;  1YNV X;  5RNT A;  2KAA A;  1B2Z A;  1RTU A;  1BVI A;  1B27 A;  1RCL A;  3AGN A;  1YVS A;  3BIR A;  1JBT A;  1LOV A;  1FUS A;  1B2X A;  1X1W A;  1RSN A;  1RGC A;  1ZGX A;  2AAE A;  4GSP A;  9RNT A;  1BNF A;  1RHL A;  1RGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...