1Z1SA

Crystal structure of putative isomerase pa3332 from pseudomonas aeruginosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
b'NLYFQGHMNAKEILVHSLRLLENGDARGWCDLFHPEGVLEFPYAPPGWKTRFEGRETIWAHMRLFPEHLTVRFTDVQFYETADPDLAIGEFHGDGVATVSGGKLAQDYISVLRTRDGQILLYRDFWNPLRHLEALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Protein PA3332
publication title Crystal Structure of the Conserved Hypothetical Protein PA3332 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
total genus 40
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1z1sA00
1Q40B 2GEXA 2BNGA 3ECFA 3K0ZA 3NXJA 1JN5B 1CQSA 5IF6A 4J8TA 4Q53A 3B4PA 1GS3A 1OHPA 4L8PA 2PZVA 2GBWB 3MG3A 1SJWA 3B7CA 3F14A 4HM1B 3GWRA 3MG2A 4OVMA 3JUQA 4PEJA 2B24B 5CF2A 5D82A 5STDA 3G8ZA 3EBTA 3KKGA 1UUWB 3F7SA 5AI1A 1QMAA 3MKIA 1JB2A 5AEWB 4HVNA 2HMMB 3CNMA 2YFIB 1ZX2A 3WMDA 2RFRA 3MHEA 3GZBA 3F40A 5DREA 5AIIA 5AEUB 2INXA 3HX8A 3JUPA 4HM2B 4XDWA 5CXOA 3STDA 1UUVB 4ORLA 3Q90A 2BMQB 2BMOB 4R9LA 3B8LA 4FCJA 4L8OA 2I9WA 1WQLB 3FKAA 1E97A 2QIYA 1OPYA 2GXFA 3DM8A 1E3VA 3RGRA 2GBXB 3I0YA 4LEHA 2XR8B 1A2KA 3NM2A 2CHCA 1BUQA 5IEPA 2HMLB 3FLJA 2Z76A 5CF1A 2CKFB 2XRXB 1IDPA 1JN5A 3OWSA 1U5OA 1DMQA 3CPOA 1OGZA 5IG0A 4RZMA 3GZYB 3DMCA 3DZLA 5CLKA 4HM8B 3GZXB 3SOAA 8CHOA 1OGXA 3F8XA 4K1VA 3B4OA 1O7MB 2B1XB 2IMJA 3LYGA 4XDVA 5AIFA 3F8HA 3IPTA 4WWUC 5BXQA 5D83A 2QGUA 1O7WB 3FF2A 4HM6B 1O7PB 3HK4A 1W01A 3EJVA 1JB4A 2BMRB 5HGRA 5DRVA 2XSOB 4KVHA 1O7HB 1OHOA 3NV0A 4HM5B 4HM7B 4XBTA 4XBYA 1C7HA 3H3HA 3NUVA 2XSHB 3DXOA 3MG1A 3EBYA 3E99A 4XB5A 2UX0A 3NV0B 3EX9A 1OCVA 3CNXA 1E3RA 1QJGA 6STDA 2RCDA 4HZ9B 3OX9A 3OV4A 1GY7A 2K54A 4WP5A 3FF0A 1S5AA 3GZRA 2F86B 4X2HA 3KSPA 1AR0A 3UJMA 5IENA 3OXAA 5IG5A 1W02A 1OUNA 5IG3A 3EC9A 1O7GB 3F7XA 3D9RA 3FSDA 2STDA 4N3VA 4XBXA 1EG9B 2HMKB 5IG4A 3ROBA 1JKGB 1STDA 5D81A 4L7KA 3KE7A 2OWPA 3OWUA 3JUOA 5AIGA 3F9SA 4HM0B 3A76A 4STDA 1O7NB 1OH0A 3UNLA 3GRDA 1GY5A 3MSOA 4R9KA 3BB9A 3FH1A 7STDA 2YFJB 4X2OA 3FZWA 3MYTA 4HKVB 3EQQB 4I4KA 5IERA 3S5CA 3KZTA 2HMJB 3NBRA 3RGAA 3FGYA 1GYBA 5JPUA 3LZAA 5G2GA 2W2CA 3T8UA 3JUNA 5FW5A 1W6YA 2HMNB 4J9AA 1TP6A 5EVHA 2HMOB 2R4IA 3NHXA 5JPPA 2GEYA 5KP4A 4K1UA 3H51A 4GB5A 3G16A 1Q42A 1K41A 1GY6A 3EN8A 4H3UA 1VZZA 3EF8A 3M8CA 1DMNA 1OHSA 5CK6A 4OUQA 3G0KA 1JKGA 3JUMA 4U13A 1ISKA 4HM3B 4HM4B 1EA2A 2RGQA 3SOYA 1TUHA 1HKXA 1OF5A 4FCMA 4IIAA 4LGQA 1ASKA 5KP3A 4XM4A 5BVBA 4WYKA 4CDLA 3CU3A 4HZBB 1Z1SA 1NDOB 1NWWA 2JQ5A 1Q40A 2F98A 2Z77A 3VGNA 1ULJB 4R1KA 3SEDA 5TGNA 3EHCA 3OWYA 3BLZA 3DUKA 3VSYA 3K7CA 2F99A 1OF5B 3EN1B 2A15A 4HJLB 1W00A 3HZPA 3T8NA 5KP1A 1DMMA 1ZO2A 2YFLB 2Z7AA 5AIHA 4WYKB 3ER7A 1ULIB 4LMIA 1JB5A 4MJDA 5IEOA 1NU3A
chains in the Genus database with same CATH superfamily
1Q40B 4OK0A 1FZUA 2BNGA 2GEXA 3CC23 4CJNA 1T2HA 2KCDA 3D5GA 3ECFA 1WMOA 3K0ZA 3NXJA 5RNTA 1JN5B 4EC6A 1SPUA 1CQSA 4FMBA 4GSPA 5IF6A 4J8TA 1BRSA 3B4PA 1GS3A 2WO0A 4Q53A 2XH9A 1SIHA 1OHPA 4L8PA 3NM7A 3K63A 3AMOA 1RCKA 2Q07A 1DE3A 2R41A 1BAOA 3CPW2 2PZVA 1FA3A 3V98A 2J8XB 2GBWB 3MG3A 2IY2A 1SJWA 1PYLA 3B7CA 4JF8A 2W9QA 3F14A 4HM1B 5LC6A 3GWRA 2CC3A 3MG2A 4OVMA 3JUQA 1RKYA 1YHQ3 2P09A 1RMSA 4J5GA 1AVKA 1A90A 4TX4A 3BU4A 1TTOA 1T3BA 2W56B 4PEJA 2B24B 5CF2A 1JZOA 1YJW3 5D82A 5STDA 3G8ZA 3EBTA 2D42A 1GOVA 1LOYA 1J2BA 3KKGA 3CMA3 1UUWB 3F7SA 2W03A 1UGHI 5ELUA 5AI1A 4DKIA 1QMAA 1BNFA 1HYFA 3MKIA 1JB2A 3HOHA 3X40A 4BU4A 1I8VA 1IYYA 5AEWB 4HVNA 1RDSA 1M904 2OQEA 2BU4A 2HMMB 3CNMA 2MC8A 1IVXA 2YFIB 2XF3A 3AMOB 1ZX2A 1RNTA 2RFRA 4IT7A 2RNTA 3WMDA 4KFEA 2CG0A 1KSIA 2P0XA 3MHEA 2ML5A 3GZBA 3Q2PA 3F40A 3IJEB 1N8R4 4ILFA 5AIIA 2SARA 2INXA 3D5IA 5DREA 1G0TA 3HX8A 5AEUB 3JUPA 1RN4A 1A2VA 4HM2B 4LZIA 3J7Yd 4AKZA 5M1AA 1X1XA 1MWUA 4XDWA 5CXOA 3MPHA 4NREA 1IK3A 1GD4A 3LT8A 3STDA 1UUVB 1A2PA 1BIRA 2ZDJA 2IYJA 2KF4A 4ORLA 3WOEB 3CCM3 1EKMA 2C11A 3Q90A 1N9EA 2OOVA 1JBSA 1RN1A 2M7OA 1TFOA 2BMQB 2BMOB 2F56A 1N9JA 3U1WA 4HAAA 4R9LA 3TDGA 4QWTA 3B8LA 4FCJA 3S28A 5I97A 1FUSA 1BRGA 2C10A 2I9WA 1WQLB 2KF5A 4L8OA 3DGNA 3FKAA 1E97A 3CCU3 1ZGXA 1SIIA 2QIYA 4N6TA 1CEWI 1IV9A 1LOXA 4RNYA 1OPYA 1YGWA 4K90B 4CCVA 1X1WA 2FGTA 4RBNA 1JBRA 1I70A 2GXFA 5FGOA 3DM8A 4GL6A 4EYCA 2H0HA 1E3VA 4N6V0 4KT3B 1VQ43 3RGRA 2GBXB 4NPBA 4BTXA 3I0YA 4LEHA 3DGOA 2XR8B 1BRKA 1I2EA 1YI23 4H61A 1A2KA 2QEX3 3PZWA 1W5ZA 3NM2A 1UW1A 7GSPA 4J5KA 3CD63 2CHCA 1BUQA 5IEPA 2HMLB 1LQGC 2Z76A 3FLJA 5CF1A 3VF1A 1RTUA 1YJ93 2W6JH 1N8QA 1Y4KA 1B2XA 2CKFB 2XRXB 1IDPA 3CCE3 1JN5A 3FG1A 3OWSA 1D6YA 1U5OA 1DMQA 3CPOA 4KFDA 5HOHA 2AAEA 1MGWA 1T2IA 1OGZA 2CX0A 4BL3A 4O02B 1BNJA 1YIT3 1BRHA 5IG0A 4O3VA 3QRDA 4N6UA 2P0MA 2CH9A 3GZYB 4RZMA 1M1K4 1CYUA 4KFFA 1YVBI 3KFQC 4CPKA 1IV7A 3DMCA 3DZLA 5CLKA 4HM8B 1C54A 2CW9A 3GZXB 1D6ZA 1IVUA 3SOAA 8CHOA 1VQO3 2OTL3 1I3IA 1OGXA 3F8XA 1RGCA 2H0GA 1NB3I 2W56A 1BSAA 3Q3FA 4FMCA 2OOVC 4K1VA 8RNTA 3X41A 3LTBA 3G6E3 3T0UA 1BNSA 1G96A 3B4OA 5M18A 1O7MB 2B1XB 2IMJA 2Y74A 3LYGA 4WFOA 7RNTA 4XDVA 4WHAA 5AIFA 3F8HA 3Q1CA 1MNLA 3IPTA 3FG4A 3X42A 3X3ZA 3N9HA 2D1WA 4WWUC 5BXQA 5D83A 5ELJA 3BNBA 3WHOA 4AEQA 2QGUA 4BTYA 1K8A4 2KXGA 3CC73 1VQL3 1UCIA 1UCKA 1BSCA 1YVSA 2Z6BA 4EV2A 3V99A 1O7WB 3CCQ3 1Q7Y4 3FF2A 4HM6B 4MMXB 1O7PB 3HK4A 1W01A 2XFTA 2Y73A 3EJVA 2K0MA 1JV2B 3LT9A 1PU4A 1V74A 1JB4A 1LOVA 2FNQA 2BMRB 1VQQA 3KSED 1BRJA 5HGRA 1I2FA 4FCZA 1V58A 3IMAB 1STFI 4R80A 5DRVA 1FUTA 1YGEA 2JDIH 3CCJ3 5EEOA 1Q864 2XSOB 3N54B 4KVHA 1MGRA 1UI8A 1O7HB 1OHOA 2IUKA 3WODG 1QAKA 1VQN3 2K3DA 4NHFA 3NV0A 1DVDA 1ROVA 4EW5A 4HM5B 1RRLA 4HM7B 1Q9EA 4XBTA 1JRQA 1VQ93 3EB8A 1IQ8A 4XBYA 1QVG2 1FGQA 1C7HA 1BVIA 2ZHXB 1LXEA 5AYRB 3X3YA 3H3HA 3NUVA 5BU4A 1KD14 2XSHB 3DXOA 1OACA 3MG1A 2QA43 2XGLA 3HI7A 1BNEA 3EBYA 4O8SA 1BSBA 3E99A 5AYSC 4FMDA 4XB5A 3X3XA 5A0OB 3CCS3 2UX0A 3JVCA 3PCRA 1LNIA 1VQK3 1K9M4 1TFKA 4RNTA 3NBJA 1QVF2 1L5GB 2BO9B 3NV0B 1X1YA 3SVAA 1BOXA 3EX9A 2XEPA 1B21A 1OCVA 2CFDA 2F5WA 4AKYA 1E3RA 1W6GA 1QJGA 3CNXA 6RNTA 6STDA 3G713 1BNGA 2CIUA 2RCDA 3PYJA 1VQ73 4HZ9B 3OX9A 4R4KA 3UL5A 1N5HA 1GY7A 2K54A 3OV4A 4WP5A 3FF0A 1KC84 1KQS2 1S5AA 1GOYA 2SBLA 1RGFA 3GZRA 1NJI4 2F86B 2V1LA 1B2SA 1IVVA 4X2HA 2WGOA 3KSPA 1AR0A 1TU5A 1K734 3LH4A 1VQP3 3UJMA 5IENA 3FG3A 2CFLA 3OXAA 5IG5A 1BNRA 1DYUA 1RGLA 1CYVA 1W02A 1OUNA 3BNDA 1CH0A 1GOUA 4MEIA 5IG3A 3EC9A 3CXC2 3CCV3 1O7GB 2CK3H 1B20A 3F7XA 3KIIA 2OCTA 2WOFA 1YNVX 5EQLA 1FUWA 3D9RA 2W9PA 1RN7A 3FSDA 2MF7A 1JBTA 4LYLB 4O2HA 2STDA 1NB5I 1B2UA 1GD3A 1IQYA 1Q7HA 1W6CA 2KF6A 3L0RA 4N3VA 1JJ22 2KRTA 3G4S3 1AVLA 1R4YA 2E2VA 1FGOA 4XBXA 1EG9B 2HMKB 2GSPA 5IG4A 1UCLA 3ZG5A 2WGQA 3ROBA 9RNTA 1TRPA 1JKGB 1STDA 1VQ53 5D81A 4L7KA 3KE7A 1LOWA 4EV5A 2OWPA 3OWUA 3JUOA 1RGHA 4HOHA 5AIGA 2RSXA 4MMYB 1UUGB 3F9SA 3NX0A 4HM0B 3A76A 3KCHA 4STDA 4ZM8A 4IPBA 1BRNL 1WNHA 3A5EA 1RJOA 1O7NB 1OH0A 3UNLA 1EUIC 3GRDA 2CFGA 4I5QA 1FGMA 1GY5A 3MSOA 2CWUA 4R9KA 3BB9A 3FH1A 1I0VA 2FXTA 7STDA 2XFSA 2YFJB 3FZWA 4X2OA 5G1KA 1BANA 1V57A 3MYTA 4HKVB 4RNZA 4BL2A 4HBRA 3ALAA 3EQQB 4I4KA 2KF3A 5IERA 1W2B2 3S5CA 1N5PA 1JZDA 3KZTA 2HMJB 3NBRA 3RGAA 1WMNA 3BNEA 3HIGA 4N6NB 1IVWA 4N6LA 1RSNA 3CME3 1RGKA 2CFKA 1W7CA 3DGLA 3N8BA 1MOLA 3LTDA 3FGYA 1GYBA 2H0IA 3PXMA 5JPUA 3LZAA 5G2GA 1I0XA 2O9UX 1F8NA 2W2CA 2KAAA 3I553 2RBIA 2WOHA 1AQZA 4BTWA 1ZS7A 3T8UA 3JUNA 4JRFA 1UDII 1RHLA 1PFPA 1W2ZA 1PY3A 1W6YA 5FW5A 1BRIA 1W4NA 1UCJA 2HMNB 1RGEA 1IQXA 4FMAA 2UUGC 1FGTA 4J9AA 2ZL8A 3DGMA 2O3OA 1QAFA 3WOFB 1ROAA 4G1MB 1FYSA 2CFWA 1G02A 1KWIA 2BIRA 3QK9A 3ZFZA 1LVNA 1TP6A 5EVHA 3UB1A 1RGAA 2IUJA 1VQ83 3LMLA 2HMOB 2L4VA 2R4IA 3SYUA 1B2MA 3NHXA 1AY7A 1RNBA 5JPPA 3WA3A 3S29A 2GU3A 2GEYA 2HOHA 5KP4A 2LQVA 4K1UA 3H51A 3DGYA 2OTJ3 2CWTA 4GB5A 3BIRA 1BSDA 4N6OB 3ZG0A 1TRQA 1GMRA 4EBGA 1HU9A 1BU4A 4K61A 2C4BA 3URPA 1IT8A 5JBSA 3I563 3SX1A 1VQM3 1Q814 2CX1A 2IA7A 3G16A 1Q42A 4HYZA 3RDEA 1JNQA 1K41A 1GY6A 2BT3A 2L1SA 2CG1A 3EN8A 3WR2A 4H3UA 3D79A 1GMPA 6GSPA 1BNIA 3UL6A 3AGOA 3AHSA 3D4AA 3D3LA 4BIRA 1B3SA 1EEJA 4GHOA 3CCL3 1VZZA 3EF8A 3M8CA 1DMNA 1OHSA 4FR9A 5CK6A 5GSPA 2UGIA 2E2TA 1RCLA 2W0QA 4OUQA 3PGBA 1LRAA 3PS8A 1YJN3 3G0KA 3GSPA 1JKGA 1MWRA 3JUMA 4N6MA 3OW22 4U13A 2YX9A 4HM3B 1MWSA 4EXRA 1ISKA 1X1UA 4HM4B 5IW9A 1BUJA 2ML6A 3RNTA 1FGRA 1WMPA 1GSPA 1RLSA 3GAXA 1EA2A 1Q824 2RGQA 5G1LA 1TUHA 3LOYA 3SOYA 1HKXA 1SQWA 1OF5A 4FCMA 1SARA 3LTCA 3V92A 4IIAA 4LGQA 3AHWA 1TJDA 1M9GA 3KN4A 1T5YA 3S27A 3FCSB 2W04A 3LTAA 1ASKA 1B27A 3DH2A 5KP3A 5M19A 1UI7A 4XM4A 4MMZB 5BVBA 5BIRA 1AV4A 1LQMB 4LSOA 1U8CB 4WYKA 3MWZA 4CDLA 2GU1A 3CU3A 1TIJA 1D6UA 3EE1A 3SLUA 2CWVA 3AGNA 1B2ZA 4HZBB 1I3FA 1K28A 1Z1SA 3SXXA 1RGGA 1MWTA 1NDOB 2F4YA 1VQ63 2ZA4A 3K9MC 1BSEA 1NWWA 3K5TA 2JQ5A 1R4CA 1GMQA 3DY5A 3NQYA 1HZ1A 1Q40A 2F98A 2Z77A 4KZ1A 3VGNA 1UGIA 1US1A 3U97A 1ULJB 2OQEC 4R1KA 5TGNA 2E2UA 3SEDA 1QALA 3EHCA 3OWYA 3CCR3 3WDGB 2PNCA 3BLZA 5LC7A 2AADA 3DUKA 3VSYA 3K7CA 2F99A 1BGSA 1OF5B 3EN1B 3NBBA 1I2GA 1DETA 3O8YA 2P38A 2A15A 2LYXA 4HJLB 1W00A 1WTHA 3NQZA 1EQKA 3HZPA 2F5MA 3T8NA 5KP1A 1DMMA 3WA2X 1ZO2A 3LXUX 2BHMA 2YFLB 2Z7AA 1S723 5AIHA 4WYKB 1NNVA 3ER7A 1ULIB 1IT7A 4LMIA 1JB5A 1A67A 3PCSA 2P05A 1NO3A 3S67A 3CC43 1YIJ3 1IU7A 4MJDA 1M1XB 5IEOA 1NU3A 1LNHA 1RRHA 1FW7A 3BNCA 2XGNA 3HIIA 1DVCA
chains in the Genus database with same CATH topology
1Q40B 4OK0A 2GEXA 2BNGA 3CC23 2KCDA 3ECFA 1WMOA 3K0ZA 3NXJA 1JN5B 4EC6A 1SPUA 1CQSA 4FMBA 5IF6A 4J8TA 4Q53A 3B4PA 1GS3A 2WO0A 2XH9A 1SIHA 1OHPA 4L8PA 3NM7A 3K63A 3AMOA 2Q07A 3CPW2 2PZVA 1FA3A 3V98A 2GBWB 3MG3A 1SJWA 3B7CA 4JF8A 2W9QA 3F14A 4HM1B 5LC6A 3GWRA 2CC3A 3MG2A 4OVMA 3JUQA 1RKYA 1YHQ3 2P09A 1A90A 1AVKA 4TX4A 2W56B 4PEJA 2B24B 5CF2A 1YJW3 5D82A 5STDA 3G8ZA 3EBTA 2D42A 1J2BA 3KKGA 3CMA3 1UUWB 3F7SA 2W03A 5ELUA 5AI1A 1QMAA 3MKIA 1JB2A 3X40A 5AEWB 4HVNA 1M904 2OQEA 2HMMB 3CNMA 2MC8A 1IVXA 2YFIB 2XF3A 3AMOB 1ZX2A 3WMDA 2RFRA 4IT7A 4KFEA 2CG0A 1KSIA 2P0XA 3MHEA 2ML5A 3GZBA 3Q2PA 3F40A 3IJEB 1N8R4 5DREA 5AIIA 5AEUB 2INXA 3HX8A 3JUPA 1A2VA 4HM2B 4LZIA 3J7Yd 4AKZA 4XDWA 5CXOA 3MPHA 4NREA 1IK3A 1GD4A 3LT8A 3STDA 1UUVB 2ZDJA 3WOEB 4ORLA 3CCM3 1EKMA 2C11A 3Q90A 1N9EA 2OOVA 2M7OA 1TFOA 2BMQB 2BMOB 3U1WA 1N9JA 4R9LA 3TDGA 4QWTA 3B8LA 4FCJA 3S28A 5I97A 4L8OA 2C10A 2I9WA 1WQLB 3DGNA 3FKAA 1E97A 3CCU3 1SIIA 2QIYA 4N6TA 4RNYA 1CEWI 1IV9A 1LOXA 1OPYA 4K90B 4CCVA 2FGTA 4RBNA 2GXFA 5FGOA 4EYCA 3DM8A 4GL6A 4N6V0 1E3VA 1VQ43 3RGRA 2GBXB 4BTXA 3I0YA 4LEHA 3DGOA 2XR8B 1YI23 4H61A 1A2KA 2QEX3 3PZWA 1W5ZA 3NM2A 1UW1A 3CD63 2CHCA 1BUQA 5IEPA 2HMLB 3FLJA 2Z76A 5CF1A 3VF1A 1YJ93 2W6JH 1N8QA 2CKFB 1Y4KA 2XRXB 1IDPA 3CCE3 1JN5A 3FG1A 3OWSA 1D6YA 1U5OA 1DMQA 3CPOA 4KFDA 1OGZA 4O02B 1YIT3 5IG0A 4O3VA 3QRDA 4N6UA 2P0MA 2CH9A 3GZYB 4RZMA 1M1K4 1CYUA 4KFFA 1YVBI 3KFQC 1IV7A 3DMCA 3DZLA 5CLKA 4HM8B 2CW9A 3GZXB 1D6ZA 1IVUA 3SOAA 8CHOA 1VQO3 2OTL3 1OGXA 3F8XA 4FMCA 2W56A 1NB3I 4K1VA 3G6E3 2OOVC 3X41A 3LTBA 3T0UA 1G96A 3B4OA 1O7MB 2B1XB 2IMJA 2Y74A 3LYGA 4WFOA 4XDVA 4WHAA 5AIFA 3F8HA 3Q1CA 1MNLA 3IPTA 3FG4A 3X42A 3X3ZA 3N9HA 2D1WA 4WWUC 5BXQA 5D83A 5ELJA 3BNBA 4AEQA 4BTYA 2QGUA 1K8A4 2KXGA 1VQL3 2Z6BA 4EV2A 3V99A 1O7WB 3CCQ3 1Q7Y4 3FF2A 4HM6B 4MMXB 1O7PB 3HK4A 1W01A 2XFTA 2Y73A 3EJVA 2K0MA 1JV2B 3LT9A 1PU4A 1V74A 1JB4A 2FNQA 2BMRB 3KSED 5HGRA 5DRVA 4FCZA 3IMAB 1STFI 4R80A 1YGEA 2JDIH 3CCJ3 5EEOA 1Q864 2XSOB 3N54B 4KVHA 1UI8A 2IUKA 1O7HB 1OHOA 3WODG 1VQN3 1QAKA 4NHFA 3NV0A 1DVDA 1ROVA 4HM5B 1RRLA 4HM7B 4XBTA 1JRQA 1VQ93 3EB8A 1IQ8A 4XBYA 1QVG2 1FGQA 1C7HA 1LXEA 5AYRB 3X3YA 3H3HA 3NUVA 1KD14 2XSHB 3DXOA 1OACA 3MG1A 2QA43 2XGLA 3HI7A 3EBYA 4O8SA 3E99A 5AYSC 4FMDA 4XB5A 3X3XA 5A0OB 3CCS3 2UX0A 3JVCA 3PCRA 1VQK3 1K9M4 1TFKA 3NBJA 1QVF2 1L5GB 2BO9B 3NV0B 3SVAA 3EX9A 2XEPA 1OCVA 2CFDA 3CC73 4AKYA 1E3RA 1W6GA 1QJGA 3CNXA 6STDA 3G713 2CIUA 2RCDA 3PYJA 1VQ73 4HZ9B 3OX9A 4R4KA 3UL5A 1N5HA 1GY7A 2K54A 3OV4A 4WP5A 3FF0A 1KC84 1KQS2 1S5AA 2SBLA 3GZRA 1NJI4 2F86B 2V1LA 1IVVA 4X2HA 2WGOA 3KSPA 1AR0A 1TU5A 1K734 3LH4A 1VQP3 3UJMA 5IENA 3FG3A 2CFLA 3OXAA 5IG5A 1DYUA 1CYVA 1W02A 1OUNA 3BNDA 4MEIA 5IG3A 3CXC2 3EC9A 3CCV3 1O7GB 2CK3H 3F7XA 3KIIA 2OCTA 2WOFA 5EQLA 1FUWA 3D9RA 2W9PA 1RN7A 3FSDA 2MF7A 4O2HA 2STDA 1NB5I 1GD3A 1IQYA 1W6CA 4N3VA 3L0RA 1JJ22 2KRTA 3G4S3 1AVLA 2E2VA 1FGOA 4XBXA 1EG9B 2HMKB 5IG4A 2WGQA 3ROBA 1JKGB 1STDA 1VQ53 5D81A 4L7KA 3KE7A 4EV5A 2OWPA 3OWUA 3JUOA 5AIGA 2RSXA 4MMYB 3F9SA 3NX0A 4HM0B 3A76A 4STDA 4ZM8A 4IPBA 1WNHA 1RJOA 1O7NB 1OH0A 3UNLA 3GRDA 2CFGA 1FGMA 1GY5A 3MSOA 2CWUA 4R9KA 3BB9A 3FH1A 2FXTA 7STDA 2YFJB 2XFSA 3FZWA 4X2OA 3MYTA 4HKVB 4RNZA 4HBRA 3ALAA 3EQQB 4I4KA 5IERA 1W2B2 3S5CA 1N5PA 3KZTA 2HMJB 3NBRA 3RGAA 1WMNA 3BNEA 3HIGA 4N6NB 1IVWA 4N6LA 3CME3 2CFKA 1W7CA 3DGLA 3N8BA 1MOLA 3LTDA 3FGYA 1GYBA 5JPUA 3PXMA 3LZAA 5G2GA 2O9UX 1F8NA 2W2CA 3I553 2WOHA 4BTWA 3T8UA 3JUNA 4JRFA 1PFPA 1W2ZA 5FW5A 1W6YA 1W4NA 2HMNB 4FMAA 1IQXA 4J9AA 1FGTA 2ZL8A 3DGMA 2O3OA 1QAFA 3WOFB 1ROAA 4G1MB 2CFWA 1KWIA 3QK9A 1LVNA 1TP6A 5EVHA 3UB1A 2IUJA 1VQ83 3LMLA 2HMOB 2L4VA 2R4IA 3NHXA 5JPPA 3WA3A 3S29A 2GU3A 2GEYA 5KP4A 2LQVA 4K1UA 3H51A 2OTJ3 2CWTA 4GB5A 4N6OB 4EBGA 1HU9A 1VQM3 4K61A 5JBSA 3I563 1IT8A 3SX1A 1Q814 2IA7A 3G16A 1Q42A 4HYZA 3RDEA 1JNQA 1K41A 1GY6A 2BT3A 2CG1A 3EN8A 4H3UA 3UL6A 3D3LA 3CCL3 1VZZA 3EF8A 3M8CA 1DMNA 1OHSA 4FR9A 5CK6A 2E2TA 2W0QA 4OUQA 3PGBA 3PS8A 1YJN3 3G0KA 1JKGA 3JUMA 4N6MA 3OW22 4U13A 2YX9A 4HM3B 4EXRA 1ISKA 4HM4B 5IW9A 2ML6A 1FGRA 1WMPA 3GAXA 1EA2A 1Q824 2RGQA 3SOYA 1TUHA 3LOYA 1HKXA 1SQWA 1OF5A 4FCMA 3LTCA 3V92A 4IIAA 4LGQA 1M9GA 3KN4A 1T5YA 3S27A 3FCSB 2W04A 3LTAA 1ASKA 5KP3A 1UI7A 4XM4A 4MMZB 5BVBA 1AV4A 4LSOA 1U8CB 4WYKA 3MWZA 4CDLA 2GU1A 3CU3A 1TIJA 1D6UA 3EE1A 3SLUA 2CWVA 4HZBB 1K28A 1Z1SA 3SXXA 1VQ63 1NDOB 3K9MC 1NWWA 3K5TA 2JQ5A 1R4CA 3DY5A 3NQYA 4KZ1A 1Q40A 2Z77A 2F98A 3VGNA 1US1A 3U97A 1ULJB 2OQEC 4R1KA 5TGNA 2E2UA 3SEDA 1QALA 3EHCA 3OWYA 3CCR3 3WDGB 2PNCA 3BLZA 5LC7A 3DUKA 3VSYA 3K7CA 2F99A 1OF5B 3EN1B 3NBBA 3O8YA 2P38A 2A15A 2LYXA 4HJLB 1W00A 1WTHA 3NQZA 1EQKA 3HZPA 3T8NA 5KP1A 1DMMA 3WA2X 1ZO2A 3LXUX 2BHMA 2YFLB 2Z7AA 1S723 5AIHA 4WYKB 3ER7A 1ULIB 1IT7A 4LMIA 1JB5A 1A67A 3PCSA 2P05A 1NO3A 3S67A 3CC43 1YIJ3 1IU7A 4MJDA 1M1XB 5IEOA 1NU3A 1LNHA 1RRHA 3BNCA 2XGNA 3HIIA 1DVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q40 B;  2GEX A;  2BNG A;  3ECF A;  3K0Z A;  3NXJ A;  1JN5 B;  1CQS A;  5IF6 A;  4J8T A;  4Q53 A;  3B4P A;  1GS3 A;  1OHP A;  4L8P A;  2PZV A;  2GBW B;  3MG3 A;  1SJW A;  3B7C A;  3F14 A;  4HM1 B;  3GWR A;  3MG2 A;  4OVM A;  3JUQ A;  4PEJ A;  2B24 B;  5CF2 A;  5D82 A;  5STD A;  3G8Z A;  3EBT A;  3KKG A;  1UUW B;  3F7S A;  5AI1 A;  1QMA A;  3MKI A;  1JB2 A;  5AEW B;  4HVN A;  2HMM B;  3CNM A;  2YFI B;  1ZX2 A;  3WMD A;  2RFR A;  3MHE A;  3GZB A;  3F40 A;  5DRE A;  5AII A;  5AEU B;  2INX A;  3HX8 A;  3JUP A;  4HM2 B;  4XDW A;  5CXO A;  3STD A;  1UUV B;  4ORL A;  3Q90 A;  2BMQ B;  2BMO B;  4R9L A;  3B8L A;  4FCJ A;  4L8O A;  2I9W A;  1WQL B;  3FKA A;  1E97 A;  2QIY A;  1OPY A;  2GXF A;  3DM8 A;  1E3V A;  3RGR A;  2GBX B;  3I0Y A;  4LEH A;  2XR8 B;  1A2K A;  3NM2 A;  2CHC A;  1BUQ A;  5IEP A;  2HML B;  3FLJ A;  2Z76 A;  5CF1 A;  2CKF B;  2XRX B;  1IDP A;  1JN5 A;  3OWS A;  1U5O A;  1DMQ A;  3CPO A;  1OGZ A;  5IG0 A;  4RZM A;  3GZY B;  3DMC A;  3DZL A;  5CLK A;  4HM8 B;  3GZX B;  3SOA A;  8CHO A;  1OGX A;  3F8X A;  4K1V A;  3B4O A;  1O7M B;  2B1X B;  2IMJ A;  3LYG A;  4XDV A;  5AIF A;  3F8H A;  3IPT A;  4WWU C;  5BXQ A;  5D83 A;  2QGU A;  1O7W B;  3FF2 A;  4HM6 B;  1O7P B;  3HK4 A;  1W01 A;  3EJV A;  1JB4 A;  2BMR B;  5HGR A;  5DRV A;  2XSO B;  4KVH A;  1O7H B;  1OHO A;  3NV0 A;  4HM5 B;  4HM7 B;  4XBT A;  4XBY A;  1C7H A;  3H3H A;  3NUV A;  2XSH B;  3DXO A;  3MG1 A;  3EBY A;  3E99 A;  4XB5 A;  2UX0 A;  3NV0 B;  3EX9 A;  1OCV A;  3CNX A;  1E3R A;  1QJG A;  6STD A;  2RCD A;  4HZ9 B;  3OX9 A;  3OV4 A;  1GY7 A;  2K54 A;  4WP5 A;  3FF0 A;  1S5A A;  3GZR A;  2F86 B;  4X2H A;  3KSP A;  1AR0 A;  3UJM A;  5IEN A;  3OXA A;  5IG5 A;  1W02 A;  1OUN A;  5IG3 A;  3EC9 A;  1O7G B;  3F7X A;  3D9R A;  3FSD A;  2STD A;  4N3V A;  4XBX A;  1EG9 B;  2HMK B;  5IG4 A;  3ROB A;  1JKG B;  1STD A;  5D81 A;  4L7K A;  3KE7 A;  2OWP A;  3OWU A;  3JUO A;  5AIG A;  3F9S A;  4HM0 B;  3A76 A;  4STD A;  1O7N B;  1OH0 A;  3UNL A;  3GRD A;  1GY5 A;  3MSO A;  4R9K A;  3BB9 A;  3FH1 A;  7STD A;  2YFJ B;  4X2O A;  3FZW A;  3MYT A;  4HKV B;  3EQQ B;  4I4K A;  5IER A;  3S5C A;  3KZT A;  2HMJ B;  3NBR A;  3RGA A;  3FGY A;  1GYB A;  5JPU A;  3LZA A;  5G2G A;  2W2C A;  3T8U A;  3JUN A;  5FW5 A;  1W6Y A;  2HMN B;  4J9A A;  1TP6 A;  5EVH A;  2HMO B;  2R4I A;  3NHX A;  5JPP A;  2GEY A;  5KP4 A;  4K1U A;  3H51 A;  4GB5 A;  3G16 A;  1Q42 A;  1K41 A;  1GY6 A;  3EN8 A;  4H3U A;  1VZZ A;  3EF8 A;  3M8C A;  1DMN A;  1OHS A;  5CK6 A;  4OUQ A;  3G0K A;  1JKG A;  3JUM A;  4U13 A;  1ISK A;  4HM3 B;  4HM4 B;  1EA2 A;  2RGQ A;  3SOY A;  1TUH A;  1HKX A;  1OF5 A;  4FCM A;  4IIA A;  4LGQ A;  1ASK A;  5KP3 A;  4XM4 A;  5BVB A;  4WYK A;  4CDL A;  3CU3 A;  4HZB B;  1Z1S A;  1NDO B;  1NWW A;  2JQ5 A;  1Q40 A;  2F98 A;  2Z77 A;  3VGN A;  1ULJ B;  4R1K A;  3SED A;  5TGN A;  3EHC A;  3OWY A;  3BLZ A;  3DUK A;  3VSY A;  3K7C A;  2F99 A;  1OF5 B;  3EN1 B;  2A15 A;  4HJL B;  1W00 A;  3HZP A;  3T8N A;  5KP1 A;  1DMM A;  1ZO2 A;  2YFL B;  2Z7A A;  5AIH A;  4WYK B;  3ER7 A;  1ULI B;  4LMI A;  1JB5 A;  4MJD A;  5IEO A;  1NU3 A; 
#chains in the Genus database with same CATH topology
 1Q40 B;  4OK0 A;  1FZU A;  2BNG A;  2GEX A;  3CC2 3;  4CJN A;  1T2H A;  2KCD A;  3D5G A;  3ECF A;  1WMO A;  3K0Z A;  3NXJ A;  5RNT A;  1JN5 B;  4EC6 A;  1SPU A;  1CQS A;  4FMB A;  4GSP A;  5IF6 A;  4J8T A;  1BRS A;  3B4P A;  1GS3 A;  2WO0 A;  4Q53 A;  2XH9 A;  1SIH A;  1OHP A;  4L8P A;  3NM7 A;  3K63 A;  3AMO A;  1RCK A;  2Q07 A;  1DE3 A;  2R41 A;  1BAO A;  3CPW 2;  2PZV A;  1FA3 A;  3V98 A;  2J8X B;  2GBW B;  3MG3 A;  2IY2 A;  1SJW A;  1PYL A;  3B7C A;  4JF8 A;  2W9Q A;  3F14 A;  4HM1 B;  5LC6 A;  3GWR A;  2CC3 A;  3MG2 A;  4OVM A;  3JUQ A;  1RKY A;  1YHQ 3;  2P09 A;  1RMS A;  4J5G A;  1AVK A;  1A90 A;  4TX4 A;  3BU4 A;  1TTO A;  1T3B A;  2W56 B;  4PEJ A;  2B24 B;  5CF2 A;  1JZO A;  1YJW 3;  5D82 A;  5STD A;  3G8Z A;  3EBT A;  2D42 A;  1GOV A;  1LOY A;  1J2B A;  3KKG A;  3CMA 3;  1UUW B;  3F7S A;  2W03 A;  1UGH I;  5ELU A;  5AI1 A;  4DKI A;  1QMA A;  1BNF A;  1HYF A;  3MKI A;  1JB2 A;  3HOH A;  3X40 A;  4BU4 A;  1I8V A;  1IYY A;  5AEW B;  4HVN A;  1RDS A;  1M90 4;  2OQE A;  2BU4 A;  2HMM B;  3CNM A;  2MC8 A;  1IVX A;  2YFI B;  2XF3 A;  3AMO B;  1ZX2 A;  1RNT A;  2RFR A;  4IT7 A;  2RNT A;  3WMD A;  4KFE A;  2CG0 A;  1KSI A;  2P0X A;  3MHE A;  2ML5 A;  3GZB A;  3Q2P A;  3F40 A;  3IJE B;  1N8R 4;  4ILF A;  5AII A;  2SAR A;  2INX A;  3D5I A;  5DRE A;  1G0T A;  3HX8 A;  5AEU B;  3JUP A;  1RN4 A;  1A2V A;  4HM2 B;  4LZI A;  3J7Y d;  4AKZ A;  5M1A A;  1X1X A;  1MWU A;  4XDW A;  5CXO A;  3MPH A;  4NRE A;  1IK3 A;  1GD4 A;  3LT8 A;  3STD A;  1UUV B;  1A2P A;  1BIR A;  2ZDJ A;  2IYJ A;  2KF4 A;  4ORL A;  3WOE B;  3CCM 3;  1EKM A;  2C11 A;  3Q90 A;  1N9E A;  2OOV A;  1JBS A;  1RN1 A;  2M7O A;  1TFO A;  2BMQ B;  2BMO B;  2F56 A;  1N9J A;  3U1W A;  4HAA A;  4R9L A;  3TDG A;  4QWT A;  3B8L A;  4FCJ A;  3S28 A;  5I97 A;  1FUS A;  1BRG A;  2C10 A;  2I9W A;  1WQL B;  2KF5 A;  4L8O A;  3DGN A;  3FKA A;  1E97 A;  3CCU 3;  1ZGX A;  1SII A;  2QIY A;  4N6T A;  1CEW I;  1IV9 A;  1LOX A;  4RNY A;  1OPY A;  1YGW A;  4K90 B;  4CCV A;  1X1W A;  2FGT A;  4RBN A;  1JBR A;  1I70 A;  2GXF A;  5FGO A;  3DM8 A;  4GL6 A;  4EYC A;  2H0H A;  1E3V A;  4N6V 0;  4KT3 B;  1VQ4 3;  3RGR A;  2GBX B;  4NPB A;  4BTX A;  3I0Y A;  4LEH A;  3DGO A;  2XR8 B;  1BRK A;  1I2E A;  1YI2 3;  4H61 A;  1A2K A;  2QEX 3;  3PZW A;  1W5Z A;  3NM2 A;  1UW1 A;  7GSP A;  4J5K A;  3CD6 3;  2CHC A;  1BUQ A;  5IEP A;  2HML B;  1LQG C;  2Z76 A;  3FLJ A;  5CF1 A;  3VF1 A;  1RTU A;  1YJ9 3;  2W6J H;  1N8Q A;  1Y4K A;  1B2X A;  2CKF B;  2XRX B;  1IDP A;  3CCE 3;  1JN5 A;  3FG1 A;  3OWS A;  1D6Y A;  1U5O A;  1DMQ A;  3CPO A;  4KFD A;  5HOH A;  2AAE A;  1MGW A;  1T2I A;  1OGZ A;  2CX0 A;  4BL3 A;  4O02 B;  1BNJ A;  1YIT 3;  1BRH A;  5IG0 A;  4O3V A;  3QRD A;  4N6U A;  2P0M A;  2CH9 A;  3GZY B;  4RZM A;  1M1K 4;  1CYU A;  4KFF A;  1YVB I;  3KFQ C;  4CPK A;  1IV7 A;  3DMC A;  3DZL A;  5CLK A;  4HM8 B;  1C54 A;  2CW9 A;  3GZX B;  1D6Z A;  1IVU A;  3SOA A;  8CHO A;  1VQO 3;  2OTL 3;  1I3I A;  1OGX A;  3F8X A;  1RGC A;  2H0G A;  1NB3 I;  2W56 A;  1BSA A;  3Q3F A;  4FMC A;  2OOV C;  4K1V A;  8RNT A;  3X41 A;  3LTB A;  3G6E 3;  3T0U A;  1BNS A;  1G96 A;  3B4O A;  5M18 A;  1O7M B;  2B1X B;  2IMJ A;  2Y74 A;  3LYG A;  4WFO A;  7RNT A;  4XDV A;  4WHA A;  5AIF A;  3F8H A;  3Q1C A;  1MNL A;  3IPT A;  3FG4 A;  3X42 A;  3X3Z A;  3N9H A;  2D1W A;  4WWU C;  5BXQ A;  5D83 A;  5ELJ A;  3BNB A;  3WHO A;  4AEQ A;  2QGU A;  4BTY A;  1K8A 4;  2KXG A;  3CC7 3;  1VQL 3;  1UCI A;  1UCK A;  1BSC A;  1YVS A;  2Z6B A;  4EV2 A;  3V99 A;  1O7W B;  3CCQ 3;  1Q7Y 4;  3FF2 A;  4HM6 B;  4MMX B;  1O7P B;  3HK4 A;  1W01 A;  2XFT A;  2Y73 A;  3EJV A;  2K0M A;  1JV2 B;  3LT9 A;  1PU4 A;  1V74 A;  1JB4 A;  1LOV A;  2FNQ A;  2BMR B;  1VQQ A;  3KSE D;  1BRJ A;  5HGR A;  1I2F A;  4FCZ A;  1V58 A;  3IMA B;  1STF I;  4R80 A;  5DRV A;  1FUT A;  1YGE A;  2JDI H;  3CCJ 3;  5EEO A;  1Q86 4;  2XSO B;  3N54 B;  4KVH A;  1MGR A;  1UI8 A;  1O7H B;  1OHO A;  2IUK A;  3WOD G;  1QAK A;  1VQN 3;  2K3D A;  4NHF A;  3NV0 A;  1DVD A;  1ROV A;  4EW5 A;  4HM5 B;  1RRL A;  4HM7 B;  1Q9E A;  4XBT A;  1JRQ A;  1VQ9 3;  3EB8 A;  1IQ8 A;  4XBY A;  1QVG 2;  1FGQ A;  1C7H A;  1BVI A;  2ZHX B;  1LXE A;  5AYR B;  3X3Y A;  3H3H A;  3NUV A;  5BU4 A;  1KD1 4;  2XSH B;  3DXO A;  1OAC A;  3MG1 A;  2QA4 3;  2XGL A;  3HI7 A;  1BNE A;  3EBY A;  4O8S A;  1BSB A;  3E99 A;  5AYS C;  4FMD A;  4XB5 A;  3X3X A;  5A0O B;  3CCS 3;  2UX0 A;  3JVC A;  3PCR A;  1LNI A;  1VQK 3;  1K9M 4;  1TFK A;  4RNT A;  3NBJ A;  1QVF 2;  1L5G B;  2BO9 B;  3NV0 B;  1X1Y A;  3SVA A;  1BOX A;  3EX9 A;  2XEP A;  1B21 A;  1OCV A;  2CFD A;  2F5W A;  4AKY A;  1E3R A;  1W6G A;  1QJG A;  3CNX A;  6RNT A;  6STD A;  3G71 3;  1BNG A;  2CIU A;  2RCD A;  3PYJ A;  1VQ7 3;  4HZ9 B;  3OX9 A;  4R4K A;  3UL5 A;  1N5H A;  1GY7 A;  2K54 A;  3OV4 A;  4WP5 A;  3FF0 A;  1KC8 4;  1KQS 2;  1S5A A;  1GOY A;  2SBL A;  1RGF A;  3GZR A;  1NJI 4;  2F86 B;  2V1L A;  1B2S A;  1IVV A;  4X2H A;  2WGO A;  3KSP A;  1AR0 A;  1TU5 A;  1K73 4;  3LH4 A;  1VQP 3;  3UJM A;  5IEN A;  3FG3 A;  2CFL A;  3OXA A;  5IG5 A;  1BNR A;  1DYU A;  1RGL A;  1CYV A;  1W02 A;  1OUN A;  3BND A;  1CH0 A;  1GOU A;  4MEI A;  5IG3 A;  3EC9 A;  3CXC 2;  3CCV 3;  1O7G B;  2CK3 H;  1B20 A;  3F7X A;  3KII A;  2OCT A;  2WOF A;  1YNV X;  5EQL A;  1FUW A;  3D9R A;  2W9P A;  1RN7 A;  3FSD A;  2MF7 A;  1JBT A;  4LYL B;  4O2H A;  2STD A;  1NB5 I;  1B2U A;  1GD3 A;  1IQY A;  1Q7H A;  1W6C A;  2KF6 A;  3L0R A;  4N3V A;  1JJ2 2;  2KRT A;  3G4S 3;  1AVL A;  1R4Y A;  2E2V A;  1FGO A;  4XBX A;  1EG9 B;  2HMK B;  2GSP A;  5IG4 A;  1UCL A;  3ZG5 A;  2WGQ A;  3ROB A;  9RNT A;  1TRP A;  1JKG B;  1STD A;  1VQ5 3;  5D81 A;  4L7K A;  3KE7 A;  1LOW A;  4EV5 A;  2OWP A;  3OWU A;  3JUO A;  1RGH A;  4HOH A;  5AIG A;  2RSX A;  4MMY B;  1UUG B;  3F9S A;  3NX0 A;  4HM0 B;  3A76 A;  3KCH A;  4STD A;  4ZM8 A;  4IPB A;  1BRN L;  1WNH A;  3A5E A;  1RJO A;  1O7N B;  1OH0 A;  3UNL A;  1EUI C;  3GRD A;  2CFG A;  4I5Q A;  1FGM A;  1GY5 A;  3MSO A;  2CWU A;  4R9K A;  3BB9 A;  3FH1 A;  1I0V A;  2FXT A;  7STD A;  2XFS A;  2YFJ B;  3FZW A;  4X2O A;  5G1K A;  1BAN A;  1V57 A;  3MYT A;  4HKV B;  4RNZ A;  4BL2 A;  4HBR A;  3ALA A;  3EQQ B;  4I4K A;  2KF3 A;  5IER A;  1W2B 2;  3S5C A;  1N5P A;  1JZD A;  3KZT A;  2HMJ B;  3NBR A;  3RGA A;  1WMN A;  3BNE A;  3HIG A;  4N6N B;  1IVW A;  4N6L A;  1RSN A;  3CME 3;  1RGK A;  2CFK A;  1W7C A;  3DGL A;  3N8B A;  1MOL A;  3LTD A;  3FGY A;  1GYB A;  2H0I A;  3PXM A;  5JPU A;  3LZA A;  5G2G A;  1I0X A;  2O9U X;  1F8N A;  2W2C A;  2KAA A;  3I55 3;  2RBI A;  2WOH A;  1AQZ A;  4BTW A;  1ZS7 A;  3T8U A;  3JUN A;  4JRF A;  1UDI I;  1RHL A;  1PFP A;  1W2Z A;  1PY3 A;  1W6Y A;  5FW5 A;  1BRI A;  1W4N A;  1UCJ A;  2HMN B;  1RGE A;  1IQX A;  4FMA A;  2UUG C;  1FGT A;  4J9A A;  2ZL8 A;  3DGM A;  2O3O A;  1QAF A;  3WOF B;  1ROA A;  4G1M B;  1FYS A;  2CFW A;  1G02 A;  1KWI A;  2BIR A;  3QK9 A;  3ZFZ A;  1LVN A;  1TP6 A;  5EVH A;  3UB1 A;  1RGA A;  2IUJ A;  1VQ8 3;  3LML A;  2HMO B;  2L4V A;  2R4I A;  3SYU A;  1B2M A;  3NHX A;  1AY7 A;  1RNB A;  5JPP A;  3WA3 A;  3S29 A;  2GU3 A;  2GEY A;  2HOH A;  5KP4 A;  2LQV A;  4K1U A;  3H51 A;  3DGY A;  2OTJ 3;  2CWT A;  4GB5 A;  3BIR A;  1BSD A;  4N6O B;  3ZG0 A;  1TRQ A;  1GMR A;  4EBG A;  1HU9 A;  1BU4 A;  4K61 A;  2C4B A;  3URP A;  1IT8 A;  5JBS A;  3I56 3;  3SX1 A;  1VQM 3;  1Q81 4;  2CX1 A;  2IA7 A;  3G16 A;  1Q42 A;  4HYZ A;  3RDE A;  1JNQ A;  1K41 A;  1GY6 A;  2BT3 A;  2L1S A;  2CG1 A;  3EN8 A;  3WR2 A;  4H3U A;  3D79 A;  1GMP A;  6GSP A;  1BNI A;  3UL6 A;  3AGO A;  3AHS A;  3D4A A;  3D3L A;  4BIR A;  1B3S A;  1EEJ A;  4GHO A;  3CCL 3;  1VZZ A;  3EF8 A;  3M8C A;  1DMN A;  1OHS A;  4FR9 A;  5CK6 A;  5GSP A;  2UGI A;  2E2T A;  1RCL A;  2W0Q A;  4OUQ A;  3PGB A;  1LRA A;  3PS8 A;  1YJN 3;  3G0K A;  3GSP A;  1JKG A;  1MWR A;  3JUM A;  4N6M A;  3OW2 2;  4U13 A;  2YX9 A;  4HM3 B;  1MWS A;  4EXR A;  1ISK A;  1X1U A;  4HM4 B;  5IW9 A;  1BUJ A;  2ML6 A;  3RNT A;  1FGR A;  1WMP A;  1GSP A;  1RLS A;  3GAX A;  1EA2 A;  1Q82 4;  2RGQ A;  5G1L A;  1TUH A;  3LOY A;  3SOY A;  1HKX A;  1SQW A;  1OF5 A;  4FCM A;  1SAR A;  3LTC A;  3V92 A;  4IIA A;  4LGQ A;  3AHW A;  1TJD A;  1M9G A;  3KN4 A;  1T5Y A;  3S27 A;  3FCS B;  2W04 A;  3LTA A;  1ASK A;  1B27 A;  3DH2 A;  5KP3 A;  5M19 A;  1UI7 A;  4XM4 A;  4MMZ B;  5BVB A;  5BIR A;  1AV4 A;  1LQM B;  4LSO A;  1U8C B;  4WYK A;  3MWZ A;  4CDL A;  2GU1 A;  3CU3 A;  1TIJ A;  1D6U A;  3EE1 A;  3SLU A;  2CWV A;  3AGN A;  1B2Z A;  4HZB B;  1I3F A;  1K28 A;  1Z1S A;  3SXX A;  1RGG A;  1MWT A;  1NDO B;  2F4Y A;  1VQ6 3;  2ZA4 A;  3K9M C;  1BSE A;  1NWW A;  3K5T A;  2JQ5 A;  1R4C A;  1GMQ A;  3DY5 A;  3NQY A;  1HZ1 A;  1Q40 A;  2F98 A;  2Z77 A;  4KZ1 A;  3VGN A;  1UGI A;  1US1 A;  3U97 A;  1ULJ B;  2OQE C;  4R1K A;  5TGN A;  2E2U A;  3SED A;  1QAL A;  3EHC A;  3OWY A;  3CCR 3;  3WDG B;  2PNC A;  3BLZ A;  5LC7 A;  2AAD A;  3DUK A;  3VSY A;  3K7C A;  2F99 A;  1BGS A;  1OF5 B;  3EN1 B;  3NBB A;  1I2G A;  1DET A;  3O8Y A;  2P38 A;  2A15 A;  2LYX A;  4HJL B;  1W00 A;  1WTH A;  3NQZ A;  1EQK A;  3HZP A;  2F5M A;  3T8N A;  5KP1 A;  1DMM A;  3WA2 X;  1ZO2 A;  3LXU X;  2BHM A;  2YFL B;  2Z7A A;  1S72 3;  5AIH A;  4WYK B;  1NNV A;  3ER7 A;  1ULI B;  1IT7 A;  4LMI A;  1JB5 A;  1A67 A;  3PCS A;  2P05 A;  1NO3 A;  3S67 A;  3CC4 3;  1YIJ 3;  1IU7 A;  4MJD A;  1M1X B;  5IEO A;  1NU3 A;  1LNH A;  1RRH A;  1FW7 A;  3BNC A;  2XGN A;  3HII A;  1DVC A; 
#chains in the Genus database with same CATH homology
 1Q40 B;  4OK0 A;  2GEX A;  2BNG A;  3CC2 3;  2KCD A;  3ECF A;  1WMO A;  3K0Z A;  3NXJ A;  1JN5 B;  4EC6 A;  1SPU A;  1CQS A;  4FMB A;  5IF6 A;  4J8T A;  4Q53 A;  3B4P A;  1GS3 A;  2WO0 A;  2XH9 A;  1SIH A;  1OHP A;  4L8P A;  3NM7 A;  3K63 A;  3AMO A;  2Q07 A;  3CPW 2;  2PZV A;  1FA3 A;  3V98 A;  2GBW B;  3MG3 A;  1SJW A;  3B7C A;  4JF8 A;  2W9Q A;  3F14 A;  4HM1 B;  5LC6 A;  3GWR A;  2CC3 A;  3MG2 A;  4OVM A;  3JUQ A;  1RKY A;  1YHQ 3;  2P09 A;  1A90 A;  1AVK A;  4TX4 A;  2W56 B;  4PEJ A;  2B24 B;  5CF2 A;  1YJW 3;  5D82 A;  5STD A;  3G8Z A;  3EBT A;  2D42 A;  1J2B A;  3KKG A;  3CMA 3;  1UUW B;  3F7S A;  2W03 A;  5ELU A;  5AI1 A;  1QMA A;  3MKI A;  1JB2 A;  3X40 A;  5AEW B;  4HVN A;  1M90 4;  2OQE A;  2HMM B;  3CNM A;  2MC8 A;  1IVX A;  2YFI B;  2XF3 A;  3AMO B;  1ZX2 A;  3WMD A;  2RFR A;  4IT7 A;  4KFE A;  2CG0 A;  1KSI A;  2P0X A;  3MHE A;  2ML5 A;  3GZB A;  3Q2P A;  3F40 A;  3IJE B;  1N8R 4;  5DRE A;  5AII A;  5AEU B;  2INX A;  3HX8 A;  3JUP A;  1A2V A;  4HM2 B;  4LZI A;  3J7Y d;  4AKZ A;  4XDW A;  5CXO A;  3MPH A;  4NRE A;  1IK3 A;  1GD4 A;  3LT8 A;  3STD A;  1UUV B;  2ZDJ A;  3WOE B;  4ORL A;  3CCM 3;  1EKM A;  2C11 A;  3Q90 A;  1N9E A;  2OOV A;  2M7O A;  1TFO A;  2BMQ B;  2BMO B;  3U1W A;  1N9J A;  4R9L A;  3TDG A;  4QWT A;  3B8L A;  4FCJ A;  3S28 A;  5I97 A;  4L8O A;  2C10 A;  2I9W A;  1WQL B;  3DGN A;  3FKA A;  1E97 A;  3CCU 3;  1SII A;  2QIY A;  4N6T A;  4RNY A;  1CEW I;  1IV9 A;  1LOX A;  1OPY A;  4K90 B;  4CCV A;  2FGT A;  4RBN A;  2GXF A;  5FGO A;  4EYC A;  3DM8 A;  4GL6 A;  4N6V 0;  1E3V A;  1VQ4 3;  3RGR A;  2GBX B;  4BTX A;  3I0Y A;  4LEH A;  3DGO A;  2XR8 B;  1YI2 3;  4H61 A;  1A2K A;  2QEX 3;  3PZW A;  1W5Z A;  3NM2 A;  1UW1 A;  3CD6 3;  2CHC A;  1BUQ A;  5IEP A;  2HML B;  3FLJ A;  2Z76 A;  5CF1 A;  3VF1 A;  1YJ9 3;  2W6J H;  1N8Q A;  2CKF B;  1Y4K A;  2XRX B;  1IDP A;  3CCE 3;  1JN5 A;  3FG1 A;  3OWS A;  1D6Y A;  1U5O A;  1DMQ A;  3CPO A;  4KFD A;  1OGZ A;  4O02 B;  1YIT 3;  5IG0 A;  4O3V A;  3QRD A;  4N6U A;  2P0M A;  2CH9 A;  3GZY B;  4RZM A;  1M1K 4;  1CYU A;  4KFF A;  1YVB I;  3KFQ C;  1IV7 A;  3DMC A;  3DZL A;  5CLK A;  4HM8 B;  2CW9 A;  3GZX B;  1D6Z A;  1IVU A;  3SOA A;  8CHO A;  1VQO 3;  2OTL 3;  1OGX A;  3F8X A;  4FMC A;  2W56 A;  1NB3 I;  4K1V A;  3G6E 3;  2OOV C;  3X41 A;  3LTB A;  3T0U A;  1G96 A;  3B4O A;  1O7M B;  2B1X B;  2IMJ A;  2Y74 A;  3LYG A;  4WFO A;  4XDV A;  4WHA A;  5AIF A;  3F8H A;  3Q1C A;  1MNL A;  3IPT A;  3FG4 A;  3X42 A;  3X3Z A;  3N9H A;  2D1W A;  4WWU C;  5BXQ A;  5D83 A;  5ELJ A;  3BNB A;  4AEQ A;  4BTY A;  2QGU A;  1K8A 4;  2KXG A;  1VQL 3;  2Z6B A;  4EV2 A;  3V99 A;  1O7W B;  3CCQ 3;  1Q7Y 4;  3FF2 A;  4HM6 B;  4MMX B;  1O7P B;  3HK4 A;  1W01 A;  2XFT A;  2Y73 A;  3EJV A;  2K0M A;  1JV2 B;  3LT9 A;  1PU4 A;  1V74 A;  1JB4 A;  2FNQ A;  2BMR B;  3KSE D;  5HGR A;  5DRV A;  4FCZ A;  3IMA B;  1STF I;  4R80 A;  1YGE A;  2JDI H;  3CCJ 3;  5EEO A;  1Q86 4;  2XSO B;  3N54 B;  4KVH A;  1UI8 A;  2IUK A;  1O7H B;  1OHO A;  3WOD G;  1VQN 3;  1QAK A;  4NHF A;  3NV0 A;  1DVD A;  1ROV A;  4HM5 B;  1RRL A;  4HM7 B;  4XBT A;  1JRQ A;  1VQ9 3;  3EB8 A;  1IQ8 A;  4XBY A;  1QVG 2;  1FGQ A;  1C7H A;  1LXE A;  5AYR B;  3X3Y A;  3H3H A;  3NUV A;  1KD1 4;  2XSH B;  3DXO A;  1OAC A;  3MG1 A;  2QA4 3;  2XGL A;  3HI7 A;  3EBY A;  4O8S A;  3E99 A;  5AYS C;  4FMD A;  4XB5 A;  3X3X A;  5A0O B;  3CCS 3;  2UX0 A;  3JVC A;  3PCR A;  1VQK 3;  1K9M 4;  1TFK A;  3NBJ A;  1QVF 2;  1L5G B;  2BO9 B;  3NV0 B;  3SVA A;  3EX9 A;  2XEP A;  1OCV A;  2CFD A;  3CC7 3;  4AKY A;  1E3R A;  1W6G A;  1QJG A;  3CNX A;  6STD A;  3G71 3;  2CIU A;  2RCD A;  3PYJ A;  1VQ7 3;  4HZ9 B;  3OX9 A;  4R4K A;  3UL5 A;  1N5H A;  1GY7 A;  2K54 A;  3OV4 A;  4WP5 A;  3FF0 A;  1KC8 4;  1KQS 2;  1S5A A;  2SBL A;  3GZR A;  1NJI 4;  2F86 B;  2V1L A;  1IVV A;  4X2H A;  2WGO A;  3KSP A;  1AR0 A;  1TU5 A;  1K73 4;  3LH4 A;  1VQP 3;  3UJM A;  5IEN A;  3FG3 A;  2CFL A;  3OXA A;  5IG5 A;  1DYU A;  1CYV A;  1W02 A;  1OUN A;  3BND A;  4MEI A;  5IG3 A;  3CXC 2;  3EC9 A;  3CCV 3;  1O7G B;  2CK3 H;  3F7X A;  3KII A;  2OCT A;  2WOF A;  5EQL A;  1FUW A;  3D9R A;  2W9P A;  1RN7 A;  3FSD A;  2MF7 A;  4O2H A;  2STD A;  1NB5 I;  1GD3 A;  1IQY A;  1W6C A;  4N3V A;  3L0R A;  1JJ2 2;  2KRT A;  3G4S 3;  1AVL A;  2E2V A;  1FGO A;  4XBX A;  1EG9 B;  2HMK B;  5IG4 A;  2WGQ A;  3ROB A;  1JKG B;  1STD A;  1VQ5 3;  5D81 A;  4L7K A;  3KE7 A;  4EV5 A;  2OWP A;  3OWU A;  3JUO A;  5AIG A;  2RSX A;  4MMY B;  3F9S A;  3NX0 A;  4HM0 B;  3A76 A;  4STD A;  4ZM8 A;  4IPB A;  1WNH A;  1RJO A;  1O7N B;  1OH0 A;  3UNL A;  3GRD A;  2CFG A;  1FGM A;  1GY5 A;  3MSO A;  2CWU A;  4R9K A;  3BB9 A;  3FH1 A;  2FXT A;  7STD A;  2YFJ B;  2XFS A;  3FZW A;  4X2O A;  3MYT A;  4HKV B;  4RNZ A;  4HBR A;  3ALA A;  3EQQ B;  4I4K A;  5IER A;  1W2B 2;  3S5C A;  1N5P A;  3KZT A;  2HMJ B;  3NBR A;  3RGA A;  1WMN A;  3BNE A;  3HIG A;  4N6N B;  1IVW A;  4N6L A;  3CME 3;  2CFK A;  1W7C A;  3DGL A;  3N8B A;  1MOL A;  3LTD A;  3FGY A;  1GYB A;  5JPU A;  3PXM A;  3LZA A;  5G2G A;  2O9U X;  1F8N A;  2W2C A;  3I55 3;  2WOH A;  4BTW A;  3T8U A;  3JUN A;  4JRF A;  1PFP A;  1W2Z A;  5FW5 A;  1W6Y A;  1W4N A;  2HMN B;  4FMA A;  1IQX A;  4J9A A;  1FGT A;  2ZL8 A;  3DGM A;  2O3O A;  1QAF A;  3WOF B;  1ROA A;  4G1M B;  2CFW A;  1KWI A;  3QK9 A;  1LVN A;  1TP6 A;  5EVH A;  3UB1 A;  2IUJ A;  1VQ8 3;  3LML A;  2HMO B;  2L4V A;  2R4I A;  3NHX A;  5JPP A;  3WA3 A;  3S29 A;  2GU3 A;  2GEY A;  5KP4 A;  2LQV A;  4K1U A;  3H51 A;  2OTJ 3;  2CWT A;  4GB5 A;  4N6O B;  4EBG A;  1HU9 A;  1VQM 3;  4K61 A;  5JBS A;  3I56 3;  1IT8 A;  3SX1 A;  1Q81 4;  2IA7 A;  3G16 A;  1Q42 A;  4HYZ A;  3RDE A;  1JNQ A;  1K41 A;  1GY6 A;  2BT3 A;  2CG1 A;  3EN8 A;  4H3U A;  3UL6 A;  3D3L A;  3CCL 3;  1VZZ A;  3EF8 A;  3M8C A;  1DMN A;  1OHS A;  4FR9 A;  5CK6 A;  2E2T A;  2W0Q A;  4OUQ A;  3PGB A;  3PS8 A;  1YJN 3;  3G0K A;  1JKG A;  3JUM A;  4N6M A;  3OW2 2;  4U13 A;  2YX9 A;  4HM3 B;  4EXR A;  1ISK A;  4HM4 B;  5IW9 A;  2ML6 A;  1FGR A;  1WMP A;  3GAX A;  1EA2 A;  1Q82 4;  2RGQ A;  3SOY A;  1TUH A;  3LOY A;  1HKX A;  1SQW A;  1OF5 A;  4FCM A;  3LTC A;  3V92 A;  4IIA A;  4LGQ A;  1M9G A;  3KN4 A;  1T5Y A;  3S27 A;  3FCS B;  2W04 A;  3LTA A;  1ASK A;  5KP3 A;  1UI7 A;  4XM4 A;  4MMZ B;  5BVB A;  1AV4 A;  4LSO A;  1U8C B;  4WYK A;  3MWZ A;  4CDL A;  2GU1 A;  3CU3 A;  1TIJ A;  1D6U A;  3EE1 A;  3SLU A;  2CWV A;  4HZB B;  1K28 A;  1Z1S A;  3SXX A;  1VQ6 3;  1NDO B;  3K9M C;  1NWW A;  3K5T A;  2JQ5 A;  1R4C A;  3DY5 A;  3NQY A;  4KZ1 A;  1Q40 A;  2Z77 A;  2F98 A;  3VGN A;  1US1 A;  3U97 A;  1ULJ B;  2OQE C;  4R1K A;  5TGN A;  2E2U A;  3SED A;  1QAL A;  3EHC A;  3OWY A;  3CCR 3;  3WDG B;  2PNC A;  3BLZ A;  5LC7 A;  3DUK A;  3VSY A;  3K7C A;  2F99 A;  1OF5 B;  3EN1 B;  3NBB A;  3O8Y A;  2P38 A;  2A15 A;  2LYX A;  4HJL B;  1W00 A;  1WTH A;  3NQZ A;  1EQK A;  3HZP A;  3T8N A;  5KP1 A;  1DMM A;  3WA2 X;  1ZO2 A;  3LXU X;  2BHM A;  2YFL B;  2Z7A A;  1S72 3;  5AIH A;  4WYK B;  3ER7 A;  1ULI B;  1IT7 A;  4LMI A;  1JB5 A;  1A67 A;  3PCS A;  2P05 A;  1NO3 A;  3S67 A;  3CC4 3;  1YIJ 3;  1IU7 A;  4MJD A;  1M1X B;  5IEO A;  1NU3 A;  1LNH A;  1RRH A;  3BNC A;  2XGN A;  3HII A;  1DVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...