2F5MA

Cross-linked barnase soaked in bromo-ethanol
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 27
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2f5mA00
1I2GA 1B27A 1A2PA 5HOHA 2RNTA 1RHLA 1BNEA 1RNBA 4GHOA 1CH0A 2C4BA 1RGCA 3WR2A 1RN4A 1GSPA 1UCLA 5GSPA 1BRNL 1B2SA 1IYYA 1BSBA 1G02A 1LRAA 1UCIA 1UCKA 1I3FA 1RGHA 1RCLA 1YVSA 1RGGA 7GSPA 2F4YA 1FUSA 1BOXA 1X1XA 1RGAA 1FW7A 1LOYA 1BNFA 1RMSA 1GOVA 1BIRA 1FUTA 1TRQA 3DH2A 1B2ZA 1T2HA 1BSEA 1GOYA 1I2EA 1BNSA 1YGWA 2F5WA 3SYUA 1FZUA 1ZGXA 3AGNA 2GSPA 2KF4A 1BNRA 1BU4A 1BSDA 1BANA 1B21A 1I2FA 1RGLA 4GSPA 4HOHA 1JBTA 1RNTA 2KF3A 3BU4A 5BIRA 1BSCA 2AADA 1AQZA 1GOUA 3AHWA 3AHSA 1R4YA 2SARA 2RBIA 1BNGA 4BU4A 1BNJA 1BSAA 1C54A 1BGSA 3D5GA 1RLSA 1RDSA 1HZ1A 4BIRA 1BRSA 5BU4A 1GMPA 1I3IA 1X1WA 1JBSA 1MGWA 1GMQA 2AAEA 1YNVX 3RNTA 2F5MA 1DE3A 6GSPA 1RGKA 1X1UA 3AGOA 2KAAA 2BIRA 3Q3FA 4J5GA 4RNTA 6RNTA 7RNTA 1TRPA 3BIRA 4HAAA 1PYLA 1B2MA 1B3SA 9RNTA 1BRKA 3D4AA 4J5KA 2F56A 1Q9EA 1HYFA 1I70A 1GMRA 2BU4A 1RCKA 1UCJA 1B20A 1LOVA 1BRIA 1RGFA 3URPA 8RNTA 1MGRA 1TTOA 3D5IA 3KCHA 1BRHA 1RN1A 1B2UA 3A5EA 1T2IA 1I0XA 1BNIA 1AY7A 1PY3A 1RSNA 1I0VA 1X1YA 3HOHA 1LOWA 1SARA 1JBRA 1DETA 2KF6A 1I8VA 1BRGA 2KF5A 2ZA4A 1BAOA 3GSPA 3WHOA 1B2XA 2HOHA 1RTUA 3DGYA 1FYSA 1BVIA 1BRJA 1LNIA 5RNTA 1BUJA 1RGEA
chains in the Genus database with same CATH superfamily
3CCS3 1B27A 2BMOB 1K734 1QALA 2RNTA 3IMAB 1RHLA 1BNEA 1O7HB 3IPTA 1QAKA 2C4BA 5M18A 1FGRA 1QAFA 5DREA 2FXTA 1GSPA 3NUVA 1QVG2 3LT9A 3HIGA 3FF0A 1JB5A 2WOHA 1FGOA 1LRAA 3B7CA 1EUIC 1PU4A 1KWIA 2E2UA 3PCRA 4KFDA 3OV4A 3EB8A 3QRDA 4N6TA 4BTYA 5STDA 4N6OB 1T5YA 3CCQ3 1RGGA 1W7CA 1FGTA 3RGRA 1FUSA 1IQXA 1WTHA 2CFWA 5G1KA 3F7SA 3X41A 2CFKA 3D9RA 3K9MC 1TRQA 2E2VA 3DH2A 1D6YA 3CCR3 2XGNA 1BSEA 2IMJA 3G713 3B4OA 5EEOA 3CNMA 2GEYA 1AV4A 1FZUA 3SYUA 2CG1A 3WODG 1S723 3AMOB 1YIJ3 2W56B 3EN1B 1BSDA 3FG3A 2P09A 1BANA 4HM2B 1OUNA 1AR0A 3DGLA 3GWRA 2OOVA 4GSPA 1W02A 1RNTA 1YGEA 5BIRA 3N8BA 4N6UA 1VQ43 3UB1A 1GOUA 3ZG5A 2OTJ3 5LC7A 1SIIA 1U8CB 1EEJA 1MWUA 2Z6BA 4BU4A 3UL6A 1YJW3 1Q7Y4 1BGSA 5AIIA 3F40A 2B1XB 1HZ1A 1LOXA 3FF2A 1BRSA 5IG0A 1I3IA 7STDA 1VQO3 4PEJA 2W03A 4J8TA 1K41A 2CFLA 3BLZA 5AYSC 3X42A 2HMNB 6GSPA 4LGQA 2KAAA 1VZZA 2BIRA 3FKAA 3Q3FA 2OQEC 6RNTA 1TRPA 2O9UX 1W5ZA 1E3VA 4XB5A 4BTXA 9RNTA 1RN7A 1N5HA 3V99A 3KIIA 5JPUA 1JRQA 2KCDA 1JKGB 1WMNA 2CX0A 2MF7A 1A90A 2KRTA 5G1LA 2JQ5A 5A0OB 1JN5A 4WYKA 2CWTA 3LZAA 5IG3A 1TFOA 1VQM3 3JUPA 3NV0A 1BRIA 4N6LA 3S28A 4LEHA 3ZG0A 5FGOA 3DXOA 1G0TA 3CU3A 3T8NA 1DMQA 3HX8A 4XBXA 1BUQA 1MNLA 1RRLA 2K3DA 1KSIA 1STDA 2BMRB 1SQWA 4KT3B 5TGNA 3VF1A 1YJN3 1BNIA 1VQ83 1MWRA 5IG5A 3MG2A 3ZFZA 4R4KA 1IU7A 4JRFA 2UUGC 3CCJ3 3J7Yd 6STDA 1I8VA 4XDWA 4WHAA 1NB3I 2CW9A 3F14A 2GBWB 1B2XA 1SIHA 1OGZA 1VQ73 1RTUA 4NHFA 3WA2X 4FMCA 1LNIA 5RNTA 5I97A 3CXC2 3STDA 4FMAA 1VQP3 3EF8A 4X2OA 5D82A 1FGQA 2M7OA 2XH9A 2Z7AA 4FMDA 5HOHA 1DMMA 1IVWA 4U13A 4EW5A 1DVCA 1IT7A 3BNCA 3S67A 1JZDA 5IENA 1NDOB 3KSED 4KFEA 1IVUA 2CKFB 5GSPA 3CCM3 1B2SA 1JJ22 3EQQB 3GZYB 2OOVC 3Q1CA 3PXMA 2XFTA 1BSBA 2BHMA 2ML6A 4CJNA 1TUHA 1I3FA 1RGHA 1RCLA 3VSYA 3D3LA 3UJMA 1YVSA 1V74A 3Q90A 4I4KA 3PYJA 7GSPA 1K28A 4NPBA 4XM4A 1M1K4 4HZ9B 1MWSA 3V98A 1RGAA 1OCVA 3NBRA 5IERA 3NM2A 3FH1A 3NXJA 2RSXA 1LOYA 1TIJA 3PGBA 3HK4A 4RNZA 4AEQA 1M904 2GU3A 1FUTA 1GOVA 1OHPA 2W6JH 2UGIA 2F5WA 1YGWA 1D6ZA 4HM7B 3HZPA 3MG3A 3MYTA 5IEOA 1YI23 1TP6A 3T8UA 2CFGA 3D79A 2HMLB 1BU4A 3MG1A 1OF5A 1EQKA 4HJLB 1VQ53 3LTBA 3B4PA 3I563 1RGLA 3DY5A 1VQ63 4FCMA 2P0MA 2KF3A 3BU4A 1N8QA 1AQZA 2CHCA 2QA43 2W9PA 3AHWA 4HM5B 1R4YA 3SOYA 1N8R4 2XFSA 3EBTA 4WWUC 1W6GA 3H3HA 1C54A 2IUJA 3D5GA 3F8HA 4N3VA 2W9QA 4EV5A 3G4S3 4L8PA 2H0HA 3CNXA 4AKYA 2IUKA 2ZDJA 3L0RA 4BTWA 3FG1A 5BU4A 1MGWA 1GD3A 1GMQA 1OACA 2HMOB 3FZWA 1YNVX 4NREA 4RBNA 1KD14 2RGQA 2F5MA 1FA3A 1N5PA 1W2ZA 1MOLA 1NWWA 4HM6B 2L4VA 1DYUA 5CK6A 5AEWB 1TU5A 7RNTA 1Q40A 1A2KA 1CEWI 5M19A 2CWUA 2F98A 4HAAA 3SEDA 1UW1A 3CC73 3SVAA 2F86B 3KE7A 3OX9A 1UI7A 1A67A 1HYFA 2HMJB 1I70A 5CXOA 3NQZA 3MWZA 2BT3A 3LT8A 3QK9A 2SBLA 1EA2A 1B20A 2K54A 5HGRA 2JDIH 3NBBA 2I9WA 4HYZA 1Q814 1LVNA 4HM0B 1GYBA 5AIFA 1OHOA 2XR8B 3B8LA 1Q864 3CPOA 3OWYA 3EX9A 1DMNA 3G6E3 3MPHA 1RN1A 5KP3A 1B2UA 3UL5A 1EG9B 3A5EA 3HIIA 2BNGA 1D6UA 3F7XA 2H0IA 1T2IA 3WOFB 2L1SA 2OTL3 2J8XB 1AY7A 1PY3A 2BMQB 2P38A 4J9AA 1I0VA 2Z77A 1RJOA 3BNDA 2RCDA 1LOWA 3HOHA 1US1A 3KN4A 4N6NB 5AYRB 1JBRA 2ZL8A 1W2B2 1ASKA 2YFLB 4H3UA 3KKGA 4R1KA 2O3OA 2ZA4A 1UUGB 1V58A 1BAOA 1WNHA 4L7KA 1GD4A 1TJDA 5ELUA 3OXAA 3WA3A 3IJEB 3DGYA 1FYSA 1BVIA 4JF8A 1IDPA 2C10A 1BRJA 2R4IA 3JVCA 5AEUB 2QIYA 1BUJA 2P05A 1R4CA 8CHOA 4N6V0 5ELJA 3NQYA 2CG0A 3DMCA 5BXQA 3OW22 1VQN3 1E3RA 1CH0A 1RGCA 1ISKA 1RN4A 4R9LA 1W6CA 3X3XA 1NB5I 4HM4B 5JPPA 3LTDA 3I553 4XDVA 1JNQA 1UCIA 3N9HA 2R41A 2KXGA 3CME3 1UDII 4FCZA 1LQGC 3FCSB 3SX1A 1OGXA 3LTCA 4GB5A 4AKZA 1F8NA 4FR9A 1LNHA 4CPKA 2CIUA 4HM8B 5IW9A 4HVNA 4DKIA 2D42A 5JBSA 1ZS7A 1W6YA 2C11A 2IA7A 1FW7A 1BNFA 2HMMB 4K61A 1RMSA 3K63A 4LSOA 1IVXA 1GOYA 1BNSA 1VQK3 1ZGXA 4KFFA 1AVKA 2K0MA 2GSPA 2KF4A 2QGUA 1GY7A 3DGOA 2CFDA 1GY6A 4LMIA 4TX4A 3K5TA 3GRDA 2W2CA 2BO9B 3DM8A 3BNEA 1Q42A 3H51A 1JBTA 3GZBA 1IT8A 2WGQA 1BSCA 2AADA 1FUWA 3AMOA 4HBRA 1JB4A 2E2TA 4IIAA 3NX0A 2Z76A 2SARA 2RBIA 4K90B 1BNGA 4XBYA 1W01A 1A2VA 1UUVB 2W04A 1J2BA 3ECFA 1FGMA 1RLSA 1RDSA 2GXFA 4BIRA 3EE1A 1GMPA 1SJWA 1NNVA 1X1WA 2CH9A 3MKIA 2AAEA 1LXEA 1ZX2A 4WP5A 2PZVA 3JUQA 3V92A 3EHCA 3U97A 3AGOA 4EV2A 4HKVB 3M8CA 1TFKA 3JUNA 3BIRA 2CC3A 4O2HA 4OK0A 3E99A 1JV2B 1SPUA 1JN5B 2XGLA 4WYKB 3X3ZA 1GY5A 1K8A4 3NV0B 2GBXB 2XEPA 5KP4A 1M1XB 3GAXA 3X3YA 5BVBA 3EC9A 5KP1A 2RFRA 2BU4A 3DGMA 2LQVA 5EVHA 3CMA3 1RCKA 2XF3A 2Q07A 3K7CA 3EN8A 4HM3B 1LOVA 3BB9A 2WGOA 5D83A 8RNTA 5CLKA 1CQSA 1AVLA 1JKGA 1STFI 3G8ZA 1IQYA 3D5IA 2ZHXB 3NHXA 4X2HA 3LOYA 3FG4A 3Q2PA 4L8OA 1JB2A 4ZM8A 1QVF2 5IF6A 4R80A 2FNQA 1VQQA 3JUMA 2STDA 3DZLA 1RKYA 2F99A 3MHEA 4K1UA 2Y73A 3G16A 4EC6A 2IYJA 1SARA 3WOEB 2CWVA 2PNCA 4MEIA 3ROBA 1DETA 2KF6A 3TDGA 2D1WA 2INXA 1BRGA 1GS3A 3LYGA 4BL3A 3MSOA 3T0UA 1W4NA 5AIGA 3WHOA 1Y4KA 3BNBA 2HOHA 2H0GA 4HZBB 5AI1A 5CF1A 1YVBI 1RGEA 1HKXA 3CC43 1LQMB 4O02B 2LYXA 1I2GA 4OVMA 1WMOA 3LTAA 1A2PA 1RNBA 2QEX3 1IV9A 4GHOA 2P0XA 4GL6A 3WR2A 4CDLA 4KZ1A 4G1MB 3S29A 3VGNA 1UCLA 1BRNL 2A15A 1YJ93 1IYYA 4I5QA 5D81A 3RGAA 3CCE3 2FGTA 1G02A 5FW5A 3A76A 1UCKA 1NJI4 1OPYA 3PCSA 3WDGB 1S5AA 4HM1B 3ER7A 1KQS2 3GZRA 3CCL3 1CYVA 1Z1SA 2CX1A 2F4YA 1BOXA 1X1XA 4MJDA 1M9GA 1RRHA 3DGNA 3GZXB 1OF5B 5AIHA 5LC6A 1N9EA 1BIRA 2Y74A 3CC23 1B2ZA 1T2HA 1ZO2A 1I2EA 1O7WB 1YHQ3 5CF2A 1C7HA 3AGNA 3G0KA 1BNRA 4STDA 3DUKA 1VQ93 2OCTA 1W00A 5EQLA 1IV7A 1HU9A 3FGYA 4WFOA 1B21A 3OWUA 5IG4A 1I2FA 4HOHA 3KSPA 1O7PB 1WQLB 1K9M4 3NM7A 4EBGA 3ALAA 4FMBA 3SOAA 1NO3A 3AHSA 2XSHB 5G2GA 3FLJA 2OWPA 3I0YA 3LXUX 1BNJA 3K0ZA 2GEXA 4LYLB 1BSAA 4ORLA 4IT7A 1Q40B 4OUQA 1ULIB 4N6MA 1JBSA 2UX0A 3SXXA 1O7GB 4IPBA 3RNTA 1DVDA 3FSDA 4K1VA 4LZIA 1PFPA 1DE3A 1OH0A 1RGKA 1UI8A 3KZTA 1X1UA 4EXRA 3EJVA 3CPW2 3CCV3 4J5GA 4RNTA 3CCU3 1VQL3 1PYLA 2W0QA 3EBYA 3HI7A 1B2MA 1O7MB 1B3SA 1G96A 1IQ8A 3PS8A 4MMZB 4FCJA 2MC8A 1Q824 1BRKA 2IY2A 2WO0A 2WOFA 1O7NB 3D4AA 4J5KA 2V1LA 2F56A 1Q9EA 3F8XA 1L5GB 4EYCA 5DRVA 1MWTA 1ROAA 3RDEA 1YIT3 5IEPA 3O8YA 1T3BA 1GMRA 1V57A 2W56A 2YFIB 1UCJA 2GU1A 1NU3A 3JUOA 1E97A 4H61A 4O3VA 1IK3A 3N54B 3URPA 1ULJB 1RGFA 1OHSA 1Q7HA 4Q53A 1UGHI 1MGRA 1TTOA 5M1AA 3S5CA 3CD63 2HMKB 3KCHA 1UUWB 1QJGA 1BRHA 3OWSA 4CCVA 1WMPA 4QWTA 1JZOA 1I0XA 4RNYA 2OQEA 2ML5A 4MMXB 3UNLA 3PZWA 1KC84 1CYUA 1N9JA 1U5OA 1RSNA 1EKMA 2XSOB 1X1YA 4RZMA 3F9SA 3KFQC 3U1WA 3NBJA 1ROVA 4R9KA 2CK3H 2XRXB 4BL2A 2KF5A 3GSPA 4MMYB 3SLUA 4O8SA 4XBTA 3S27A 3LMLA 4ILFA 1UGIA 3LH4A 4KVHA 2YFJB 1IVVA 3X40A 2B24B 1QMAA 2YX9A 3WMDA
chains in the Genus database with same CATH topology
1I2GA 1B27A 1A2PA 5HOHA 2RNTA 1RHLA 1BNEA 1RNBA 4GHOA 1CH0A 2C4BA 1RGCA 3WR2A 1RN4A 1GSPA 1UCLA 5GSPA 1BRNL 1B2SA 1IYYA 1BSBA 1G02A 1LRAA 1UCIA 1UCKA 1I3FA 1RGHA 1RCLA 1YVSA 1RGGA 7GSPA 2F4YA 1FUSA 1BOXA 1X1XA 1RGAA 1FW7A 1LOYA 1BNFA 1RMSA 1GOVA 1BIRA 1FUTA 1TRQA 3DH2A 1B2ZA 1T2HA 1BSEA 1GOYA 1I2EA 1BNSA 1YGWA 2F5WA 3SYUA 1FZUA 1ZGXA 3AGNA 2GSPA 2KF4A 1BNRA 1BU4A 1BSDA 1BANA 1B21A 1I2FA 1RGLA 4GSPA 4HOHA 1JBTA 1RNTA 2KF3A 3BU4A 5BIRA 1BSCA 2AADA 1AQZA 1GOUA 3AHWA 3AHSA 1R4YA 2SARA 2RBIA 1BNGA 4BU4A 1BNJA 1BSAA 1C54A 1BGSA 3D5GA 1RLSA 1RDSA 1HZ1A 4BIRA 1BRSA 5BU4A 1GMPA 1I3IA 1X1WA 1JBSA 1MGWA 1GMQA 2AAEA 1YNVX 3RNTA 2F5MA 1DE3A 6GSPA 1RGKA 1X1UA 3AGOA 2KAAA 2BIRA 3Q3FA 4J5GA 4RNTA 6RNTA 7RNTA 1TRPA 3BIRA 4HAAA 1PYLA 1B2MA 1B3SA 9RNTA 1BRKA 3D4AA 4J5KA 2F56A 1Q9EA 1HYFA 1I70A 1GMRA 2BU4A 1RCKA 1UCJA 1B20A 1LOVA 1BRIA 1RGFA 3URPA 8RNTA 1MGRA 1TTOA 3D5IA 3KCHA 1BRHA 1RN1A 1B2UA 3A5EA 1T2IA 1I0XA 1BNIA 1AY7A 1PY3A 1RSNA 1I0VA 1X1YA 3HOHA 1LOWA 1SARA 1JBRA 1DETA 2KF6A 1I8VA 1BRGA 2KF5A 2ZA4A 1BAOA 3GSPA 3WHOA 1B2XA 2HOHA 1RTUA 3DGYA 1FYSA 1BVIA 1BRJA 1LNIA 5RNTA 1BUJA 1RGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2G A;  1B27 A;  1A2P A;  5HOH A;  2RNT A;  1RHL A;  1BNE A;  1RNB A;  4GHO A;  1CH0 A;  2C4B A;  1RGC A;  3WR2 A;  1RN4 A;  1GSP A;  1UCL A;  5GSP A;  1BRN L;  1B2S A;  1IYY A;  1BSB A;  1G02 A;  1LRA A;  1UCI A;  1UCK A;  1I3F A;  1RGH A;  1RCL A;  1YVS A;  1RGG A;  7GSP A;  2F4Y A;  1FUS A;  1BOX A;  1X1X A;  1RGA A;  1FW7 A;  1LOY A;  1BNF A;  1RMS A;  1GOV A;  1BIR A;  1FUT A;  1TRQ A;  3DH2 A;  1B2Z A;  1T2H A;  1BSE A;  1GOY A;  1I2E A;  1BNS A;  1YGW A;  2F5W A;  3SYU A;  1FZU A;  1ZGX A;  3AGN A;  2GSP A;  2KF4 A;  1BNR A;  1BU4 A;  1BSD A;  1BAN A;  1B21 A;  1I2F A;  1RGL A;  4GSP A;  4HOH A;  1JBT A;  1RNT A;  2KF3 A;  3BU4 A;  5BIR A;  1BSC A;  2AAD A;  1AQZ A;  1GOU A;  3AHW A;  3AHS A;  1R4Y A;  2SAR A;  2RBI A;  1BNG A;  4BU4 A;  1BNJ A;  1BSA A;  1C54 A;  1BGS A;  3D5G A;  1RLS A;  1RDS A;  1HZ1 A;  4BIR A;  1BRS A;  5BU4 A;  1GMP A;  1I3I A;  1X1W A;  1JBS A;  1MGW A;  1GMQ A;  2AAE A;  1YNV X;  3RNT A;  2F5M A;  1DE3 A;  6GSP A;  1RGK A;  1X1U A;  3AGO A;  2KAA A;  2BIR A;  3Q3F A;  4J5G A;  4RNT A;  6RNT A;  7RNT A;  1TRP A;  3BIR A;  4HAA A;  1PYL A;  1B2M A;  1B3S A;  9RNT A;  1BRK A;  3D4A A;  4J5K A;  2F56 A;  1Q9E A;  1HYF A;  1I70 A;  1GMR A;  2BU4 A;  1RCK A;  1UCJ A;  1B20 A;  1LOV A;  1BRI A;  1RGF A;  3URP A;  8RNT A;  1MGR A;  1TTO A;  3D5I A;  3KCH A;  1BRH A;  1RN1 A;  1B2U A;  3A5E A;  1T2I A;  1I0X A;  1BNI A;  1AY7 A;  1PY3 A;  1RSN A;  1I0V A;  1X1Y A;  3HOH A;  1LOW A;  1SAR A;  1JBR A;  1DET A;  2KF6 A;  1I8V A;  1BRG A;  2KF5 A;  2ZA4 A;  1BAO A;  3GSP A;  3WHO A;  1B2X A;  2HOH A;  1RTU A;  3DGY A;  1FYS A;  1BVI A;  1BRJ A;  1LNI A;  5RNT A;  1BUJ A;  1RGE A; 
#chains in the Genus database with same CATH topology
 3CCS 3;  1B27 A;  2BMO B;  1K73 4;  1QAL A;  2RNT A;  3IMA B;  1RHL A;  1BNE A;  1O7H B;  3IPT A;  1QAK A;  2C4B A;  5M18 A;  1FGR A;  1QAF A;  5DRE A;  2FXT A;  1GSP A;  3NUV A;  1QVG 2;  3LT9 A;  3HIG A;  3FF0 A;  1JB5 A;  2WOH A;  1FGO A;  1LRA A;  3B7C A;  1EUI C;  1PU4 A;  1KWI A;  2E2U A;  3PCR A;  4KFD A;  3OV4 A;  3EB8 A;  3QRD A;  4N6T A;  4BTY A;  5STD A;  4N6O B;  1T5Y A;  3CCQ 3;  1RGG A;  1W7C A;  1FGT A;  3RGR A;  1FUS A;  1IQX A;  1WTH A;  2CFW A;  5G1K A;  3F7S A;  3X41 A;  2CFK A;  3D9R A;  3K9M C;  1TRQ A;  2E2V A;  3DH2 A;  1D6Y A;  3CCR 3;  2XGN A;  1BSE A;  2IMJ A;  3G71 3;  3B4O A;  5EEO A;  3CNM A;  2GEY A;  1AV4 A;  1FZU A;  3SYU A;  2CG1 A;  3WOD G;  1S72 3;  3AMO B;  1YIJ 3;  2W56 B;  3EN1 B;  1BSD A;  3FG3 A;  2P09 A;  1BAN A;  4HM2 B;  1OUN A;  1AR0 A;  3DGL A;  3GWR A;  2OOV A;  4GSP A;  1W02 A;  1RNT A;  1YGE A;  5BIR A;  3N8B A;  4N6U A;  1VQ4 3;  3UB1 A;  1GOU A;  3ZG5 A;  2OTJ 3;  5LC7 A;  1SII A;  1U8C B;  1EEJ A;  1MWU A;  2Z6B A;  4BU4 A;  3UL6 A;  1YJW 3;  1Q7Y 4;  1BGS A;  5AII A;  3F40 A;  2B1X B;  1HZ1 A;  1LOX A;  3FF2 A;  1BRS A;  5IG0 A;  1I3I A;  7STD A;  1VQO 3;  4PEJ A;  2W03 A;  4J8T A;  1K41 A;  2CFL A;  3BLZ A;  5AYS C;  3X42 A;  2HMN B;  6GSP A;  4LGQ A;  2KAA A;  1VZZ A;  2BIR A;  3FKA A;  3Q3F A;  2OQE C;  6RNT A;  1TRP A;  2O9U X;  1W5Z A;  1E3V A;  4XB5 A;  4BTX A;  9RNT A;  1RN7 A;  1N5H A;  3V99 A;  3KII A;  5JPU A;  1JRQ A;  2KCD A;  1JKG B;  1WMN A;  2CX0 A;  2MF7 A;  1A90 A;  2KRT A;  5G1L A;  2JQ5 A;  5A0O B;  1JN5 A;  4WYK A;  2CWT A;  3LZA A;  5IG3 A;  1TFO A;  1VQM 3;  3JUP A;  3NV0 A;  1BRI A;  4N6L A;  3S28 A;  4LEH A;  3ZG0 A;  5FGO A;  3DXO A;  1G0T A;  3CU3 A;  3T8N A;  1DMQ A;  3HX8 A;  4XBX A;  1BUQ A;  1MNL A;  1RRL A;  2K3D A;  1KSI A;  1STD A;  2BMR B;  1SQW A;  4KT3 B;  5TGN A;  3VF1 A;  1YJN 3;  1BNI A;  1VQ8 3;  1MWR A;  5IG5 A;  3MG2 A;  3ZFZ A;  4R4K A;  1IU7 A;  4JRF A;  2UUG C;  3CCJ 3;  3J7Y d;  6STD A;  1I8V A;  4XDW A;  4WHA A;  1NB3 I;  2CW9 A;  3F14 A;  2GBW B;  1B2X A;  1SIH A;  1OGZ A;  1VQ7 3;  1RTU A;  4NHF A;  3WA2 X;  4FMC A;  1LNI A;  5RNT A;  5I97 A;  3CXC 2;  3STD A;  4FMA A;  1VQP 3;  3EF8 A;  4X2O A;  5D82 A;  1FGQ A;  2M7O A;  2XH9 A;  2Z7A A;  4FMD A;  5HOH A;  1DMM A;  1IVW A;  4U13 A;  4EW5 A;  1DVC A;  1IT7 A;  3BNC A;  3S67 A;  1JZD A;  5IEN A;  1NDO B;  3KSE D;  4KFE A;  1IVU A;  2CKF B;  5GSP A;  3CCM 3;  1B2S A;  1JJ2 2;  3EQQ B;  3GZY B;  2OOV C;  3Q1C A;  3PXM A;  2XFT A;  1BSB A;  2BHM A;  2ML6 A;  4CJN A;  1TUH A;  1I3F A;  1RGH A;  1RCL A;  3VSY A;  3D3L A;  3UJM A;  1YVS A;  1V74 A;  3Q90 A;  4I4K A;  3PYJ A;  7GSP A;  1K28 A;  4NPB A;  4XM4 A;  1M1K 4;  4HZ9 B;  1MWS A;  3V98 A;  1RGA A;  1OCV A;  3NBR A;  5IER A;  3NM2 A;  3FH1 A;  3NXJ A;  2RSX A;  1LOY A;  1TIJ A;  3PGB A;  3HK4 A;  4RNZ A;  4AEQ A;  1M90 4;  2GU3 A;  1FUT A;  1GOV A;  1OHP A;  2W6J H;  2UGI A;  2F5W A;  1YGW A;  1D6Z A;  4HM7 B;  3HZP A;  3MG3 A;  3MYT A;  5IEO A;  1YI2 3;  1TP6 A;  3T8U A;  2CFG A;  3D79 A;  2HML B;  1BU4 A;  3MG1 A;  1OF5 A;  1EQK A;  4HJL B;  1VQ5 3;  3LTB A;  3B4P A;  3I56 3;  1RGL A;  3DY5 A;  1VQ6 3;  4FCM A;  2P0M A;  2KF3 A;  3BU4 A;  1N8Q A;  1AQZ A;  2CHC A;  2QA4 3;  2W9P A;  3AHW A;  4HM5 B;  1R4Y A;  3SOY A;  1N8R 4;  2XFS A;  3EBT A;  4WWU C;  1W6G A;  3H3H A;  1C54 A;  2IUJ A;  3D5G A;  3F8H A;  4N3V A;  2W9Q A;  4EV5 A;  3G4S 3;  4L8P A;  2H0H A;  3CNX A;  4AKY A;  2IUK A;  2ZDJ A;  3L0R A;  4BTW A;  3FG1 A;  5BU4 A;  1MGW A;  1GD3 A;  1GMQ A;  1OAC A;  2HMO B;  3FZW A;  1YNV X;  4NRE A;  4RBN A;  1KD1 4;  2RGQ A;  2F5M A;  1FA3 A;  1N5P A;  1W2Z A;  1MOL A;  1NWW A;  4HM6 B;  2L4V A;  1DYU A;  5CK6 A;  5AEW B;  1TU5 A;  7RNT A;  1Q40 A;  1A2K A;  1CEW I;  5M19 A;  2CWU A;  2F98 A;  4HAA A;  3SED A;  1UW1 A;  3CC7 3;  3SVA A;  2F86 B;  3KE7 A;  3OX9 A;  1UI7 A;  1A67 A;  1HYF A;  2HMJ B;  1I70 A;  5CXO A;  3NQZ A;  3MWZ A;  2BT3 A;  3LT8 A;  3QK9 A;  2SBL A;  1EA2 A;  1B20 A;  2K54 A;  5HGR A;  2JDI H;  3NBB A;  2I9W A;  4HYZ A;  1Q81 4;  1LVN A;  4HM0 B;  1GYB A;  5AIF A;  1OHO A;  2XR8 B;  3B8L A;  1Q86 4;  3CPO A;  3OWY A;  3EX9 A;  1DMN A;  3G6E 3;  3MPH A;  1RN1 A;  5KP3 A;  1B2U A;  3UL5 A;  1EG9 B;  3A5E A;  3HII A;  2BNG A;  1D6U A;  3F7X A;  2H0I A;  1T2I A;  3WOF B;  2L1S A;  2OTL 3;  2J8X B;  1AY7 A;  1PY3 A;  2BMQ B;  2P38 A;  4J9A A;  1I0V A;  2Z77 A;  1RJO A;  3BND A;  2RCD A;  1LOW A;  3HOH A;  1US1 A;  3KN4 A;  4N6N B;  5AYR B;  1JBR A;  2ZL8 A;  1W2B 2;  1ASK A;  2YFL B;  4H3U A;  3KKG A;  4R1K A;  2O3O A;  2ZA4 A;  1UUG B;  1V58 A;  1BAO A;  1WNH A;  4L7K A;  1GD4 A;  1TJD A;  5ELU A;  3OXA A;  3WA3 A;  3IJE B;  3DGY A;  1FYS A;  1BVI A;  4JF8 A;  1IDP A;  2C10 A;  1BRJ A;  2R4I A;  3JVC A;  5AEU B;  2QIY A;  1BUJ A;  2P05 A;  1R4C A;  8CHO A;  4N6V 0;  5ELJ A;  3NQY A;  2CG0 A;  3DMC A;  5BXQ A;  3OW2 2;  1VQN 3;  1E3R A;  1CH0 A;  1RGC A;  1ISK A;  1RN4 A;  4R9L A;  1W6C A;  3X3X A;  1NB5 I;  4HM4 B;  5JPP A;  3LTD A;  3I55 3;  4XDV A;  1JNQ A;  1UCI A;  3N9H A;  2R41 A;  2KXG A;  3CME 3;  1UDI I;  4FCZ A;  1LQG C;  3FCS B;  3SX1 A;  1OGX A;  3LTC A;  4GB5 A;  4AKZ A;  1F8N A;  4FR9 A;  1LNH A;  4CPK A;  2CIU A;  4HM8 B;  5IW9 A;  4HVN A;  4DKI A;  2D42 A;  5JBS A;  1ZS7 A;  1W6Y A;  2C11 A;  2IA7 A;  1FW7 A;  1BNF A;  2HMM B;  4K61 A;  1RMS A;  3K63 A;  4LSO A;  1IVX A;  1GOY A;  1BNS A;  1VQK 3;  1ZGX A;  4KFF A;  1AVK A;  2K0M A;  2GSP A;  2KF4 A;  2QGU A;  1GY7 A;  3DGO A;  2CFD A;  1GY6 A;  4LMI A;  4TX4 A;  3K5T A;  3GRD A;  2W2C A;  2BO9 B;  3DM8 A;  3BNE A;  1Q42 A;  3H51 A;  1JBT A;  3GZB A;  1IT8 A;  2WGQ A;  1BSC A;  2AAD A;  1FUW A;  3AMO A;  4HBR A;  1JB4 A;  2E2T A;  4IIA A;  3NX0 A;  2Z76 A;  2SAR A;  2RBI A;  4K90 B;  1BNG A;  4XBY A;  1W01 A;  1A2V A;  1UUV B;  2W04 A;  1J2B A;  3ECF A;  1FGM A;  1RLS A;  1RDS A;  2GXF A;  4BIR A;  3EE1 A;  1GMP A;  1SJW A;  1NNV A;  1X1W A;  2CH9 A;  3MKI A;  2AAE A;  1LXE A;  1ZX2 A;  4WP5 A;  2PZV A;  3JUQ A;  3V92 A;  3EHC A;  3U97 A;  3AGO A;  4EV2 A;  4HKV B;  3M8C A;  1TFK A;  3JUN A;  3BIR A;  2CC3 A;  4O2H A;  4OK0 A;  3E99 A;  1JV2 B;  1SPU A;  1JN5 B;  2XGL A;  4WYK B;  3X3Z A;  1GY5 A;  1K8A 4;  3NV0 B;  2GBX B;  2XEP A;  5KP4 A;  1M1X B;  3GAX A;  3X3Y A;  5BVB A;  3EC9 A;  5KP1 A;  2RFR A;  2BU4 A;  3DGM A;  2LQV A;  5EVH A;  3CMA 3;  1RCK A;  2XF3 A;  2Q07 A;  3K7C A;  3EN8 A;  4HM3 B;  1LOV A;  3BB9 A;  2WGO A;  5D83 A;  8RNT A;  5CLK A;  1CQS A;  1AVL A;  1JKG A;  1STF I;  3G8Z A;  1IQY A;  3D5I A;  2ZHX B;  3NHX A;  4X2H A;  3LOY A;  3FG4 A;  3Q2P A;  4L8O A;  1JB2 A;  4ZM8 A;  1QVF 2;  5IF6 A;  4R80 A;  2FNQ A;  1VQQ A;  3JUM A;  2STD A;  3DZL A;  1RKY A;  2F99 A;  3MHE A;  4K1U A;  2Y73 A;  3G16 A;  4EC6 A;  2IYJ A;  1SAR A;  3WOE B;  2CWV A;  2PNC A;  4MEI A;  3ROB A;  1DET A;  2KF6 A;  3TDG A;  2D1W A;  2INX A;  1BRG A;  1GS3 A;  3LYG A;  4BL3 A;  3MSO A;  3T0U A;  1W4N A;  5AIG A;  3WHO A;  1Y4K A;  3BNB A;  2HOH A;  2H0G A;  4HZB B;  5AI1 A;  5CF1 A;  1YVB I;  1RGE A;  1HKX A;  3CC4 3;  1LQM B;  4O02 B;  2LYX A;  1I2G A;  4OVM A;  1WMO A;  3LTA A;  1A2P A;  1RNB A;  2QEX 3;  1IV9 A;  4GHO A;  2P0X A;  4GL6 A;  3WR2 A;  4CDL A;  4KZ1 A;  4G1M B;  3S29 A;  3VGN A;  1UCL A;  1BRN L;  2A15 A;  1YJ9 3;  1IYY A;  4I5Q A;  5D81 A;  3RGA A;  3CCE 3;  2FGT A;  1G02 A;  5FW5 A;  3A76 A;  1UCK A;  1NJI 4;  1OPY A;  3PCS A;  3WDG B;  1S5A A;  4HM1 B;  3ER7 A;  1KQS 2;  3GZR A;  3CCL 3;  1CYV A;  1Z1S A;  2CX1 A;  2F4Y A;  1BOX A;  1X1X A;  4MJD A;  1M9G A;  1RRH A;  3DGN A;  3GZX B;  1OF5 B;  5AIH A;  5LC6 A;  1N9E A;  1BIR A;  2Y74 A;  3CC2 3;  1B2Z A;  1T2H A;  1ZO2 A;  1I2E A;  1O7W B;  1YHQ 3;  5CF2 A;  1C7H A;  3AGN A;  3G0K A;  1BNR A;  4STD A;  3DUK A;  1VQ9 3;  2OCT A;  1W00 A;  5EQL A;  1IV7 A;  1HU9 A;  3FGY A;  4WFO A;  1B21 A;  3OWU A;  5IG4 A;  1I2F A;  4HOH A;  3KSP A;  1O7P B;  1WQL B;  1K9M 4;  3NM7 A;  4EBG A;  3ALA A;  4FMB A;  3SOA A;  1NO3 A;  3AHS A;  2XSH B;  5G2G A;  3FLJ A;  2OWP A;  3I0Y A;  3LXU X;  1BNJ A;  3K0Z A;  2GEX A;  4LYL B;  1BSA A;  4ORL A;  4IT7 A;  1Q40 B;  4OUQ A;  1ULI B;  4N6M A;  1JBS A;  2UX0 A;  3SXX A;  1O7G B;  4IPB A;  3RNT A;  1DVD A;  3FSD A;  4K1V A;  4LZI A;  1PFP A;  1DE3 A;  1OH0 A;  1RGK A;  1UI8 A;  3KZT A;  1X1U A;  4EXR A;  3EJV A;  3CPW 2;  3CCV 3;  4J5G A;  4RNT A;  3CCU 3;  1VQL 3;  1PYL A;  2W0Q A;  3EBY A;  3HI7 A;  1B2M A;  1O7M B;  1B3S A;  1G96 A;  1IQ8 A;  3PS8 A;  4MMZ B;  4FCJ A;  2MC8 A;  1Q82 4;  1BRK A;  2IY2 A;  2WO0 A;  2WOF A;  1O7N B;  3D4A A;  4J5K A;  2V1L A;  2F56 A;  1Q9E A;  3F8X A;  1L5G B;  4EYC A;  5DRV A;  1MWT A;  1ROA A;  3RDE A;  1YIT 3;  5IEP A;  3O8Y A;  1T3B A;  1GMR A;  1V57 A;  2W56 A;  2YFI B;  1UCJ A;  2GU1 A;  1NU3 A;  3JUO A;  1E97 A;  4H61 A;  4O3V A;  1IK3 A;  3N54 B;  3URP A;  1ULJ B;  1RGF A;  1OHS A;  1Q7H A;  4Q53 A;  1UGH I;  1MGR A;  1TTO A;  5M1A A;  3S5C A;  3CD6 3;  2HMK B;  3KCH A;  1UUW B;  1QJG A;  1BRH A;  3OWS A;  4CCV A;  1WMP A;  4QWT A;  1JZO A;  1I0X A;  4RNY A;  2OQE A;  2ML5 A;  4MMX B;  3UNL A;  3PZW A;  1KC8 4;  1CYU A;  1N9J A;  1U5O A;  1RSN A;  1EKM A;  2XSO B;  1X1Y A;  4RZM A;  3F9S A;  3KFQ C;  3U1W A;  3NBJ A;  1ROV A;  4R9K A;  2CK3 H;  2XRX B;  4BL2 A;  2KF5 A;  3GSP A;  4MMY B;  3SLU A;  4O8S A;  4XBT A;  3S27 A;  3LML A;  4ILF A;  1UGI A;  3LH4 A;  4KVH A;  2YFJ B;  1IVV A;  3X40 A;  2B24 B;  1QMA A;  2YX9 A;  3WMD A; 
#chains in the Genus database with same CATH homology
 1I2G A;  1B27 A;  1A2P A;  5HOH A;  2RNT A;  1RHL A;  1BNE A;  1RNB A;  4GHO A;  1CH0 A;  2C4B A;  1RGC A;  3WR2 A;  1RN4 A;  1GSP A;  1UCL A;  5GSP A;  1BRN L;  1B2S A;  1IYY A;  1BSB A;  1G02 A;  1LRA A;  1UCI A;  1UCK A;  1I3F A;  1RGH A;  1RCL A;  1YVS A;  1RGG A;  7GSP A;  2F4Y A;  1FUS A;  1BOX A;  1X1X A;  1RGA A;  1FW7 A;  1LOY A;  1BNF A;  1RMS A;  1GOV A;  1BIR A;  1FUT A;  1TRQ A;  3DH2 A;  1B2Z A;  1T2H A;  1BSE A;  1GOY A;  1I2E A;  1BNS A;  1YGW A;  2F5W A;  3SYU A;  1FZU A;  1ZGX A;  3AGN A;  2GSP A;  2KF4 A;  1BNR A;  1BU4 A;  1BSD A;  1BAN A;  1B21 A;  1I2F A;  1RGL A;  4GSP A;  4HOH A;  1JBT A;  1RNT A;  2KF3 A;  3BU4 A;  5BIR A;  1BSC A;  2AAD A;  1AQZ A;  1GOU A;  3AHW A;  3AHS A;  1R4Y A;  2SAR A;  2RBI A;  1BNG A;  4BU4 A;  1BNJ A;  1BSA A;  1C54 A;  1BGS A;  3D5G A;  1RLS A;  1RDS A;  1HZ1 A;  4BIR A;  1BRS A;  5BU4 A;  1GMP A;  1I3I A;  1X1W A;  1JBS A;  1MGW A;  1GMQ A;  2AAE A;  1YNV X;  3RNT A;  2F5M A;  1DE3 A;  6GSP A;  1RGK A;  1X1U A;  3AGO A;  2KAA A;  2BIR A;  3Q3F A;  4J5G A;  4RNT A;  6RNT A;  7RNT A;  1TRP A;  3BIR A;  4HAA A;  1PYL A;  1B2M A;  1B3S A;  9RNT A;  1BRK A;  3D4A A;  4J5K A;  2F56 A;  1Q9E A;  1HYF A;  1I70 A;  1GMR A;  2BU4 A;  1RCK A;  1UCJ A;  1B20 A;  1LOV A;  1BRI A;  1RGF A;  3URP A;  8RNT A;  1MGR A;  1TTO A;  3D5I A;  3KCH A;  1BRH A;  1RN1 A;  1B2U A;  3A5E A;  1T2I A;  1I0X A;  1BNI A;  1AY7 A;  1PY3 A;  1RSN A;  1I0V A;  1X1Y A;  3HOH A;  1LOW A;  1SAR A;  1JBR A;  1DET A;  2KF6 A;  1I8V A;  1BRG A;  2KF5 A;  2ZA4 A;  1BAO A;  3GSP A;  3WHO A;  1B2X A;  2HOH A;  1RTU A;  3DGY A;  1FYS A;  1BVI A;  1BRJ A;  1LNI A;  5RNT A;  1BUJ A;  1RGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...