1Z1SA

Crystal structure of putative isomerase pa3332 from pseudomonas aeruginosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
NLYFQGHMNAKEILVHSLRLLENGDARGWCDLFHPEGVLEFPYAPPGWKTRFEGRETIWAHMRLFPEHLTVRFTDVQFYETADPDLAIGEFHGDGVATVSGGKLAQDYISVLRTRDGQILLYRDFWNPLRHLEALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Protein PA3332
publication title Crystal Structure of the Conserved Hypothetical Protein PA3332 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
total genus 40
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1z1sA00
1W00A 5IF6A 2F99A 3KE7A 6STDA 1O7PB 3STDA 3JUOA 1O7GB 3EC9A 1GYBA 4CDLA 1VZZA 3T8UA 3G0KA 4U13A 5JPUA 1OHPA 4K1UA 3EHCA 2BMQB 3DMCA 3KSPA 3KZTA 5IEOA 2K54A 1IDPA 3GZBA 5EVHA 1OCVA 3DXOA 2CHCA 5D83A 3KKGA 2UX0A 4GB5A 5AI1A 1OHOA 3F8HA 1JB2A 1E97A 1ZX2A 1E3VA 3JUQA 3FF0A 3NXJA 1JKGA 4L8OA 1SJWA 5AEWB 1OF5A 2B1XB 3FH1A 4HM4B 1O7HB 1A2KA 3FSDA 4Q53A 4X2OA 1E3RA 1Q40B 5KP1A 4K1VA 3FF2A 3EN1B 2QGUA 2CKFB 2YFJB 4LGQA 4XBYA 1O7MB 4HM1B 3UNLA 1BUQA 2HMMB 1ULJB 2XR8B 1NU3A 3H51A 3OX9A 5G2GA 2XRXB 3LZAA 4L7KA 1EA2A 3A76A 4R9LA 1ISKA 3GZRA 1OPYA 1OH0A 5TGNA 4FCJA 4N3VA 4XBXA 2RCDA 4XB5A 4KVHA 2PZVA 1O7WB 2YFIB 3F7SA 3S5CA 5AEUB 8CHOA 2F98A 1JKGB 4L8PA 2R4IA 4RZMA 2IMJA 3G8ZA 5CF1A 1OF5B 5CF2A 5D81A 1QMAA 2HMKB 4OVMA 1EG9B 4XDVA 5BXQA 2I9WA 3ER7A 3F7XA 4WYKA 4HM7B 2A15A 1OGZA 3FGYA 4LMIA 1OUNA 3SOYA 2HMLB 5BVBA 4HM6B 1STDA 4R1KA 3GZYB 4IIAA 5AIHA 5CLKA 1DMMA 3HZPA 3EF8A 2XSHB 4STDA 5IG4A 3I0YA 2INXA 4PEJA 4XBTA 5JPPA 3CPOA 2OWPA 2Z7AA 3DM8A 2QIYA 1JB4A 4HJLB 2GXFA 4HM3B 3CNMA 3OXAA 2XSOB 1GY7A 1QJGA 3WMDA 4X2HA 1W6YA 2HMNB 2GEXA 4XDWA 1TUHA 1W02A 1TP6A 1JN5A 4HM8B 2BMRB 1OGXA 3E99A 1GS3A 5AIIA 3T8NA 3EX9A 3FLJA 3ECFA 3OWSA 3DZLA 3OV4A 4WYKB 2RFRA 5IENA 5IG0A 4HM5B 3NBRA 2JQ5A 3NUVA 1AR0A 3MG3A 3G16A 3MHEA 1GY6A 2BNGA 3MG2A 4HM0B 4XM4A 3B7CA 3RGAA 2W2CA 3M8CA 3K0ZA 2RGQA 3VSYA 1NDOB 2YFLB 4J8TA 5KP4A 3DUKA 3GRDA 3NV0A 5AIFA 1DMQA 1S5AA 4HVNA 4I4KA 1HKXA 3HX8A 3F40A 3EN8A 3MYTA 3H3HA 2HMJB 1Q40A 3SOAA 1Z1SA 1W01A 3GWRA 5IERA 3B4OA 3EBTA 3FZWA 5KP3A 1JN5B 3F8XA 5DREA 3RGRA 5AIGA 3B4PA 3K7CA 1C7HA 2GBWB 1U5OA 2F86B 3NHXA 7STDA 4WP5A 4FCMA 4LEHA 3EJVA 3NM2A 3VGNA 3F9SA 1K41A 3IPTA 2Z77A 3JUMA 3ROBA 3LYGA 4HZBB 3CU3A 3SEDA 3BLZA 3UJMA 2GEYA 4OUQA 3EQQB 3NV0B 5IEPA 1UUVB 5FW5A 5IG5A 3MG1A 1ASKA 3F14A 3MKIA 1DMNA 5CXOA 3OWUA 3Q90A 2BMOB 1JB5A 1CQSA 1ULIB 4ORLA 3D9RA 3GZXB 3JUPA 3BB9A 3OWYA 4H3UA 4MJDA 2B24B 4HM2B 5IG3A 4WWUC 5D82A 1Q42A 2Z76A 3MSOA 1NWWA 3HK4A 1GY5A 3FKAA 3JUNA 4R9KA 2HMOB 1O7NB 5STDA 4HKVB 1ZO2A 3B8LA 1OHSA 2STDA 1WQLB 5DRVA 3EBYA 4HZ9B 4J9AA 5HGRA 3CNXA 1UUWB 2GBXB 5CK6A
chains in the Genus database with same CATH superfamily
2BT3A 4BL2A 3OW22 1UGIA 3PYJA 1W00A 2CC3A 2FXTA 1I2EA 2WGOA 2CWTA 2F99A 2WOHA 3KE7A 5IF6A 6STDA 3U97A 1O7PB 1B21A 1LNHA 3IJEB 1M1K4 3STDA 1N8QA 4QWTA 3NM7A 3SYUA 2XFSA 5I97A 3O8YA 1PFPA 3D4AA 3JUOA 1O7GB 1YJ93 1I0XA 3EC9A 1GYBA 4CDLA 1VZZA 3T8UA 1BUJA 3G0KA 3RNTA 4K61A 2SBLA 5G1KA 4U13A 3EE1A 5JPUA 2OTL3 1G0TA 1OHPA 1RGKA 4K1UA 4LSOA 4NHFA 3EHCA 2BMQB 4WFOA 2PNCA 3DMCA 3KSPA 3KZTA 4H61A 5IEOA 3RDEA 2BO9B 2K54A 3T0UA 1R4CA 1QAFA 3QRDA 3KIIA 2CWUA 2Q07A 1IDPA 3AGOA 3GZBA 1VQQA 5GSPA 3WA2X 1BSBA 1NB3I 5EVHA 2W56B 1OCVA 3DXOA 2CHCA 5D83A 3KKGA 2UX0A 2OTJ3 3V92A 4GB5A 5M1AA 3IMAB 2Z6BA 1FYSA 5AI1A 1B20A 1ZS7A 1W5ZA 1UW1A 1ROVA 4KZ1A 1OHOA 1TFKA 4KFFA 4N6V0 1W7CA 3F8HA 1JB2A 1E97A 2CX0A 1ZX2A 3KN4A 1E3VA 3JUQA 1RHLA 1RGEA 3FF0A 3NQZA 1GMRA 3X3XA 1IT7A 2W0QA 1FGTA 1W2ZA 3NXJA 1JKGA 3NQYA 4KT3B 1RLSA 1MNLA 2LYXA 2W9QA 4LZIA 4RNYA 4L8OA 1QVF2 1X1YA 1SJWA 1V74A 2P0MA 1OF5A 2B1XB 2XH9A 5AEWB 3FH1A 4HM4B 1O7HB 3WOEB 3LTDA 1X1XA 1UI7A 1A2KA 1MWRA 1PU4A 1U8CB 3FSDA 3Q1CA 4Q53A 4N6NB 1K734 1B2MA 1CYVA 4X2OA 1Q9EA 1BRHA 3DGYA 1E3RA 4NREA 9RNTA 1VQK3 1NO3A 1EUIC 1B27A 4O2HA 1Q40B 4HAAA 3U1WA 2CK3H 4JF8A 4TX4A 3S28A 1YVBI 5KP1A 1B3SA 2UGIA 1I0VA 4CCVA 4K1VA 2ML6A 3FF2A 3LT9A 3EN1B 1WMNA 2K3DA 2H0GA 2QGUA 3LOYA 2WO0A 5FGOA 2CKFB 2YFJB 4LGQA 2MF7A 4XBYA 1O7MB 4HM1B 2IY2A 4EV5A 3ALAA 1RCLA 1N5PA 1LRAA 3UNLA 1BUQA 4ILFA 3PXMA 1RGCA 2QA43 2HMMB 4RNZA 1ULJB 1SIIA 1FUSA 2XR8B 2UUGC 1NU3A 3H51A 3OX9A 1TRPA 5G2GA 1YVSA 5AYSC 1NB5I 1GSPA 2XRXB 1B2XA 3N9HA 1UCIA 2XFTA 4CJNA 1N9EA 3LZAA 1EA2A 3A76A 4L7KA 4R9LA 1N8R4 5EEOA 1ISKA 3GZRA 2LQVA 1OPYA 1RGLA 2RBIA 2WOFA 1OH0A 4MMXB 5ELUA 4N6OB 1BSCA 1SQWA 1BRIA 1UCKA 3TDGA 5TGNA 2E2UA 1I2GA 4FCJA 4N3VA 1KSIA 3VF1A 4N6UA 2RCDA 4XBXA 4XB5A 4IT7A 4N6MA 1MGRA 3AHSA 4KVHA 4EBGA 2PZVA 3LTCA 1EQKA 1O7WB 1RDSA 1N9JA 2YFIB 1AVKA 1T3BA 3F7SA 3S5CA 1AV4A 1N5HA 3G6E3 5AEUB 8CHOA 3WOFB 2F98A 2KF6A 2CFWA 2C4BA 1T2HA 1JKGB 4L8PA 1RGAA 2R4IA 3SVAA 3CCR3 4O3VA 4RZMA 2IMJA 1VQ83 3EB8A 3G8ZA 1BU4A 1KC84 3CCV3 1BNSA 5CF1A 1OF5B 3CMA3 1C54A 5CF2A 3N8BA 5D81A 1QMAA 2HMKB 4OVMA 1EG9B 4XDVA 2GU3A 3CC23 3UL5A 5BXQA 2I9WA 3ER7A 5AYRB 1RRHA 3F7XA 1BIRA 3A5EA 3GAXA 1RN7A 1JBRA 4WYKA 4HM7B 1YGEA 2A15A 4MMYB 1BSEA 1CYUA 2FGTA 1A67A 1GOVA 2BU4A 1OGZA 3FGYA 1US1A 2W6JH 1SIHA 1GD3A 4GL6A 4LMIA 2GSPA 1OUNA 2CIUA 2J8XB 2D42A 1I3FA 3SOYA 1STFI 2BIRA 3HI7A 2BHMA 2HMLB 5BVBA 1SPUA 4HM6B 1STDA 1QAKA 4R1KA 2L1SA 1FA3A 4WHAA 1LNIA 2L4VA 3D79A 3GZYB 3X3YA 4IIAA 2C11A 5AIHA 1YHQ3 1V58A 4AEQA 2IUJA 3G4S3 3AMOA 3I553 1YI23 3K63A 2CW9A 5CLKA 1DMMA 1X1UA 1RN1A 2XGLA 3HZPA 5G1LA 3EF8A 2XF3A 1WTHA 2XSHB 4STDA 5A0OB 5IG4A 3HIIA 3I0YA 1K8A4 3WDGB 1UDII 2P0XA 2INXA 2CFGA 3NBBA 4PEJA 1Q824 1MGWA 1BANA 2KF5A 4XBTA 3DY5A 5JPPA 2ZDJA 3CPOA 2OWPA 1MWUA 3JVCA 3G713 2F5MA 1DETA 2Z7AA 3D5GA 2CX1A 3DM8A 3DGNA 3LMLA 2OOVC 2QIYA 1I70A 1JB4A 5IW9A 4HJLB 1K28A 3KSED 2GXFA 1RN4A 3K5TA 3FG3A 1MOLA 1WMOA 4GSPA 3CNMA 4HM3B 1NJI4 3OXAA 2CH9A 2FNQA 2XSOB 1GY7A 1QJGA 3CCM3 1BRNL 2ZA4A 1OACA 3WMDA 3LH4A 3FG1A 4MMZB 1BNEA 2IYJA 2W04A 4X2HA 4IPBA 1W6YA 7RNTA 2CG1A 6GSPA 2HMNB 4HYZA 3DGMA 4EXRA 2GEXA 3FCSB 4XDWA 1TUHA 1W02A 1ZGXA 1TP6A 3CCJ3 1IVWA 3BU4A 1JN5A 3SXXA 1JBTA 4HM8B 4BTWA 4EC6A 1LQGC 3DH2A 2BMRB 3SLUA 1T5YA 2KF3A 4EYCA 1OGXA 1BSDA 4EV2A 1TTOA 3E99A 1PYLA 2RNTA 1A2PA 1VQP3 1B2SA 1GS3A 4FMAA 1YIJ3 1RSNA 1FGMA 1VQ53 5AIIA 3X41A 1J2BA 1EEJA 1RNBA 1VQL3 3T8NA 1WNHA 7GSPA 3MWZA 1Q7HA 1LOWA 3ZG5A 1IVXA 1BNFA 3EX9A 4ZM8A 1Q814 4FMDA 3FLJA 3ECFA 2KRTA 1LOYA 1R4YA 3GSPA 3OWSA 1FUWA 3DZLA 3OV4A 4RBNA 1Q864 4WYKB 1DVCA 2RFRA 5IENA 2YX9A 1V57A 1BAOA 4LYLB 5IG0A 1BNGA 1RGGA 1UGHI 3SX1A 2GU1A 1TU5A 3BNEA 3KFQC 4HM5B 5BU4A 1YJW3 1CH0A 3DGOA 3NBRA 1FGRA 1IV9A 2JQ5A 1IVUA 1MWSA 1UI8A 1IQ8A 1GMPA 2F5WA 1YJN3 3NUVA 2CFLA 1AR0A 3MG3A 3NBJA 3G16A 3MHEA 1G96A 1BOXA 1GY6A 2BNGA 3BNCA 1W4NA 3MG2A 4HM0B 3B7CA 4XM4A 1DVDA 2WGQA 4RNTA 3RGAA 3UB1A 2W2CA 3X42A 1GOYA 4BL3A 3M8CA 3K0ZA 2RGQA 3VSYA 1D6UA 1RTUA 3Q2PA 4FCZA 3AMOB 1NDOB 2K0MA 2YFLB 4J8TA 1VQO3 5KP4A 3DUKA 3GRDA 2IA7A 2XEPA 4J5KA 1A2VA 2KF4A 3CCU3 1QVG2 2H0HA 3NV0A 1JJ22 3CD63 5AIFA 3S29A 1DMQA 1S5AA 4HVNA 1TIJA 4I4KA 1HKXA 2F56A 4I5QA 1K9M4 1EKMA 2OOVA 3V98A 1B2UA 3HX8A 1DYUA 4FMCA 3WA3A 1T2IA 2D1WA 4GHOA 1RMSA 3F40A 1F8NA 5ELJA 3EN8A 3MYTA 3PS8A 3CCQ3 3H3HA 4BTXA 1NNVA 1AVLA 2HMJB 1Q40A 3SOAA 1Z1SA 1YIT3 1W01A 4NPBA 3GWRA 3BNDA 4BIRA 1IVVA 3B4OA 4K90B 5IERA 2SARA 4R80A 5HOHA 3CC73 3AHWA 4DKIA 3CCE3 4N6TA 3EBTA 1JZDA 2ZL8A 1IQYA 3CPW2 1UCLA 1VQ63 3FZWA 3K9MC 1FZUA 3WR2A 2CFDA 1IT8A 1JN5B 1RNTA 3F8XA 5KP3A 1X1WA 1SARA 2E2VA 3NX0A 5DREA 3RGRA 1VQN3 3BIRA 3ZG0A 5AIGA 4BTYA 2OQEC 3B4PA 2R41A 4BU4A 3Q3FA 3PZWA 4KFEA 1YNVX 1LQMB 3K7CA 1C7HA 2GBWB 1U5OA 2F86B 3NHXA 3S67A 1A90A 1L5GB 7STDA 1JBSA 4WP5A 1GD4A 3LTAA 1TRQA 4FCMA 1VQM3 1VQ73 1VQ93 4LEHA 3EJVA 3N54B 3NM2A 1LOVA 1Q7Y4 1FUTA 1W6CA 3LXUX 1JRQA 2KCDA 3VGNA 1GMQA 1BNIA 2QEX3 1RGHA 1I2FA 2CFKA 2C10A 3PCRA 2P05A 1FW7A 3V99A 3F9SA 2CWVA 3HOHA 5JBSA 1QALA 2HOHA 1K41A 3IPTA 4R4KA 1BSAA 2M7OA 3L0RA 8RNTA 2Z77A 3JUMA 1IU7A 3ROBA 1AQZA 3LYGA 2IUKA 4HZBB 2P09A 3CU3A 1RJOA 3SEDA 1G02A 2P38A 1DE3A 3PCSA 3BLZA 3X3ZA 1RGFA 5RNTA 4HBRA 3UJMA 2GEYA 4JRFA 1M904 3QK9A 3WODG 1IK3A 3CME3 3PGBA 5BIRA 1JNQA 1RRLA 4OUQA 1D6YA 1D6ZA 1LOXA 3EQQB 3NV0B 1HZ1A 3X40A 5IEPA 1M1XB 1WMPA 2O9UX 3HIGA 1UUVB 5FW5A 1UCJA 5IG5A 3ZFZA 1TFOA 1LXEA 3MG1A 1ASKA 5EQLA 4KFDA 5M19A 3F14A 4G1MB 3CCL3 1JZOA 1YGWA 5LC6A 3MKIA 1FGOA 4OK0A 1DMNA 5CXOA 3D3LA 1MWTA 3OWUA 3Q90A 2BMOB 3KCHA 4AKYA 1S723 1UUGB 2MC8A 1JB5A 1CQSA 1VQ43 1ULIB 4ORLA 3D9RA 1I8VA 3GZXB 2CG0A 3MPHA 3JUPA 4AKZA 2XGNA 3BB9A 3OWYA 3UL6A 2AAEA 2H0IA 1BRKA 1KWIA 4H3UA 2W56A 4MJDA 2B24B 2OQEA 1LVNA 5M18A 1CEWI 3BNBA 2V1LA 1Y4KA 2Y73A 1W2B2 4HM2B 3CXC2 5IG3A 2F4YA 1B2ZA 1M9GA 1HU9A 4WWUC 1KQS2 5D82A 3CC43 2Y74A 2RSXA 3DGLA 1AY7A 3FG4A 4FMBA 1BRGA 2ZHXB 1BGSA 1Q42A 1TJDA 2Z76A 3MSOA 1IV7A 1NWWA 3HK4A 4MEIA 1BVIA 2E2TA 1I3IA 1GY5A 1W6GA 2KAAA 3FKAA 3JUNA 2W9PA 4R9KA 3URPA 3I563 1JV2B 1ROAA 2HMOB 2JDIH 1O7NB 1HYFA 2KXGA 4FR9A 5STDA 2ML5A 1FGQA 1BRJA 4N6LA 3J7Yd 1KD14 4HKVB 3D5IA 4EW5A 2AADA 1RKYA 1ZO2A 1PY3A 3B8LA 3LT8A 3AGNA 2W03A 1OHSA 2STDA 1BNJA 1RCKA 1WQLB 5DRVA 1IYYA 4CPKA 1IQXA 3EBYA 4HZ9B 4J5GA 4J9AA 4O02B 4O8SA 3CNXA 1UUWB 5HGRA 5LC7A 4HOHA 3CCS3 1GOUA 2GBXB 3S27A 3WHOA 1BRSA 2OCTA 2O3OA 5CK6A 3LTBA 6RNTA 1BNRA
chains in the Genus database with same CATH topology
2BT3A 3OW22 3PYJA 1W00A 2CC3A 2FXTA 2WGOA 2WOHA 2CWTA 2F99A 3KE7A 5IF6A 6STDA 3U97A 1O7PB 1LNHA 3IJEB 1M1K4 3STDA 1N8QA 4QWTA 3NM7A 2XFSA 5I97A 3O8YA 1PFPA 3JUOA 1O7GB 1YJ93 3EC9A 1GYBA 4CDLA 1VZZA 3T8UA 3G0KA 4K61A 2SBLA 4U13A 3EE1A 5JPUA 2OTL3 1OHPA 4K1UA 4LSOA 4NHFA 3EHCA 2BMQB 4WFOA 2PNCA 3DMCA 3KSPA 3KZTA 4H61A 5IEOA 3RDEA 2BO9B 2K54A 3T0UA 1R4CA 1QAFA 3QRDA 3KIIA 2CWUA 2Q07A 1IDPA 3GZBA 3WA2X 1NB3I 5EVHA 2W56B 1OCVA 3DXOA 2CHCA 5D83A 3KKGA 2UX0A 2OTJ3 3V92A 4GB5A 3IMAB 2Z6BA 5AI1A 1W5ZA 1UW1A 1ROVA 4KZ1A 1OHOA 1TFKA 4KFFA 4N6V0 1W7CA 3F8HA 1JB2A 1E97A 3KN4A 1ZX2A 1E3VA 3JUQA 3FF0A 3NQZA 3X3XA 1IT7A 2W0QA 1FGTA 1W2ZA 3NXJA 1JKGA 3NQYA 1MNLA 2LYXA 2W9QA 4LZIA 4RNYA 4L8OA 1QVF2 1SJWA 1V74A 2P0MA 1OF5A 2B1XB 2XH9A 5AEWB 3FH1A 4HM4B 1O7HB 3WOEB 3LTDA 1A2KA 1UI7A 1PU4A 1U8CB 3FSDA 3Q1CA 4Q53A 4N6NB 1K734 1CYVA 4X2OA 1E3RA 4NREA 1VQK3 1NO3A 4O2HA 1Q40B 3U1WA 2CK3H 4JF8A 4TX4A 3S28A 1YVBI 5KP1A 4CCVA 4K1VA 2ML6A 3FF2A 3LT9A 3EN1B 1WMNA 2QGUA 3LOYA 2WO0A 5FGOA 2CKFB 2YFJB 4LGQA 2MF7A 4XBYA 1O7MB 4HM1B 4EV5A 3ALAA 1N5PA 3UNLA 1BUQA 3PXMA 2QA43 2HMMB 4RNZA 1ULJB 1SIIA 2XR8B 1NU3A 3H51A 3OX9A 5G2GA 5AYSC 1NB5I 2XRXB 3N9HA 2XFTA 1N8R4 1N9EA 3LZAA 1EA2A 3A76A 4L7KA 4R9LA 5EEOA 1ISKA 3GZRA 2LQVA 1OPYA 2WOFA 1OH0A 4MMXB 5ELUA 4N6OB 1SQWA 3TDGA 5TGNA 2E2UA 4FCJA 4N3VA 1KSIA 3VF1A 4N6UA 2RCDA 4XBXA 4XB5A 4IT7A 4N6MA 4KVHA 4EBGA 2PZVA 3LTCA 1EQKA 1O7WB 1N9JA 2YFIB 1AVKA 3F7SA 3S5CA 1AV4A 1N5HA 3G6E3 5AEUB 8CHOA 3WOFB 2F98A 2CFWA 1JKGB 4L8PA 2R4IA 3SVAA 3CCR3 4O3VA 4RZMA 2IMJA 1VQ83 3EB8A 3G8ZA 1KC84 3CCV3 5CF1A 1OF5B 3CMA3 5CF2A 3N8BA 5D81A 1QMAA 2HMKB 4OVMA 1EG9B 4XDVA 2GU3A 3CC23 3UL5A 5BXQA 2I9WA 3ER7A 5AYRB 1RRHA 3F7XA 3GAXA 1RN7A 4WYKA 4HM7B 1YGEA 2A15A 4MMYB 1CYUA 2FGTA 1A67A 1OGZA 3FGYA 1US1A 2W6JH 1SIHA 1GD3A 4GL6A 4LMIA 1OUNA 2CIUA 2D42A 3SOYA 1STFI 3HI7A 2BHMA 2HMLB 5BVBA 1SPUA 4HM6B 1STDA 1QAKA 4R1KA 1FA3A 4WHAA 2L4VA 3GZYB 3X3YA 4IIAA 2C11A 5AIHA 1YHQ3 4AEQA 2IUJA 3G4S3 3AMOA 3I553 1YI23 3K63A 2CW9A 5CLKA 1DMMA 2XGLA 3HZPA 3EF8A 2XF3A 1WTHA 2XSHB 4STDA 5A0OB 5IG4A 3HIIA 3I0YA 1K8A4 3WDGB 2P0XA 2INXA 2CFGA 3NBBA 4PEJA 1Q824 4XBTA 3DY5A 5JPPA 2ZDJA 3CPOA 2OWPA 3JVCA 3G713 2Z7AA 3DM8A 3DGNA 3LMLA 2OOVC 2QIYA 1JB4A 5IW9A 4HJLB 1K28A 3KSED 2GXFA 3K5TA 3FG3A 1MOLA 1WMOA 4HM3B 3CNMA 1NJI4 3OXAA 2CH9A 2FNQA 2XSOB 1GY7A 1QJGA 3CCM3 1OACA 3WMDA 3LH4A 3FG1A 4MMZB 2W04A 4X2HA 4IPBA 1W6YA 2CG1A 2HMNB 4HYZA 3DGMA 4EXRA 2GEXA 3FCSB 4XDWA 1TUHA 1W02A 1TP6A 3CCJ3 1IVWA 1JN5A 3SXXA 4HM8B 4BTWA 4EC6A 2BMRB 3SLUA 1T5YA 4EYCA 1OGXA 4EV2A 3E99A 1VQP3 4FMAA 1GS3A 1YIJ3 1FGMA 1VQ53 5AIIA 3X41A 1J2BA 1VQL3 3T8NA 1WNHA 3MWZA 1IVXA 3EX9A 4ZM8A 1Q814 4FMDA 3FLJA 3ECFA 2KRTA 1FUWA 3OWSA 3DZLA 3OV4A 4RBNA 1Q864 4WYKB 1DVCA 2RFRA 5IENA 2YX9A 5IG0A 3SX1A 1TU5A 2GU1A 3BNEA 3KFQC 4HM5B 1YJW3 3DGOA 3NBRA 1FGRA 1IV9A 2JQ5A 1IVUA 1UI8A 1IQ8A 1YJN3 3NUVA 2CFLA 1AR0A 3MG3A 3NBJA 3G16A 3MHEA 1G96A 1GY6A 2BNGA 3BNCA 1W4NA 3MG2A 4HM0B 3B7CA 4XM4A 1DVDA 2WGQA 3RGAA 3UB1A 2W2CA 3X42A 3M8CA 3K0ZA 2RGQA 3VSYA 1D6UA 3Q2PA 4FCZA 3AMOB 1NDOB 2K0MA 2YFLB 4J8TA 1VQO3 5KP4A 3DUKA 3GRDA 2IA7A 2XEPA 1A2VA 3CCU3 1QVG2 1JJ22 3NV0A 3CD63 5AIFA 3S29A 1DMQA 1S5AA 4HVNA 1TIJA 4I4KA 1HKXA 1K9M4 1EKMA 2OOVA 3V98A 3HX8A 1DYUA 4FMCA 3WA3A 2D1WA 3F40A 5ELJA 1F8NA 3EN8A 3MYTA 3PS8A 3CCQ3 3H3HA 4BTXA 1AVLA 2HMJB 1Q40A 3SOAA 1Z1SA 1YIT3 1W01A 3GWRA 3BNDA 1IVVA 3B4OA 4K90B 5IERA 4R80A 3CC73 3CCE3 4N6TA 3EBTA 2ZL8A 1IQYA 3CPW2 1VQ63 3FZWA 3K9MC 2CFDA 1IT8A 1JN5B 5KP3A 3F8XA 2E2VA 3NX0A 5DREA 3RGRA 1VQN3 5AIGA 4BTYA 2OQEC 3B4PA 3PZWA 4KFEA 3K7CA 1C7HA 2GBWB 1U5OA 2F86B 3NHXA 3S67A 1A90A 1L5GB 7STDA 4WP5A 1GD4A 3LTAA 4FCMA 1VQM3 1VQ73 1VQ93 4LEHA 3EJVA 3N54B 3NM2A 1Q7Y4 3LXUX 1W6CA 1JRQA 2KCDA 3VGNA 2QEX3 2CFKA 2C10A 3PCRA 2P05A 3V99A 3F9SA 2CWVA 5JBSA 1QALA 1K41A 3IPTA 4R4KA 2M7OA 3L0RA 2Z77A 3JUMA 1IU7A 3ROBA 3LYGA 4HZBB 2IUKA 2P09A 3CU3A 1RJOA 3SEDA 2P38A 3PCSA 3BLZA 3X3ZA 4HBRA 3UJMA 2GEYA 4JRFA 1M904 3QK9A 3WODG 1IK3A 3CME3 3PGBA 1JNQA 1RRLA 4OUQA 1D6YA 1D6ZA 1LOXA 3EQQB 3NV0B 3X40A 5IEPA 1M1XB 1WMPA 2O9UX 3HIGA 1UUVB 5FW5A 5IG5A 1TFOA 1LXEA 3MG1A 1ASKA 5EQLA 4KFDA 3F14A 4G1MB 3CCL3 5LC6A 3MKIA 1FGOA 4OK0A 1DMNA 5CXOA 3D3LA 3OWUA 3Q90A 2BMOB 4AKYA 1S723 2MC8A 1JB5A 1CQSA 1VQ43 1ULIB 4ORLA 3D9RA 3GZXB 3MPHA 2CG0A 3JUPA 4AKZA 2XGNA 3BB9A 3OWYA 3UL6A 4H3UA 1KWIA 2W56A 4MJDA 2B24B 2OQEA 1LVNA 1CEWI 3BNBA 2V1LA 1Y4KA 2Y73A 1W2B2 4HM2B 3CXC2 5IG3A 1M9GA 1HU9A 4WWUC 1KQS2 5D82A 3CC43 2Y74A 2RSXA 3DGLA 3FG4A 4FMBA 1Q42A 2Z76A 3MSOA 1IV7A 1NWWA 3HK4A 4MEIA 2E2TA 1GY5A 1W6GA 3FKAA 3JUNA 2W9PA 4R9KA 3I563 1JV2B 1ROAA 2HMOB 2JDIH 1O7NB 2KXGA 4FR9A 5STDA 2ML5A 1FGQA 4N6LA 1KD14 3J7Yd 4HKVB 1RKYA 1ZO2A 3B8LA 3LT8A 2W03A 1OHSA 2STDA 1WQLB 5DRVA 1IQXA 3EBYA 4HZ9B 4J9AA 4O02B 4O8SA 5HGRA 3CNXA 1UUWB 5LC7A 3CCS3 2GBXB 3S27A 2OCTA 2O3OA 5CK6A 3LTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W00 A;  5IF6 A;  2F99 A;  3KE7 A;  6STD A;  1O7P B;  3STD A;  3JUO A;  1O7G B;  3EC9 A;  1GYB A;  4CDL A;  1VZZ A;  3T8U A;  3G0K A;  4U13 A;  5JPU A;  1OHP A;  4K1U A;  3EHC A;  2BMQ B;  3DMC A;  3KSP A;  3KZT A;  5IEO A;  2K54 A;  1IDP A;  3GZB A;  5EVH A;  1OCV A;  3DXO A;  2CHC A;  5D83 A;  3KKG A;  2UX0 A;  4GB5 A;  5AI1 A;  1OHO A;  3F8H A;  1JB2 A;  1E97 A;  1ZX2 A;  1E3V A;  3JUQ A;  3FF0 A;  3NXJ A;  1JKG A;  4L8O A;  1SJW A;  5AEW B;  1OF5 A;  2B1X B;  3FH1 A;  4HM4 B;  1O7H B;  1A2K A;  3FSD A;  4Q53 A;  4X2O A;  1E3R A;  1Q40 B;  5KP1 A;  4K1V A;  3FF2 A;  3EN1 B;  2QGU A;  2CKF B;  2YFJ B;  4LGQ A;  4XBY A;  1O7M B;  4HM1 B;  3UNL A;  1BUQ A;  2HMM B;  1ULJ B;  2XR8 B;  1NU3 A;  3H51 A;  3OX9 A;  5G2G A;  2XRX B;  3LZA A;  4L7K A;  1EA2 A;  3A76 A;  4R9L A;  1ISK A;  3GZR A;  1OPY A;  1OH0 A;  5TGN A;  4FCJ A;  4N3V A;  4XBX A;  2RCD A;  4XB5 A;  4KVH A;  2PZV A;  1O7W B;  2YFI B;  3F7S A;  3S5C A;  5AEU B;  8CHO A;  2F98 A;  1JKG B;  4L8P A;  2R4I A;  4RZM A;  2IMJ A;  3G8Z A;  5CF1 A;  1OF5 B;  5CF2 A;  5D81 A;  1QMA A;  2HMK B;  4OVM A;  1EG9 B;  4XDV A;  5BXQ A;  2I9W A;  3ER7 A;  3F7X A;  4WYK A;  4HM7 B;  2A15 A;  1OGZ A;  3FGY A;  4LMI A;  1OUN A;  3SOY A;  2HML B;  5BVB A;  4HM6 B;  1STD A;  4R1K A;  3GZY B;  4IIA A;  5AIH A;  5CLK A;  1DMM A;  3HZP A;  3EF8 A;  2XSH B;  4STD A;  5IG4 A;  3I0Y A;  2INX A;  4PEJ A;  4XBT A;  5JPP A;  3CPO A;  2OWP A;  2Z7A A;  3DM8 A;  2QIY A;  1JB4 A;  4HJL B;  2GXF A;  4HM3 B;  3CNM A;  3OXA A;  2XSO B;  1GY7 A;  1QJG A;  3WMD A;  4X2H A;  1W6Y A;  2HMN B;  2GEX A;  4XDW A;  1TUH A;  1W02 A;  1TP6 A;  1JN5 A;  4HM8 B;  2BMR B;  1OGX A;  3E99 A;  1GS3 A;  5AII A;  3T8N A;  3EX9 A;  3FLJ A;  3ECF A;  3OWS A;  3DZL A;  3OV4 A;  4WYK B;  2RFR A;  5IEN A;  5IG0 A;  4HM5 B;  3NBR A;  2JQ5 A;  3NUV A;  1AR0 A;  3MG3 A;  3G16 A;  3MHE A;  1GY6 A;  2BNG A;  3MG2 A;  4HM0 B;  4XM4 A;  3B7C A;  3RGA A;  2W2C A;  3M8C A;  3K0Z A;  2RGQ A;  3VSY A;  1NDO B;  2YFL B;  4J8T A;  5KP4 A;  3DUK A;  3GRD A;  3NV0 A;  5AIF A;  1DMQ A;  1S5A A;  4HVN A;  4I4K A;  1HKX A;  3HX8 A;  3F40 A;  3EN8 A;  3MYT A;  3H3H A;  2HMJ B;  1Q40 A;  3SOA A;  1Z1S A;  1W01 A;  3GWR A;  5IER A;  3B4O A;  3EBT A;  3FZW A;  5KP3 A;  1JN5 B;  3F8X A;  5DRE A;  3RGR A;  5AIG A;  3B4P A;  3K7C A;  1C7H A;  2GBW B;  1U5O A;  2F86 B;  3NHX A;  7STD A;  4WP5 A;  4FCM A;  4LEH A;  3EJV A;  3NM2 A;  3VGN A;  3F9S A;  1K41 A;  3IPT A;  2Z77 A;  3JUM A;  3ROB A;  3LYG A;  4HZB B;  3CU3 A;  3SED A;  3BLZ A;  3UJM A;  2GEY A;  4OUQ A;  3EQQ B;  3NV0 B;  5IEP A;  1UUV B;  5FW5 A;  5IG5 A;  3MG1 A;  1ASK A;  3F14 A;  3MKI A;  1DMN A;  5CXO A;  3OWU A;  3Q90 A;  2BMO B;  1JB5 A;  1CQS A;  1ULI B;  4ORL A;  3D9R A;  3GZX B;  3JUP A;  3BB9 A;  3OWY A;  4H3U A;  4MJD A;  2B24 B;  4HM2 B;  5IG3 A;  4WWU C;  5D82 A;  1Q42 A;  2Z76 A;  3MSO A;  1NWW A;  3HK4 A;  1GY5 A;  3FKA A;  3JUN A;  4R9K A;  2HMO B;  1O7N B;  5STD A;  4HKV B;  1ZO2 A;  3B8L A;  1OHS A;  2STD A;  1WQL B;  5DRV A;  3EBY A;  4HZ9 B;  4J9A A;  5HGR A;  3CNX A;  1UUW B;  2GBX B;  5CK6 A; 
#chains in the Genus database with same CATH topology
 2BT3 A;  4BL2 A;  3OW2 2;  1UGI A;  3PYJ A;  1W00 A;  2CC3 A;  2FXT A;  1I2E A;  2WGO A;  2CWT A;  2F99 A;  2WOH A;  3KE7 A;  5IF6 A;  6STD A;  3U97 A;  1O7P B;  1B21 A;  1LNH A;  3IJE B;  1M1K 4;  3STD A;  1N8Q A;  4QWT A;  3NM7 A;  3SYU A;  2XFS A;  5I97 A;  3O8Y A;  1PFP A;  3D4A A;  3JUO A;  1O7G B;  1YJ9 3;  1I0X A;  3EC9 A;  1GYB A;  4CDL A;  1VZZ A;  3T8U A;  1BUJ A;  3G0K A;  3RNT A;  4K61 A;  2SBL A;  5G1K A;  4U13 A;  3EE1 A;  5JPU A;  2OTL 3;  1G0T A;  1OHP A;  1RGK A;  4K1U A;  4LSO A;  4NHF A;  3EHC A;  2BMQ B;  4WFO A;  2PNC A;  3DMC A;  3KSP A;  3KZT A;  4H61 A;  5IEO A;  3RDE A;  2BO9 B;  2K54 A;  3T0U A;  1R4C A;  1QAF A;  3QRD A;  3KII A;  2CWU A;  2Q07 A;  1IDP A;  3AGO A;  3GZB A;  1VQQ A;  5GSP A;  3WA2 X;  1BSB A;  1NB3 I;  5EVH A;  2W56 B;  1OCV A;  3DXO A;  2CHC A;  5D83 A;  3KKG A;  2UX0 A;  2OTJ 3;  3V92 A;  4GB5 A;  5M1A A;  3IMA B;  2Z6B A;  1FYS A;  5AI1 A;  1B20 A;  1ZS7 A;  1W5Z A;  1UW1 A;  1ROV A;  4KZ1 A;  1OHO A;  1TFK A;  4KFF A;  4N6V 0;  1W7C A;  3F8H A;  1JB2 A;  1E97 A;  2CX0 A;  1ZX2 A;  3KN4 A;  1E3V A;  3JUQ A;  1RHL A;  1RGE A;  3FF0 A;  3NQZ A;  1GMR A;  3X3X A;  1IT7 A;  2W0Q A;  1FGT A;  1W2Z A;  3NXJ A;  1JKG A;  3NQY A;  4KT3 B;  1RLS A;  1MNL A;  2LYX A;  2W9Q A;  4LZI A;  4RNY A;  4L8O A;  1QVF 2;  1X1Y A;  1SJW A;  1V74 A;  2P0M A;  1OF5 A;  2B1X B;  2XH9 A;  5AEW B;  3FH1 A;  4HM4 B;  1O7H B;  3WOE B;  3LTD A;  1X1X A;  1UI7 A;  1A2K A;  1MWR A;  1PU4 A;  1U8C B;  3FSD A;  3Q1C A;  4Q53 A;  4N6N B;  1K73 4;  1B2M A;  1CYV A;  4X2O A;  1Q9E A;  1BRH A;  3DGY A;  1E3R A;  4NRE A;  9RNT A;  1VQK 3;  1NO3 A;  1EUI C;  1B27 A;  4O2H A;  1Q40 B;  4HAA A;  3U1W A;  2CK3 H;  4JF8 A;  4TX4 A;  3S28 A;  1YVB I;  5KP1 A;  1B3S A;  2UGI A;  1I0V A;  4CCV A;  4K1V A;  2ML6 A;  3FF2 A;  3LT9 A;  3EN1 B;  1WMN A;  2K3D A;  2H0G A;  2QGU A;  3LOY A;  2WO0 A;  5FGO A;  2CKF B;  2YFJ B;  4LGQ A;  2MF7 A;  4XBY A;  1O7M B;  4HM1 B;  2IY2 A;  4EV5 A;  3ALA A;  1RCL A;  1N5P A;  1LRA A;  3UNL A;  1BUQ A;  4ILF A;  3PXM A;  1RGC A;  2QA4 3;  2HMM B;  4RNZ A;  1ULJ B;  1SII A;  1FUS A;  2XR8 B;  2UUG C;  1NU3 A;  3H51 A;  3OX9 A;  1TRP A;  5G2G A;  1YVS A;  5AYS C;  1NB5 I;  1GSP A;  2XRX B;  1B2X A;  3N9H A;  1UCI A;  2XFT A;  4CJN A;  1N9E A;  3LZA A;  1EA2 A;  3A76 A;  4L7K A;  4R9L A;  1N8R 4;  5EEO A;  1ISK A;  3GZR A;  2LQV A;  1OPY A;  1RGL A;  2RBI A;  2WOF A;  1OH0 A;  4MMX B;  5ELU A;  4N6O B;  1BSC A;  1SQW A;  1BRI A;  1UCK A;  3TDG A;  5TGN A;  2E2U A;  1I2G A;  4FCJ A;  4N3V A;  1KSI A;  3VF1 A;  4N6U A;  2RCD A;  4XBX A;  4XB5 A;  4IT7 A;  4N6M A;  1MGR A;  3AHS A;  4KVH A;  4EBG A;  2PZV A;  3LTC A;  1EQK A;  1O7W B;  1RDS A;  1N9J A;  2YFI B;  1AVK A;  1T3B A;  3F7S A;  3S5C A;  1AV4 A;  1N5H A;  3G6E 3;  5AEU B;  8CHO A;  3WOF B;  2F98 A;  2KF6 A;  2CFW A;  2C4B A;  1T2H A;  1JKG B;  4L8P A;  1RGA A;  2R4I A;  3SVA A;  3CCR 3;  4O3V A;  4RZM A;  2IMJ A;  1VQ8 3;  3EB8 A;  3G8Z A;  1BU4 A;  1KC8 4;  3CCV 3;  1BNS A;  5CF1 A;  1OF5 B;  3CMA 3;  1C54 A;  5CF2 A;  3N8B A;  5D81 A;  1QMA A;  2HMK B;  4OVM A;  1EG9 B;  4XDV A;  2GU3 A;  3CC2 3;  3UL5 A;  5BXQ A;  2I9W A;  3ER7 A;  5AYR B;  1RRH A;  3F7X A;  1BIR A;  3A5E A;  3GAX A;  1RN7 A;  1JBR A;  4WYK A;  4HM7 B;  1YGE A;  2A15 A;  4MMY B;  1BSE A;  1CYU A;  2FGT A;  1A67 A;  1GOV A;  2BU4 A;  1OGZ A;  3FGY A;  1US1 A;  2W6J H;  1SIH A;  1GD3 A;  4GL6 A;  4LMI A;  2GSP A;  1OUN A;  2CIU A;  2J8X B;  2D42 A;  1I3F A;  3SOY A;  1STF I;  2BIR A;  3HI7 A;  2BHM A;  2HML B;  5BVB A;  1SPU A;  4HM6 B;  1STD A;  1QAK A;  4R1K A;  2L1S A;  1FA3 A;  4WHA A;  1LNI A;  2L4V A;  3D79 A;  3GZY B;  3X3Y A;  4IIA A;  2C11 A;  5AIH A;  1YHQ 3;  1V58 A;  4AEQ A;  2IUJ A;  3G4S 3;  3AMO A;  3I55 3;  1YI2 3;  3K63 A;  2CW9 A;  5CLK A;  1DMM A;  1X1U A;  1RN1 A;  2XGL A;  3HZP A;  5G1L A;  3EF8 A;  2XF3 A;  1WTH A;  2XSH B;  4STD A;  5A0O B;  5IG4 A;  3HII A;  3I0Y A;  1K8A 4;  3WDG B;  1UDI I;  2P0X A;  2INX A;  2CFG A;  3NBB A;  4PEJ A;  1Q82 4;  1MGW A;  1BAN A;  2KF5 A;  4XBT A;  3DY5 A;  5JPP A;  2ZDJ A;  3CPO A;  2OWP A;  1MWU A;  3JVC A;  3G71 3;  2F5M A;  1DET A;  2Z7A A;  3D5G A;  2CX1 A;  3DM8 A;  3DGN A;  3LML A;  2OOV C;  2QIY A;  1I70 A;  1JB4 A;  5IW9 A;  4HJL B;  1K28 A;  3KSE D;  2GXF A;  1RN4 A;  3K5T A;  3FG3 A;  1MOL A;  1WMO A;  4GSP A;  3CNM A;  4HM3 B;  1NJI 4;  3OXA A;  2CH9 A;  2FNQ A;  2XSO B;  1GY7 A;  1QJG A;  3CCM 3;  1BRN L;  2ZA4 A;  1OAC A;  3WMD A;  3LH4 A;  3FG1 A;  4MMZ B;  1BNE A;  2IYJ A;  2W04 A;  4X2H A;  4IPB A;  1W6Y A;  7RNT A;  2CG1 A;  6GSP A;  2HMN B;  4HYZ A;  3DGM A;  4EXR A;  2GEX A;  3FCS B;  4XDW A;  1TUH A;  1W02 A;  1ZGX A;  1TP6 A;  3CCJ 3;  1IVW A;  3BU4 A;  1JN5 A;  3SXX A;  1JBT A;  4HM8 B;  4BTW A;  4EC6 A;  1LQG C;  3DH2 A;  2BMR B;  3SLU A;  1T5Y A;  2KF3 A;  4EYC A;  1OGX A;  1BSD A;  4EV2 A;  1TTO A;  3E99 A;  1PYL A;  2RNT A;  1A2P A;  1VQP 3;  1B2S A;  1GS3 A;  4FMA A;  1YIJ 3;  1RSN A;  1FGM A;  1VQ5 3;  5AII A;  3X41 A;  1J2B A;  1EEJ A;  1RNB A;  1VQL 3;  3T8N A;  1WNH A;  7GSP A;  3MWZ A;  1Q7H A;  1LOW A;  3ZG5 A;  1IVX A;  1BNF A;  3EX9 A;  4ZM8 A;  1Q81 4;  4FMD A;  3FLJ A;  3ECF A;  2KRT A;  1LOY A;  1R4Y A;  3GSP A;  3OWS A;  1FUW A;  3DZL A;  3OV4 A;  4RBN A;  1Q86 4;  4WYK B;  1DVC A;  2RFR A;  5IEN A;  2YX9 A;  1V57 A;  1BAO A;  4LYL B;  5IG0 A;  1BNG A;  1RGG A;  1UGH I;  3SX1 A;  2GU1 A;  1TU5 A;  3BNE A;  3KFQ C;  4HM5 B;  5BU4 A;  1YJW 3;  1CH0 A;  3DGO A;  3NBR A;  1FGR A;  1IV9 A;  2JQ5 A;  1IVU A;  1MWS A;  1UI8 A;  1IQ8 A;  1GMP A;  2F5W A;  1YJN 3;  3NUV A;  2CFL A;  1AR0 A;  3MG3 A;  3NBJ A;  3G16 A;  3MHE A;  1G96 A;  1BOX A;  1GY6 A;  2BNG A;  3BNC A;  1W4N A;  3MG2 A;  4HM0 B;  3B7C A;  4XM4 A;  1DVD A;  2WGQ A;  4RNT A;  3RGA A;  3UB1 A;  2W2C A;  3X42 A;  1GOY A;  4BL3 A;  3M8C A;  3K0Z A;  2RGQ A;  3VSY A;  1D6U A;  1RTU A;  3Q2P A;  4FCZ A;  3AMO B;  1NDO B;  2K0M A;  2YFL B;  4J8T A;  1VQO 3;  5KP4 A;  3DUK A;  3GRD A;  2IA7 A;  2XEP A;  4J5K A;  1A2V A;  2KF4 A;  3CCU 3;  1QVG 2;  2H0H A;  3NV0 A;  1JJ2 2;  3CD6 3;  5AIF A;  3S29 A;  1DMQ A;  1S5A A;  4HVN A;  1TIJ A;  4I4K A;  1HKX A;  2F56 A;  4I5Q A;  1K9M 4;  1EKM A;  2OOV A;  3V98 A;  1B2U A;  3HX8 A;  1DYU A;  4FMC A;  3WA3 A;  1T2I A;  2D1W A;  4GHO A;  1RMS A;  3F40 A;  1F8N A;  5ELJ A;  3EN8 A;  3MYT A;  3PS8 A;  3CCQ 3;  3H3H A;  4BTX A;  1NNV A;  1AVL A;  2HMJ B;  1Q40 A;  3SOA A;  1Z1S A;  1YIT 3;  1W01 A;  4NPB A;  3GWR A;  3BND A;  4BIR A;  1IVV A;  3B4O A;  4K90 B;  5IER A;  2SAR A;  4R80 A;  5HOH A;  3CC7 3;  3AHW A;  4DKI A;  3CCE 3;  4N6T A;  3EBT A;  1JZD A;  2ZL8 A;  1IQY A;  3CPW 2;  1UCL A;  1VQ6 3;  3FZW A;  3K9M C;  1FZU A;  3WR2 A;  2CFD A;  1IT8 A;  1JN5 B;  1RNT A;  3F8X A;  5KP3 A;  1X1W A;  1SAR A;  2E2V A;  3NX0 A;  5DRE A;  3RGR A;  1VQN 3;  3BIR A;  3ZG0 A;  5AIG A;  4BTY A;  2OQE C;  3B4P A;  2R41 A;  4BU4 A;  3Q3F A;  3PZW A;  4KFE A;  1YNV X;  1LQM B;  3K7C A;  1C7H A;  2GBW B;  1U5O A;  2F86 B;  3NHX A;  3S67 A;  1A90 A;  1L5G B;  7STD A;  1JBS A;  4WP5 A;  1GD4 A;  3LTA A;  1TRQ A;  4FCM A;  1VQM 3;  1VQ7 3;  1VQ9 3;  4LEH A;  3EJV A;  3N54 B;  3NM2 A;  1LOV A;  1Q7Y 4;  1FUT A;  1W6C A;  3LXU X;  1JRQ A;  2KCD A;  3VGN A;  1GMQ A;  1BNI A;  2QEX 3;  1RGH A;  1I2F A;  2CFK A;  2C10 A;  3PCR A;  2P05 A;  1FW7 A;  3V99 A;  3F9S A;  2CWV A;  3HOH A;  5JBS A;  1QAL A;  2HOH A;  1K41 A;  3IPT A;  4R4K A;  1BSA A;  2M7O A;  3L0R A;  8RNT A;  2Z77 A;  3JUM A;  1IU7 A;  3ROB A;  1AQZ A;  3LYG A;  2IUK A;  4HZB B;  2P09 A;  3CU3 A;  1RJO A;  3SED A;  1G02 A;  2P38 A;  1DE3 A;  3PCS A;  3BLZ A;  3X3Z A;  1RGF A;  5RNT A;  4HBR A;  3UJM A;  2GEY A;  4JRF A;  1M90 4;  3QK9 A;  3WOD G;  1IK3 A;  3CME 3;  3PGB A;  5BIR A;  1JNQ A;  1RRL A;  4OUQ A;  1D6Y A;  1D6Z A;  1LOX A;  3EQQ B;  3NV0 B;  1HZ1 A;  3X40 A;  5IEP A;  1M1X B;  1WMP A;  2O9U X;  3HIG A;  1UUV B;  5FW5 A;  1UCJ A;  5IG5 A;  3ZFZ A;  1TFO A;  1LXE A;  3MG1 A;  1ASK A;  5EQL A;  4KFD A;  5M19 A;  3F14 A;  4G1M B;  3CCL 3;  1JZO A;  1YGW A;  5LC6 A;  3MKI A;  1FGO A;  4OK0 A;  1DMN A;  5CXO A;  3D3L A;  1MWT A;  3OWU A;  3Q90 A;  2BMO B;  3KCH A;  4AKY A;  1S72 3;  1UUG B;  2MC8 A;  1JB5 A;  1CQS A;  1VQ4 3;  1ULI B;  4ORL A;  3D9R A;  1I8V A;  3GZX B;  2CG0 A;  3MPH A;  3JUP A;  4AKZ A;  2XGN A;  3BB9 A;  3OWY A;  3UL6 A;  2AAE A;  2H0I A;  1BRK A;  1KWI A;  4H3U A;  2W56 A;  4MJD A;  2B24 B;  2OQE A;  1LVN A;  5M18 A;  1CEW I;  3BNB A;  2V1L A;  1Y4K A;  2Y73 A;  1W2B 2;  4HM2 B;  3CXC 2;  5IG3 A;  2F4Y A;  1B2Z A;  1M9G A;  1HU9 A;  4WWU C;  1KQS 2;  5D82 A;  3CC4 3;  2Y74 A;  2RSX A;  3DGL A;  1AY7 A;  3FG4 A;  4FMB A;  1BRG A;  2ZHX B;  1BGS A;  1Q42 A;  1TJD A;  2Z76 A;  3MSO A;  1IV7 A;  1NWW A;  3HK4 A;  4MEI A;  1BVI A;  2E2T A;  1I3I A;  1GY5 A;  1W6G A;  2KAA A;  3FKA A;  3JUN A;  2W9P A;  4R9K A;  3URP A;  3I56 3;  1JV2 B;  1ROA A;  2HMO B;  2JDI H;  1O7N B;  1HYF A;  2KXG A;  4FR9 A;  5STD A;  2ML5 A;  1FGQ A;  1BRJ A;  4N6L A;  3J7Y d;  1KD1 4;  4HKV B;  3D5I A;  4EW5 A;  2AAD A;  1RKY A;  1ZO2 A;  1PY3 A;  3B8L A;  3LT8 A;  3AGN A;  2W03 A;  1OHS A;  2STD A;  1BNJ A;  1RCK A;  1WQL B;  5DRV A;  1IYY A;  4CPK A;  1IQX A;  3EBY A;  4HZ9 B;  4J5G A;  4J9A A;  4O02 B;  4O8S A;  3CNX A;  1UUW B;  5HGR A;  5LC7 A;  4HOH A;  3CCS 3;  1GOU A;  2GBX B;  3S27 A;  3WHO A;  1BRS A;  2OCT A;  2O3O A;  5CK6 A;  3LTB A;  6RNT A;  1BNR A; 
#chains in the Genus database with same CATH homology
 2BT3 A;  3OW2 2;  3PYJ A;  1W00 A;  2CC3 A;  2FXT A;  2WGO A;  2WOH A;  2CWT A;  2F99 A;  3KE7 A;  5IF6 A;  6STD A;  3U97 A;  1O7P B;  1LNH A;  3IJE B;  1M1K 4;  3STD A;  1N8Q A;  4QWT A;  3NM7 A;  2XFS A;  5I97 A;  3O8Y A;  1PFP A;  3JUO A;  1O7G B;  1YJ9 3;  3EC9 A;  1GYB A;  4CDL A;  1VZZ A;  3T8U A;  3G0K A;  4K61 A;  2SBL A;  4U13 A;  3EE1 A;  5JPU A;  2OTL 3;  1OHP A;  4K1U A;  4LSO A;  4NHF A;  3EHC A;  2BMQ B;  4WFO A;  2PNC A;  3DMC A;  3KSP A;  3KZT A;  4H61 A;  5IEO A;  3RDE A;  2BO9 B;  2K54 A;  3T0U A;  1R4C A;  1QAF A;  3QRD A;  3KII A;  2CWU A;  2Q07 A;  1IDP A;  3GZB A;  3WA2 X;  1NB3 I;  5EVH A;  2W56 B;  1OCV A;  3DXO A;  2CHC A;  5D83 A;  3KKG A;  2UX0 A;  2OTJ 3;  3V92 A;  4GB5 A;  3IMA B;  2Z6B A;  5AI1 A;  1W5Z A;  1UW1 A;  1ROV A;  4KZ1 A;  1OHO A;  1TFK A;  4KFF A;  4N6V 0;  1W7C A;  3F8H A;  1JB2 A;  1E97 A;  3KN4 A;  1ZX2 A;  1E3V A;  3JUQ A;  3FF0 A;  3NQZ A;  3X3X A;  1IT7 A;  2W0Q A;  1FGT A;  1W2Z A;  3NXJ A;  1JKG A;  3NQY A;  1MNL A;  2LYX A;  2W9Q A;  4LZI A;  4RNY A;  4L8O A;  1QVF 2;  1SJW A;  1V74 A;  2P0M A;  1OF5 A;  2B1X B;  2XH9 A;  5AEW B;  3FH1 A;  4HM4 B;  1O7H B;  3WOE B;  3LTD A;  1A2K A;  1UI7 A;  1PU4 A;  1U8C B;  3FSD A;  3Q1C A;  4Q53 A;  4N6N B;  1K73 4;  1CYV A;  4X2O A;  1E3R A;  4NRE A;  1VQK 3;  1NO3 A;  4O2H A;  1Q40 B;  3U1W A;  2CK3 H;  4JF8 A;  4TX4 A;  3S28 A;  1YVB I;  5KP1 A;  4CCV A;  4K1V A;  2ML6 A;  3FF2 A;  3LT9 A;  3EN1 B;  1WMN A;  2QGU A;  3LOY A;  2WO0 A;  5FGO A;  2CKF B;  2YFJ B;  4LGQ A;  2MF7 A;  4XBY A;  1O7M B;  4HM1 B;  4EV5 A;  3ALA A;  1N5P A;  3UNL A;  1BUQ A;  3PXM A;  2QA4 3;  2HMM B;  4RNZ A;  1ULJ B;  1SII A;  2XR8 B;  1NU3 A;  3H51 A;  3OX9 A;  5G2G A;  5AYS C;  1NB5 I;  2XRX B;  3N9H A;  2XFT A;  1N8R 4;  1N9E A;  3LZA A;  1EA2 A;  3A76 A;  4L7K A;  4R9L A;  5EEO A;  1ISK A;  3GZR A;  2LQV A;  1OPY A;  2WOF A;  1OH0 A;  4MMX B;  5ELU A;  4N6O B;  1SQW A;  3TDG A;  5TGN A;  2E2U A;  4FCJ A;  4N3V A;  1KSI A;  3VF1 A;  4N6U A;  2RCD A;  4XBX A;  4XB5 A;  4IT7 A;  4N6M A;  4KVH A;  4EBG A;  2PZV A;  3LTC A;  1EQK A;  1O7W B;  1N9J A;  2YFI B;  1AVK A;  3F7S A;  3S5C A;  1AV4 A;  1N5H A;  3G6E 3;  5AEU B;  8CHO A;  3WOF B;  2F98 A;  2CFW A;  1JKG B;  4L8P A;  2R4I A;  3SVA A;  3CCR 3;  4O3V A;  4RZM A;  2IMJ A;  1VQ8 3;  3EB8 A;  3G8Z A;  1KC8 4;  3CCV 3;  5CF1 A;  1OF5 B;  3CMA 3;  5CF2 A;  3N8B A;  5D81 A;  1QMA A;  2HMK B;  4OVM A;  1EG9 B;  4XDV A;  2GU3 A;  3CC2 3;  3UL5 A;  5BXQ A;  2I9W A;  3ER7 A;  5AYR B;  1RRH A;  3F7X A;  3GAX A;  1RN7 A;  4WYK A;  4HM7 B;  1YGE A;  2A15 A;  4MMY B;  1CYU A;  2FGT A;  1A67 A;  1OGZ A;  3FGY A;  1US1 A;  2W6J H;  1SIH A;  1GD3 A;  4GL6 A;  4LMI A;  1OUN A;  2CIU A;  2D42 A;  3SOY A;  1STF I;  3HI7 A;  2BHM A;  2HML B;  5BVB A;  1SPU A;  4HM6 B;  1STD A;  1QAK A;  4R1K A;  1FA3 A;  4WHA A;  2L4V A;  3GZY B;  3X3Y A;  4IIA A;  2C11 A;  5AIH A;  1YHQ 3;  4AEQ A;  2IUJ A;  3G4S 3;  3AMO A;  3I55 3;  1YI2 3;  3K63 A;  2CW9 A;  5CLK A;  1DMM A;  2XGL A;  3HZP A;  3EF8 A;  2XF3 A;  1WTH A;  2XSH B;  4STD A;  5A0O B;  5IG4 A;  3HII A;  3I0Y A;  1K8A 4;  3WDG B;  2P0X A;  2INX A;  2CFG A;  3NBB A;  4PEJ A;  1Q82 4;  4XBT A;  3DY5 A;  5JPP A;  2ZDJ A;  3CPO A;  2OWP A;  3JVC A;  3G71 3;  2Z7A A;  3DM8 A;  3DGN A;  3LML A;  2OOV C;  2QIY A;  1JB4 A;  5IW9 A;  4HJL B;  1K28 A;  3KSE D;  2GXF A;  3K5T A;  3FG3 A;  1MOL A;  1WMO A;  4HM3 B;  3CNM A;  1NJI 4;  3OXA A;  2CH9 A;  2FNQ A;  2XSO B;  1GY7 A;  1QJG A;  3CCM 3;  1OAC A;  3WMD A;  3LH4 A;  3FG1 A;  4MMZ B;  2W04 A;  4X2H A;  4IPB A;  1W6Y A;  2CG1 A;  2HMN B;  4HYZ A;  3DGM A;  4EXR A;  2GEX A;  3FCS B;  4XDW A;  1TUH A;  1W02 A;  1TP6 A;  3CCJ 3;  1IVW A;  1JN5 A;  3SXX A;  4HM8 B;  4BTW A;  4EC6 A;  2BMR B;  3SLU A;  1T5Y A;  4EYC A;  1OGX A;  4EV2 A;  3E99 A;  1VQP 3;  4FMA A;  1GS3 A;  1YIJ 3;  1FGM A;  1VQ5 3;  5AII A;  3X41 A;  1J2B A;  1VQL 3;  3T8N A;  1WNH A;  3MWZ A;  1IVX A;  3EX9 A;  4ZM8 A;  1Q81 4;  4FMD A;  3FLJ A;  3ECF A;  2KRT A;  1FUW A;  3OWS A;  3DZL A;  3OV4 A;  4RBN A;  1Q86 4;  4WYK B;  1DVC A;  2RFR A;  5IEN A;  2YX9 A;  5IG0 A;  3SX1 A;  1TU5 A;  2GU1 A;  3BNE A;  3KFQ C;  4HM5 B;  1YJW 3;  3DGO A;  3NBR A;  1FGR A;  1IV9 A;  2JQ5 A;  1IVU A;  1UI8 A;  1IQ8 A;  1YJN 3;  3NUV A;  2CFL A;  1AR0 A;  3MG3 A;  3NBJ A;  3G16 A;  3MHE A;  1G96 A;  1GY6 A;  2BNG A;  3BNC A;  1W4N A;  3MG2 A;  4HM0 B;  3B7C A;  4XM4 A;  1DVD A;  2WGQ A;  3RGA A;  3UB1 A;  2W2C A;  3X42 A;  3M8C A;  3K0Z A;  2RGQ A;  3VSY A;  1D6U A;  3Q2P A;  4FCZ A;  3AMO B;  1NDO B;  2K0M A;  2YFL B;  4J8T A;  1VQO 3;  5KP4 A;  3DUK A;  3GRD A;  2IA7 A;  2XEP A;  1A2V A;  3CCU 3;  1QVG 2;  1JJ2 2;  3NV0 A;  3CD6 3;  5AIF A;  3S29 A;  1DMQ A;  1S5A A;  4HVN A;  1TIJ A;  4I4K A;  1HKX A;  1K9M 4;  1EKM A;  2OOV A;  3V98 A;  3HX8 A;  1DYU A;  4FMC A;  3WA3 A;  2D1W A;  3F40 A;  5ELJ A;  1F8N A;  3EN8 A;  3MYT A;  3PS8 A;  3CCQ 3;  3H3H A;  4BTX A;  1AVL A;  2HMJ B;  1Q40 A;  3SOA A;  1Z1S A;  1YIT 3;  1W01 A;  3GWR A;  3BND A;  1IVV A;  3B4O A;  4K90 B;  5IER A;  4R80 A;  3CC7 3;  3CCE 3;  4N6T A;  3EBT A;  2ZL8 A;  1IQY A;  3CPW 2;  1VQ6 3;  3FZW A;  3K9M C;  2CFD A;  1IT8 A;  1JN5 B;  5KP3 A;  3F8X A;  2E2V A;  3NX0 A;  5DRE A;  3RGR A;  1VQN 3;  5AIG A;  4BTY A;  2OQE C;  3B4P A;  3PZW A;  4KFE A;  3K7C A;  1C7H A;  2GBW B;  1U5O A;  2F86 B;  3NHX A;  3S67 A;  1A90 A;  1L5G B;  7STD A;  4WP5 A;  1GD4 A;  3LTA A;  4FCM A;  1VQM 3;  1VQ7 3;  1VQ9 3;  4LEH A;  3EJV A;  3N54 B;  3NM2 A;  1Q7Y 4;  3LXU X;  1W6C A;  1JRQ A;  2KCD A;  3VGN A;  2QEX 3;  2CFK A;  2C10 A;  3PCR A;  2P05 A;  3V99 A;  3F9S A;  2CWV A;  5JBS A;  1QAL A;  1K41 A;  3IPT A;  4R4K A;  2M7O A;  3L0R A;  2Z77 A;  3JUM A;  1IU7 A;  3ROB A;  3LYG A;  4HZB B;  2IUK A;  2P09 A;  3CU3 A;  1RJO A;  3SED A;  2P38 A;  3PCS A;  3BLZ A;  3X3Z A;  4HBR A;  3UJM A;  2GEY A;  4JRF A;  1M90 4;  3QK9 A;  3WOD G;  1IK3 A;  3CME 3;  3PGB A;  1JNQ A;  1RRL A;  4OUQ A;  1D6Y A;  1D6Z A;  1LOX A;  3EQQ B;  3NV0 B;  3X40 A;  5IEP A;  1M1X B;  1WMP A;  2O9U X;  3HIG A;  1UUV B;  5FW5 A;  5IG5 A;  1TFO A;  1LXE A;  3MG1 A;  1ASK A;  5EQL A;  4KFD A;  3F14 A;  4G1M B;  3CCL 3;  5LC6 A;  3MKI A;  1FGO A;  4OK0 A;  1DMN A;  5CXO A;  3D3L A;  3OWU A;  3Q90 A;  2BMO B;  4AKY A;  1S72 3;  2MC8 A;  1JB5 A;  1CQS A;  1VQ4 3;  1ULI B;  4ORL A;  3D9R A;  3GZX B;  3MPH A;  2CG0 A;  3JUP A;  4AKZ A;  2XGN A;  3BB9 A;  3OWY A;  3UL6 A;  4H3U A;  1KWI A;  2W56 A;  4MJD A;  2B24 B;  2OQE A;  1LVN A;  1CEW I;  3BNB A;  2V1L A;  1Y4K A;  2Y73 A;  1W2B 2;  4HM2 B;  3CXC 2;  5IG3 A;  1M9G A;  1HU9 A;  4WWU C;  1KQS 2;  5D82 A;  3CC4 3;  2Y74 A;  2RSX A;  3DGL A;  3FG4 A;  4FMB A;  1Q42 A;  2Z76 A;  3MSO A;  1IV7 A;  1NWW A;  3HK4 A;  4MEI A;  2E2T A;  1GY5 A;  1W6G A;  3FKA A;  3JUN A;  2W9P A;  4R9K A;  3I56 3;  1JV2 B;  1ROA A;  2HMO B;  2JDI H;  1O7N B;  2KXG A;  4FR9 A;  5STD A;  2ML5 A;  1FGQ A;  4N6L A;  1KD1 4;  3J7Y d;  4HKV B;  1RKY A;  1ZO2 A;  3B8L A;  3LT8 A;  2W03 A;  1OHS A;  2STD A;  1WQL B;  5DRV A;  1IQX A;  3EBY A;  4HZ9 B;  4J9A A;  4O02 B;  4O8S A;  5HGR A;  3CNX A;  1UUW B;  5LC7 A;  3CCS 3;  2GBX B;  3S27 A;  2OCT A;  2O3O A;  5CK6 A;  3LTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...