1NU3A

Limonene-1,2-epoxide hydrolase in complex with valpromide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
145
structure length
145
Chain Sequence
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSIDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNLSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords limonene-1,2-epoxide hydrolase
publication title Structure of Rhodococcus erythropolis limonene-1,2-epoxide hydrolase reveals a novel active site
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 39
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nu3A00
4XBTA 1C7HA 2XRXB 2YFJB 3LZAA 1JN5A 3T8NA 4FCJA 4HM5B 1O7GB 4CDLA 4J9AA 2IMJA 3K0ZA 5CK6A 3JUMA 3MSOA 3A76A 1GY6A 3OXAA 5AI1A 1E97A 4GB5A 4MJDA 5FW5A 4LMIA 1OHOA 8CHOA 3BB9A 3T8UA 1W00A 5BVBA 1OCVA 4HM8B 1DMMA 2CHCA 5G2GA 2XSHB 5IEOA 5D81A 1E3VA 5IF6A 1W01A 3GZXB 1STDA 3F14A 1K41A 4HVNA 1IDPA 3B4PA 4X2OA 3DM8A 3FF2A 5D82A 4HM1B 2BMOB 1Q42A 4HKVB 3SOAA 3F9SA 1O7WB 3GZRA 3FH1A 1OF5B 4HM7B 2F98A 2RGQA 3D9RA 3DMCA 1EA2A 3DZLA 3M8CA 3NM2A 4K1UA 6STDA 3F8XA 1GY5A 1JN5B 1UUVB 1JKGA 3RGAA 1GYBA 3SEDA 4XDVA 2HMLB 3KE7A 3JUQA 4HM4B 2GEYA 3KZTA 4LEHA 3MG1A 3EC9A 3FZWA 3WMDA 4WYKA 5KP4A 2K54A 3JUNA 1JB5A 4L8OA 5HGRA 1AR0A 1NWWA 3SOYA 3CNXA 3UJMA 3GZBA 4X2HA 5JPUA 4HM2B 5IERA 3NV0A 2R4IA 2GBXB 2I9WA 3EBTA 2GBWB 3OV4A 2W2CA 3EQQB 1OGZA 2CKFB 4L8PA 4WP5A 1GY7A 4HZBB 5IG4A 3OWSA 4I4KA 3EF8A 3ER7A 2A15A 3EHCA 2F86B 5TGNA 1OH0A 3GZYB 1GS3A 5CLKA 1E3RA 3OWUA 4RZMA 4R1KA 4FCMA 1TP6A 1ULIB 3FF0A 4XM4A 4KVHA 5AIHA 4R9LA 4HM6B 2B24B 5KP3A 3VGNA 3S5CA 3FSDA 5KP1A 2UX0A 1W6YA 3DUKA 1ASKA 1QMAA 5BXQA 4OVMA 1ISKA 3EJVA 3MKIA 1VZZA 3FGYA 2Z7AA 1O7MB 3EBYA 4WYKB 4N3VA 5IG5A 2GXFA 1OHPA 1JB4A 3STDA 1NDOB 5AEWB 3GWRA 2HMJB 3F8HA 3CPOA 1DMNA 1UUWB 1OHSA 1OGXA 3F40A 5CF1A 1Z1SA 3KKGA 3MHEA 4K1VA 2HMOB 3OX9A 4HJLB 4OUQA 3IPTA 5AIFA 5DREA 4HZ9B 3K7CA 4J8TA 2GEXA 3G8ZA 5AIGA 3MYTA 2XSOB 1WQLB 2OWPA 4IIAA 5AEUB 3HX8A 3HK4A 1Q40A 3RGRA 5DRVA 2RCDA 3F7SA 1QJGA 3Q90A 1S5AA 5D83A 4STDA 4XBYA 4ORLA 1ZX2A 1ULJB 2JQ5A 2YFLB 4L7KA 1O7NB 5IEPA 1HKXA 2STDA 1O7PB 3I0YA 5IG3A 3FKAA 2INXA 3DXOA 3ECFA 1DMQA 4XB5A 3KSPA 4U13A 4Q53A 3UNLA 2Z77A 2F99A 3JUOA 3NBRA 3G0KA 4PEJA 3GRDA 3LYGA 1TUHA 3CU3A 3MG2A 2HMMB 3F7XA 1EG9B 5JPPA 1JKGB 2B1XB 3H3HA 3VSYA 3EX9A 2BMQB 4XBXA 2Z76A 3HZPA 1O7HB 1OPYA 2XR8B 1JB2A 5IENA 1CQSA 1U5OA 3ROBA 5CF2A 5EVHA 2RFRA 2BMRB 1OUNA 3H51A 2HMNB 3OWYA 5CXOA 4H3UA 1ZO2A 3B8LA 4R9KA 3E99A 3JUPA 2YFIB 3EN8A 1Q40B 3NV0B 3FLJA 3MG3A 1NU3A 4XDWA 3NXJA 1A2KA 3B7CA 4HM3B 3B4OA 1W02A 3G16A 5AIIA 3NHXA 3CNMA 2QGUA 1BUQA 2HMKB 4WWUC 1OF5A 2PZVA 3NUVA 2BNGA 4HM0B 1SJWA 4LGQA 3BLZA 2QIYA 5IG0A 3EN1B 5STDA 7STDA
chains in the Genus database with same CATH superfamily
4XBTA 1JBRA 1RGFA 1NNVA 1C7HA 4QWTA 2XRXB 2YFJB 3LZAA 1JN5A 3T8NA 4FCJA 4N6MA 4HM5B 1O7GB 3D4AA 2CFDA 3AMOA 4CDLA 3CC23 2W0QA 4J9AA 2IMJA 1B3SA 3K0ZA 3WA2X 4AKZA 1RNTA 5CK6A 1IYYA 3JUMA 1RGLA 3MSOA 3CCU3 1X1YA 2P0XA 1NO3A 1LQGC 3D79A 1BRSA 1JZOA 3A76A 3BIRA 1GY6A 3LT8A 3OXAA 5AI1A 1QAFA 1E97A 1UI8A 4GB5A 1DETA 4MJDA 2O9UX 5FW5A 4LMIA 2ZL8A 1STFI 2OCTA 1OHOA 3QRDA 4R4KA 8CHOA 4EYCA 1I2EA 1RKYA 3BB9A 3T8UA 3WA3A 1W00A 5BVBA 3CPW2 1W6CA 3CC43 1IVWA 3URPA 4FR9A 1OCVA 1PFPA 4HM8B 1DMMA 2CH9A 3QK9A 3V98A 2CHCA 2XFTA 4RNYA 3V92A 4N6UA 3HIIA 4BTWA 5G2GA 3FCSB 2XSHB 5IEOA 5D81A 3CXC2 1FUWA 6RNTA 3UB1A 3K9MC 1FUSA 1L5GB 3AGNA 1E3VA 1FGTA 1AVLA 3I553 4K90B 2QA43 1YIJ3 2KXGA 2F5WA 5IF6A 1W01A 1M904 2P0MA 1HYFA 4J5GA 1RNBA 4G1MB 4NHFA 4MEIA 2CG1A 4LZIA 2ML6A 3GZXB 1STDA 4RBNA 1AVKA 1TJDA 1BRNL 3F14A 2WGOA 1MWTA 3NQZA 3TDGA 1K41A 2FGTA 4GL6A 2MF7A 2D1WA 4HVNA 2XGNA 1K734 1IDPA 4O2HA 1RDSA 1RGEA 3B4PA 1GD3A 3LTAA 4X2OA 1T2HA 2CWVA 2ML5A 4JF8A 1YHQ3 1DE3A 1I2FA 1V74A 1FW7A 1UGIA 3ALAA 2BHMA 3ZG5A 1ZS7A 3DM8A 3N8BA 3FF2A 1RN7A 1TTOA 5EEOA 1BNEA 3CCQ3 5D82A 4HM1B 2BMOB 2CC3A 3ZFZA 1UCKA 8RNTA 1LOVA 1Q42A 1A90A 3CCR3 1RLSA 2XF3A 1CH0A 4HKVB 1BOXA 3SOAA 3F9SA 1QVG2 1O7WB 3UL6A 1R4CA 4HYZA 5GSPA 1ROAA 1A2PA 2JDIH 3GZRA 3FH1A 1FYSA 2M7OA 3CMA3 2IA7A 1GOYA 3PCRA 1M9GA 1OF5B 3AGOA 4N6LA 4HM7B 2F98A 2RGQA 3D9RA 1RCLA 1DVCA 1JRQA 1JNQA 2KCDA 2R41A 3DMCA 2KRTA 2OTJ3 3J7Yd 3LTCA 2FNQA 1EA2A 3DZLA 3M8CA 3NM2A 1IQ8A 2ZHXB 2CFWA 4K1UA 6STDA 3F8XA 1GY5A 1UCLA 1JN5B 1UUVB 4HAAA 2OOVA 1AY7A 1B27A 1IVUA 3LOYA 1JKGA 2V1LA 3RGAA 2E2TA 3AMOB 3RDEA 1I0XA 5LC6A 3SYUA 4EXRA 1N9EA 1WMPA 1GYBA 1GOVA 1QVF2 2XEPA 1RJOA 1PYLA 1J2BA 4HOHA 1VQ43 1NB5I 1BSDA 1YJ93 3SEDA 2GU1A 1W5ZA 4XDVA 5AYSC 2HMLB 3KE7A 3PGBA 3JUQA 4HM4B 4ILFA 1KWIA 3CCM3 2GEYA 3KZTA 4DKIA 3WR2A 3ZG0A 2P38A 4N6OB 1US1A 1TFOA 4LEHA 3MG1A 3OW22 1KD14 3EC9A 3KSED 1TRPA 2W04A 3LTDA 4EBGA 1BRJA 2KF5A 1V58A 3FZWA 4LYLB 4WYKA 3WMDA 1KSIA 2XH9A 1MNLA 4OK0A 5KP4A 1BSEA 1GOUA 2K54A 1JB5A 3JUNA 4L8OA 5LC7A 5HGRA 1A67A 1BU4A 1AR0A 2SARA 1TU5A 2CK3H 1RTUA 1NWWA 1GMRA 2HOHA 3SOYA 1RGGA 3CNXA 3UJMA 2W03A 3GZBA 1JBTA 3CCJ3 1B21A 1BSAA 1X1WA 2RNTA 1YJN3 3SX1A 4X2HA 5JPUA 3AHWA 3D3LA 1YNVX 2AADA 4HM2B 5IERA 3NV0A 1AV4A 4LSOA 4EC6A 1D6ZA 1WMOA 1EUIC 2GBXB 2I9WA 2IY2A 2R4IA 4KZ1A 3EBTA 4KT3B 1CEWI 5A0OB 4BU4A 1TFKA 1VQ73 1BNJA 2W56A 2GBWB 2SBLA 3DGLA 4H61A 3SXXA 3X42A 3OV4A 1IV9A 2W2CA 1FGQA 3EQQB 1OGZA 2WOFA 4HBRA 2CFLA 1BRIA 1SPUA 1LNHA 2CKFB 4L8PA 1QALA 5M1AA 1KC84 4WP5A 1JZDA 1RN4A 3NM7A 1ZGXA 1GY7A 1EKMA 4GHOA 2P05A 4HZBB 1LRAA 5IG4A 1D6UA 1G96A 3K63A 3OWSA 5ELJA 7GSPA 3RNTA 3NX0A 4I4KA 3EF8A 3ER7A 4JRFA 1W2ZA 2A15A 3X3ZA 3EHCA 2F86B 1VQP3 4KFDA 1W6GA 5TGNA 1OH0A 3GZYB 3NQYA 3SVAA 1GMPA 1YIT3 1S723 4KFFA 3BNEA 4N6NB 1K28A 1FGOA 1K8A4 1MWSA 1GS3A 1W4NA 1YVSA 3S67A 1WMNA 2Y74A 1YVBI 5CLKA 3KIIA 1E3RA 3OWUA 4EW5A 1UW1A 4RZMA 3X3YA 1UUGB 4R1KA 4FCMA 1SIIA 3CCE3 1TP6A 3KFQC 1ULIB 3GAXA 2CX0A 3FF0A 1B2MA 4XM4A 1IT8A 4FMAA 4FMCA 4KVHA 4TX4A 4BTXA 3G6E3 4CPKA 5AIHA 4R9LA 4IT7A 4HM6B 1IQYA 5M18A 2B24B 5KP3A 3VGNA 3S5CA 3WDGB 2P09A 2BU4A 3FSDA 5KP1A 2UX0A 1UCIA 4MMXB 3FG1A 2QEX3 1W6YA 1YJW3 3DUKA 1TRQA 4FMDA 7RNTA 1ASKA 3HOHA 4O3VA 1M1K4 1QMAA 3I563 5BXQA 3LH4A 2IUKA 4OVMA 3DH2A 3EE1A 3GSPA 1ISKA 3EJVA 3MKIA 1VZZA 2KF4A 3FGYA 1T3BA 1O7MB 2Z7AA 3FG4A 3SLUA 1GSPA 2FXTA 5BIRA 1FA3A 1HU9A 1MGWA 3EBYA 3Q1CA 4WYKB 4N3VA 5IG5A 2GSPA 4RNZA 4AKYA 1FUTA 2IUJA 2GXFA 1OHPA 2MC8A 3LT9A 1JB4A 1PY3A 1Q7HA 2WGQA 3STDA 1NDOB 1VQ93 5AEWB 2W9PA 3D5GA 4O02B 3GWRA 1IT7A 1IU7A 2HMJB 3F8HA 3CPOA 1DMNA 1UUWB 1OHSA 1OGXA 2C11A 2IYJA 2KAAA 2AAEA 3F40A 5CF1A 1Q814 1BNFA 1DVDA 1OACA 1DYUA 1B2UA 1Z1SA 1ROVA 3L0RA 1N5PA 3KKGA 2E2UA 3MHEA 2W9QA 4K1VA 1MWRA 1AQZA 1IV7A 2HMOB 5EQLA 2Y73A 3OX9A 4HJLB 4OUQA 4R80A 1R4YA 1BGSA 2OQEC 1BVIA 3IPTA 3G4S3 1MOLA 1CYUA 2PNCA 5HOHA 1TIJA 5AIFA 1LOYA 1JJ22 4N6TA 3X40A 1Q9EA 1SARA 3PZWA 5DREA 4HZ9B 1M1XB 9RNTA 1Q824 1W7CA 3K7CA 1YI23 1UCJA 1BRGA 2H0IA 4J8TA 4EV2A 2GEXA 1BNIA 1JBSA 1BNSA 3G8ZA 1RGKA 5AIGA 3DY5A 3MYTA 4EV5A 3JVCA 1B2ZA 2XSOB 1WQLB 2OWPA 2BIRA 4IIAA 4N6V0 1G0TA 1BSBA 4BL2A 5BU4A 1SIHA 3BNCA 1K9M4 5AEUB 1RRHA 3HX8A 1B20A 1B2XA 2LYXA 1VQO3 1VQ53 3HK4A 1RGCA 1Q40A 2C4BA 2RSXA 4RNTA 3RGRA 1A2VA 1LQMB 1YGEA 4CCVA 4I5QA 4NREA 5DRVA 1IQXA 2RCDA 1UI7A 1Y4KA 3Q2PA 2ZDJA 3A5EA 3F7SA 1QJGA 1RSNA 3MPHA 3Q90A 4NPBA 4ZM8A 3X3XA 1LOXA 1S5AA 5D83A 1BRKA 3KN4A 1LXEA 4STDA 3KCHA 1VQ63 4XBYA 4ORLA 3U1WA 1YGWA 1FGMA 1ZX2A 1ULJB 2H0HA 3WODG 2JQ5A 2YFLB 2O3OA 4L7KA 5G1KA 1O7NB 3PCSA 1VQ83 5IEPA 4J5KA 2BT3A 2W6JH 2L4VA 3LTBA 4BIRA 1I70A 3WHOA 1CYVA 2CW9A 1HKXA 1RGHA 2KF3A 1O7PB 2STDA 1D6YA 2GU3A 4K61A 1BANA 3I0YA 5IG3A 1I0VA 5G1LA 3FKAA 1T2IA 2INXA 3DXOA 1Q864 3ECFA 1DMQA 4XB5A 4CJNA 3KSPA 1MWUA 2C10A 1UGHI 1PU4A 1JV2B 4U13A 3CCV3 3WOFB 3T0UA 2Z6BA 2Q07A 4Q53A 3UNLA 4BL3A 2Z77A 5JBSA 1BNGA 2F99A 3JUOA 3N9HA 2D42A 2RBIA 3G0KA 2CWUA 3NBRA 2OTL3 2UGIA 1VQK3 5AYRB 1WTHA 4PEJA 3GRDA 3LYGA 3LXUX 1EQKA 1TUHA 1BSCA 3CU3A 1FGRA 5M19A 1I3FA 3BNBA 3MG2A 2HMMB 1GMQA 4KFEA 1I8VA 4FCZA 3CCL3 3F7XA 5FGOA 1BUJA 1EG9B 1RGAA 1JKGB 1X1UA 5JPPA 3CME3 1W2B2 1G02A 3V99A 2F5MA 5IW9A 2B1XB 3H3HA 3IJEB 3X41A 3VSYA 1UDII 1RRLA 3EX9A 3CD63 1T5YA 2BMQB 2J8XB 1VQM3 1IVVA 1RMSA 2H0GA 2CG0A 3DGOA 3PYJA 2Z76A 4XBXA 3HZPA 1O7HB 3CCS3 1OPYA 3NBBA 1NB3I 1LNIA 1VQL3 1IVXA 3N54B 4GSPA 1SQWA 2K3DA 5I97A 3U97A 3K5TA 1RCKA 3S27A 2XR8B 1IK3A 4IPBA 1JB2A 2F4YA 1WNHA 2BO9B 1KQS2 2CFKA 1GD4A 1CQSA 2WO0A 3HIGA 4MMZB 1FZUA 2OQEA 5IENA 2F56A 3MWZA 1U5OA 3ROBA 5CF2A 1V57A 3PS8A 3AHSA 5EVHA 1QAKA 2RFRA 3FG3A 2BMRB 1I2GA 1N8QA 1OUNA 3S29A 2WOHA 1I3IA 1X1XA 6GSPA 3H51A 1F8NA 2HMNB 3HI7A 1N5HA 3OWYA 1BNRA 2CIUA 3EB8A 3BU4A 2K0MA 4H3UA 5CXOA 1ZO2A 1VQQA 3B8LA 1N9JA 3D5IA 3E99A 4MMYB 4R9KA 2CWTA 3JUPA 2YFIB 3EN8A 1Q40B 1BAOA 3NV0B 3FLJA 1N8R4 3MG3A 1NU3A 4XDWA 3VF1A 1EEJA 2YX9A 5ELUA 3BNDA 3NBJA 3IMAB 4WFOA 3DGMA 1A2KA 3B7CA 3NXJA 4HM3B 2XGLA 5RNTA 3B4OA 3G713 1BIRA 1LOWA 1RN1A 2E2VA 2W56B 3WOEB 1W02A 2CX1A 3G16A 3O8YA 5AIIA 3NHXA 3Q3FA 4AEQA 3CNMA 3LMLA 1HZ1A 2QGUA 1BUQA 2HMKB 2L1SA 2LQVA 4WWUC 1LVNA 3DGNA 4FMBA 1OF5A 2PZVA 4O8SA 3NUVA 2BNGA 1BRHA 3S28A 1NJI4 2CFGA 1SJWA 4HM0B 4LGQA 2ZA4A 2KF6A 3CC73 4BTYA 1MGRA 3BLZA 2QIYA 1C54A 3UL5A 1B2SA 3EN1B 5IG0A 2UUGC 3PXMA 1VQN3 5STDA 3DGYA 7STDA 4WHAA 2XFSA 2OOVC 1Q7Y4 1RHLA 1U8CB
chains in the Genus database with same CATH topology
4XBTA 1C7HA 4QWTA 2XRXB 2YFJB 3LZAA 1JN5A 3T8NA 4FCJA 4N6MA 4HM5B 1O7GB 2CFDA 3AMOA 4CDLA 3CC23 2W0QA 4J9AA 2IMJA 3K0ZA 3WA2X 4AKZA 5CK6A 3JUMA 3CCU3 3MSOA 2P0XA 1NO3A 3A76A 1GY6A 3LT8A 3OXAA 5AI1A 1QAFA 1E97A 1UI8A 4GB5A 4MJDA 2O9UX 5FW5A 4LMIA 2ZL8A 1STFI 2OCTA 1OHOA 3QRDA 4R4KA 8CHOA 4EYCA 1RKYA 3BB9A 3T8UA 3WA3A 1W00A 5BVBA 3CPW2 1W6CA 3CC43 1IVWA 4FR9A 1OCVA 1PFPA 4HM8B 1DMMA 2CH9A 3QK9A 3V98A 2CHCA 2XFTA 4RNYA 3V92A 4N6UA 3HIIA 4BTWA 5G2GA 3FCSB 2XSHB 5IEOA 5D81A 3CXC2 1FUWA 3UB1A 3K9MC 1L5GB 1E3VA 1FGTA 1AVLA 3I553 4K90B 2QA43 1YIJ3 2KXGA 5IF6A 1W01A 1M904 2P0MA 4G1MB 4NHFA 4MEIA 2CG1A 4LZIA 2ML6A 3GZXB 1STDA 4RBNA 1AVKA 3F14A 2WGOA 3NQZA 3TDGA 1K41A 2FGTA 4GL6A 2MF7A 2D1WA 4HVNA 2XGNA 1K734 1IDPA 4O2HA 3B4PA 1GD3A 3LTAA 4X2OA 2CWVA 4JF8A 2ML5A 1YHQ3 1V74A 3ALAA 2BHMA 3DM8A 3N8BA 3FF2A 1RN7A 5EEOA 3CCQ3 5D82A 4HM1B 2BMOB 2CC3A 3CCS3 1A90A 1Q42A 3CCR3 2XF3A 4HKVB 1QVG2 3SOAA 3F9SA 1O7WB 3UL6A 1R4CA 4HYZA 1ROAA 2JDIH 3GZRA 3FH1A 2M7OA 3CMA3 2IA7A 3PCRA 1M9GA 1OF5B 4N6LA 4HM7B 2F98A 2RGQA 3D9RA 1DVCA 1JRQA 1JNQA 2KCDA 3DMCA 2KRTA 2OTJ3 3J7Yd 3LTCA 2FNQA 1EA2A 3DZLA 3M8CA 3NM2A 1IQ8A 2CFWA 4K1UA 6STDA 3F8XA 1GY5A 1JN5B 1UUVB 2OOVA 3RDEA 3LOYA 1IVUA 1JKGA 2V1LA 3RGAA 2E2TA 3AMOB 5LC6A 4EXRA 1N9EA 1WMPA 1GYBA 1QVF2 2XEPA 1RJOA 1J2BA 1VQ43 1NB5I 1YJ93 3SEDA 2GU1A 1W5ZA 4XDVA 5AYSC 2HMLB 3KE7A 3PGBA 3JUQA 4HM4B 1KWIA 3CCM3 2GEYA 3KZTA 2P38A 4N6OB 1US1A 1TFOA 4LEHA 3MG1A 3OW22 1KD14 3EC9A 3KSED 2W04A 3LTDA 4EBGA 3FZWA 3WMDA 4WYKA 1KSIA 2XH9A 1MNLA 4OK0A 5KP4A 2K54A 3JUNA 1JB5A 4L8OA 5LC7A 5HGRA 1A67A 1AR0A 1TU5A 2CK3H 1NWWA 3SOYA 3CNXA 3UJMA 2W03A 3GZBA 3CCJ3 1YJN3 3SX1A 4X2HA 5JPUA 3D3LA 4HM2B 5IERA 3NV0A 1AV4A 4LSOA 4EC6A 1D6ZA 1WMOA 2GBXB 2I9WA 2R4IA 4KZ1A 3EBTA 1CEWI 5A0OB 1VQ73 1TFKA 2W56A 2GBWB 2SBLA 3DGLA 4H61A 3SXXA 3X42A 3OV4A 1IV9A 2W2CA 1FGQA 3EQQB 1OGZA 2WOFA 4HBRA 2CFLA 1SPUA 2CKFB 1LNHA 4L8PA 1QALA 1KC84 4WP5A 3NM7A 1GY7A 1EKMA 2P05A 4HZBB 5IG4A 1D6UA 1G96A 3K63A 3OWSA 5ELJA 3NX0A 4I4KA 3EF8A 3ER7A 4JRFA 1W2ZA 2A15A 3X3ZA 3EHCA 2F86B 1VQP3 4KFDA 1W6GA 5TGNA 1OH0A 3GZYB 3NQYA 3SVAA 1YIT3 1S723 4KFFA 3BNEA 4N6NB 1K28A 1FGOA 1K8A4 1GS3A 1W4NA 3S67A 1WMNA 2Y74A 1YVBI 5CLKA 3KIIA 1E3RA 3OWUA 1UW1A 4RZMA 3X3YA 4R1KA 4FCMA 1SIIA 3CCE3 1TP6A 3KFQC 1ULIB 3GAXA 3FF0A 4XM4A 1IT8A 4FMAA 4FMCA 4KVHA 4TX4A 4BTXA 3G6E3 5AIHA 4R9LA 4IT7A 4HM6B 1IQYA 2B24B 5KP3A 3VGNA 3S5CA 3WDGB 2P09A 3FSDA 5KP1A 2UX0A 4MMXB 3FG1A 2QEX3 1W6YA 1YJW3 3DUKA 4FMDA 1ASKA 4O3VA 1M1K4 1QMAA 3I563 5BXQA 3LH4A 2IUKA 4OVMA 3EE1A 1ISKA 3EJVA 3MKIA 1VZZA 3FGYA 2Z7AA 1O7MB 3FG4A 3SLUA 1FA3A 2FXTA 1HU9A 3EBYA 3Q1CA 4WYKB 4N3VA 5IG5A 4RNZA 4AKYA 2IUJA 2GXFA 1OHPA 2MC8A 3LT9A 1JB4A 2WGQA 3STDA 1NDOB 1VQ93 5AEWB 2W9PA 4O02B 3GWRA 1IT7A 1IU7A 2HMJB 3F8HA 3CPOA 1DMNA 1UUWB 1OHSA 1OGXA 2C11A 3F40A 4NREA 5CF1A 1Q814 1DVDA 1OACA 1DYUA 1Z1SA 1ROVA 3L0RA 1N5PA 3KKGA 2E2UA 3MHEA 2W9QA 4K1VA 1IV7A 2HMOB 5EQLA 2Y73A 3OX9A 4HJLB 4OUQA 4R80A 3IPTA 3G4S3 2OQEC 1CYUA 1MOLA 2PNCA 1TIJA 5AIFA 1JJ22 4N6TA 3X40A 3PZWA 5DREA 4HZ9B 1M1XB 1Q824 1W7CA 3K7CA 1YI23 4J8TA 4EV2A 2GEXA 3G8ZA 5AIGA 3DY5A 3MYTA 4EV5A 3JVCA 2XSOB 1WQLB 2OWPA 4IIAA 4N6V0 1SIHA 3BNCA 1K9M4 5AEUB 1RRHA 3HX8A 2LYXA 1VQO3 1VQ53 3HK4A 1Q40A 2RSXA 3RGRA 1A2VA 1YGEA 4CCVA 5DRVA 1IQXA 2RCDA 1UI7A 1Y4KA 3Q2PA 2ZDJA 3F7SA 1QJGA 3Q90A 3MPHA 4ZM8A 3X3XA 1LOXA 1S5AA 5D83A 3KN4A 1LXEA 4STDA 1VQ63 4XBYA 4ORLA 3U1WA 1FGMA 1ZX2A 1ULJB 3WODG 2JQ5A 2YFLB 2O3OA 4L7KA 1O7NB 3PCSA 1VQ83 5IEPA 2BT3A 2W6JH 2L4VA 3LTBA 1CYVA 2CW9A 1HKXA 2STDA 1O7PB 1D6YA 2GU3A 4K61A 3I0YA 5IG3A 3FKAA 2INXA 3DXOA 1Q864 3ECFA 1DMQA 4XB5A 3KSPA 3CCV3 2C10A 1PU4A 1JV2B 4U13A 3WOFB 3T0UA 2Z6BA 2Q07A 4Q53A 3UNLA 2Z77A 5JBSA 2F99A 3JUOA 3N9HA 2D42A 3G0KA 3NBRA 2CWUA 2OTL3 1VQK3 5AYRB 1WTHA 4PEJA 3GRDA 3LYGA 3LXUX 1EQKA 1TUHA 3CU3A 1FGRA 3BNBA 3MG2A 2HMMB 4KFEA 4FCZA 3CCL3 3F7XA 5FGOA 1EG9B 5JPPA 1JKGB 3CME3 1W2B2 3V99A 5IW9A 2B1XB 3H3HA 3IJEB 3X41A 3VSYA 3EX9A 1RRLA 3CD63 1T5YA 2BMQB 1VQM3 1IVVA 2CG0A 3DGOA 3PYJA 2Z76A 4XBXA 3HZPA 1O7HB 1OPYA 3NBBA 1NB3I 1VQL3 1IVXA 3N54B 1SQWA 5I97A 3U97A 3K5TA 3S27A 2XR8B 1IK3A 4IPBA 1JB2A 1WNHA 2BO9B 1KQS2 2CFKA 1GD4A 1CQSA 2WO0A 3HIGA 4MMZB 2OQEA 5IENA 3MWZA 1U5OA 3ROBA 5CF2A 3PS8A 5EVHA 1QAKA 2RFRA 3FG3A 2BMRB 1N8QA 1OUNA 3S29A 2WOHA 3H51A 1F8NA 2HMNB 3HI7A 1N5HA 3OWYA 2CIUA 3EB8A 5CXOA 2K0MA 4H3UA 1ZO2A 3B8LA 1N9JA 3E99A 4MMYB 4R9KA 2CWTA 3JUPA 2YFIB 3EN8A 1Q40B 1N8R4 3NV0B 3FLJA 3MG3A 1NU3A 4XDWA 3VF1A 2YX9A 5ELUA 3BNDA 3NBJA 3IMAB 4WFOA 3DGMA 1A2KA 3B7CA 3NXJA 4HM3B 2XGLA 3B4OA 3G713 2E2VA 2W56B 3WOEB 1W02A 3O8YA 3G16A 5AIIA 3NHXA 4AEQA 3CNMA 3LMLA 2QGUA 1BUQA 2HMKB 2LQVA 4WWUC 1LVNA 3DGNA 4FMBA 1OF5A 2PZVA 4O8SA 3NUVA 2BNGA 1NJI4 3S28A 2CFGA 1SJWA 4HM0B 4LGQA 3CC73 4BTYA 3BLZA 2QIYA 3UL5A 5IG0A 3EN1B 1VQN3 3PXMA 5STDA 7STDA 4WHAA 2XFSA 2OOVC 1Q7Y4 1U8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBT A;  1C7H A;  2XRX B;  2YFJ B;  3LZA A;  1JN5 A;  3T8N A;  4FCJ A;  4HM5 B;  1O7G B;  4CDL A;  4J9A A;  2IMJ A;  3K0Z A;  5CK6 A;  3JUM A;  3MSO A;  3A76 A;  1GY6 A;  3OXA A;  5AI1 A;  1E97 A;  4GB5 A;  4MJD A;  5FW5 A;  4LMI A;  1OHO A;  8CHO A;  3BB9 A;  3T8U A;  1W00 A;  5BVB A;  1OCV A;  4HM8 B;  1DMM A;  2CHC A;  5G2G A;  2XSH B;  5IEO A;  5D81 A;  1E3V A;  5IF6 A;  1W01 A;  3GZX B;  1STD A;  3F14 A;  1K41 A;  4HVN A;  1IDP A;  3B4P A;  4X2O A;  3DM8 A;  3FF2 A;  5D82 A;  4HM1 B;  2BMO B;  1Q42 A;  4HKV B;  3SOA A;  3F9S A;  1O7W B;  3GZR A;  3FH1 A;  1OF5 B;  4HM7 B;  2F98 A;  2RGQ A;  3D9R A;  3DMC A;  1EA2 A;  3DZL A;  3M8C A;  3NM2 A;  4K1U A;  6STD A;  3F8X A;  1GY5 A;  1JN5 B;  1UUV B;  1JKG A;  3RGA A;  1GYB A;  3SED A;  4XDV A;  2HML B;  3KE7 A;  3JUQ A;  4HM4 B;  2GEY A;  3KZT A;  4LEH A;  3MG1 A;  3EC9 A;  3FZW A;  3WMD A;  4WYK A;  5KP4 A;  2K54 A;  3JUN A;  1JB5 A;  4L8O A;  5HGR A;  1AR0 A;  1NWW A;  3SOY A;  3CNX A;  3UJM A;  3GZB A;  4X2H A;  5JPU A;  4HM2 B;  5IER A;  3NV0 A;  2R4I A;  2GBX B;  2I9W A;  3EBT A;  2GBW B;  3OV4 A;  2W2C A;  3EQQ B;  1OGZ A;  2CKF B;  4L8P A;  4WP5 A;  1GY7 A;  4HZB B;  5IG4 A;  3OWS A;  4I4K A;  3EF8 A;  3ER7 A;  2A15 A;  3EHC A;  2F86 B;  5TGN A;  1OH0 A;  3GZY B;  1GS3 A;  5CLK A;  1E3R A;  3OWU A;  4RZM A;  4R1K A;  4FCM A;  1TP6 A;  1ULI B;  3FF0 A;  4XM4 A;  4KVH A;  5AIH A;  4R9L A;  4HM6 B;  2B24 B;  5KP3 A;  3VGN A;  3S5C A;  3FSD A;  5KP1 A;  2UX0 A;  1W6Y A;  3DUK A;  1ASK A;  1QMA A;  5BXQ A;  4OVM A;  1ISK A;  3EJV A;  3MKI A;  1VZZ A;  3FGY A;  2Z7A A;  1O7M B;  3EBY A;  4WYK B;  4N3V A;  5IG5 A;  2GXF A;  1OHP A;  1JB4 A;  3STD A;  1NDO B;  5AEW B;  3GWR A;  2HMJ B;  3F8H A;  3CPO A;  1DMN A;  1UUW B;  1OHS A;  1OGX A;  3F40 A;  5CF1 A;  1Z1S A;  3KKG A;  3MHE A;  4K1V A;  2HMO B;  3OX9 A;  4HJL B;  4OUQ A;  3IPT A;  5AIF A;  5DRE A;  4HZ9 B;  3K7C A;  4J8T A;  2GEX A;  3G8Z A;  5AIG A;  3MYT A;  2XSO B;  1WQL B;  2OWP A;  4IIA A;  5AEU B;  3HX8 A;  3HK4 A;  1Q40 A;  3RGR A;  5DRV A;  2RCD A;  3F7S A;  1QJG A;  3Q90 A;  1S5A A;  5D83 A;  4STD A;  4XBY A;  4ORL A;  1ZX2 A;  1ULJ B;  2JQ5 A;  2YFL B;  4L7K A;  1O7N B;  5IEP A;  1HKX A;  2STD A;  1O7P B;  3I0Y A;  5IG3 A;  3FKA A;  2INX A;  3DXO A;  3ECF A;  1DMQ A;  4XB5 A;  3KSP A;  4U13 A;  4Q53 A;  3UNL A;  2Z77 A;  2F99 A;  3JUO A;  3NBR A;  3G0K A;  4PEJ A;  3GRD A;  3LYG A;  1TUH A;  3CU3 A;  3MG2 A;  2HMM B;  3F7X A;  1EG9 B;  5JPP A;  1JKG B;  2B1X B;  3H3H A;  3VSY A;  3EX9 A;  2BMQ B;  4XBX A;  2Z76 A;  3HZP A;  1O7H B;  1OPY A;  2XR8 B;  1JB2 A;  5IEN A;  1CQS A;  1U5O A;  3ROB A;  5CF2 A;  5EVH A;  2RFR A;  2BMR B;  1OUN A;  3H51 A;  2HMN B;  3OWY A;  5CXO A;  4H3U A;  1ZO2 A;  3B8L A;  4R9K A;  3E99 A;  3JUP A;  2YFI B;  3EN8 A;  1Q40 B;  3NV0 B;  3FLJ A;  3MG3 A;  1NU3 A;  4XDW A;  3NXJ A;  1A2K A;  3B7C A;  4HM3 B;  3B4O A;  1W02 A;  3G16 A;  5AII A;  3NHX A;  3CNM A;  2QGU A;  1BUQ A;  2HMK B;  4WWU C;  1OF5 A;  2PZV A;  3NUV A;  2BNG A;  4HM0 B;  1SJW A;  4LGQ A;  3BLZ A;  2QIY A;  5IG0 A;  3EN1 B;  5STD A;  7STD A; 
#chains in the Genus database with same CATH topology
 4XBT A;  1JBR A;  1RGF A;  1NNV A;  1C7H A;  4QWT A;  2XRX B;  2YFJ B;  3LZA A;  1JN5 A;  3T8N A;  4FCJ A;  4N6M A;  4HM5 B;  1O7G B;  3D4A A;  2CFD A;  3AMO A;  4CDL A;  3CC2 3;  2W0Q A;  4J9A A;  2IMJ A;  1B3S A;  3K0Z A;  3WA2 X;  4AKZ A;  1RNT A;  5CK6 A;  1IYY A;  3JUM A;  1RGL A;  3MSO A;  3CCU 3;  1X1Y A;  2P0X A;  1NO3 A;  1LQG C;  3D79 A;  1BRS A;  1JZO A;  3A76 A;  3BIR A;  1GY6 A;  3LT8 A;  3OXA A;  5AI1 A;  1QAF A;  1E97 A;  1UI8 A;  4GB5 A;  1DET A;  4MJD A;  2O9U X;  5FW5 A;  4LMI A;  2ZL8 A;  1STF I;  2OCT A;  1OHO A;  3QRD A;  4R4K A;  8CHO A;  4EYC A;  1I2E A;  1RKY A;  3BB9 A;  3T8U A;  3WA3 A;  1W00 A;  5BVB A;  3CPW 2;  1W6C A;  3CC4 3;  1IVW A;  3URP A;  4FR9 A;  1OCV A;  1PFP A;  4HM8 B;  1DMM A;  2CH9 A;  3QK9 A;  3V98 A;  2CHC A;  2XFT A;  4RNY A;  3V92 A;  4N6U A;  3HII A;  4BTW A;  5G2G A;  3FCS B;  2XSH B;  5IEO A;  5D81 A;  3CXC 2;  1FUW A;  6RNT A;  3UB1 A;  3K9M C;  1FUS A;  1L5G B;  3AGN A;  1E3V A;  1FGT A;  1AVL A;  3I55 3;  4K90 B;  2QA4 3;  1YIJ 3;  2KXG A;  2F5W A;  5IF6 A;  1W01 A;  1M90 4;  2P0M A;  1HYF A;  4J5G A;  1RNB A;  4G1M B;  4NHF A;  4MEI A;  2CG1 A;  4LZI A;  2ML6 A;  3GZX B;  1STD A;  4RBN A;  1AVK A;  1TJD A;  1BRN L;  3F14 A;  2WGO A;  1MWT A;  3NQZ A;  3TDG A;  1K41 A;  2FGT A;  4GL6 A;  2MF7 A;  2D1W A;  4HVN A;  2XGN A;  1K73 4;  1IDP A;  4O2H A;  1RDS A;  1RGE A;  3B4P A;  1GD3 A;  3LTA A;  4X2O A;  1T2H A;  2CWV A;  2ML5 A;  4JF8 A;  1YHQ 3;  1DE3 A;  1I2F A;  1V74 A;  1FW7 A;  1UGI A;  3ALA A;  2BHM A;  3ZG5 A;  1ZS7 A;  3DM8 A;  3N8B A;  3FF2 A;  1RN7 A;  1TTO A;  5EEO A;  1BNE A;  3CCQ 3;  5D82 A;  4HM1 B;  2BMO B;  2CC3 A;  3ZFZ A;  1UCK A;  8RNT A;  1LOV A;  1Q42 A;  1A90 A;  3CCR 3;  1RLS A;  2XF3 A;  1CH0 A;  4HKV B;  1BOX A;  3SOA A;  3F9S A;  1QVG 2;  1O7W B;  3UL6 A;  1R4C A;  4HYZ A;  5GSP A;  1ROA A;  1A2P A;  2JDI H;  3GZR A;  3FH1 A;  1FYS A;  2M7O A;  3CMA 3;  2IA7 A;  1GOY A;  3PCR A;  1M9G A;  1OF5 B;  3AGO A;  4N6L A;  4HM7 B;  2F98 A;  2RGQ A;  3D9R A;  1RCL A;  1DVC A;  1JRQ A;  1JNQ A;  2KCD A;  2R41 A;  3DMC A;  2KRT A;  2OTJ 3;  3J7Y d;  3LTC A;  2FNQ A;  1EA2 A;  3DZL A;  3M8C A;  3NM2 A;  1IQ8 A;  2ZHX B;  2CFW A;  4K1U A;  6STD A;  3F8X A;  1GY5 A;  1UCL A;  1JN5 B;  1UUV B;  4HAA A;  2OOV A;  1AY7 A;  1B27 A;  1IVU A;  3LOY A;  1JKG A;  2V1L A;  3RGA A;  2E2T A;  3AMO B;  3RDE A;  1I0X A;  5LC6 A;  3SYU A;  4EXR A;  1N9E A;  1WMP A;  1GYB A;  1GOV A;  1QVF 2;  2XEP A;  1RJO A;  1PYL A;  1J2B A;  4HOH A;  1VQ4 3;  1NB5 I;  1BSD A;  1YJ9 3;  3SED A;  2GU1 A;  1W5Z A;  4XDV A;  5AYS C;  2HML B;  3KE7 A;  3PGB A;  3JUQ A;  4HM4 B;  4ILF A;  1KWI A;  3CCM 3;  2GEY A;  3KZT A;  4DKI A;  3WR2 A;  3ZG0 A;  2P38 A;  4N6O B;  1US1 A;  1TFO A;  4LEH A;  3MG1 A;  3OW2 2;  1KD1 4;  3EC9 A;  3KSE D;  1TRP A;  2W04 A;  3LTD A;  4EBG A;  1BRJ A;  2KF5 A;  1V58 A;  3FZW A;  4LYL B;  4WYK A;  3WMD A;  1KSI A;  2XH9 A;  1MNL A;  4OK0 A;  5KP4 A;  1BSE A;  1GOU A;  2K54 A;  1JB5 A;  3JUN A;  4L8O A;  5LC7 A;  5HGR A;  1A67 A;  1BU4 A;  1AR0 A;  2SAR A;  1TU5 A;  2CK3 H;  1RTU A;  1NWW A;  1GMR A;  2HOH A;  3SOY A;  1RGG A;  3CNX A;  3UJM A;  2W03 A;  3GZB A;  1JBT A;  3CCJ 3;  1B21 A;  1BSA A;  1X1W A;  2RNT A;  1YJN 3;  3SX1 A;  4X2H A;  5JPU A;  3AHW A;  3D3L A;  1YNV X;  2AAD A;  4HM2 B;  5IER A;  3NV0 A;  1AV4 A;  4LSO A;  4EC6 A;  1D6Z A;  1WMO A;  1EUI C;  2GBX B;  2I9W A;  2IY2 A;  2R4I A;  4KZ1 A;  3EBT A;  4KT3 B;  1CEW I;  5A0O B;  4BU4 A;  1TFK A;  1VQ7 3;  1BNJ A;  2W56 A;  2GBW B;  2SBL A;  3DGL A;  4H61 A;  3SXX A;  3X42 A;  3OV4 A;  1IV9 A;  2W2C A;  1FGQ A;  3EQQ B;  1OGZ A;  2WOF A;  4HBR A;  2CFL A;  1BRI A;  1SPU A;  1LNH A;  2CKF B;  4L8P A;  1QAL A;  5M1A A;  1KC8 4;  4WP5 A;  1JZD A;  1RN4 A;  3NM7 A;  1ZGX A;  1GY7 A;  1EKM A;  4GHO A;  2P05 A;  4HZB B;  1LRA A;  5IG4 A;  1D6U A;  1G96 A;  3K63 A;  3OWS A;  5ELJ A;  7GSP A;  3RNT A;  3NX0 A;  4I4K A;  3EF8 A;  3ER7 A;  4JRF A;  1W2Z A;  2A15 A;  3X3Z A;  3EHC A;  2F86 B;  1VQP 3;  4KFD A;  1W6G A;  5TGN A;  1OH0 A;  3GZY B;  3NQY A;  3SVA A;  1GMP A;  1YIT 3;  1S72 3;  4KFF A;  3BNE A;  4N6N B;  1K28 A;  1FGO A;  1K8A 4;  1MWS A;  1GS3 A;  1W4N A;  1YVS A;  3S67 A;  1WMN A;  2Y74 A;  1YVB I;  5CLK A;  3KII A;  1E3R A;  3OWU A;  4EW5 A;  1UW1 A;  4RZM A;  3X3Y A;  1UUG B;  4R1K A;  4FCM A;  1SII A;  3CCE 3;  1TP6 A;  3KFQ C;  1ULI B;  3GAX A;  2CX0 A;  3FF0 A;  1B2M A;  4XM4 A;  1IT8 A;  4FMA A;  4FMC A;  4KVH A;  4TX4 A;  4BTX A;  3G6E 3;  4CPK A;  5AIH A;  4R9L A;  4IT7 A;  4HM6 B;  1IQY A;  5M18 A;  2B24 B;  5KP3 A;  3VGN A;  3S5C A;  3WDG B;  2P09 A;  2BU4 A;  3FSD A;  5KP1 A;  2UX0 A;  1UCI A;  4MMX B;  3FG1 A;  2QEX 3;  1W6Y A;  1YJW 3;  3DUK A;  1TRQ A;  4FMD A;  7RNT A;  1ASK A;  3HOH A;  4O3V A;  1M1K 4;  1QMA A;  3I56 3;  5BXQ A;  3LH4 A;  2IUK A;  4OVM A;  3DH2 A;  3EE1 A;  3GSP A;  1ISK A;  3EJV A;  3MKI A;  1VZZ A;  2KF4 A;  3FGY A;  1T3B A;  1O7M B;  2Z7A A;  3FG4 A;  3SLU A;  1GSP A;  2FXT A;  5BIR A;  1FA3 A;  1HU9 A;  1MGW A;  3EBY A;  3Q1C A;  4WYK B;  4N3V A;  5IG5 A;  2GSP A;  4RNZ A;  4AKY A;  1FUT A;  2IUJ A;  2GXF A;  1OHP A;  2MC8 A;  3LT9 A;  1JB4 A;  1PY3 A;  1Q7H A;  2WGQ A;  3STD A;  1NDO B;  1VQ9 3;  5AEW B;  2W9P A;  3D5G A;  4O02 B;  3GWR A;  1IT7 A;  1IU7 A;  2HMJ B;  3F8H A;  3CPO A;  1DMN A;  1UUW B;  1OHS A;  1OGX A;  2C11 A;  2IYJ A;  2KAA A;  2AAE A;  3F40 A;  5CF1 A;  1Q81 4;  1BNF A;  1DVD A;  1OAC A;  1DYU A;  1B2U A;  1Z1S A;  1ROV A;  3L0R A;  1N5P A;  3KKG A;  2E2U A;  3MHE A;  2W9Q A;  4K1V A;  1MWR A;  1AQZ A;  1IV7 A;  2HMO B;  5EQL A;  2Y73 A;  3OX9 A;  4HJL B;  4OUQ A;  4R80 A;  1R4Y A;  1BGS A;  2OQE C;  1BVI A;  3IPT A;  3G4S 3;  1MOL A;  1CYU A;  2PNC A;  5HOH A;  1TIJ A;  5AIF A;  1LOY A;  1JJ2 2;  4N6T A;  3X40 A;  1Q9E A;  1SAR A;  3PZW A;  5DRE A;  4HZ9 B;  1M1X B;  9RNT A;  1Q82 4;  1W7C A;  3K7C A;  1YI2 3;  1UCJ A;  1BRG A;  2H0I A;  4J8T A;  4EV2 A;  2GEX A;  1BNI A;  1JBS A;  1BNS A;  3G8Z A;  1RGK A;  5AIG A;  3DY5 A;  3MYT A;  4EV5 A;  3JVC A;  1B2Z A;  2XSO B;  1WQL B;  2OWP A;  2BIR A;  4IIA A;  4N6V 0;  1G0T A;  1BSB A;  4BL2 A;  5BU4 A;  1SIH A;  3BNC A;  1K9M 4;  5AEU B;  1RRH A;  3HX8 A;  1B20 A;  1B2X A;  2LYX A;  1VQO 3;  1VQ5 3;  3HK4 A;  1RGC A;  1Q40 A;  2C4B A;  2RSX A;  4RNT A;  3RGR A;  1A2V A;  1LQM B;  1YGE A;  4CCV A;  4I5Q A;  4NRE A;  5DRV A;  1IQX A;  2RCD A;  1UI7 A;  1Y4K A;  3Q2P A;  2ZDJ A;  3A5E A;  3F7S A;  1QJG A;  1RSN A;  3MPH A;  3Q90 A;  4NPB A;  4ZM8 A;  3X3X A;  1LOX A;  1S5A A;  5D83 A;  1BRK A;  3KN4 A;  1LXE A;  4STD A;  3KCH A;  1VQ6 3;  4XBY A;  4ORL A;  3U1W A;  1YGW A;  1FGM A;  1ZX2 A;  1ULJ B;  2H0H A;  3WOD G;  2JQ5 A;  2YFL B;  2O3O A;  4L7K A;  5G1K A;  1O7N B;  3PCS A;  1VQ8 3;  5IEP A;  4J5K A;  2BT3 A;  2W6J H;  2L4V A;  3LTB A;  4BIR A;  1I70 A;  3WHO A;  1CYV A;  2CW9 A;  1HKX A;  1RGH A;  2KF3 A;  1O7P B;  2STD A;  1D6Y A;  2GU3 A;  4K61 A;  1BAN A;  3I0Y A;  5IG3 A;  1I0V A;  5G1L A;  3FKA A;  1T2I A;  2INX A;  3DXO A;  1Q86 4;  3ECF A;  1DMQ A;  4XB5 A;  4CJN A;  3KSP A;  1MWU A;  2C10 A;  1UGH I;  1PU4 A;  1JV2 B;  4U13 A;  3CCV 3;  3WOF B;  3T0U A;  2Z6B A;  2Q07 A;  4Q53 A;  3UNL A;  4BL3 A;  2Z77 A;  5JBS A;  1BNG A;  2F99 A;  3JUO A;  3N9H A;  2D42 A;  2RBI A;  3G0K A;  2CWU A;  3NBR A;  2OTL 3;  2UGI A;  1VQK 3;  5AYR B;  1WTH A;  4PEJ A;  3GRD A;  3LYG A;  3LXU X;  1EQK A;  1TUH A;  1BSC A;  3CU3 A;  1FGR A;  5M19 A;  1I3F A;  3BNB A;  3MG2 A;  2HMM B;  1GMQ A;  4KFE A;  1I8V A;  4FCZ A;  3CCL 3;  3F7X A;  5FGO A;  1BUJ A;  1EG9 B;  1RGA A;  1JKG B;  1X1U A;  5JPP A;  3CME 3;  1W2B 2;  1G02 A;  3V99 A;  2F5M A;  5IW9 A;  2B1X B;  3H3H A;  3IJE B;  3X41 A;  3VSY A;  1UDI I;  1RRL A;  3EX9 A;  3CD6 3;  1T5Y A;  2BMQ B;  2J8X B;  1VQM 3;  1IVV A;  1RMS A;  2H0G A;  2CG0 A;  3DGO A;  3PYJ A;  2Z76 A;  4XBX A;  3HZP A;  1O7H B;  3CCS 3;  1OPY A;  3NBB A;  1NB3 I;  1LNI A;  1VQL 3;  1IVX A;  3N54 B;  4GSP A;  1SQW A;  2K3D A;  5I97 A;  3U97 A;  3K5T A;  1RCK A;  3S27 A;  2XR8 B;  1IK3 A;  4IPB A;  1JB2 A;  2F4Y A;  1WNH A;  2BO9 B;  1KQS 2;  2CFK A;  1GD4 A;  1CQS A;  2WO0 A;  3HIG A;  4MMZ B;  1FZU A;  2OQE A;  5IEN A;  2F56 A;  3MWZ A;  1U5O A;  3ROB A;  5CF2 A;  1V57 A;  3PS8 A;  3AHS A;  5EVH A;  1QAK A;  2RFR A;  3FG3 A;  2BMR B;  1I2G A;  1N8Q A;  1OUN A;  3S29 A;  2WOH A;  1I3I A;  1X1X A;  6GSP A;  3H51 A;  1F8N A;  2HMN B;  3HI7 A;  1N5H A;  3OWY A;  1BNR A;  2CIU A;  3EB8 A;  3BU4 A;  2K0M A;  4H3U A;  5CXO A;  1ZO2 A;  1VQQ A;  3B8L A;  1N9J A;  3D5I A;  3E99 A;  4MMY B;  4R9K A;  2CWT A;  3JUP A;  2YFI B;  3EN8 A;  1Q40 B;  1BAO A;  3NV0 B;  3FLJ A;  1N8R 4;  3MG3 A;  1NU3 A;  4XDW A;  3VF1 A;  1EEJ A;  2YX9 A;  5ELU A;  3BND A;  3NBJ A;  3IMA B;  4WFO A;  3DGM A;  1A2K A;  3B7C A;  3NXJ A;  4HM3 B;  2XGL A;  5RNT A;  3B4O A;  3G71 3;  1BIR A;  1LOW A;  1RN1 A;  2E2V A;  2W56 B;  3WOE B;  1W02 A;  2CX1 A;  3G16 A;  3O8Y A;  5AII A;  3NHX A;  3Q3F A;  4AEQ A;  3CNM A;  3LML A;  1HZ1 A;  2QGU A;  1BUQ A;  2HMK B;  2L1S A;  2LQV A;  4WWU C;  1LVN A;  3DGN A;  4FMB A;  1OF5 A;  2PZV A;  4O8S A;  3NUV A;  2BNG A;  1BRH A;  3S28 A;  1NJI 4;  2CFG A;  1SJW A;  4HM0 B;  4LGQ A;  2ZA4 A;  2KF6 A;  3CC7 3;  4BTY A;  1MGR A;  3BLZ A;  2QIY A;  1C54 A;  3UL5 A;  1B2S A;  3EN1 B;  5IG0 A;  2UUG C;  3PXM A;  1VQN 3;  5STD A;  3DGY A;  7STD A;  4WHA A;  2XFS A;  2OOV C;  1Q7Y 4;  1RHL A;  1U8C B; 
#chains in the Genus database with same CATH homology
 4XBT A;  1C7H A;  4QWT A;  2XRX B;  2YFJ B;  3LZA A;  1JN5 A;  3T8N A;  4FCJ A;  4N6M A;  4HM5 B;  1O7G B;  2CFD A;  3AMO A;  4CDL A;  3CC2 3;  2W0Q A;  4J9A A;  2IMJ A;  3K0Z A;  3WA2 X;  4AKZ A;  5CK6 A;  3JUM A;  3CCU 3;  3MSO A;  2P0X A;  1NO3 A;  3A76 A;  1GY6 A;  3LT8 A;  3OXA A;  5AI1 A;  1QAF A;  1E97 A;  1UI8 A;  4GB5 A;  4MJD A;  2O9U X;  5FW5 A;  4LMI A;  2ZL8 A;  1STF I;  2OCT A;  1OHO A;  3QRD A;  4R4K A;  8CHO A;  4EYC A;  1RKY A;  3BB9 A;  3T8U A;  3WA3 A;  1W00 A;  5BVB A;  3CPW 2;  1W6C A;  3CC4 3;  1IVW A;  4FR9 A;  1OCV A;  1PFP A;  4HM8 B;  1DMM A;  2CH9 A;  3QK9 A;  3V98 A;  2CHC A;  2XFT A;  4RNY A;  3V92 A;  4N6U A;  3HII A;  4BTW A;  5G2G A;  3FCS B;  2XSH B;  5IEO A;  5D81 A;  3CXC 2;  1FUW A;  3UB1 A;  3K9M C;  1L5G B;  1E3V A;  1FGT A;  1AVL A;  3I55 3;  4K90 B;  2QA4 3;  1YIJ 3;  2KXG A;  5IF6 A;  1W01 A;  1M90 4;  2P0M A;  4G1M B;  4NHF A;  4MEI A;  2CG1 A;  4LZI A;  2ML6 A;  3GZX B;  1STD A;  4RBN A;  1AVK A;  3F14 A;  2WGO A;  3NQZ A;  3TDG A;  1K41 A;  2FGT A;  4GL6 A;  2MF7 A;  2D1W A;  4HVN A;  2XGN A;  1K73 4;  1IDP A;  4O2H A;  3B4P A;  1GD3 A;  3LTA A;  4X2O A;  2CWV A;  4JF8 A;  2ML5 A;  1YHQ 3;  1V74 A;  3ALA A;  2BHM A;  3DM8 A;  3N8B A;  3FF2 A;  1RN7 A;  5EEO A;  3CCQ 3;  5D82 A;  4HM1 B;  2BMO B;  2CC3 A;  3CCS 3;  1A90 A;  1Q42 A;  3CCR 3;  2XF3 A;  4HKV B;  1QVG 2;  3SOA A;  3F9S A;  1O7W B;  3UL6 A;  1R4C A;  4HYZ A;  1ROA A;  2JDI H;  3GZR A;  3FH1 A;  2M7O A;  3CMA 3;  2IA7 A;  3PCR A;  1M9G A;  1OF5 B;  4N6L A;  4HM7 B;  2F98 A;  2RGQ A;  3D9R A;  1DVC A;  1JRQ A;  1JNQ A;  2KCD A;  3DMC A;  2KRT A;  2OTJ 3;  3J7Y d;  3LTC A;  2FNQ A;  1EA2 A;  3DZL A;  3M8C A;  3NM2 A;  1IQ8 A;  2CFW A;  4K1U A;  6STD A;  3F8X A;  1GY5 A;  1JN5 B;  1UUV B;  2OOV A;  3RDE A;  3LOY A;  1IVU A;  1JKG A;  2V1L A;  3RGA A;  2E2T A;  3AMO B;  5LC6 A;  4EXR A;  1N9E A;  1WMP A;  1GYB A;  1QVF 2;  2XEP A;  1RJO A;  1J2B A;  1VQ4 3;  1NB5 I;  1YJ9 3;  3SED A;  2GU1 A;  1W5Z A;  4XDV A;  5AYS C;  2HML B;  3KE7 A;  3PGB A;  3JUQ A;  4HM4 B;  1KWI A;  3CCM 3;  2GEY A;  3KZT A;  2P38 A;  4N6O B;  1US1 A;  1TFO A;  4LEH A;  3MG1 A;  3OW2 2;  1KD1 4;  3EC9 A;  3KSE D;  2W04 A;  3LTD A;  4EBG A;  3FZW A;  3WMD A;  4WYK A;  1KSI A;  2XH9 A;  1MNL A;  4OK0 A;  5KP4 A;  2K54 A;  3JUN A;  1JB5 A;  4L8O A;  5LC7 A;  5HGR A;  1A67 A;  1AR0 A;  1TU5 A;  2CK3 H;  1NWW A;  3SOY A;  3CNX A;  3UJM A;  2W03 A;  3GZB A;  3CCJ 3;  1YJN 3;  3SX1 A;  4X2H A;  5JPU A;  3D3L A;  4HM2 B;  5IER A;  3NV0 A;  1AV4 A;  4LSO A;  4EC6 A;  1D6Z A;  1WMO A;  2GBX B;  2I9W A;  2R4I A;  4KZ1 A;  3EBT A;  1CEW I;  5A0O B;  1VQ7 3;  1TFK A;  2W56 A;  2GBW B;  2SBL A;  3DGL A;  4H61 A;  3SXX A;  3X42 A;  3OV4 A;  1IV9 A;  2W2C A;  1FGQ A;  3EQQ B;  1OGZ A;  2WOF A;  4HBR A;  2CFL A;  1SPU A;  2CKF B;  1LNH A;  4L8P A;  1QAL A;  1KC8 4;  4WP5 A;  3NM7 A;  1GY7 A;  1EKM A;  2P05 A;  4HZB B;  5IG4 A;  1D6U A;  1G96 A;  3K63 A;  3OWS A;  5ELJ A;  3NX0 A;  4I4K A;  3EF8 A;  3ER7 A;  4JRF A;  1W2Z A;  2A15 A;  3X3Z A;  3EHC A;  2F86 B;  1VQP 3;  4KFD A;  1W6G A;  5TGN A;  1OH0 A;  3GZY B;  3NQY A;  3SVA A;  1YIT 3;  1S72 3;  4KFF A;  3BNE A;  4N6N B;  1K28 A;  1FGO A;  1K8A 4;  1GS3 A;  1W4N A;  3S67 A;  1WMN A;  2Y74 A;  1YVB I;  5CLK A;  3KII A;  1E3R A;  3OWU A;  1UW1 A;  4RZM A;  3X3Y A;  4R1K A;  4FCM A;  1SII A;  3CCE 3;  1TP6 A;  3KFQ C;  1ULI B;  3GAX A;  3FF0 A;  4XM4 A;  1IT8 A;  4FMA A;  4FMC A;  4KVH A;  4TX4 A;  4BTX A;  3G6E 3;  5AIH A;  4R9L A;  4IT7 A;  4HM6 B;  1IQY A;  2B24 B;  5KP3 A;  3VGN A;  3S5C A;  3WDG B;  2P09 A;  3FSD A;  5KP1 A;  2UX0 A;  4MMX B;  3FG1 A;  2QEX 3;  1W6Y A;  1YJW 3;  3DUK A;  4FMD A;  1ASK A;  4O3V A;  1M1K 4;  1QMA A;  3I56 3;  5BXQ A;  3LH4 A;  2IUK A;  4OVM A;  3EE1 A;  1ISK A;  3EJV A;  3MKI A;  1VZZ A;  3FGY A;  2Z7A A;  1O7M B;  3FG4 A;  3SLU A;  1FA3 A;  2FXT A;  1HU9 A;  3EBY A;  3Q1C A;  4WYK B;  4N3V A;  5IG5 A;  4RNZ A;  4AKY A;  2IUJ A;  2GXF A;  1OHP A;  2MC8 A;  3LT9 A;  1JB4 A;  2WGQ A;  3STD A;  1NDO B;  1VQ9 3;  5AEW B;  2W9P A;  4O02 B;  3GWR A;  1IT7 A;  1IU7 A;  2HMJ B;  3F8H A;  3CPO A;  1DMN A;  1UUW B;  1OHS A;  1OGX A;  2C11 A;  3F40 A;  4NRE A;  5CF1 A;  1Q81 4;  1DVD A;  1OAC A;  1DYU A;  1Z1S A;  1ROV A;  3L0R A;  1N5P A;  3KKG A;  2E2U A;  3MHE A;  2W9Q A;  4K1V A;  1IV7 A;  2HMO B;  5EQL A;  2Y73 A;  3OX9 A;  4HJL B;  4OUQ A;  4R80 A;  3IPT A;  3G4S 3;  2OQE C;  1CYU A;  1MOL A;  2PNC A;  1TIJ A;  5AIF A;  1JJ2 2;  4N6T A;  3X40 A;  3PZW A;  5DRE A;  4HZ9 B;  1M1X B;  1Q82 4;  1W7C A;  3K7C A;  1YI2 3;  4J8T A;  4EV2 A;  2GEX A;  3G8Z A;  5AIG A;  3DY5 A;  3MYT A;  4EV5 A;  3JVC A;  2XSO B;  1WQL B;  2OWP A;  4IIA A;  4N6V 0;  1SIH A;  3BNC A;  1K9M 4;  5AEU B;  1RRH A;  3HX8 A;  2LYX A;  1VQO 3;  1VQ5 3;  3HK4 A;  1Q40 A;  2RSX A;  3RGR A;  1A2V A;  1YGE A;  4CCV A;  5DRV A;  1IQX A;  2RCD A;  1UI7 A;  1Y4K A;  3Q2P A;  2ZDJ A;  3F7S A;  1QJG A;  3Q90 A;  3MPH A;  4ZM8 A;  3X3X A;  1LOX A;  1S5A A;  5D83 A;  3KN4 A;  1LXE A;  4STD A;  1VQ6 3;  4XBY A;  4ORL A;  3U1W A;  1FGM A;  1ZX2 A;  1ULJ B;  3WOD G;  2JQ5 A;  2YFL B;  2O3O A;  4L7K A;  1O7N B;  3PCS A;  1VQ8 3;  5IEP A;  2BT3 A;  2W6J H;  2L4V A;  3LTB A;  1CYV A;  2CW9 A;  1HKX A;  2STD A;  1O7P B;  1D6Y A;  2GU3 A;  4K61 A;  3I0Y A;  5IG3 A;  3FKA A;  2INX A;  3DXO A;  1Q86 4;  3ECF A;  1DMQ A;  4XB5 A;  3KSP A;  3CCV 3;  2C10 A;  1PU4 A;  1JV2 B;  4U13 A;  3WOF B;  3T0U A;  2Z6B A;  2Q07 A;  4Q53 A;  3UNL A;  2Z77 A;  5JBS A;  2F99 A;  3JUO A;  3N9H A;  2D42 A;  3G0K A;  3NBR A;  2CWU A;  2OTL 3;  1VQK 3;  5AYR B;  1WTH A;  4PEJ A;  3GRD A;  3LYG A;  3LXU X;  1EQK A;  1TUH A;  3CU3 A;  1FGR A;  3BNB A;  3MG2 A;  2HMM B;  4KFE A;  4FCZ A;  3CCL 3;  3F7X A;  5FGO A;  1EG9 B;  5JPP A;  1JKG B;  3CME 3;  1W2B 2;  3V99 A;  5IW9 A;  2B1X B;  3H3H A;  3IJE B;  3X41 A;  3VSY A;  3EX9 A;  1RRL A;  3CD6 3;  1T5Y A;  2BMQ B;  1VQM 3;  1IVV A;  2CG0 A;  3DGO A;  3PYJ A;  2Z76 A;  4XBX A;  3HZP A;  1O7H B;  1OPY A;  3NBB A;  1NB3 I;  1VQL 3;  1IVX A;  3N54 B;  1SQW A;  5I97 A;  3U97 A;  3K5T A;  3S27 A;  2XR8 B;  1IK3 A;  4IPB A;  1JB2 A;  1WNH A;  2BO9 B;  1KQS 2;  2CFK A;  1GD4 A;  1CQS A;  2WO0 A;  3HIG A;  4MMZ B;  2OQE A;  5IEN A;  3MWZ A;  1U5O A;  3ROB A;  5CF2 A;  3PS8 A;  5EVH A;  1QAK A;  2RFR A;  3FG3 A;  2BMR B;  1N8Q A;  1OUN A;  3S29 A;  2WOH A;  3H51 A;  1F8N A;  2HMN B;  3HI7 A;  1N5H A;  3OWY A;  2CIU A;  3EB8 A;  5CXO A;  2K0M A;  4H3U A;  1ZO2 A;  3B8L A;  1N9J A;  3E99 A;  4MMY B;  4R9K A;  2CWT A;  3JUP A;  2YFI B;  3EN8 A;  1Q40 B;  1N8R 4;  3NV0 B;  3FLJ A;  3MG3 A;  1NU3 A;  4XDW A;  3VF1 A;  2YX9 A;  5ELU A;  3BND A;  3NBJ A;  3IMA B;  4WFO A;  3DGM A;  1A2K A;  3B7C A;  3NXJ A;  4HM3 B;  2XGL A;  3B4O A;  3G71 3;  2E2V A;  2W56 B;  3WOE B;  1W02 A;  3O8Y A;  3G16 A;  5AII A;  3NHX A;  4AEQ A;  3CNM A;  3LML A;  2QGU A;  1BUQ A;  2HMK B;  2LQV A;  4WWU C;  1LVN A;  3DGN A;  4FMB A;  1OF5 A;  2PZV A;  4O8S A;  3NUV A;  2BNG A;  1NJI 4;  3S28 A;  2CFG A;  1SJW A;  4HM0 B;  4LGQ A;  3CC7 3;  4BTY A;  3BLZ A;  2QIY A;  3UL5 A;  5IG0 A;  3EN1 B;  1VQN 3;  3PXM A;  5STD A;  7STD A;  4WHA A;  2XFS A;  2OOV C;  1Q7Y 4;  1U8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...