1Z1SA

Crystal structure of putative isomerase pa3332 from pseudomonas aeruginosa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
NLYFQGHMNAKEILVHSLRLLENGDARGWCDLFHPEGVLEFPYAPPGWKTRFEGRETIWAHMRLFPEHLTVRFTDVQFYETADPDLAIGEFHGDGVATVSGGKLAQDYISVLRTRDGQILLYRDFWNPLRHLEALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical Protein PA3332
publication title Crystal Structure of the Conserved Hypothetical Protein PA3332 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 40
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1z1sA00
2IMJA 2OWPA 1W01A 5AEWB 3M8CA 4HM4B 5KP1A 1GY7A 4HM0B 4XBTA 5IG3A 5AIHA 4XDWA 5KP4A 5BVBA 3JUMA 3OWSA 1NDOB 3CPOA 2YFIB 4HM8B 2B1XB 3VSYA 5JPUA 3FKAA 4WYKB 4R1KA 3HK4A 3EBYA 2F99A 1OF5A 1E97A 1BUQA 2Z77A 4HM1B 1A2KA 3T8NA 1IDPA 2F98A 5D82A 5IG4A 3B8LA 3RGRA 3OXAA 3FLJA 3KE7A 3SEDA 1OGZA 1O7MB 4FCMA 4HJLB 2XR8B 1JN5A 5CXOA 1Q42A 4U13A 2YFLB 3EN1B 4GB5A 1Z1SA 4L8PA 3D9RA 2INXA 3A76A 5HGRA 3I0YA 2BMQB 4FCJA 3SOAA 2QGUA 1O7PB 5IG0A 2I9WA 4H3UA 2HMJB 2BNGA 2XSHB 1GY6A 1JKGB 3F7XA 3GWRA 2RFRA 1OH0A 4XM4A 2BMRB 2PZVA 4RZMA 3F8XA 4XB5A 1NU3A 3MG1A 1OHPA 3F9SA 2Z7AA 5JPPA 3DM8A 3B4OA 5AIFA 4OUQA 1W6YA 3K0ZA 3EN8A 1C7HA 3G0KA 3EF8A 2HMLB 3DZLA 3NUVA 2GXFA 1HKXA 3K7CA 2A15A 3EX9A 2RCDA 3RGAA 3UJMA 1TP6A 5DREA 3B4PA 2BMOB 1EG9B 1Q40A 3CNMA 4J9AA 3T8UA 2GEXA 8CHOA 1TUHA 1QJGA 4STDA 2YFJB 3STDA 3MKIA 1K41A 5AIIA 3Q90A 4WYKA 1OF5B 4HVNA 4HZBB 1ZO2A 3CU3A 3NV0B 1DMNA 1O7NB 1ULIB 3H3HA 1ASKA 3MYTA 4I4KA 3ECFA 4HKVB 5KP3A 4MJDA 1W00A 2Z76A 3MG3A 4J8TA 3BB9A 3H51A 1OHSA 4N3VA 3B7CA 2CHCA 4KVHA 7STDA 2QIYA 2GEYA 4XBXA 4LEHA 3FGYA 2GBWB 1GYBA 1ZX2A 5IEPA 3FH1A 1ULJB 3NXJA 3OX9A 5IG5A 1AR0A 2CKFB 3UNLA 2STDA 4R9LA 3JUOA 4HM6B 4L7KA 5CF2A 2JQ5A 1CQSA 3G8ZA 5AEUB 3CNXA 1OGXA 2HMNB 3DMCA 3HZPA 1EA2A 5EVHA 5AI1A 1E3VA 2B24B 3OV4A 4HM3B 3DUKA 3GZXB 1E3RA 4OVMA 3JUNA 4WP5A 3LZAA 3OWUA 4X2HA 3MHEA 5CLKA 3GZRA 4L8OA 1GS3A 3SOYA 3EC9A 4HM2B 3NM2A 3FF0A 4CDLA 3E99A 3MSOA 3IPTA 1S5AA 1OCVA 2XRXB 3EJVA 1JB5A 1Q40B 3FF2A 4HZ9B 4LGQA 1ISKA 4K1UA 2UX0A 1JB4A 1GY5A 3OWYA 2F86B 4WWUC 1OHOA 5D81A 3JUPA 2W2CA 2GBXB 6STDA 3S5CA 4R9KA 3FZWA 3NV0A 2HMKB 3KKGA 1SJWA 3F40A 1DMQA 3F14A 5CF1A 5G2GA 1OPYA 1JN5B 3EBTA 2K54A 3GZYB 4ORLA 5AIGA 3EHCA 3ER7A 1VZZA 4HM7B 3NBRA 4XBYA 2XSOB 5CK6A 1O7WB 5FW5A 1W02A 3DXOA 3GRDA 3NHXA 1OUNA 3ROBA 5IEOA 1STDA 2HMOB 4IIAA 5IENA 4XDVA 4K1VA 5D83A 3KSPA 3G16A 3WMDA 4HM5B 4PEJA 3KZTA 2RGQA 1JKGA 5BXQA 3FSDA 4LMIA 4Q53A 2HMMB 1UUWB 2R4IA 1O7HB 5IF6A 1DMMA 1WQLB 3F8HA 3MG2A 3F7SA 5TGNA 3EQQB 4X2OA 3JUQA 3GZBA 3HX8A 1O7GB 1UUVB 3BLZA 1QMAA 3LYGA 1U5OA 5DRVA 5STDA 3VGNA 5IERA 1JB2A 1NWWA
chains in the Genus database with same CATH superfamily
2IMJA 3VF1A 2OWPA 2BU4A 1EKMA 4KT3B 4AKYA 1B20A 1W01A 5AEWB 1FA3A 2PNCA 3M8CA 4MMYB 3V98A 2OOVA 4HM4B 1PU4A 5GSPA 5KP1A 1GY7A 2WO0A 4HM0B 1KD14 1M1K4 1I3IA 2C10A 2ZHXB 3KSED 1FZUA 1JBTA 1BRNL 4XBTA 1LNHA 5IG3A 1RGCA 5AIHA 4XDWA 1RRHA 2CFGA 3CCQ3 5KP4A 1K8A4 3CC43 3AGOA 5BVBA 2CW9A 1FGTA 3JUMA 1QAKA 3OWSA 1MGWA 2AAEA 1UCLA 1NDOB 3CPOA 2YFIB 1PYLA 2SBLA 4HM8B 4IPBA 3CCL3 2B1XB 2H0HA 3U97A 3VSYA 5JPUA 3WODG 3X40A 3FKAA 1IQ8A 2CG1A 1WMNA 1NNVA 2Y74A 1BSDA 1VQM3 4G1MB 1GOUA 4WYKB 4R1KA 3HK4A 2CWTA 3EBYA 4FMCA 1UUGB 2F99A 3Q1CA 2CX0A 2H0IA 1BSAA 1WNHA 1OF5A 1K734 2XFSA 3LTAA 1E97A 1BUQA 3SXXA 2D1WA 3V92A 2Z77A 1TIJA 4HM1B 1YHQ3 1A2KA 1LOVA 3HI7A 4JF8A 2OQEA 3T8NA 1YJ93 1JNQA 1RNTA 4BL3A 1IDPA 2F98A 4H61A 1JBSA 5D82A 5RNTA 4RNZA 5IG4A 1VQP3 3B8LA 1BSEA 1FUTA 3DY5A 1MWRA 3RGRA 3OXAA 1RNBA 3FLJA 3JVCA 2IUJA 1RJOA 3FG3A 3X3ZA 3KE7A 1CH0A 3SEDA 1W4NA 2V1LA 3NBJA 1OGZA 3HOHA 1MNLA 1RN4A 1O7MB 2CWVA 3AMOB 1KC84 4FCMA 1W2B2 4J5KA 4LZIA 1NB3I 4ILFA 2W56B 4HJLB 4RNTA 4AKZA 2XR8B 2M7OA 1BNEA 1B2XA 1AV4A 1YJW3 1RGEA 3BNEA 5HOHA 3LTBA 1BSBA 1JN5A 5CXOA 1Q42A 4BL2A 1N5HA 4U13A 1WMPA 2YFLB 5I97A 1BNFA 2C11A 3LTCA 2RBIA 1HYFA 2CIUA 1IVWA 3EN1B 4GB5A 3WR2A 4EW5A 1Z1SA 4EXRA 1RLSA 4L8PA 2KF4A 2QA43 1CYVA 3J7Yd 4WHAA 3CXC2 4DKIA 3D9RA 2MC8A 2INXA 1HU9A 2P0MA 2OCTA 3A76A 5HGRA 3I0YA 4GHOA 1RGGA 1IV9A 3KIIA 4AEQA 2YX9A 4EV2A 2BMQB 4FCJA 4HAAA 1VQ63 1R4CA 3D5IA 3K63A 3SOAA 2QGUA 1VQ93 1O7PB 5JBSA 1A90A 1LQMB 5IG0A 3WOEB 1PFPA 1V74A 2O9UX 1IVXA 1VQN3 1D6UA 4NHFA 4O8SA 4EYCA 1K9M4 2I9WA 4H3UA 4FCZA 2GSPA 2HMJB 2KRTA 1L5GB 2BNGA 1KQS2 2XSHB 1GY6A 4R4KA 3TDGA 1JKGB 1UGHI 1LNIA 2W9QA 4WFOA 1U8CB 3G6E3 2L1SA 2ZA4A 3G4S3 3F7XA 3MWZA 1RDSA 3PCSA 2W0QA 3GWRA 1W6CA 3BNDA 2P38A 2RFRA 2F5WA 1B21A 1BRIA 1OH0A 4XM4A 3CPW2 3CD63 1BU4A 2BMRB 2ZL8A 1BUJA 2E2VA 2CH9A 1YVSA 2W9PA 1TTOA 2PZVA 4BTWA 4QWTA 4RZMA 1TRQA 1BIRA 1MOLA 4HBRA 1YNVX 1RSNA 3F8XA 3PCRA 1FGQA 5EQLA 3N8BA 4XB5A 1VQ73 1NU3A 3MG1A 1OHPA 3CC23 5M19A 1RMSA 4EV5A 1N8QA 3F9SA 3WA3A 1KWIA 1UCKA 4N6OB 1EEJA 2E2UA 2Z7AA 1BRJA 3DM8A 5JPPA 3B4OA 1RHLA 5BIRA 1YGEA 1R4YA 3SLUA 5AIFA 1RGHA 2IUKA 4OUQA 1W6YA 1RKYA 1JRQA 2KAAA 3K0ZA 3EN8A 1C7HA 3G0KA 3D5GA 2CX1A 3EF8A 2HMLB 3DZLA 3NM7A 1RN1A 2BIRA 1BNSA 3NUVA 1BNJA 1STFI 3AMOA 1C54A 2GXFA 3NX0A 1UGIA 1HKXA 2R41A 4CCVA 1BNGA 3K7CA 1SQWA 2A15A 1BOXA 3EX9A 4RBNA 2RCDA 5EEOA 3RGAA 3UB1A 1W7CA 1A2VA 1BRSA 1W6GA 1N9EA 2W6JH 5FGOA 3UJMA 1VQO3 1TP6A 1I3FA 5DREA 1YIJ3 3Q3FA 1BNRA 1DE3A 3SX1A 1BANA 3B4PA 1EQKA 1VQ53 6RNTA 2BMOB 3S27A 1EG9B 1Q40A 3CNMA 3FG1A 2XH9A 4J9AA 3T8UA 1K28A 1UI7A 2GEXA 5IERA 1CEWI 2D42A 8CHOA 3CCE3 2C4BA 1IQYA 1TUHA 3PYJA 1QJGA 4STDA 7RNTA 2YFJB 1A67A 3DH2A 3STDA 1G0TA 5G1LA 3MKIA 1RN7A 1K41A 2F4YA 5AIIA 1M904 3CME3 1G02A 2BO9B 3Q90A 4WYKA 2UUGC 5IW9A 1OF5B 4HVNA 4MMXB 1B2SA 3ZG0A 1RGLA 4HZBB 3MPHA 3I553 1ZO2A 3CU3A 3O8YA 1LRAA 1DMNA 1O7NB 3NV0B 4NREA 1ULIB 3SYUA 1BAOA 3H3HA 5M18A 3FG4A 1IU7A 1ASKA 3MYTA 1GMRA 1I0XA 4FMAA 4I5QA 3IMAB 4I4KA 4MEIA 3ECFA 4HKVB 5KP3A 1OACA 4MJDA 4EBGA 1W00A 1SIHA 2K3DA 2Z76A 1G96A 1B2ZA 3RDEA 1SIIA 1IVVA 1RGFA 3MG3A 3K5TA 4K61A 6GSPA 3K9MC 2XGNA 3X3XA 1AVLA 3ALAA 1A2PA 4J8TA 3BB9A 3H51A 1OHSA 5LC7A 4N3VA 3X3YA 3AGNA 4N6NB 3B7CA 2CHCA 3S67A 4KVHA 1PY3A 1RCLA 3BU4A 1TRPA 3LXUX 3SVAA 2OOVC 7STDA 1BRGA 2QIYA 3I563 2GEYA 4XBXA 1JJ22 3ZG5A 4LEHA 1VQ83 2P05A 2W03A 4EC6A 1MWSA 1FYSA 3FGYA 3PZWA 3WOFB 1D6ZA 1M1XB 2GBWB 2O3OA 3WA2X 2F5MA 2ML6A 1GYBA 5ELJA 1ZX2A 3ZFZA 1D6YA 5IEPA 4N6V0 3CCJ3 2RSXA 1UCJA 3FH1A 1ULJB 3NXJA 4HOHA 3OX9A 1RRLA 5IG5A 1AR0A 2CKFB 3UNLA 3V99A 1IYYA 1Q824 1V57A 2RNTA 2STDA 3BIRA 4KFDA 4R9LA 1WMOA 4TX4A 5BU4A 2L4VA 3JUOA 4HM6B 4L7KA 5CF2A 2JQ5A 1TU5A 1QVF2 1CQSA 3G8ZA 5AEUB 2ZDJA 3CNXA 1OGXA 3LH4A 1BSCA 2HMNB 1F8NA 3DMCA 1Q864 2CG0A 3HZPA 1EA2A 1FUWA 1ZGXA 7GSPA 3CMA3 1JBRA 1X1WA 1GSPA 5EVHA 3NBBA 1GOVA 1JV2B 5AI1A 1E3VA 1MWUA 3D3LA 4FR9A 2B24B 3AHWA 1B3SA 1DETA 3CCM3 4HYZA 1VQK3 5AYRB 3Q2PA 3OV4A 4HM3B 2OQEC 3A5EA 3PXMA 4ZM8A 1VQQA 1T5YA 3DUKA 1N8R4 3PGBA 3GZXB 3LMLA 1E3RA 3EE1A 4OVMA 4BTYA 1IVUA 1RGAA 1UW1A 1RCKA 3JUNA 4WP5A 1IK3A 2P0XA 1GMQA 3LZAA 3OWUA 4X2HA 3MHEA 1DYUA 1SARA 5CLKA 1Q9EA 4IT7A 2J8XB 2XEPA 1EUIC 3UL5A 1X1UA 3DGOA 2QEX3 3GZRA 4L8OA 9RNTA 1GS3A 2CWUA 3IJEB 4OK0A 1FGRA 1TFKA 3SOYA 2GU1A 3EC9A 4BU4A 1IV7A 4KFFA 5AYSC 1AVKA 1Q7Y4 1B2UA 3CC73 1MGRA 1BGSA 3X42A 1GD3A 2F56A 4FMDA 1GD4A 1US1A 8RNTA 1I2FA 4HM2B 3NM2A 3FF0A 1SPUA 1LOXA 1BRHA 2WOFA 3LOYA 4CDLA 1QALA 5A0OB 1T3BA 3D79A 3E99A 4FMBA 3N54B 1MWTA 1QVG2 3MSOA 3IPTA 3NQZA 2HOHA 1TFOA 1AY7A 1S5AA 2Y73A 4KFEA 3UL6A 1OCVA 2Q07A 2XRXB 3EJVA 4MMZB 1JB5A 1Q40B 1GOYA 1LOYA 3RNTA 3FF2A 4O3VA 3EB8A 4N6UA 4N6LA 4HZ9B 4LGQA 1VQ43 1ISKA 1BRKA 1Q814 4K1UA 2UX0A 4LYLB 3FCSB 1JB4A 3AHSA 1GY5A 1IQXA 3OWYA 1DVCA 4CPKA 1T2HA 2OTJ3 3N9HA 2F86B 1BVIA 1I0VA 2H0GA 3L0RA 2LQVA 3LTDA 3DGYA 4WWUC 1OHOA 1YI23 5D81A 2FGTA 1RGKA 1W5ZA 3JUPA 1Y4KA 1FGMA 1IT7A 2GBXB 2W2CA 6STDA 3BNBA 2XF3A 1LXEA 2IA7A 4R9KA 3S5CA 4J5GA 1ROVA 1JZDA 1X1YA 3FZWA 3NV0A 3WDGB 3CCS3 1T2IA 2HMKB 3KKGA 1ROAA 1SJWA 1FGOA 2JDIH 4KZ1A 1TJDA 3F40A 3GAXA 3PS8A 1KSIA 1NO3A 2BHMA 1DMQA 3DGLA 3F14A 1W2ZA 4GL6A 4JRFA 2FNQA 5CF1A 3U1WA 2W56A 2XGLA 5G1KA 1RTUA 2E2TA 1JN5B 1OPYA 2FXTA 3EBTA 5G2GA 3CCR3 1M9GA 2K54A 3LT8A 4BTXA 1QAFA 3GZYB 4ORLA 5AIGA 3EHCA 1I8VA 3ER7A 1VZZA 3QK9A 5M1AA 1WTHA 1FUSA 2KCDA 3NBRA 1ZS7A 2XSOB 4GSPA 4HM7B 1O7WB 4O02B 4XBYA 3KN4A 5CK6A 5FW5A 3WHOA 1W02A 2LYXA 3DXOA 1CYUA 2CC3A 3GRDA 2WGOA 4BIRA 3NHXA 3S29A 1YIT3 2BT3A 1S723 1OUNA 2KXGA 2SARA 2KF3A 3ROBA 1LQGC 2WGQA 3T0UA 5IEOA 2GU3A 1STDA 2HMOB 4IIAA 5IENA 1IT8A 3CCU3 2K0MA 4XDVA 1X1XA 4K1VA 5D83A 1N5PA 1FW7A 3KSPA 3G16A 1N9JA 3CCV3 3WMDA 1I70A 1HZ1A 1UCIA 2KF5A 3HIIA 4LSOA 4R80A 1B27A 1JZOA 2CFLA 4HM5B 2CFWA 4N6TA 2OTL3 1YGWA 1YVBI 3OW22 3KFQC 2CFKA 3KZTA 2RGQA 4PEJA 2P09A 1JKGA 1LOWA 5BXQA 3FSDA 2AADA 1UI8A 1YJN3 4LMIA 1B2MA 4Q53A 4K90B 2HMMB 3QRDA 1NB5I 1Q7HA 4O2HA 1UUWB 3BNCA 5ELUA 2XFTA 1UDII 1BNIA 2R4IA 2WOHA 1O7HB 2CK3H 2MF7A 5IF6A 2W04A 1DVDA 1DMMA 2IY2A 1WQLB 3F8HA 2Z6BA 3F7SA 1LVNA 3MG2A 4NPBA 5TGNA 3DGNA 3EQQB 4X2OA 3LT9A 4RNYA 3NQYA 3JUQA 3GZBA 3HX8A 3X41A 3G713 2KF6A 3HIGA 1V58A 1GMPA 2UGIA 1O7GB 2IYJA 4CJNA 1UUVB 1VQL3 3KCHA 3S28A 3BLZA 2ML5A 4N6MA 1QMAA 1AQZA 3DGMA 3LYGA 1J2BA 1U5OA 2CFDA 3D4AA 5DRVA 5STDA 3GSPA 5LC6A 1NJI4 3VGNA 1I2EA 1I2GA 3URPA 1JB2A 1NWWA
chains in the Genus database with same CATH topology
2IMJA 3VF1A 2OWPA 1EKMA 4AKYA 1W01A 5AEWB 1FA3A 2PNCA 3M8CA 4MMYB 3V98A 2OOVA 4HM4B 1PU4A 5KP1A 1GY7A 2WO0A 4HM0B 1KD14 1M1K4 2C10A 3KSED 4XBTA 1LNHA 5IG3A 5AIHA 4XDWA 1RRHA 2CFGA 3CCQ3 5KP4A 1K8A4 3CC43 5BVBA 2CW9A 1FGTA 3JUMA 1QAKA 3OWSA 1NDOB 3CPOA 2YFIB 2SBLA 4HM8B 4IPBA 3CCL3 2B1XB 3U97A 3VSYA 5JPUA 3WODG 3X40A 3FKAA 1IQ8A 2CG1A 1WMNA 2Y74A 1VQM3 4G1MB 4WYKB 4R1KA 3HK4A 2CWTA 3EBYA 4FMCA 2F99A 3Q1CA 1WNHA 1OF5A 1K734 2XFSA 3LTAA 1E97A 1BUQA 3SXXA 2D1WA 3V92A 2Z77A 1TIJA 4HM1B 1YHQ3 1A2KA 3HI7A 4JF8A 2OQEA 3T8NA 1YJ93 1JNQA 1IDPA 2F98A 4H61A 5D82A 4RNZA 5IG4A 1VQP3 3B8LA 3DY5A 3RGRA 3OXAA 3FLJA 3JVCA 2IUJA 1RJOA 3FG3A 3X3ZA 3KE7A 3SEDA 1W4NA 2V1LA 3NBJA 1OGZA 1MNLA 1KC84 1O7MB 2CWVA 4FCMA 1W2B2 4LZIA 1NB3I 2W56B 4HJLB 4AKZA 2XR8B 2M7OA 1AV4A 1YJW3 3BNEA 3LTBA 1JN5A 5CXOA 1Q42A 1N5HA 4U13A 1WMPA 2YFLB 5I97A 2C11A 3LTCA 2CIUA 1IVWA 3EN1B 4GB5A 4EXRA 1Z1SA 4L8PA 2QA43 1CYVA 3J7Yd 4WHAA 3CXC2 3D9RA 2MC8A 2INXA 1HU9A 2P0MA 2OCTA 3A76A 5HGRA 3I0YA 1IV9A 3KIIA 4AEQA 2YX9A 4EV2A 2BMQB 4FCJA 1VQ63 1R4CA 3K63A 3SOAA 2QGUA 1VQ93 1O7PB 5JBSA 1A90A 5IG0A 3WOEB 1PFPA 1V74A 2O9UX 1IVXA 1VQN3 1D6UA 4NHFA 4O8SA 4EYCA 1K9M4 2I9WA 4H3UA 4FCZA 2HMJB 2KRTA 1L5GB 2BNGA 1KQS2 2XSHB 1GY6A 4R4KA 3TDGA 1JKGB 2W9QA 4WFOA 1U8CB 3G6E3 3G4S3 3F7XA 3MWZA 3PCSA 2W0QA 3GWRA 1W6CA 3BNDA 2P38A 2RFRA 1OH0A 4XM4A 3CPW2 3CD63 2ZL8A 2BMRB 2E2VA 2CH9A 2W9PA 4BTWA 2PZVA 4QWTA 4RZMA 1MOLA 4HBRA 5EQLA 3F8XA 3PCRA 1FGQA 3N8BA 4XB5A 1VQ73 1NU3A 3MG1A 1OHPA 3CC23 4EV5A 1N8QA 3F9SA 3WA3A 1KWIA 4N6OB 2E2UA 2Z7AA 5JPPA 3DM8A 3B4OA 1YGEA 3SLUA 5AIFA 2IUKA 4OUQA 1W6YA 1RKYA 1JRQA 3K0ZA 3EN8A 1C7HA 3G0KA 3EF8A 2HMLB 3DZLA 3NM7A 3NUVA 1STFI 3AMOA 2GXFA 3NX0A 1HKXA 4CCVA 3K7CA 1SQWA 2A15A 3EX9A 4RBNA 2RCDA 5EEOA 3RGAA 3UB1A 1W7CA 1A2VA 1N9EA 1W6GA 2W6JH 5FGOA 1VQO3 3UJMA 1YIJ3 1TP6A 5DREA 3SX1A 3B4PA 1EQKA 1VQ53 2BMOB 3S27A 1EG9B 1Q40A 3CNMA 3FG1A 2XH9A 4J9AA 3T8UA 1K28A 1UI7A 2GEXA 5IERA 1CEWI 2D42A 8CHOA 3CCE3 1IQYA 1TUHA 3PYJA 1QJGA 4STDA 2YFJB 1A67A 3STDA 3MKIA 1RN7A 1K41A 5AIIA 1M904 3CME3 2BO9B 3Q90A 4WYKA 5IW9A 1OF5B 4HVNA 4MMXB 4HZBB 3MPHA 3I553 1ZO2A 3CU3A 3O8YA 3NV0B 1DMNA 1O7NB 4NREA 1ULIB 3H3HA 3FG4A 1IU7A 1ASKA 3MYTA 4FMAA 3IMAB 4I4KA 4MEIA 3ECFA 4HKVB 5KP3A 1OACA 4MJDA 4EBGA 1W00A 2Z76A 1SIHA 1G96A 3RDEA 1SIIA 1IVVA 3MG3A 4K61A 3K5TA 3K9MC 2XGNA 3X3XA 1AVLA 3ALAA 4J8TA 3BB9A 3H51A 1OHSA 5LC7A 4N3VA 3X3YA 4N6NB 3B7CA 2CHCA 3S67A 4KVHA 3LXUX 3SVAA 2OOVC 7STDA 2QIYA 3I563 2GEYA 4XBXA 1JJ22 4LEHA 1VQ83 2P05A 2W03A 4EC6A 3FGYA 3PZWA 3WOFB 1D6ZA 1M1XB 2GBWB 2O3OA 3WA2X 2ML6A 1GYBA 5ELJA 1ZX2A 3CCJ3 1D6YA 5IEPA 4N6V0 2RSXA 3FH1A 1ULJB 3NXJA 3OX9A 1RRLA 5IG5A 1AR0A 2CKFB 3UNLA 3V99A 1Q824 4TX4A 2STDA 4KFDA 4R9LA 1WMOA 1TU5A 2L4VA 3JUOA 4HM6B 4L7KA 5CF2A 2JQ5A 1QVF2 1CQSA 3G8ZA 5AEUB 2ZDJA 3CNXA 1OGXA 3LH4A 2HMNB 1F8NA 3DMCA 1Q864 2CG0A 3HZPA 1EA2A 1FUWA 3CMA3 5EVHA 3NBBA 1JV2B 5AI1A 1E3VA 3D3LA 4FR9A 2B24B 3CCM3 4HYZA 1VQK3 5AYRB 3Q2PA 3OV4A 4HM3B 2OQEC 3PXMA 4ZM8A 1T5YA 3DUKA 1N8R4 3PGBA 3GZXB 3LMLA 1E3RA 3EE1A 4OVMA 4BTYA 1IVUA 1UW1A 3JUNA 4WP5A 1IK3A 2P0XA 3LZAA 3OWUA 4X2HA 3MHEA 1DYUA 5CLKA 4IT7A 2XEPA 2QEX3 3UL5A 3DGOA 3GZRA 4L8OA 1GS3A 2CWUA 3IJEB 4OK0A 1FGRA 1TFKA 3SOYA 2GU1A 3EC9A 1IV7A 4KFFA 5AYSC 1AVKA 1Q7Y4 3CC73 3X42A 1GD3A 4FMDA 1GD4A 1US1A 4HM2B 3NM2A 3FF0A 1SPUA 1LOXA 2WOFA 3LOYA 4CDLA 1QALA 5A0OB 3E99A 4FMBA 3N54B 1QVG2 3MSOA 3IPTA 3NQZA 1TFOA 4KFEA 1S5AA 2Y73A 3UL6A 1OCVA 2Q07A 2XRXB 3EJVA 4MMZB 1JB5A 1Q40B 3FF2A 4O3VA 3EB8A 4N6UA 4N6LA 4HZ9B 4LGQA 1VQ43 1ISKA 1Q814 4K1UA 2UX0A 3FCSB 1JB4A 1IQXA 1GY5A 3OWYA 1DVCA 2OTJ3 3N9HA 2F86B 3L0RA 2LQVA 3LTDA 4WWUC 1OHOA 1YI23 5D81A 2FGTA 1W5ZA 3JUPA 1Y4KA 1FGMA 1IT7A 2GBXB 2W2CA 6STDA 3BNBA 2XF3A 1LXEA 2IA7A 4R9KA 3S5CA 1ROVA 3FZWA 3CCS3 3NV0A 3WDGB 2HMKB 3KKGA 1ROAA 1SJWA 1FGOA 2JDIH 4KZ1A 3F40A 3GAXA 3PS8A 1KSIA 1NO3A 2BHMA 1DMQA 3DGLA 3F14A 1W2ZA 4GL6A 4JRFA 2FNQA 5CF1A 3U1WA 2W56A 2XGLA 2E2TA 1JN5B 1OPYA 2FXTA 3EBTA 5G2GA 3CCR3 1M9GA 2K54A 3LT8A 4BTXA 1QAFA 3GZYB 4ORLA 5AIGA 3EHCA 3ER7A 1VZZA 3QK9A 1WTHA 2KCDA 3NBRA 4HM7B 2XSOB 4O02B 4XBYA 5CK6A 1O7WB 5FW5A 3KN4A 1W02A 2LYXA 3DXOA 1CYUA 2CC3A 3GRDA 2WGOA 3NHXA 3S29A 1YIT3 2BT3A 1S723 1OUNA 2KXGA 3ROBA 2WGQA 3T0UA 5IEOA 2GU3A 1STDA 2HMOB 4IIAA 5IENA 1IT8A 3CCU3 2K0MA 4XDVA 4K1VA 5D83A 1N5PA 3KSPA 3G16A 1N9JA 3CCV3 3WMDA 3HIIA 4LSOA 4R80A 2CFLA 4HM5B 2CFWA 4N6TA 2OTL3 1YVBI 3OW22 3KFQC 2CFKA 3KZTA 2RGQA 4PEJA 2P09A 1JKGA 5BXQA 3FSDA 1UI8A 1YJN3 4LMIA 4Q53A 4K90B 2HMMB 3QRDA 1NB5I 4O2HA 1UUWB 3BNCA 5ELUA 2XFTA 2R4IA 2WOHA 1O7HB 2CK3H 2MF7A 5IF6A 2W04A 1DVDA 1DMMA 1WQLB 3F8HA 2Z6BA 3F7SA 1LVNA 3MG2A 5TGNA 3DGNA 3EQQB 4X2OA 3LT9A 4RNYA 3NQYA 3JUQA 3GZBA 3HX8A 3X41A 3G713 3HIGA 1O7GB 1UUVB 1VQL3 3S28A 3BLZA 2ML5A 4N6MA 1QMAA 3DGMA 3LYGA 1J2BA 1U5OA 2CFDA 5DRVA 5STDA 5LC6A 1NJI4 3VGNA 3AMOB 1JB2A 1NWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMJ A;  2OWP A;  1W01 A;  5AEW B;  3M8C A;  4HM4 B;  5KP1 A;  1GY7 A;  4HM0 B;  4XBT A;  5IG3 A;  5AIH A;  4XDW A;  5KP4 A;  5BVB A;  3JUM A;  3OWS A;  1NDO B;  3CPO A;  2YFI B;  4HM8 B;  2B1X B;  3VSY A;  5JPU A;  3FKA A;  4WYK B;  4R1K A;  3HK4 A;  3EBY A;  2F99 A;  1OF5 A;  1E97 A;  1BUQ A;  2Z77 A;  4HM1 B;  1A2K A;  3T8N A;  1IDP A;  2F98 A;  5D82 A;  5IG4 A;  3B8L A;  3RGR A;  3OXA A;  3FLJ A;  3KE7 A;  3SED A;  1OGZ A;  1O7M B;  4FCM A;  4HJL B;  2XR8 B;  1JN5 A;  5CXO A;  1Q42 A;  4U13 A;  2YFL B;  3EN1 B;  4GB5 A;  1Z1S A;  4L8P A;  3D9R A;  2INX A;  3A76 A;  5HGR A;  3I0Y A;  2BMQ B;  4FCJ A;  3SOA A;  2QGU A;  1O7P B;  5IG0 A;  2I9W A;  4H3U A;  2HMJ B;  2BNG A;  2XSH B;  1GY6 A;  1JKG B;  3F7X A;  3GWR A;  2RFR A;  1OH0 A;  4XM4 A;  2BMR B;  2PZV A;  4RZM A;  3F8X A;  4XB5 A;  1NU3 A;  3MG1 A;  1OHP A;  3F9S A;  2Z7A A;  5JPP A;  3DM8 A;  3B4O A;  5AIF A;  4OUQ A;  1W6Y A;  3K0Z A;  3EN8 A;  1C7H A;  3G0K A;  3EF8 A;  2HML B;  3DZL A;  3NUV A;  2GXF A;  1HKX A;  3K7C A;  2A15 A;  3EX9 A;  2RCD A;  3RGA A;  3UJM A;  1TP6 A;  5DRE A;  3B4P A;  2BMO B;  1EG9 B;  1Q40 A;  3CNM A;  4J9A A;  3T8U A;  2GEX A;  8CHO A;  1TUH A;  1QJG A;  4STD A;  2YFJ B;  3STD A;  3MKI A;  1K41 A;  5AII A;  3Q90 A;  4WYK A;  1OF5 B;  4HVN A;  4HZB B;  1ZO2 A;  3CU3 A;  3NV0 B;  1DMN A;  1O7N B;  1ULI B;  3H3H A;  1ASK A;  3MYT A;  4I4K A;  3ECF A;  4HKV B;  5KP3 A;  4MJD A;  1W00 A;  2Z76 A;  3MG3 A;  4J8T A;  3BB9 A;  3H51 A;  1OHS A;  4N3V A;  3B7C A;  2CHC A;  4KVH A;  7STD A;  2QIY A;  2GEY A;  4XBX A;  4LEH A;  3FGY A;  2GBW B;  1GYB A;  1ZX2 A;  5IEP A;  3FH1 A;  1ULJ B;  3NXJ A;  3OX9 A;  5IG5 A;  1AR0 A;  2CKF B;  3UNL A;  2STD A;  4R9L A;  3JUO A;  4HM6 B;  4L7K A;  5CF2 A;  2JQ5 A;  1CQS A;  3G8Z A;  5AEU B;  3CNX A;  1OGX A;  2HMN B;  3DMC A;  3HZP A;  1EA2 A;  5EVH A;  5AI1 A;  1E3V A;  2B24 B;  3OV4 A;  4HM3 B;  3DUK A;  3GZX B;  1E3R A;  4OVM A;  3JUN A;  4WP5 A;  3LZA A;  3OWU A;  4X2H A;  3MHE A;  5CLK A;  3GZR A;  4L8O A;  1GS3 A;  3SOY A;  3EC9 A;  4HM2 B;  3NM2 A;  3FF0 A;  4CDL A;  3E99 A;  3MSO A;  3IPT A;  1S5A A;  1OCV A;  2XRX B;  3EJV A;  1JB5 A;  1Q40 B;  3FF2 A;  4HZ9 B;  4LGQ A;  1ISK A;  4K1U A;  2UX0 A;  1JB4 A;  1GY5 A;  3OWY A;  2F86 B;  4WWU C;  1OHO A;  5D81 A;  3JUP A;  2W2C A;  2GBX B;  6STD A;  3S5C A;  4R9K A;  3FZW A;  3NV0 A;  2HMK B;  3KKG A;  1SJW A;  3F40 A;  1DMQ A;  3F14 A;  5CF1 A;  5G2G A;  1OPY A;  1JN5 B;  3EBT A;  2K54 A;  3GZY B;  4ORL A;  5AIG A;  3EHC A;  3ER7 A;  1VZZ A;  4HM7 B;  3NBR A;  4XBY A;  2XSO B;  5CK6 A;  1O7W B;  5FW5 A;  1W02 A;  3DXO A;  3GRD A;  3NHX A;  1OUN A;  3ROB A;  5IEO A;  1STD A;  2HMO B;  4IIA A;  5IEN A;  4XDV A;  4K1V A;  5D83 A;  3KSP A;  3G16 A;  3WMD A;  4HM5 B;  4PEJ A;  3KZT A;  2RGQ A;  1JKG A;  5BXQ A;  3FSD A;  4LMI A;  4Q53 A;  2HMM B;  1UUW B;  2R4I A;  1O7H B;  5IF6 A;  1DMM A;  1WQL B;  3F8H A;  3MG2 A;  3F7S A;  5TGN A;  3EQQ B;  4X2O A;  3JUQ A;  3GZB A;  3HX8 A;  1O7G B;  1UUV B;  3BLZ A;  1QMA A;  3LYG A;  1U5O A;  5DRV A;  5STD A;  3VGN A;  5IER A;  1JB2 A;  1NWW A; 
#chains in the Genus database with same CATH topology
 2IMJ A;  3VF1 A;  2OWP A;  2BU4 A;  1EKM A;  4KT3 B;  4AKY A;  1B20 A;  1W01 A;  5AEW B;  1FA3 A;  2PNC A;  3M8C A;  4MMY B;  3V98 A;  2OOV A;  4HM4 B;  1PU4 A;  5GSP A;  5KP1 A;  1GY7 A;  2WO0 A;  4HM0 B;  1KD1 4;  1M1K 4;  1I3I A;  2C10 A;  2ZHX B;  3KSE D;  1FZU A;  1JBT A;  1BRN L;  4XBT A;  1LNH A;  5IG3 A;  1RGC A;  5AIH A;  4XDW A;  1RRH A;  2CFG A;  3CCQ 3;  5KP4 A;  1K8A 4;  3CC4 3;  3AGO A;  5BVB A;  2CW9 A;  1FGT A;  3JUM A;  1QAK A;  3OWS A;  1MGW A;  2AAE A;  1UCL A;  1NDO B;  3CPO A;  2YFI B;  1PYL A;  2SBL A;  4HM8 B;  4IPB A;  3CCL 3;  2B1X B;  2H0H A;  3U97 A;  3VSY A;  5JPU A;  3WOD G;  3X40 A;  3FKA A;  1IQ8 A;  2CG1 A;  1WMN A;  1NNV A;  2Y74 A;  1BSD A;  1VQM 3;  4G1M B;  1GOU A;  4WYK B;  4R1K A;  3HK4 A;  2CWT A;  3EBY A;  4FMC A;  1UUG B;  2F99 A;  3Q1C A;  2CX0 A;  2H0I A;  1BSA A;  1WNH A;  1OF5 A;  1K73 4;  2XFS A;  3LTA A;  1E97 A;  1BUQ A;  3SXX A;  2D1W A;  3V92 A;  2Z77 A;  1TIJ A;  4HM1 B;  1YHQ 3;  1A2K A;  1LOV A;  3HI7 A;  4JF8 A;  2OQE A;  3T8N A;  1YJ9 3;  1JNQ A;  1RNT A;  4BL3 A;  1IDP A;  2F98 A;  4H61 A;  1JBS A;  5D82 A;  5RNT A;  4RNZ A;  5IG4 A;  1VQP 3;  3B8L A;  1BSE A;  1FUT A;  3DY5 A;  1MWR A;  3RGR A;  3OXA A;  1RNB A;  3FLJ A;  3JVC A;  2IUJ A;  1RJO A;  3FG3 A;  3X3Z A;  3KE7 A;  1CH0 A;  3SED A;  1W4N A;  2V1L A;  3NBJ A;  1OGZ A;  3HOH A;  1MNL A;  1RN4 A;  1O7M B;  2CWV A;  3AMO B;  1KC8 4;  4FCM A;  1W2B 2;  4J5K A;  4LZI A;  1NB3 I;  4ILF A;  2W56 B;  4HJL B;  4RNT A;  4AKZ A;  2XR8 B;  2M7O A;  1BNE A;  1B2X A;  1AV4 A;  1YJW 3;  1RGE A;  3BNE A;  5HOH A;  3LTB A;  1BSB A;  1JN5 A;  5CXO A;  1Q42 A;  4BL2 A;  1N5H A;  4U13 A;  1WMP A;  2YFL B;  5I97 A;  1BNF A;  2C11 A;  3LTC A;  2RBI A;  1HYF A;  2CIU A;  1IVW A;  3EN1 B;  4GB5 A;  3WR2 A;  4EW5 A;  1Z1S A;  4EXR A;  1RLS A;  4L8P A;  2KF4 A;  2QA4 3;  1CYV A;  3J7Y d;  4WHA A;  3CXC 2;  4DKI A;  3D9R A;  2MC8 A;  2INX A;  1HU9 A;  2P0M A;  2OCT A;  3A76 A;  5HGR A;  3I0Y A;  4GHO A;  1RGG A;  1IV9 A;  3KII A;  4AEQ A;  2YX9 A;  4EV2 A;  2BMQ B;  4FCJ A;  4HAA A;  1VQ6 3;  1R4C A;  3D5I A;  3K63 A;  3SOA A;  2QGU A;  1VQ9 3;  1O7P B;  5JBS A;  1A90 A;  1LQM B;  5IG0 A;  3WOE B;  1PFP A;  1V74 A;  2O9U X;  1IVX A;  1VQN 3;  1D6U A;  4NHF A;  4O8S A;  4EYC A;  1K9M 4;  2I9W A;  4H3U A;  4FCZ A;  2GSP A;  2HMJ B;  2KRT A;  1L5G B;  2BNG A;  1KQS 2;  2XSH B;  1GY6 A;  4R4K A;  3TDG A;  1JKG B;  1UGH I;  1LNI A;  2W9Q A;  4WFO A;  1U8C B;  3G6E 3;  2L1S A;  2ZA4 A;  3G4S 3;  3F7X A;  3MWZ A;  1RDS A;  3PCS A;  2W0Q A;  3GWR A;  1W6C A;  3BND A;  2P38 A;  2RFR A;  2F5W A;  1B21 A;  1BRI A;  1OH0 A;  4XM4 A;  3CPW 2;  3CD6 3;  1BU4 A;  2BMR B;  2ZL8 A;  1BUJ A;  2E2V A;  2CH9 A;  1YVS A;  2W9P A;  1TTO A;  2PZV A;  4BTW A;  4QWT A;  4RZM A;  1TRQ A;  1BIR A;  1MOL A;  4HBR A;  1YNV X;  1RSN A;  3F8X A;  3PCR A;  1FGQ A;  5EQL A;  3N8B A;  4XB5 A;  1VQ7 3;  1NU3 A;  3MG1 A;  1OHP A;  3CC2 3;  5M19 A;  1RMS A;  4EV5 A;  1N8Q A;  3F9S A;  3WA3 A;  1KWI A;  1UCK A;  4N6O B;  1EEJ A;  2E2U A;  2Z7A A;  1BRJ A;  3DM8 A;  5JPP A;  3B4O A;  1RHL A;  5BIR A;  1YGE A;  1R4Y A;  3SLU A;  5AIF A;  1RGH A;  2IUK A;  4OUQ A;  1W6Y A;  1RKY A;  1JRQ A;  2KAA A;  3K0Z A;  3EN8 A;  1C7H A;  3G0K A;  3D5G A;  2CX1 A;  3EF8 A;  2HML B;  3DZL A;  3NM7 A;  1RN1 A;  2BIR A;  1BNS A;  3NUV A;  1BNJ A;  1STF I;  3AMO A;  1C54 A;  2GXF A;  3NX0 A;  1UGI A;  1HKX A;  2R41 A;  4CCV A;  1BNG A;  3K7C A;  1SQW A;  2A15 A;  1BOX A;  3EX9 A;  4RBN A;  2RCD A;  5EEO A;  3RGA A;  3UB1 A;  1W7C A;  1A2V A;  1BRS A;  1W6G A;  1N9E A;  2W6J H;  5FGO A;  3UJM A;  1VQO 3;  1TP6 A;  1I3F A;  5DRE A;  1YIJ 3;  3Q3F A;  1BNR A;  1DE3 A;  3SX1 A;  1BAN A;  3B4P A;  1EQK A;  1VQ5 3;  6RNT A;  2BMO B;  3S27 A;  1EG9 B;  1Q40 A;  3CNM A;  3FG1 A;  2XH9 A;  4J9A A;  3T8U A;  1K28 A;  1UI7 A;  2GEX A;  5IER A;  1CEW I;  2D42 A;  8CHO A;  3CCE 3;  2C4B A;  1IQY A;  1TUH A;  3PYJ A;  1QJG A;  4STD A;  7RNT A;  2YFJ B;  1A67 A;  3DH2 A;  3STD A;  1G0T A;  5G1L A;  3MKI A;  1RN7 A;  1K41 A;  2F4Y A;  5AII A;  1M90 4;  3CME 3;  1G02 A;  2BO9 B;  3Q90 A;  4WYK A;  2UUG C;  5IW9 A;  1OF5 B;  4HVN A;  4MMX B;  1B2S A;  3ZG0 A;  1RGL A;  4HZB B;  3MPH A;  3I55 3;  1ZO2 A;  3CU3 A;  3O8Y A;  1LRA A;  1DMN A;  1O7N B;  3NV0 B;  4NRE A;  1ULI B;  3SYU A;  1BAO A;  3H3H A;  5M18 A;  3FG4 A;  1IU7 A;  1ASK A;  3MYT A;  1GMR A;  1I0X A;  4FMA A;  4I5Q A;  3IMA B;  4I4K A;  4MEI A;  3ECF A;  4HKV B;  5KP3 A;  1OAC A;  4MJD A;  4EBG A;  1W00 A;  1SIH A;  2K3D A;  2Z76 A;  1G96 A;  1B2Z A;  3RDE A;  1SII A;  1IVV A;  1RGF A;  3MG3 A;  3K5T A;  4K61 A;  6GSP A;  3K9M C;  2XGN A;  3X3X A;  1AVL A;  3ALA A;  1A2P A;  4J8T A;  3BB9 A;  3H51 A;  1OHS A;  5LC7 A;  4N3V A;  3X3Y A;  3AGN A;  4N6N B;  3B7C A;  2CHC A;  3S67 A;  4KVH A;  1PY3 A;  1RCL A;  3BU4 A;  1TRP A;  3LXU X;  3SVA A;  2OOV C;  7STD A;  1BRG A;  2QIY A;  3I56 3;  2GEY A;  4XBX A;  1JJ2 2;  3ZG5 A;  4LEH A;  1VQ8 3;  2P05 A;  2W03 A;  4EC6 A;  1MWS A;  1FYS A;  3FGY A;  3PZW A;  3WOF B;  1D6Z A;  1M1X B;  2GBW B;  2O3O A;  3WA2 X;  2F5M A;  2ML6 A;  1GYB A;  5ELJ A;  1ZX2 A;  3ZFZ A;  1D6Y A;  5IEP A;  4N6V 0;  3CCJ 3;  2RSX A;  1UCJ A;  3FH1 A;  1ULJ B;  3NXJ A;  4HOH A;  3OX9 A;  1RRL A;  5IG5 A;  1AR0 A;  2CKF B;  3UNL A;  3V99 A;  1IYY A;  1Q82 4;  1V57 A;  2RNT A;  2STD A;  3BIR A;  4KFD A;  4R9L A;  1WMO A;  4TX4 A;  5BU4 A;  2L4V A;  3JUO A;  4HM6 B;  4L7K A;  5CF2 A;  2JQ5 A;  1TU5 A;  1QVF 2;  1CQS A;  3G8Z A;  5AEU B;  2ZDJ A;  3CNX A;  1OGX A;  3LH4 A;  1BSC A;  2HMN B;  1F8N A;  3DMC A;  1Q86 4;  2CG0 A;  3HZP A;  1EA2 A;  1FUW A;  1ZGX A;  7GSP A;  3CMA 3;  1JBR A;  1X1W A;  1GSP A;  5EVH A;  3NBB A;  1GOV A;  1JV2 B;  5AI1 A;  1E3V A;  1MWU A;  3D3L A;  4FR9 A;  2B24 B;  3AHW A;  1B3S A;  1DET A;  3CCM 3;  4HYZ A;  1VQK 3;  5AYR B;  3Q2P A;  3OV4 A;  4HM3 B;  2OQE C;  3A5E A;  3PXM A;  4ZM8 A;  1VQQ A;  1T5Y A;  3DUK A;  1N8R 4;  3PGB A;  3GZX B;  3LML A;  1E3R A;  3EE1 A;  4OVM A;  4BTY A;  1IVU A;  1RGA A;  1UW1 A;  1RCK A;  3JUN A;  4WP5 A;  1IK3 A;  2P0X A;  1GMQ A;  3LZA A;  3OWU A;  4X2H A;  3MHE A;  1DYU A;  1SAR A;  5CLK A;  1Q9E A;  4IT7 A;  2J8X B;  2XEP A;  1EUI C;  3UL5 A;  1X1U A;  3DGO A;  2QEX 3;  3GZR A;  4L8O A;  9RNT A;  1GS3 A;  2CWU A;  3IJE B;  4OK0 A;  1FGR A;  1TFK A;  3SOY A;  2GU1 A;  3EC9 A;  4BU4 A;  1IV7 A;  4KFF A;  5AYS C;  1AVK A;  1Q7Y 4;  1B2U A;  3CC7 3;  1MGR A;  1BGS A;  3X42 A;  1GD3 A;  2F56 A;  4FMD A;  1GD4 A;  1US1 A;  8RNT A;  1I2F A;  4HM2 B;  3NM2 A;  3FF0 A;  1SPU A;  1LOX A;  1BRH A;  2WOF A;  3LOY A;  4CDL A;  1QAL A;  5A0O B;  1T3B A;  3D79 A;  3E99 A;  4FMB A;  3N54 B;  1MWT A;  1QVG 2;  3MSO A;  3IPT A;  3NQZ A;  2HOH A;  1TFO A;  1AY7 A;  1S5A A;  2Y73 A;  4KFE A;  3UL6 A;  1OCV A;  2Q07 A;  2XRX B;  3EJV A;  4MMZ B;  1JB5 A;  1Q40 B;  1GOY A;  1LOY A;  3RNT A;  3FF2 A;  4O3V A;  3EB8 A;  4N6U A;  4N6L A;  4HZ9 B;  4LGQ A;  1VQ4 3;  1ISK A;  1BRK A;  1Q81 4;  4K1U A;  2UX0 A;  4LYL B;  3FCS B;  1JB4 A;  3AHS A;  1GY5 A;  1IQX A;  3OWY A;  1DVC A;  4CPK A;  1T2H A;  2OTJ 3;  3N9H A;  2F86 B;  1BVI A;  1I0V A;  2H0G A;  3L0R A;  2LQV A;  3LTD A;  3DGY A;  4WWU C;  1OHO A;  1YI2 3;  5D81 A;  2FGT A;  1RGK A;  1W5Z A;  3JUP A;  1Y4K A;  1FGM A;  1IT7 A;  2GBX B;  2W2C A;  6STD A;  3BNB A;  2XF3 A;  1LXE A;  2IA7 A;  4R9K A;  3S5C A;  4J5G A;  1ROV A;  1JZD A;  1X1Y A;  3FZW A;  3NV0 A;  3WDG B;  3CCS 3;  1T2I A;  2HMK B;  3KKG A;  1ROA A;  1SJW A;  1FGO A;  2JDI H;  4KZ1 A;  1TJD A;  3F40 A;  3GAX A;  3PS8 A;  1KSI A;  1NO3 A;  2BHM A;  1DMQ A;  3DGL A;  3F14 A;  1W2Z A;  4GL6 A;  4JRF A;  2FNQ A;  5CF1 A;  3U1W A;  2W56 A;  2XGL A;  5G1K A;  1RTU A;  2E2T A;  1JN5 B;  1OPY A;  2FXT A;  3EBT A;  5G2G A;  3CCR 3;  1M9G A;  2K54 A;  3LT8 A;  4BTX A;  1QAF A;  3GZY B;  4ORL A;  5AIG A;  3EHC A;  1I8V A;  3ER7 A;  1VZZ A;  3QK9 A;  5M1A A;  1WTH A;  1FUS A;  2KCD A;  3NBR A;  1ZS7 A;  2XSO B;  4GSP A;  4HM7 B;  1O7W B;  4O02 B;  4XBY A;  3KN4 A;  5CK6 A;  5FW5 A;  3WHO A;  1W02 A;  2LYX A;  3DXO A;  1CYU A;  2CC3 A;  3GRD A;  2WGO A;  4BIR A;  3NHX A;  3S29 A;  1YIT 3;  2BT3 A;  1S72 3;  1OUN A;  2KXG A;  2SAR A;  2KF3 A;  3ROB A;  1LQG C;  2WGQ A;  3T0U A;  5IEO A;  2GU3 A;  1STD A;  2HMO B;  4IIA A;  5IEN A;  1IT8 A;  3CCU 3;  2K0M A;  4XDV A;  1X1X A;  4K1V A;  5D83 A;  1N5P A;  1FW7 A;  3KSP A;  3G16 A;  1N9J A;  3CCV 3;  3WMD A;  1I70 A;  1HZ1 A;  1UCI A;  2KF5 A;  3HII A;  4LSO A;  4R80 A;  1B27 A;  1JZO A;  2CFL A;  4HM5 B;  2CFW A;  4N6T A;  2OTL 3;  1YGW A;  1YVB I;  3OW2 2;  3KFQ C;  2CFK A;  3KZT A;  2RGQ A;  4PEJ A;  2P09 A;  1JKG A;  1LOW A;  5BXQ A;  3FSD A;  2AAD A;  1UI8 A;  1YJN 3;  4LMI A;  1B2M A;  4Q53 A;  4K90 B;  2HMM B;  3QRD A;  1NB5 I;  1Q7H A;  4O2H A;  1UUW B;  3BNC A;  5ELU A;  2XFT A;  1UDI I;  1BNI A;  2R4I A;  2WOH A;  1O7H B;  2CK3 H;  2MF7 A;  5IF6 A;  2W04 A;  1DVD A;  1DMM A;  2IY2 A;  1WQL B;  3F8H A;  2Z6B A;  3F7S A;  1LVN A;  3MG2 A;  4NPB A;  5TGN A;  3DGN A;  3EQQ B;  4X2O A;  3LT9 A;  4RNY A;  3NQY A;  3JUQ A;  3GZB A;  3HX8 A;  3X41 A;  3G71 3;  2KF6 A;  3HIG A;  1V58 A;  1GMP A;  2UGI A;  1O7G B;  2IYJ A;  4CJN A;  1UUV B;  1VQL 3;  3KCH A;  3S28 A;  3BLZ A;  2ML5 A;  4N6M A;  1QMA A;  1AQZ A;  3DGM A;  3LYG A;  1J2B A;  1U5O A;  2CFD A;  3D4A A;  5DRV A;  5STD A;  3GSP A;  5LC6 A;  1NJI 4;  3VGN A;  1I2E A;  1I2G A;  3URP A;  1JB2 A;  1NWW A; 
#chains in the Genus database with same CATH homology
 2IMJ A;  3VF1 A;  2OWP A;  1EKM A;  4AKY A;  1W01 A;  5AEW B;  1FA3 A;  2PNC A;  3M8C A;  4MMY B;  3V98 A;  2OOV A;  4HM4 B;  1PU4 A;  5KP1 A;  1GY7 A;  2WO0 A;  4HM0 B;  1KD1 4;  1M1K 4;  2C10 A;  3KSE D;  4XBT A;  1LNH A;  5IG3 A;  5AIH A;  4XDW A;  1RRH A;  2CFG A;  3CCQ 3;  5KP4 A;  1K8A 4;  3CC4 3;  5BVB A;  2CW9 A;  1FGT A;  3JUM A;  1QAK A;  3OWS A;  1NDO B;  3CPO A;  2YFI B;  2SBL A;  4HM8 B;  4IPB A;  3CCL 3;  2B1X B;  3U97 A;  3VSY A;  5JPU A;  3WOD G;  3X40 A;  3FKA A;  1IQ8 A;  2CG1 A;  1WMN A;  2Y74 A;  1VQM 3;  4G1M B;  4WYK B;  4R1K A;  3HK4 A;  2CWT A;  3EBY A;  4FMC A;  2F99 A;  3Q1C A;  1WNH A;  1OF5 A;  1K73 4;  2XFS A;  3LTA A;  1E97 A;  1BUQ A;  3SXX A;  2D1W A;  3V92 A;  2Z77 A;  1TIJ A;  4HM1 B;  1YHQ 3;  1A2K A;  3HI7 A;  4JF8 A;  2OQE A;  3T8N A;  1YJ9 3;  1JNQ A;  1IDP A;  2F98 A;  4H61 A;  5D82 A;  4RNZ A;  5IG4 A;  1VQP 3;  3B8L A;  3DY5 A;  3RGR A;  3OXA A;  3FLJ A;  3JVC A;  2IUJ A;  1RJO A;  3FG3 A;  3X3Z A;  3KE7 A;  3SED A;  1W4N A;  2V1L A;  3NBJ A;  1OGZ A;  1MNL A;  1KC8 4;  1O7M B;  2CWV A;  4FCM A;  1W2B 2;  4LZI A;  1NB3 I;  2W56 B;  4HJL B;  4AKZ A;  2XR8 B;  2M7O A;  1AV4 A;  1YJW 3;  3BNE A;  3LTB A;  1JN5 A;  5CXO A;  1Q42 A;  1N5H A;  4U13 A;  1WMP A;  2YFL B;  5I97 A;  2C11 A;  3LTC A;  2CIU A;  1IVW A;  3EN1 B;  4GB5 A;  4EXR A;  1Z1S A;  4L8P A;  2QA4 3;  1CYV A;  3J7Y d;  4WHA A;  3CXC 2;  3D9R A;  2MC8 A;  2INX A;  1HU9 A;  2P0M A;  2OCT A;  3A76 A;  5HGR A;  3I0Y A;  1IV9 A;  3KII A;  4AEQ A;  2YX9 A;  4EV2 A;  2BMQ B;  4FCJ A;  1VQ6 3;  1R4C A;  3K63 A;  3SOA A;  2QGU A;  1VQ9 3;  1O7P B;  5JBS A;  1A90 A;  5IG0 A;  3WOE B;  1PFP A;  1V74 A;  2O9U X;  1IVX A;  1VQN 3;  1D6U A;  4NHF A;  4O8S A;  4EYC A;  1K9M 4;  2I9W A;  4H3U A;  4FCZ A;  2HMJ B;  2KRT A;  1L5G B;  2BNG A;  1KQS 2;  2XSH B;  1GY6 A;  4R4K A;  3TDG A;  1JKG B;  2W9Q A;  4WFO A;  1U8C B;  3G6E 3;  3G4S 3;  3F7X A;  3MWZ A;  3PCS A;  2W0Q A;  3GWR A;  1W6C A;  3BND A;  2P38 A;  2RFR A;  1OH0 A;  4XM4 A;  3CPW 2;  3CD6 3;  2ZL8 A;  2BMR B;  2E2V A;  2CH9 A;  2W9P A;  4BTW A;  2PZV A;  4QWT A;  4RZM A;  1MOL A;  4HBR A;  5EQL A;  3F8X A;  3PCR A;  1FGQ A;  3N8B A;  4XB5 A;  1VQ7 3;  1NU3 A;  3MG1 A;  1OHP A;  3CC2 3;  4EV5 A;  1N8Q A;  3F9S A;  3WA3 A;  1KWI A;  4N6O B;  2E2U A;  2Z7A A;  5JPP A;  3DM8 A;  3B4O A;  1YGE A;  3SLU A;  5AIF A;  2IUK A;  4OUQ A;  1W6Y A;  1RKY A;  1JRQ A;  3K0Z A;  3EN8 A;  1C7H A;  3G0K A;  3EF8 A;  2HML B;  3DZL A;  3NM7 A;  3NUV A;  1STF I;  3AMO A;  2GXF A;  3NX0 A;  1HKX A;  4CCV A;  3K7C A;  1SQW A;  2A15 A;  3EX9 A;  4RBN A;  2RCD A;  5EEO A;  3RGA A;  3UB1 A;  1W7C A;  1A2V A;  1N9E A;  1W6G A;  2W6J H;  5FGO A;  1VQO 3;  3UJM A;  1YIJ 3;  1TP6 A;  5DRE A;  3SX1 A;  3B4P A;  1EQK A;  1VQ5 3;  2BMO B;  3S27 A;  1EG9 B;  1Q40 A;  3CNM A;  3FG1 A;  2XH9 A;  4J9A A;  3T8U A;  1K28 A;  1UI7 A;  2GEX A;  5IER A;  1CEW I;  2D42 A;  8CHO A;  3CCE 3;  1IQY A;  1TUH A;  3PYJ A;  1QJG A;  4STD A;  2YFJ B;  1A67 A;  3STD A;  3MKI A;  1RN7 A;  1K41 A;  5AII A;  1M90 4;  3CME 3;  2BO9 B;  3Q90 A;  4WYK A;  5IW9 A;  1OF5 B;  4HVN A;  4MMX B;  4HZB B;  3MPH A;  3I55 3;  1ZO2 A;  3CU3 A;  3O8Y A;  3NV0 B;  1DMN A;  1O7N B;  4NRE A;  1ULI B;  3H3H A;  3FG4 A;  1IU7 A;  1ASK A;  3MYT A;  4FMA A;  3IMA B;  4I4K A;  4MEI A;  3ECF A;  4HKV B;  5KP3 A;  1OAC A;  4MJD A;  4EBG A;  1W00 A;  2Z76 A;  1SIH A;  1G96 A;  3RDE A;  1SII A;  1IVV A;  3MG3 A;  4K61 A;  3K5T A;  3K9M C;  2XGN A;  3X3X A;  1AVL A;  3ALA A;  4J8T A;  3BB9 A;  3H51 A;  1OHS A;  5LC7 A;  4N3V A;  3X3Y A;  4N6N B;  3B7C A;  2CHC A;  3S67 A;  4KVH A;  3LXU X;  3SVA A;  2OOV C;  7STD A;  2QIY A;  3I56 3;  2GEY A;  4XBX A;  1JJ2 2;  4LEH A;  1VQ8 3;  2P05 A;  2W03 A;  4EC6 A;  3FGY A;  3PZW A;  3WOF B;  1D6Z A;  1M1X B;  2GBW B;  2O3O A;  3WA2 X;  2ML6 A;  1GYB A;  5ELJ A;  1ZX2 A;  3CCJ 3;  1D6Y A;  5IEP A;  4N6V 0;  2RSX A;  3FH1 A;  1ULJ B;  3NXJ A;  3OX9 A;  1RRL A;  5IG5 A;  1AR0 A;  2CKF B;  3UNL A;  3V99 A;  1Q82 4;  4TX4 A;  2STD A;  4KFD A;  4R9L A;  1WMO A;  1TU5 A;  2L4V A;  3JUO A;  4HM6 B;  4L7K A;  5CF2 A;  2JQ5 A;  1QVF 2;  1CQS A;  3G8Z A;  5AEU B;  2ZDJ A;  3CNX A;  1OGX A;  3LH4 A;  2HMN B;  1F8N A;  3DMC A;  1Q86 4;  2CG0 A;  3HZP A;  1EA2 A;  1FUW A;  3CMA 3;  5EVH A;  3NBB A;  1JV2 B;  5AI1 A;  1E3V A;  3D3L A;  4FR9 A;  2B24 B;  3CCM 3;  4HYZ A;  1VQK 3;  5AYR B;  3Q2P A;  3OV4 A;  4HM3 B;  2OQE C;  3PXM A;  4ZM8 A;  1T5Y A;  3DUK A;  1N8R 4;  3PGB A;  3GZX B;  3LML A;  1E3R A;  3EE1 A;  4OVM A;  4BTY A;  1IVU A;  1UW1 A;  3JUN A;  4WP5 A;  1IK3 A;  2P0X A;  3LZA A;  3OWU A;  4X2H A;  3MHE A;  1DYU A;  5CLK A;  4IT7 A;  2XEP A;  2QEX 3;  3UL5 A;  3DGO A;  3GZR A;  4L8O A;  1GS3 A;  2CWU A;  3IJE B;  4OK0 A;  1FGR A;  1TFK A;  3SOY A;  2GU1 A;  3EC9 A;  1IV7 A;  4KFF A;  5AYS C;  1AVK A;  1Q7Y 4;  3CC7 3;  3X42 A;  1GD3 A;  4FMD A;  1GD4 A;  1US1 A;  4HM2 B;  3NM2 A;  3FF0 A;  1SPU A;  1LOX A;  2WOF A;  3LOY A;  4CDL A;  1QAL A;  5A0O B;  3E99 A;  4FMB A;  3N54 B;  1QVG 2;  3MSO A;  3IPT A;  3NQZ A;  1TFO A;  4KFE A;  1S5A A;  2Y73 A;  3UL6 A;  1OCV A;  2Q07 A;  2XRX B;  3EJV A;  4MMZ B;  1JB5 A;  1Q40 B;  3FF2 A;  4O3V A;  3EB8 A;  4N6U A;  4N6L A;  4HZ9 B;  4LGQ A;  1VQ4 3;  1ISK A;  1Q81 4;  4K1U A;  2UX0 A;  3FCS B;  1JB4 A;  1IQX A;  1GY5 A;  3OWY A;  1DVC A;  2OTJ 3;  3N9H A;  2F86 B;  3L0R A;  2LQV A;  3LTD A;  4WWU C;  1OHO A;  1YI2 3;  5D81 A;  2FGT A;  1W5Z A;  3JUP A;  1Y4K A;  1FGM A;  1IT7 A;  2GBX B;  2W2C A;  6STD A;  3BNB A;  2XF3 A;  1LXE A;  2IA7 A;  4R9K A;  3S5C A;  1ROV A;  3FZW A;  3CCS 3;  3NV0 A;  3WDG B;  2HMK B;  3KKG A;  1ROA A;  1SJW A;  1FGO A;  2JDI H;  4KZ1 A;  3F40 A;  3GAX A;  3PS8 A;  1KSI A;  1NO3 A;  2BHM A;  1DMQ A;  3DGL A;  3F14 A;  1W2Z A;  4GL6 A;  4JRF A;  2FNQ A;  5CF1 A;  3U1W A;  2W56 A;  2XGL A;  2E2T A;  1JN5 B;  1OPY A;  2FXT A;  3EBT A;  5G2G A;  3CCR 3;  1M9G A;  2K54 A;  3LT8 A;  4BTX A;  1QAF A;  3GZY B;  4ORL A;  5AIG A;  3EHC A;  3ER7 A;  1VZZ A;  3QK9 A;  1WTH A;  2KCD A;  3NBR A;  4HM7 B;  2XSO B;  4O02 B;  4XBY A;  5CK6 A;  1O7W B;  5FW5 A;  3KN4 A;  1W02 A;  2LYX A;  3DXO A;  1CYU A;  2CC3 A;  3GRD A;  2WGO A;  3NHX A;  3S29 A;  1YIT 3;  2BT3 A;  1S72 3;  1OUN A;  2KXG A;  3ROB A;  2WGQ A;  3T0U A;  5IEO A;  2GU3 A;  1STD A;  2HMO B;  4IIA A;  5IEN A;  1IT8 A;  3CCU 3;  2K0M A;  4XDV A;  4K1V A;  5D83 A;  1N5P A;  3KSP A;  3G16 A;  1N9J A;  3CCV 3;  3WMD A;  3HII A;  4LSO A;  4R80 A;  2CFL A;  4HM5 B;  2CFW A;  4N6T A;  2OTL 3;  1YVB I;  3OW2 2;  3KFQ C;  2CFK A;  3KZT A;  2RGQ A;  4PEJ A;  2P09 A;  1JKG A;  5BXQ A;  3FSD A;  1UI8 A;  1YJN 3;  4LMI A;  4Q53 A;  4K90 B;  2HMM B;  3QRD A;  1NB5 I;  4O2H A;  1UUW B;  3BNC A;  5ELU A;  2XFT A;  2R4I A;  2WOH A;  1O7H B;  2CK3 H;  2MF7 A;  5IF6 A;  2W04 A;  1DVD A;  1DMM A;  1WQL B;  3F8H A;  2Z6B A;  3F7S A;  1LVN A;  3MG2 A;  5TGN A;  3DGN A;  3EQQ B;  4X2O A;  3LT9 A;  4RNY A;  3NQY A;  3JUQ A;  3GZB A;  3HX8 A;  3X41 A;  3G71 3;  3HIG A;  1O7G B;  1UUV B;  1VQL 3;  3S28 A;  3BLZ A;  2ML5 A;  4N6M A;  1QMA A;  3DGM A;  3LYG A;  1J2B A;  1U5O A;  2CFD A;  5DRV A;  5STD A;  5LC6 A;  1NJI 4;  3VGN A;  3AMO B;  1JB2 A;  1NWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...