4FR9A

Crystal structure of a blip-like protein (bf1215) from bacteroides fragilis nctc 9343 at 1.20 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
141
structure length
133
Chain Sequence
DDDTGYLPPSQAIQDALLYPNATAIWEQGVYYVADCQADGREEVWFDANANWLMTETELNSINNLPPAVLTAFMESSYNNWVVDDVVILEYPNEPSTEFVVTVEQGVDLYFSEGGGLLHEDVTNGDDTHWPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BF1215) from Bacteroides fragilis NCTC 9343 at 1.20 A resolution
rcsb
source organism Bacteroides fragilis
total genus 24
structure length 133
sequence length 141
ec nomenclature
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11396 PepSY_like Putative beta-lactamase-inhibitor-like, PepSY-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.360 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4fr9A00
3U1WA 4FR9A 4K61A 4IPBA 4HBRA
chains in the Genus database with same CATH superfamily
3N54B 3UB1A 8RNTA 1I70A 2GXFA 4IPBA 3LTBA 1FYSA 3G0KA 1ROVA 1RRHA 3PZWA 3CPOA 3N9HA 4HM4B 1BSDA 2B24B 1OH0A 3MG2A 4R4KA 3FLJA 2WGOA 3ZFZA 1FGTA 3IPTA 3ECFA 1Q9EA 1FGRA 5IENA 2WOHA 4NHFA 3LYGA 1A2KA 1TU5A 1AR0A 1BNFA 2CFLA 1W02A 3QK9A 1OGZA 2HMJB 1IVUA 1M904 2C11A 3X3ZA 1TUHA 1IVWA 2HMKB 4FCZA 4XBXA 2C4BA 4GSPA 5FGOA 4EBGA 3EBYA 3TDGA 1DVCA 3BNCA 1K8A4 3NHXA 3X41A 4R9KA 3SLUA 1YNVX 2GSPA 3DGOA 3WOFB 5IG3A 3CCJ3 1QMAA 3SVAA 3U1WA 7GSPA 3CXC2 3B4OA 1O7NB 3M8CA 3UL5A 3UNLA 3DUKA 1FUTA 3I0YA 3RNTA 1C54A 1JKGB 3NQYA 1QALA 4AKYA 4LEHA 1JB2A 2XR8B 2XF3A 3JUOA 2SBLA 1Z1SA 1JZOA 3G8ZA 4Q53A 1QJGA 1B27A 2D42A 3EF8A 2CG0A 2IMJA 4LGQA 1IVVA 5KP1A 2OTJ3 2ML6A 1B3SA 3ALAA 3HIIA 4HAAA 4ORLA 1ROAA 4U13A 1EQKA 3STDA 4EC6A 1CYVA 1O7MB 2A15A 1K28A 4EV5A 3FF2A 2W56B 1RN4A 5BXQA 1GSPA 4OUQA 1BNJA 2CH9A 1BNIA 3X40A 1D6ZA 1RGHA 1WMPA 3DM8A 4I5QA 5ELJA 5M1AA 1LOWA 1W2ZA 3ZG5A 3CPW2 1EUIC 1YIJ3 1BUJA 4N6UA 3S27A 4O2HA 2GBWB 3NUVA 1US1A 4NPBA 3G4S3 1EG9B 5GSPA 1SARA 3V99A 4FMBA 2RSXA 5IW9A 3X42A 1V57A 2W2CA 4R1KA 2INXA 4X2OA 2I9WA 4HZ9B 4BU4A 3LOYA 3EB8A 3DMCA 2L1SA 5EQLA 3EE1A 1B21A 1O7WB 3NBRA 5IG0A 1HZ1A 2IY2A 1JBSA 1VQ93 2PZVA 1RNTA 4WYKB 1RN1A 3AMOB 3L0RA 1F8NA 3J7Yd 1DYUA 3OX9A 1M9GA 2HMLB 2CWUA 2HOHA 4HJLB 5D81A 5EVHA 5IF6A 1U5OA 4WHAA 2QIYA 5LC7A 1BNRA 4CPKA 5AYRB 1BSAA 1YJ93 1YJN3 5LC6A 2XFTA 2IA7A 1X1WA 4O02B 3VGNA 1FZUA 3PS8A 3WODG 3BU4A 4O3VA 1NWWA 3SXXA 1LOXA 1RNBA 3X3YA 1CYUA 1GY7A 2AADA 4OK0A 1BNEA 1W6YA 1AY7A 4N6NB 1LQMB 3KSED 2O9UX 4N6TA 4XBYA 1VQ73 3EN8A 3OW22 3DGMA 1B2SA 3O8YA 1E97A 3ROBA 1DMMA 3LT9A 3FH1A 3K0ZA 1T2HA 1JNQA 6RNTA 1VQN3 2OQEA 5M19A 2P38A 2UGIA 3CC73 3UL6A 3MG1A 3DGYA 1B2XA 4HZBB 4IIAA 5KP4A 3KSPA 2GBXB 1OF5A 5M18A 2BMRB 2E2VA 3DY5A 4BTYA 2E2TA 4LZIA 2W9PA 2XSOB 1ULIB 4HM1B 1L5GB 3ZG0A 1S5AA 4K61A 5AYSC 5A0OB 1DMNA 2XGNA 4HOHA 1UUWB 3FG1A 3E99A 2KXGA 3QRDA 2FGTA 4EXRA 2O3OA 2UX0A 4BIRA 4N6OB 1BRSA 1YHQ3 3FCSB 2ZDJA 3VSYA 1OUNA 1STFI 1TFKA 1KD14 1RRLA 1FUWA 2Z76A 4MMYB 3SOAA 1EKMA 2C10A 2CWVA 5IERA 1KC84 3NX0A 2H0IA 4O8SA 2H0HA 1JBTA 1D6YA 4HM6B 3CCL3 3CNMA 3S28A 1UI7A 2F5WA 2RNTA 1O7PB 1W6GA 1VQ53 1UUVB 3WA2X 2KRTA 5AIFA 4FCMA 2XSHB 2YFIB 3DGNA 5AIIA 3KZTA 4JRFA 4N6V0 1UCLA 4XBTA 1VQ43 1FGQA 2W03A 1I2FA 2PNCA 1D6UA 4ILFA 4R80A 1YIT3 1E3RA 2STDA 1E3VA 1RGFA 3JUMA 4RNYA 1RGGA 3AGOA 3K7CA 1MOLA 1NNVA 3OV4A 3RDEA 5CF1A 4KFDA 2ZA4A 1S723 1Q824 3WDGB 3KN4A 4ZM8A 1V58A 2F99A 3BB9A 3BNDA 4RNZA 3LTCA 3VF1A 3I553 1X1UA 3FZWA 1UCIA 3MSOA 1WNHA 3WOEB 4AKZA 3NV0B 1OCVA 5IG5A 1JJ22 2HMOB 1N9EA 3V92A 1JN5B 1DE3A 1MGRA 5JBSA 3EC9A 5CXOA 3I563 1LOVA 1MWTA 3F8HA 2AAEA 4N6LA 5G2GA 3CU3A 4HM2B 1IDPA 1K41A 3HK4A 1EA2A 1WMNA 1UI8A 1TIJA 3B7CA 3BNBA 3Q3FA 1YVBI 4HKVB 3BIRA 4R9LA 1CEWI 1GMQA 2BT3A 3IMAB 1CQSA 1LVNA 2F86B 2XRXB 3MWZA 1Q40B 4NREA 2CG1A 3CCV3 1DMQA 3B8LA 1GOYA 3PCRA 1B2ZA 2P05A 2QGUA 1W6CA 5JPPA 4MMXB 2GU3A 3WR2A 1MWUA 1SPUA 3SYUA 3GZXB 2QEX3 1A90A 1T3BA 3HIGA 3PGBA 2BIRA 1BAOA 1JB4A 1RGLA 2B1XB 3CD63 1UGHI 2SARA 1AVLA 1YVSA 3JUQA 3JVCA 1M1K4 1ZGXA 1LOYA 4K1UA 1I2GA 3D79A 4GB5A 4IT7A 4LMIA 2E2UA 1OHSA 2BMOB 1RLSA 2YFLB 3GZBA 1T2IA 3KFQC 2OWPA 5IG4A 1BRIA 2V1LA 4HM7B 4CDLA 4KVHA 5HOHA 2IUKA 3NM2A 1KQS2 5RNTA 1OGXA 1WMOA 2CW9A 1SQWA 1HU9A 1BIRA 1YGEA 3AHWA 3K9MC 3U97A 4CCVA 4EW5A 8CHOA 1B2MA 4MMZB 1LNIA 4XB5A 1W2B2 6GSPA 3AGNA 1BANA 1MWSA 2K3DA 1I8VA 2OOVC 9RNTA 3CCM3 5I97A 3GRDA 2OQEC 3LMLA 2BO9B 1N5HA 1UCKA 1RGAA 2ZL8A 3SEDA 3V98A 4FR9A 4J8TA 4X2HA 4RBNA 1EEJA 1ULJB 2KF4A 5G1LA 1ZS7A 3FG4A 1DVDA 1GOVA 1FUSA 2RFRA 2CK3H 3EQQB 3CCQ3 3G713 3FF0A 3LZAA 1SIIA 1YGWA 4XDWA 1VQP3 2P0XA 4HYZA 1RGKA 3URPA 3X3XA 2KF6A 1JRQA 1UGIA 2CKFB 3Q1CA 4TX4A 2CHCA 1UDII 1W7CA 4QWTA 4XM4A 1FW7A 1I3IA 1Q7HA 4LYLB 2CFDA 1RN7A 1YI23 2YFJB 2Y74A 3BLZA 1TRQA 5EEOA 1OACA 3CC23 1GMPA 1M1XB 2ZHXB 3CNXA 5D83A 2UUGC 3LT8A 3KIIA 3CCR3 1GYBA 4OVMA 2Y73A 1B20A 2MF7A 3MPHA 2XH9A 2CX0A 1U8CB 1JKGA 3FSDA 4HM8B 4J5KA 5DREA 1LQGC 5CF2A 1BSEA 1VQ63 3LTAA 1A67A 2BNGA 1IV9A 4N3VA 2XGLA 1J2BA 3RGAA 2P0MA 2LQVA 3GAXA 1K734 3MYTA 3MKIA 2LYXA 4WWUC 5BVBA 3T8NA 5STDA 1IV7A 1RCKA 1RTUA 5AIHA 1JBRA 4J5GA 2OTL3 2W6JH 4HM5B 1BOXA 1BGSA 1CH0A 6STDA 3S67A 1KWIA 1ISKA 1B2UA 5TGNA 3HX8A 3DGLA 3S5CA 2CFKA 1PY3A 1N5PA 1R4CA 2JDIH 3KE7A 1I3FA 3GSPA 5AI1A 4L7KA 1YJW3 2W56A 1PFPA 4HBRA 2BMQB 2WOFA 3JUNA 3G6E3 3OXAA 4GHOA 3ER7A 1PU4A 4L8OA 1X1YA 1Q7Y4 3T8UA 1MNLA 1NB5I 2F5MA 4I4KA 1RHLA 3CCE3 3Q2PA 3D4AA 1JZDA 2MC8A 1W4NA 2M7OA 2CIUA 3H51A 1NDOB 1NU3A 2L4VA 1JB5A 5AEUB 1K9M4 1BRKA 5CLKA 1BRGA 4PEJA 2BU4A 1W01A 3N8BA 1RCLA 4K1VA 4BTXA 4WYKA 1TP6A 3F7XA 3AMOA 1FGMA 3IJEB 2OCTA 1ZX2A 4FCJA 3OWSA 4G1MB 3HOHA 3HZPA 3D5IA 2K54A 1VZZA 4BL3A 1W5ZA 3SX1A 1IQYA 1QAFA 1TRPA 2CC3A 1ASKA 4EV2A 3G16A 5ELUA 3LXUX 1LNHA 4FMAA 2KCDA 2RGQA 1STDA 3F9SA 3RGRA 1VQM3 2Z77A 1FGOA 3LTDA 1BNSA 1BRNL 2KAAA 2XFSA 4N6MA 1MWRA 1SIHA 1WQLB 2RCDA 4BTWA 1OF5B 1BNGA 1I2EA 1RSNA 1G0TA 1IT7A 1TTOA 4MJDA 1RDSA 1HYFA 3GZRA 2F4YA 1I0VA 3F40A 4WP5A 3FGYA 1W00A 4KT3B 2WO0A 4L8PA 3CC43 1Q814 1IQ8A 1A2VA 4H61A 4KZ1A 2FNQA 2HMNB 1BSCA 3EX9A 3OWYA 5BU4A 3DH2A 4RZMA 2JQ5A 4DKIA 3GZYB 2Z6BA 3F8XA 1TJDA 2D1WA 4XDVA 2KF5A 1RMSA 1R4YA 3MHEA 2FXTA 1LRAA 3D9RA 3EN1B 4AEQA 1N9JA 1O7GB 1C7HA 3GWRA 1GY6A 2Z7AA 3WA3A 4RNTA 2XEPA 1NJI4 2P09A 3EBTA 7STDA 3Q90A 3F7SA 1AQZA 5BIRA 3UJMA 3LH4A 5IEPA 1QAKA 3EHCA 1VQ83 1FA3A 1IT8A 5FW5A 3FG3A 4STDA 2F56A 4HM3B 3SOYA 3WHOA 1GMRA 1GY5A 3CCS3 4FMDA 2W9QA 4LSOA 3KKGA 3PXMA 1GD4A 2BHMA 5G1KA 5KP3A 1G96A 1RGCA 2H0GA 1I0XA 1DETA 1N8QA 1ZO2A 2GEYA 1BVIA 3DXOA 1BU4A 3FKAA 3KCHA 3NBJA 3NM7A 2KF3A 1UCJA 5HGRA 1KSIA 1QVF2 1Q864 3BNEA 2K0MA 3B4PA 1N8R4 1BRJA 7RNTA 4WFOA 3WMDA 2QA43 2WGQA 1RJOA 3A5EA 1RKYA 1Q42A 2CX1A 5AEWB 1SJWA 1IK3A 2Q07A 2J8XB 1JV2B 2R4IA 2R41A 3JUPA 3NXJA 1X1XA 3H3HA 1VQQA 3MG3A 2IUJA 3D3LA 4H3UA 1AV4A 1UW1A 1A2PA 1IYYA 1BUQA 3NBBA 3OWUA 3PYJA 4CJNA 1MGWA 3NQZA 1IVXA 1BRHA 4EYCA 4BL2A 2CFWA 2CFGA 5DRVA 1QVG2 1G02A 2F98A 4K90B 1AVKA 1WTHA 3CCU3 2W0QA 5CK6A 1NB3I 1PYLA 2GEXA 3NV0A 2YX9A 3K5TA 3D5GA 1V74A 5IEOA 3CMA3 2OOVA 4GL6A 1JN5A 1GD3A 3T0UA 1GOUA 3K63A 3A76A 4MEIA 1LXEA 5AIGA 2W04A 1OHPA 3AHSA 1T5YA 4J9AA 1Y4KA 4KFFA 5D82A 1VQO3 3S29A 2ML5A 2CWTA 1GS3A 3DZLA 3EJVA 3HI7A 4HVNA 1RGEA 4JF8A 1Q40A 1HKXA 4HM0B 1BSBA 3CME3 1TFOA 1VQL3 1UUGB 2GU1A 4FMCA 1VQK3 5JPUA 1O7HB 1OPYA 3F14A 4KFEA 2RBIA 1NO3A 1IU7A 2HMMB 1OHOA 3PCSA 1IQXA 2IYJA
chains in the Genus database with same CATH topology
3N54B 3UB1A 2GXFA 4IPBA 3LTBA 3G0KA 1ROVA 1RRHA 3PZWA 3CPOA 3N9HA 4HM4B 2B24B 1OH0A 3MG2A 4R4KA 3FLJA 2WGOA 1FGTA 3IPTA 3ECFA 1FGRA 5IENA 2WOHA 4NHFA 3LYGA 1A2KA 1TU5A 1AR0A 2CFLA 1W02A 3QK9A 1OGZA 2HMJB 1IVUA 1M904 2C11A 3X3ZA 1TUHA 1IVWA 2HMKB 4FCZA 4XBXA 4EBGA 5FGOA 3EBYA 3TDGA 1DVCA 3BNCA 1K8A4 3NHXA 3X41A 4R9KA 3SLUA 3DGOA 3WOFB 5IG3A 3CCJ3 1QMAA 3SVAA 3U1WA 3CXC2 3B4OA 1O7NB 3M8CA 3UL5A 3UNLA 3DUKA 3I0YA 1JKGB 3NQYA 1QALA 4AKYA 4LEHA 1JB2A 2XR8B 2XF3A 3JUOA 2SBLA 1Z1SA 3G8ZA 4Q53A 1QJGA 2D42A 3EF8A 2CG0A 2IMJA 4LGQA 1IVVA 5KP1A 2OTJ3 2ML6A 3ALAA 3HIIA 4ORLA 1ROAA 4U13A 1EQKA 3STDA 4EC6A 1CYVA 1O7MB 2A15A 1K28A 4EV5A 3FF2A 2W56B 5BXQA 4OUQA 2CH9A 3X40A 1D6ZA 3DM8A 1WMPA 3CPW2 5ELJA 1W2ZA 1YIJ3 4N6UA 3S27A 4O2HA 2GBWB 3NUVA 1US1A 3G4S3 1EG9B 3V99A 4FMBA 2RSXA 5IW9A 3X42A 2W2CA 4R1KA 2INXA 4X2OA 2I9WA 4HZ9B 3LOYA 3EB8A 3DMCA 5EQLA 3EE1A 1O7WB 3NBRA 5IG0A 1VQ93 2PZVA 4WYKB 3AMOB 3L0RA 1F8NA 3J7Yd 1DYUA 3OX9A 1M9GA 2HMLB 2CWUA 4HJLB 5D81A 5IF6A 5EVHA 1U5OA 4WHAA 2QIYA 5LC7A 5AYRB 1YJ93 1YJN3 5LC6A 2XFTA 2IA7A 3VGNA 4O02B 3PS8A 3WODG 4O3VA 1NWWA 3SXXA 1LOXA 3X3YA 1CYUA 1GY7A 4OK0A 1W6YA 4N6NB 3KSED 2O9UX 4N6TA 4XBYA 1VQ73 3EN8A 3OW22 3DGMA 3O8YA 1E97A 3ROBA 1DMMA 3LT9A 3FH1A 3K0ZA 1JNQA 1VQN3 2OQEA 2P38A 3CC73 3UL6A 3MG1A 4IIAA 5KP4A 4HZBB 3KSPA 2GBXB 1OF5A 2BMRB 2E2VA 3DY5A 4BTYA 2E2TA 4LZIA 2W9PA 2XSOB 1ULIB 4HM1B 1L5GB 1S5AA 4K61A 5AYSC 5A0OB 1DMNA 2XGNA 1UUWB 3FG1A 3E99A 2KXGA 3QRDA 2FGTA 4EXRA 2O3OA 2UX0A 4N6OB 1YHQ3 3FCSB 2ZDJA 3VSYA 1OUNA 1STFI 1TFKA 1KD14 1RRLA 1FUWA 2Z76A 4MMYB 3SOAA 1EKMA 2C10A 2CWVA 5IERA 1KC84 3NX0A 4O8SA 1D6YA 4HM6B 3CCL3 3CNMA 3S28A 1UI7A 1O7PB 1W6GA 1VQ53 1UUVB 3WA2X 2KRTA 5AIFA 4FCMA 2XSHB 2YFIB 3DGNA 5AIIA 3KZTA 4JRFA 4N6V0 4XBTA 1VQ43 1FGQA 2W03A 4R80A 2PNCA 1D6UA 1YIT3 1E3RA 2STDA 1E3VA 3JUMA 4RNYA 3OV4A 3K7CA 3RDEA 1MOLA 5CF1A 4KFDA 1S723 1Q824 3WDGB 3KN4A 4ZM8A 2F99A 3BB9A 3BNDA 4RNZA 3LTCA 3VF1A 3I553 3FZWA 3MSOA 3WOEB 4AKZA 1WNHA 3NV0B 1OCVA 5IG5A 1JJ22 2HMOB 1N9EA 3V92A 1JN5B 5JBSA 3EC9A 5CXOA 3I563 3F8HA 5G2GA 4N6LA 3CU3A 4HM2B 1IDPA 1K41A 3HK4A 1EA2A 1WMNA 1UI8A 1TIJA 3B7CA 3BNBA 4HKVB 1YVBI 4R9LA 3CMA3 1CEWI 2BT3A 3IMAB 1CQSA 2F86B 1LVNA 2XRXB 3MWZA 1Q40B 4NREA 2CG1A 3CCV3 1DMQA 3B8LA 3PCRA 2P05A 2QGUA 1W6CA 5JPPA 4MMXB 2GU3A 1SPUA 3GZXB 2QEX3 1A90A 3HIGA 3PGBA 1JB4A 2B1XB 3CD63 1AVLA 3JUQA 3JVCA 1M1K4 4K1UA 4GB5A 4IT7A 4LMIA 2E2UA 1OHSA 2BMOB 2YFLB 3GZBA 3KFQC 5IG4A 2OWPA 2V1LA 4HM7B 4CDLA 4KVHA 2IUKA 3NM2A 1KQS2 1OGXA 1WMOA 2CW9A 1SQWA 1HU9A 1YGEA 3K9MC 3U97A 4CCVA 8CHOA 4MMZB 4XB5A 1W2B2 2OOVC 3CCM3 5I97A 3GRDA 2OQEC 3LMLA 2BO9B 1N5HA 2ZL8A 3SEDA 3V98A 4FR9A 4J8TA 4X2HA 4RBNA 1ULJB 3FG4A 1DVDA 2RFRA 2CK3H 3EQQB 3CCQ3 3G713 3FF0A 3LZAA 1SIIA 4XDWA 1VQP3 2P0XA 4HYZA 3X3XA 1JRQA 2CKFB 4TX4A 3Q1CA 2CHCA 1W7CA 4QWTA 4XM4A 2CFDA 1RN7A 1YI23 2YFJB 2Y74A 3BLZA 5EEOA 3CC23 1OACA 1M1XB 3CNXA 5D83A 3LT8A 3KIIA 3CCR3 1GYBA 4OVMA 2Y73A 2MF7A 3MPHA 2XH9A 4HM8B 1U8CB 1JKGA 3FSDA 5DREA 5CF2A 1VQ63 1A67A 3LTAA 2BNGA 1IV9A 4N3VA 2XGLA 1J2BA 3RGAA 2P0MA 2LQVA 3GAXA 1K734 3MYTA 3MKIA 2LYXA 4WWUC 5BVBA 3T8NA 5STDA 1IV7A 5AIHA 2OTL3 2W6JH 4HM5B 6STDA 3S67A 1KWIA 1ISKA 5TGNA 3HX8A 3DGLA 3S5CA 2CFKA 1R4CA 1N5PA 2JDIH 3KE7A 5AI1A 4L7KA 1YJW3 2W56A 1PFPA 4HBRA 2BMQB 2WOFA 3JUNA 3G6E3 3OXAA 3ER7A 1PU4A 4L8OA 1Q7Y4 1NB5I 3T8UA 1MNLA 4I4KA 3CCE3 3Q2PA 2MC8A 1W4NA 2M7OA 2CIUA 3H51A 1NDOB 1NU3A 2L4VA 1JB5A 5AEUB 1K9M4 5CLKA 4PEJA 3N8BA 1W01A 4K1VA 4BTXA 4WYKA 1TP6A 3F7XA 3AMOA 1FGMA 3IJEB 2OCTA 1ZX2A 4FCJA 3OWSA 4G1MB 3HZPA 2K54A 1VZZA 1W5ZA 3SX1A 1IQYA 1QAFA 2CC3A 1ASKA 4EV2A 3G16A 5ELUA 3LXUX 1LNHA 4FMAA 2KCDA 2RGQA 1STDA 3F9SA 3RGRA 1VQM3 2Z77A 1FGOA 3LTDA 2XFSA 4N6MA 1SIHA 1WQLB 2RCDA 4BTWA 1OF5B 1IT7A 4MJDA 3GZRA 3F40A 4WP5A 3FGYA 1W00A 2WO0A 4L8PA 3CC43 1Q814 1IQ8A 1A2VA 4H61A 4KZ1A 2FNQA 2HMNB 3EX9A 3OWYA 4RZMA 2JQ5A 3GZYB 2Z6BA 3F8XA 2D1WA 4XDVA 3MHEA 2FXTA 3D9RA 3EN1B 4AEQA 1N9JA 1O7GB 1C7HA 3GWRA 1GY6A 2Z7AA 3WA3A 2XEPA 1NJI4 2P09A 3EBTA 7STDA 3Q90A 3F7SA 3UJMA 3LH4A 5IEPA 1QAKA 3EHCA 1VQ83 1FA3A 1IT8A 5FW5A 3FG3A 4STDA 3SOYA 4HM3B 1GY5A 3CCS3 4FMDA 2W9QA 4LSOA 3KKGA 3PXMA 1GD4A 2BHMA 5KP3A 1G96A 1N8QA 1ZO2A 2GEYA 3DXOA 3NM7A 3NBJA 3FKAA 5HGRA 1KSIA 1QVF2 1Q864 3BNEA 2K0MA 3B4PA 1N8R4 4WFOA 3WMDA 2QA43 2WGQA 1RJOA 1RKYA 1Q42A 5AEWB 1SJWA 1IK3A 2Q07A 2R4IA 1JV2B 3NXJA 3JUPA 3H3HA 3MG3A 2IUJA 3D3LA 4H3UA 1AV4A 1UW1A 1BUQA 3NBBA 3OWUA 3PYJA 3NQZA 1IVXA 4EYCA 2CFWA 2CFGA 5DRVA 1QVG2 2F98A 4K90B 1AVKA 1WTHA 3CCU3 2W0QA 5CK6A 1NB3I 2GEXA 3NV0A 2YX9A 3K5TA 5IEOA 1V74A 2OOVA 4GL6A 1JN5A 1GD3A 3T0UA 3K63A 3A76A 4MEIA 1LXEA 5AIGA 2W04A 1OHPA 1T5YA 4J9AA 1Y4KA 4KFFA 5D82A 1VQO3 3S29A 2ML5A 2CWTA 1GS3A 3DZLA 3EJVA 3HI7A 4HVNA 4JF8A 1Q40A 1HKXA 4HM0B 3CME3 1TFOA 1VQL3 2GU1A 4FMCA 1VQK3 5JPUA 1O7HB 1OPYA 3F14A 4KFEA 1NO3A 1IU7A 2HMMB 1OHOA 3PCSA 1IQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1W A;  4FR9 A;  4K61 A;  4IPB A;  4HBR A; 
#chains in the Genus database with same CATH topology
 3N54 B;  3UB1 A;  8RNT A;  1I70 A;  2GXF A;  4IPB A;  3LTB A;  1FYS A;  3G0K A;  1ROV A;  1RRH A;  3PZW A;  3CPO A;  3N9H A;  4HM4 B;  1BSD A;  2B24 B;  1OH0 A;  3MG2 A;  4R4K A;  3FLJ A;  2WGO A;  3ZFZ A;  1FGT A;  3IPT A;  3ECF A;  1Q9E A;  1FGR A;  5IEN A;  2WOH A;  4NHF A;  3LYG A;  1A2K A;  1TU5 A;  1AR0 A;  1BNF A;  2CFL A;  1W02 A;  3QK9 A;  1OGZ A;  2HMJ B;  1IVU A;  1M90 4;  2C11 A;  3X3Z A;  1TUH A;  1IVW A;  2HMK B;  4FCZ A;  4XBX A;  2C4B A;  4GSP A;  5FGO A;  4EBG A;  3EBY A;  3TDG A;  1DVC A;  3BNC A;  1K8A 4;  3NHX A;  3X41 A;  4R9K A;  3SLU A;  1YNV X;  2GSP A;  3DGO A;  3WOF B;  5IG3 A;  3CCJ 3;  1QMA A;  3SVA A;  3U1W A;  7GSP A;  3CXC 2;  3B4O A;  1O7N B;  3M8C A;  3UL5 A;  3UNL A;  3DUK A;  1FUT A;  3I0Y A;  3RNT A;  1C54 A;  1JKG B;  3NQY A;  1QAL A;  4AKY A;  4LEH A;  1JB2 A;  2XR8 B;  2XF3 A;  3JUO A;  2SBL A;  1Z1S A;  1JZO A;  3G8Z A;  4Q53 A;  1QJG A;  1B27 A;  2D42 A;  3EF8 A;  2CG0 A;  2IMJ A;  4LGQ A;  1IVV A;  5KP1 A;  2OTJ 3;  2ML6 A;  1B3S A;  3ALA A;  3HII A;  4HAA A;  4ORL A;  1ROA A;  4U13 A;  1EQK A;  3STD A;  4EC6 A;  1CYV A;  1O7M B;  2A15 A;  1K28 A;  4EV5 A;  3FF2 A;  2W56 B;  1RN4 A;  5BXQ A;  1GSP A;  4OUQ A;  1BNJ A;  2CH9 A;  1BNI A;  3X40 A;  1D6Z A;  1RGH A;  1WMP A;  3DM8 A;  4I5Q A;  5ELJ A;  5M1A A;  1LOW A;  1W2Z A;  3ZG5 A;  3CPW 2;  1EUI C;  1YIJ 3;  1BUJ A;  4N6U A;  3S27 A;  4O2H A;  2GBW B;  3NUV A;  1US1 A;  4NPB A;  3G4S 3;  1EG9 B;  5GSP A;  1SAR A;  3V99 A;  4FMB A;  2RSX A;  5IW9 A;  3X42 A;  1V57 A;  2W2C A;  4R1K A;  2INX A;  4X2O A;  2I9W A;  4HZ9 B;  4BU4 A;  3LOY A;  3EB8 A;  3DMC A;  2L1S A;  5EQL A;  3EE1 A;  1B21 A;  1O7W B;  3NBR A;  5IG0 A;  1HZ1 A;  2IY2 A;  1JBS A;  1VQ9 3;  2PZV A;  1RNT A;  4WYK B;  1RN1 A;  3AMO B;  3L0R A;  1F8N A;  3J7Y d;  1DYU A;  3OX9 A;  1M9G A;  2HML B;  2CWU A;  2HOH A;  4HJL B;  5D81 A;  5EVH A;  5IF6 A;  1U5O A;  4WHA A;  2QIY A;  5LC7 A;  1BNR A;  4CPK A;  5AYR B;  1BSA A;  1YJ9 3;  1YJN 3;  5LC6 A;  2XFT A;  2IA7 A;  1X1W A;  4O02 B;  3VGN A;  1FZU A;  3PS8 A;  3WOD G;  3BU4 A;  4O3V A;  1NWW A;  3SXX A;  1LOX A;  1RNB A;  3X3Y A;  1CYU A;  1GY7 A;  2AAD A;  4OK0 A;  1BNE A;  1W6Y A;  1AY7 A;  4N6N B;  1LQM B;  3KSE D;  2O9U X;  4N6T A;  4XBY A;  1VQ7 3;  3EN8 A;  3OW2 2;  3DGM A;  1B2S A;  3O8Y A;  1E97 A;  3ROB A;  1DMM A;  3LT9 A;  3FH1 A;  3K0Z A;  1T2H A;  1JNQ A;  6RNT A;  1VQN 3;  2OQE A;  5M19 A;  2P38 A;  2UGI A;  3CC7 3;  3UL6 A;  3MG1 A;  3DGY A;  1B2X A;  4HZB B;  4IIA A;  5KP4 A;  3KSP A;  2GBX B;  1OF5 A;  5M18 A;  2BMR B;  2E2V A;  3DY5 A;  4BTY A;  2E2T A;  4LZI A;  2W9P A;  2XSO B;  1ULI B;  4HM1 B;  1L5G B;  3ZG0 A;  1S5A A;  4K61 A;  5AYS C;  5A0O B;  1DMN A;  2XGN A;  4HOH A;  1UUW B;  3FG1 A;  3E99 A;  2KXG A;  3QRD A;  2FGT A;  4EXR A;  2O3O A;  2UX0 A;  4BIR A;  4N6O B;  1BRS A;  1YHQ 3;  3FCS B;  2ZDJ A;  3VSY A;  1OUN A;  1STF I;  1TFK A;  1KD1 4;  1RRL A;  1FUW A;  2Z76 A;  4MMY B;  3SOA A;  1EKM A;  2C10 A;  2CWV A;  5IER A;  1KC8 4;  3NX0 A;  2H0I A;  4O8S A;  2H0H A;  1JBT A;  1D6Y A;  4HM6 B;  3CCL 3;  3CNM A;  3S28 A;  1UI7 A;  2F5W A;  2RNT A;  1O7P B;  1W6G A;  1VQ5 3;  1UUV B;  3WA2 X;  2KRT A;  5AIF A;  4FCM A;  2XSH B;  2YFI B;  3DGN A;  5AII A;  3KZT A;  4JRF A;  4N6V 0;  1UCL A;  4XBT A;  1VQ4 3;  1FGQ A;  2W03 A;  1I2F A;  2PNC A;  1D6U A;  4ILF A;  4R80 A;  1YIT 3;  1E3R A;  2STD A;  1E3V A;  1RGF A;  3JUM A;  4RNY A;  1RGG A;  3AGO A;  3K7C A;  1MOL A;  1NNV A;  3OV4 A;  3RDE A;  5CF1 A;  4KFD A;  2ZA4 A;  1S72 3;  1Q82 4;  3WDG B;  3KN4 A;  4ZM8 A;  1V58 A;  2F99 A;  3BB9 A;  3BND A;  4RNZ A;  3LTC A;  3VF1 A;  3I55 3;  1X1U A;  3FZW A;  1UCI A;  3MSO A;  1WNH A;  3WOE B;  4AKZ A;  3NV0 B;  1OCV A;  5IG5 A;  1JJ2 2;  2HMO B;  1N9E A;  3V92 A;  1JN5 B;  1DE3 A;  1MGR A;  5JBS A;  3EC9 A;  5CXO A;  3I56 3;  1LOV A;  1MWT A;  3F8H A;  2AAE A;  4N6L A;  5G2G A;  3CU3 A;  4HM2 B;  1IDP A;  1K41 A;  3HK4 A;  1EA2 A;  1WMN A;  1UI8 A;  1TIJ A;  3B7C A;  3BNB A;  3Q3F A;  1YVB I;  4HKV B;  3BIR A;  4R9L A;  1CEW I;  1GMQ A;  2BT3 A;  3IMA B;  1CQS A;  1LVN A;  2F86 B;  2XRX B;  3MWZ A;  1Q40 B;  4NRE A;  2CG1 A;  3CCV 3;  1DMQ A;  3B8L A;  1GOY A;  3PCR A;  1B2Z A;  2P05 A;  2QGU A;  1W6C A;  5JPP A;  4MMX B;  2GU3 A;  3WR2 A;  1MWU A;  1SPU A;  3SYU A;  3GZX B;  2QEX 3;  1A90 A;  1T3B A;  3HIG A;  3PGB A;  2BIR A;  1BAO A;  1JB4 A;  1RGL A;  2B1X B;  3CD6 3;  1UGH I;  2SAR A;  1AVL A;  1YVS A;  3JUQ A;  3JVC A;  1M1K 4;  1ZGX A;  1LOY A;  4K1U A;  1I2G A;  3D79 A;  4GB5 A;  4IT7 A;  4LMI A;  2E2U A;  1OHS A;  2BMO B;  1RLS A;  2YFL B;  3GZB A;  1T2I A;  3KFQ C;  2OWP A;  5IG4 A;  1BRI A;  2V1L A;  4HM7 B;  4CDL A;  4KVH A;  5HOH A;  2IUK A;  3NM2 A;  1KQS 2;  5RNT A;  1OGX A;  1WMO A;  2CW9 A;  1SQW A;  1HU9 A;  1BIR A;  1YGE A;  3AHW A;  3K9M C;  3U97 A;  4CCV A;  4EW5 A;  8CHO A;  1B2M A;  4MMZ B;  1LNI A;  4XB5 A;  1W2B 2;  6GSP A;  3AGN A;  1BAN A;  1MWS A;  2K3D A;  1I8V A;  2OOV C;  9RNT A;  3CCM 3;  5I97 A;  3GRD A;  2OQE C;  3LML A;  2BO9 B;  1N5H A;  1UCK A;  1RGA A;  2ZL8 A;  3SED A;  3V98 A;  4FR9 A;  4J8T A;  4X2H A;  4RBN A;  1EEJ A;  1ULJ B;  2KF4 A;  5G1L A;  1ZS7 A;  3FG4 A;  1DVD A;  1GOV A;  1FUS A;  2RFR A;  2CK3 H;  3EQQ B;  3CCQ 3;  3G71 3;  3FF0 A;  3LZA A;  1SII A;  1YGW A;  4XDW A;  1VQP 3;  2P0X A;  4HYZ A;  1RGK A;  3URP A;  3X3X A;  2KF6 A;  1JRQ A;  1UGI A;  2CKF B;  3Q1C A;  4TX4 A;  2CHC A;  1UDI I;  1W7C A;  4QWT A;  4XM4 A;  1FW7 A;  1I3I A;  1Q7H A;  4LYL B;  2CFD A;  1RN7 A;  1YI2 3;  2YFJ B;  2Y74 A;  3BLZ A;  1TRQ A;  5EEO A;  1OAC A;  3CC2 3;  1GMP A;  1M1X B;  2ZHX B;  3CNX A;  5D83 A;  2UUG C;  3LT8 A;  3KII A;  3CCR 3;  1GYB A;  4OVM A;  2Y73 A;  1B20 A;  2MF7 A;  3MPH A;  2XH9 A;  2CX0 A;  1U8C B;  1JKG A;  3FSD A;  4HM8 B;  4J5K A;  5DRE A;  1LQG C;  5CF2 A;  1BSE A;  1VQ6 3;  3LTA A;  1A67 A;  2BNG A;  1IV9 A;  4N3V A;  2XGL A;  1J2B A;  3RGA A;  2P0M A;  2LQV A;  3GAX A;  1K73 4;  3MYT A;  3MKI A;  2LYX A;  4WWU C;  5BVB A;  3T8N A;  5STD A;  1IV7 A;  1RCK A;  1RTU A;  5AIH A;  1JBR A;  4J5G A;  2OTL 3;  2W6J H;  4HM5 B;  1BOX A;  1BGS A;  1CH0 A;  6STD A;  3S67 A;  1KWI A;  1ISK A;  1B2U A;  5TGN A;  3HX8 A;  3DGL A;  3S5C A;  2CFK A;  1PY3 A;  1N5P A;  1R4C A;  2JDI H;  3KE7 A;  1I3F A;  3GSP A;  5AI1 A;  4L7K A;  1YJW 3;  2W56 A;  1PFP A;  4HBR A;  2BMQ B;  2WOF A;  3JUN A;  3G6E 3;  3OXA A;  4GHO A;  3ER7 A;  1PU4 A;  4L8O A;  1X1Y A;  1Q7Y 4;  3T8U A;  1MNL A;  1NB5 I;  2F5M A;  4I4K A;  1RHL A;  3CCE 3;  3Q2P A;  3D4A A;  1JZD A;  2MC8 A;  1W4N A;  2M7O A;  2CIU A;  3H51 A;  1NDO B;  1NU3 A;  2L4V A;  1JB5 A;  5AEU B;  1K9M 4;  1BRK A;  5CLK A;  1BRG A;  4PEJ A;  2BU4 A;  1W01 A;  3N8B A;  1RCL A;  4K1V A;  4BTX A;  4WYK A;  1TP6 A;  3F7X A;  3AMO A;  1FGM A;  3IJE B;  2OCT A;  1ZX2 A;  4FCJ A;  3OWS A;  4G1M B;  3HOH A;  3HZP A;  3D5I A;  2K54 A;  1VZZ A;  4BL3 A;  1W5Z A;  3SX1 A;  1IQY A;  1QAF A;  1TRP A;  2CC3 A;  1ASK A;  4EV2 A;  3G16 A;  5ELU A;  3LXU X;  1LNH A;  4FMA A;  2KCD A;  2RGQ A;  1STD A;  3F9S A;  3RGR A;  1VQM 3;  2Z77 A;  1FGO A;  3LTD A;  1BNS A;  1BRN L;  2KAA A;  2XFS A;  4N6M A;  1MWR A;  1SIH A;  1WQL B;  2RCD A;  4BTW A;  1OF5 B;  1BNG A;  1I2E A;  1RSN A;  1G0T A;  1IT7 A;  1TTO A;  4MJD A;  1RDS A;  1HYF A;  3GZR A;  2F4Y A;  1I0V A;  3F40 A;  4WP5 A;  3FGY A;  1W00 A;  4KT3 B;  2WO0 A;  4L8P A;  3CC4 3;  1Q81 4;  1IQ8 A;  1A2V A;  4H61 A;  4KZ1 A;  2FNQ A;  2HMN B;  1BSC A;  3EX9 A;  3OWY A;  5BU4 A;  3DH2 A;  4RZM A;  2JQ5 A;  4DKI A;  3GZY B;  2Z6B A;  3F8X A;  1TJD A;  2D1W A;  4XDV A;  2KF5 A;  1RMS A;  1R4Y A;  3MHE A;  2FXT A;  1LRA A;  3D9R A;  3EN1 B;  4AEQ A;  1N9J A;  1O7G B;  1C7H A;  3GWR A;  1GY6 A;  2Z7A A;  3WA3 A;  4RNT A;  2XEP A;  1NJI 4;  2P09 A;  3EBT A;  7STD A;  3Q90 A;  3F7S A;  1AQZ A;  5BIR A;  3UJM A;  3LH4 A;  5IEP A;  1QAK A;  3EHC A;  1VQ8 3;  1FA3 A;  1IT8 A;  5FW5 A;  3FG3 A;  4STD A;  2F56 A;  4HM3 B;  3SOY A;  3WHO A;  1GMR A;  1GY5 A;  3CCS 3;  4FMD A;  2W9Q A;  4LSO A;  3KKG A;  3PXM A;  1GD4 A;  2BHM A;  5G1K A;  5KP3 A;  1G96 A;  1RGC A;  2H0G A;  1I0X A;  1DET A;  1N8Q A;  1ZO2 A;  2GEY A;  1BVI A;  3DXO A;  1BU4 A;  3FKA A;  3KCH A;  3NBJ A;  3NM7 A;  2KF3 A;  1UCJ A;  5HGR A;  1KSI A;  1QVF 2;  1Q86 4;  3BNE A;  2K0M A;  3B4P A;  1N8R 4;  1BRJ A;  7RNT A;  4WFO A;  3WMD A;  2QA4 3;  2WGQ A;  1RJO A;  3A5E A;  1RKY A;  1Q42 A;  2CX1 A;  5AEW B;  1SJW A;  1IK3 A;  2Q07 A;  2J8X B;  1JV2 B;  2R4I A;  2R41 A;  3JUP A;  3NXJ A;  1X1X A;  3H3H A;  1VQQ A;  3MG3 A;  2IUJ A;  3D3L A;  4H3U A;  1AV4 A;  1UW1 A;  1A2P A;  1IYY A;  1BUQ A;  3NBB A;  3OWU A;  3PYJ A;  4CJN A;  1MGW A;  3NQZ A;  1IVX A;  1BRH A;  4EYC A;  4BL2 A;  2CFW A;  2CFG A;  5DRV A;  1QVG 2;  1G02 A;  2F98 A;  4K90 B;  1AVK A;  1WTH A;  3CCU 3;  2W0Q A;  5CK6 A;  1NB3 I;  1PYL A;  2GEX A;  3NV0 A;  2YX9 A;  3K5T A;  3D5G A;  1V74 A;  5IEO A;  3CMA 3;  2OOV A;  4GL6 A;  1JN5 A;  1GD3 A;  3T0U A;  1GOU A;  3K63 A;  3A76 A;  4MEI A;  1LXE A;  5AIG A;  2W04 A;  1OHP A;  3AHS A;  1T5Y A;  4J9A A;  1Y4K A;  4KFF A;  5D82 A;  1VQO 3;  3S29 A;  2ML5 A;  2CWT A;  1GS3 A;  3DZL A;  3EJV A;  3HI7 A;  4HVN A;  1RGE A;  4JF8 A;  1Q40 A;  1HKX A;  4HM0 B;  1BSB A;  3CME 3;  1TFO A;  1VQL 3;  1UUG B;  2GU1 A;  4FMC A;  1VQK 3;  5JPU A;  1O7H B;  1OPY A;  3F14 A;  4KFE A;  2RBI A;  1NO3 A;  1IU7 A;  2HMM B;  1OHO A;  3PCS A;  1IQX A;  2IYJ A; 
#chains in the Genus database with same CATH homology
 3N54 B;  3UB1 A;  2GXF A;  4IPB A;  3LTB A;  3G0K A;  1ROV A;  1RRH A;  3PZW A;  3CPO A;  3N9H A;  4HM4 B;  2B24 B;  1OH0 A;  3MG2 A;  4R4K A;  3FLJ A;  2WGO A;  1FGT A;  3IPT A;  3ECF A;  1FGR A;  5IEN A;  2WOH A;  4NHF A;  3LYG A;  1A2K A;  1TU5 A;  1AR0 A;  2CFL A;  1W02 A;  3QK9 A;  1OGZ A;  2HMJ B;  1IVU A;  1M90 4;  2C11 A;  3X3Z A;  1TUH A;  1IVW A;  2HMK B;  4FCZ A;  4XBX A;  4EBG A;  5FGO A;  3EBY A;  3TDG A;  1DVC A;  3BNC A;  1K8A 4;  3NHX A;  3X41 A;  4R9K A;  3SLU A;  3DGO A;  3WOF B;  5IG3 A;  3CCJ 3;  1QMA A;  3SVA A;  3U1W A;  3CXC 2;  3B4O A;  1O7N B;  3M8C A;  3UL5 A;  3UNL A;  3DUK A;  3I0Y A;  1JKG B;  3NQY A;  1QAL A;  4AKY A;  4LEH A;  1JB2 A;  2XR8 B;  2XF3 A;  3JUO A;  2SBL A;  1Z1S A;  3G8Z A;  4Q53 A;  1QJG A;  2D42 A;  3EF8 A;  2CG0 A;  2IMJ A;  4LGQ A;  1IVV A;  5KP1 A;  2OTJ 3;  2ML6 A;  3ALA A;  3HII A;  4ORL A;  1ROA A;  4U13 A;  1EQK A;  3STD A;  4EC6 A;  1CYV A;  1O7M B;  2A15 A;  1K28 A;  4EV5 A;  3FF2 A;  2W56 B;  5BXQ A;  4OUQ A;  2CH9 A;  3X40 A;  1D6Z A;  3DM8 A;  1WMP A;  3CPW 2;  5ELJ A;  1W2Z A;  1YIJ 3;  4N6U A;  3S27 A;  4O2H A;  2GBW B;  3NUV A;  1US1 A;  3G4S 3;  1EG9 B;  3V99 A;  4FMB A;  2RSX A;  5IW9 A;  3X42 A;  2W2C A;  4R1K A;  2INX A;  4X2O A;  2I9W A;  4HZ9 B;  3LOY A;  3EB8 A;  3DMC A;  5EQL A;  3EE1 A;  1O7W B;  3NBR A;  5IG0 A;  1VQ9 3;  2PZV A;  4WYK B;  3AMO B;  3L0R A;  1F8N A;  3J7Y d;  1DYU A;  3OX9 A;  1M9G A;  2HML B;  2CWU A;  4HJL B;  5D81 A;  5IF6 A;  5EVH A;  1U5O A;  4WHA A;  2QIY A;  5LC7 A;  5AYR B;  1YJ9 3;  1YJN 3;  5LC6 A;  2XFT A;  2IA7 A;  3VGN A;  4O02 B;  3PS8 A;  3WOD G;  4O3V A;  1NWW A;  3SXX A;  1LOX A;  3X3Y A;  1CYU A;  1GY7 A;  4OK0 A;  1W6Y A;  4N6N B;  3KSE D;  2O9U X;  4N6T A;  4XBY A;  1VQ7 3;  3EN8 A;  3OW2 2;  3DGM A;  3O8Y A;  1E97 A;  3ROB A;  1DMM A;  3LT9 A;  3FH1 A;  3K0Z A;  1JNQ A;  1VQN 3;  2OQE A;  2P38 A;  3CC7 3;  3UL6 A;  3MG1 A;  4IIA A;  5KP4 A;  4HZB B;  3KSP A;  2GBX B;  1OF5 A;  2BMR B;  2E2V A;  3DY5 A;  4BTY A;  2E2T A;  4LZI A;  2W9P A;  2XSO B;  1ULI B;  4HM1 B;  1L5G B;  1S5A A;  4K61 A;  5AYS C;  5A0O B;  1DMN A;  2XGN A;  1UUW B;  3FG1 A;  3E99 A;  2KXG A;  3QRD A;  2FGT A;  4EXR A;  2O3O A;  2UX0 A;  4N6O B;  1YHQ 3;  3FCS B;  2ZDJ A;  3VSY A;  1OUN A;  1STF I;  1TFK A;  1KD1 4;  1RRL A;  1FUW A;  2Z76 A;  4MMY B;  3SOA A;  1EKM A;  2C10 A;  2CWV A;  5IER A;  1KC8 4;  3NX0 A;  4O8S A;  1D6Y A;  4HM6 B;  3CCL 3;  3CNM A;  3S28 A;  1UI7 A;  1O7P B;  1W6G A;  1VQ5 3;  1UUV B;  3WA2 X;  2KRT A;  5AIF A;  4FCM A;  2XSH B;  2YFI B;  3DGN A;  5AII A;  3KZT A;  4JRF A;  4N6V 0;  4XBT A;  1VQ4 3;  1FGQ A;  2W03 A;  4R80 A;  2PNC A;  1D6U A;  1YIT 3;  1E3R A;  2STD A;  1E3V A;  3JUM A;  4RNY A;  3OV4 A;  3K7C A;  3RDE A;  1MOL A;  5CF1 A;  4KFD A;  1S72 3;  1Q82 4;  3WDG B;  3KN4 A;  4ZM8 A;  2F99 A;  3BB9 A;  3BND A;  4RNZ A;  3LTC A;  3VF1 A;  3I55 3;  3FZW A;  3MSO A;  3WOE B;  4AKZ A;  1WNH A;  3NV0 B;  1OCV A;  5IG5 A;  1JJ2 2;  2HMO B;  1N9E A;  3V92 A;  1JN5 B;  5JBS A;  3EC9 A;  5CXO A;  3I56 3;  3F8H A;  5G2G A;  4N6L A;  3CU3 A;  4HM2 B;  1IDP A;  1K41 A;  3HK4 A;  1EA2 A;  1WMN A;  1UI8 A;  1TIJ A;  3B7C A;  3BNB A;  4HKV B;  1YVB I;  4R9L A;  3CMA 3;  1CEW I;  2BT3 A;  3IMA B;  1CQS A;  2F86 B;  1LVN A;  2XRX B;  3MWZ A;  1Q40 B;  4NRE A;  2CG1 A;  3CCV 3;  1DMQ A;  3B8L A;  3PCR A;  2P05 A;  2QGU A;  1W6C A;  5JPP A;  4MMX B;  2GU3 A;  1SPU A;  3GZX B;  2QEX 3;  1A90 A;  3HIG A;  3PGB A;  1JB4 A;  2B1X B;  3CD6 3;  1AVL A;  3JUQ A;  3JVC A;  1M1K 4;  4K1U A;  4GB5 A;  4IT7 A;  4LMI A;  2E2U A;  1OHS A;  2BMO B;  2YFL B;  3GZB A;  3KFQ C;  5IG4 A;  2OWP A;  2V1L A;  4HM7 B;  4CDL A;  4KVH A;  2IUK A;  3NM2 A;  1KQS 2;  1OGX A;  1WMO A;  2CW9 A;  1SQW A;  1HU9 A;  1YGE A;  3K9M C;  3U97 A;  4CCV A;  8CHO A;  4MMZ B;  4XB5 A;  1W2B 2;  2OOV C;  3CCM 3;  5I97 A;  3GRD A;  2OQE C;  3LML A;  2BO9 B;  1N5H A;  2ZL8 A;  3SED A;  3V98 A;  4FR9 A;  4J8T A;  4X2H A;  4RBN A;  1ULJ B;  3FG4 A;  1DVD A;  2RFR A;  2CK3 H;  3EQQ B;  3CCQ 3;  3G71 3;  3FF0 A;  3LZA A;  1SII A;  4XDW A;  1VQP 3;  2P0X A;  4HYZ A;  3X3X A;  1JRQ A;  2CKF B;  4TX4 A;  3Q1C A;  2CHC A;  1W7C A;  4QWT A;  4XM4 A;  2CFD A;  1RN7 A;  1YI2 3;  2YFJ B;  2Y74 A;  3BLZ A;  5EEO A;  3CC2 3;  1OAC A;  1M1X B;  3CNX A;  5D83 A;  3LT8 A;  3KII A;  3CCR 3;  1GYB A;  4OVM A;  2Y73 A;  2MF7 A;  3MPH A;  2XH9 A;  4HM8 B;  1U8C B;  1JKG A;  3FSD A;  5DRE A;  5CF2 A;  1VQ6 3;  1A67 A;  3LTA A;  2BNG A;  1IV9 A;  4N3V A;  2XGL A;  1J2B A;  3RGA A;  2P0M A;  2LQV A;  3GAX A;  1K73 4;  3MYT A;  3MKI A;  2LYX A;  4WWU C;  5BVB A;  3T8N A;  5STD A;  1IV7 A;  5AIH A;  2OTL 3;  2W6J H;  4HM5 B;  6STD A;  3S67 A;  1KWI A;  1ISK A;  5TGN A;  3HX8 A;  3DGL A;  3S5C A;  2CFK A;  1R4C A;  1N5P A;  2JDI H;  3KE7 A;  5AI1 A;  4L7K A;  1YJW 3;  2W56 A;  1PFP A;  4HBR A;  2BMQ B;  2WOF A;  3JUN A;  3G6E 3;  3OXA A;  3ER7 A;  1PU4 A;  4L8O A;  1Q7Y 4;  1NB5 I;  3T8U A;  1MNL A;  4I4K A;  3CCE 3;  3Q2P A;  2MC8 A;  1W4N A;  2M7O A;  2CIU A;  3H51 A;  1NDO B;  1NU3 A;  2L4V A;  1JB5 A;  5AEU B;  1K9M 4;  5CLK A;  4PEJ A;  3N8B A;  1W01 A;  4K1V A;  4BTX A;  4WYK A;  1TP6 A;  3F7X A;  3AMO A;  1FGM A;  3IJE B;  2OCT A;  1ZX2 A;  4FCJ A;  3OWS A;  4G1M B;  3HZP A;  2K54 A;  1VZZ A;  1W5Z A;  3SX1 A;  1IQY A;  1QAF A;  2CC3 A;  1ASK A;  4EV2 A;  3G16 A;  5ELU A;  3LXU X;  1LNH A;  4FMA A;  2KCD A;  2RGQ A;  1STD A;  3F9S A;  3RGR A;  1VQM 3;  2Z77 A;  1FGO A;  3LTD A;  2XFS A;  4N6M A;  1SIH A;  1WQL B;  2RCD A;  4BTW A;  1OF5 B;  1IT7 A;  4MJD A;  3GZR A;  3F40 A;  4WP5 A;  3FGY A;  1W00 A;  2WO0 A;  4L8P A;  3CC4 3;  1Q81 4;  1IQ8 A;  1A2V A;  4H61 A;  4KZ1 A;  2FNQ A;  2HMN B;  3EX9 A;  3OWY A;  4RZM A;  2JQ5 A;  3GZY B;  2Z6B A;  3F8X A;  2D1W A;  4XDV A;  3MHE A;  2FXT A;  3D9R A;  3EN1 B;  4AEQ A;  1N9J A;  1O7G B;  1C7H A;  3GWR A;  1GY6 A;  2Z7A A;  3WA3 A;  2XEP A;  1NJI 4;  2P09 A;  3EBT A;  7STD A;  3Q90 A;  3F7S A;  3UJM A;  3LH4 A;  5IEP A;  1QAK A;  3EHC A;  1VQ8 3;  1FA3 A;  1IT8 A;  5FW5 A;  3FG3 A;  4STD A;  3SOY A;  4HM3 B;  1GY5 A;  3CCS 3;  4FMD A;  2W9Q A;  4LSO A;  3KKG A;  3PXM A;  1GD4 A;  2BHM A;  5KP3 A;  1G96 A;  1N8Q A;  1ZO2 A;  2GEY A;  3DXO A;  3NM7 A;  3NBJ A;  3FKA A;  5HGR A;  1KSI A;  1QVF 2;  1Q86 4;  3BNE A;  2K0M A;  3B4P A;  1N8R 4;  4WFO A;  3WMD A;  2QA4 3;  2WGQ A;  1RJO A;  1RKY A;  1Q42 A;  5AEW B;  1SJW A;  1IK3 A;  2Q07 A;  2R4I A;  1JV2 B;  3NXJ A;  3JUP A;  3H3H A;  3MG3 A;  2IUJ A;  3D3L A;  4H3U A;  1AV4 A;  1UW1 A;  1BUQ A;  3NBB A;  3OWU A;  3PYJ A;  3NQZ A;  1IVX A;  4EYC A;  2CFW A;  2CFG A;  5DRV A;  1QVG 2;  2F98 A;  4K90 B;  1AVK A;  1WTH A;  3CCU 3;  2W0Q A;  5CK6 A;  1NB3 I;  2GEX A;  3NV0 A;  2YX9 A;  3K5T A;  5IEO A;  1V74 A;  2OOV A;  4GL6 A;  1JN5 A;  1GD3 A;  3T0U A;  3K63 A;  3A76 A;  4MEI A;  1LXE A;  5AIG A;  2W04 A;  1OHP A;  1T5Y A;  4J9A A;  1Y4K A;  4KFF A;  5D82 A;  1VQO 3;  3S29 A;  2ML5 A;  2CWT A;  1GS3 A;  3DZL A;  3EJV A;  3HI7 A;  4HVN A;  4JF8 A;  1Q40 A;  1HKX A;  4HM0 B;  3CME 3;  1TFO A;  1VQL 3;  2GU1 A;  4FMC A;  1VQK 3;  5JPU A;  1O7H B;  1OPY A;  3F14 A;  4KFE A;  1NO3 A;  1IU7 A;  2HMM B;  1OHO A;  3PCS A;  1IQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...