4FR9A

Crystal structure of a blip-like protein (bf1215) from bacteroides fragilis nctc 9343 at 1.20 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
141
structure length
133
Chain Sequence
b'DDDTGYLPPSQAIQDALLYPNATAIWEQGVYYVADCQADGREEVWFDANANWLMTETELNSINNLPPAVLTAFMESSYNNWVVDDVVILEYPNEPSTEFVVTVEQGVDLYFSEGGGLLHEDVTNGDDTHWPRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BF1215) from Bacteroides fragilis NCTC 9343 at 1.20 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Unknown function
total genus 24
structure length 133
sequence length 141
ec nomenclature
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11396 PepSY_like Putative beta-lactamase-inhibitor-like, PepSY-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.360 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4fr9A00
4FR9A 4HBRA 4K61A 4IPBA 3U1WA
chains in the Genus database with same CATH superfamily
1IT8A 1BRGA 1IDPA 4EYCA 1QVF2 2CWTA 1UUVB 1WTHA 2C4BA 2Z7AA 3D4AA 5JPPA 2J8XB 4EV5A 1BSEA 2CIUA 2GU3A 3PS8A 4RNYA 4BTYA 1AQZA 2C10A 2CG1A 4U13A 4CPKA 1SPUA 1JKGB 3LTBA 3LOYA 1YJN3 1UCLA 1Z1SA 1SARA 1YVBI 3KE7A 1FW7A 4HM2B 3CC43 3DM8A 1Q864 3URPA 5IG5A 4BIRA 3AGOA 1AVLA 4ZM8A 3CCL3 1T3BA 1M1XB 3DGYA 1Q40A 2B24B 1Q9EA 1RGFA 1TTOA 2HMLB 1LOXA 1RDSA 3NM7A 3PXMA 3FZWA 2STDA 1SIHA 1BRJA 1OGZA 1B2ZA 1GMPA 2Y73A 4N6OB 1OHPA 2R41A 1PYLA 1I8VA 1NDOB 1SQWA 3GWRA 2CFLA 4XBYA 2IY2A 5M19A 2YX9A 1RGKA 1QVG2 4KVHA 1VQ83 1ZO2A 2WGQA 3LT8A 4HM6B 4AEQA 3NUVA 1JBTA 2F4YA 3NV0A 3STDA 1FGTA 1A67A 1N5HA 1TJDA 3PCSA 3UB1A 1KWIA 4Q53A 4OVMA 3NQZA 5FGOA 3WA2X 1DVDA 5CF1A 1TIJA 1DETA 2E2VA 2ML5A 5KP3A 1IVUA 2WOFA 1B20A 1JN5B 2FNQA 3OXAA 1GY7A 4LYLB 5ELUA 1K734 2AADA 1IV9A 2BHMA 2P0XA 1MGWA 1BAOA 2M7OA 1FGOA 1JBSA 3F7XA 2BNGA 1RHLA 2W9PA 3D3LA 1D6ZA 4HM4B 1TP6A 1UDII 3F7SA 3F8HA 5AEUB 3LH4A 3GAXA 4HM0B 4G1MB 1BNFA 3NBJA 1VZZA 2XSOB 1W7CA 1UCIA 3EX9A 3GRDA 3GZBA 1FUSA 1CH0A 3I0YA 4O2HA 5KP1A 1JZDA 4FR9A 1FUTA 2XFTA 1YJ93 2MF7A 1BSBA 3KSPA 1VQ53 1X1XA 1X1UA 2GXFA 3M8CA 1BRKA 1RKYA 1WNHA 2OQEC 4HYZA 4EXRA 1VQL3 1ULJB 2C11A 1A2KA 3WODG 2KF4A 3N8BA 1RN1A 3BIRA 1IQ8A 3IPTA 2HMOB 3JUMA 3X3ZA 1JJ22 2H0GA 1F8NA 4X2HA 1LOYA 3FLJA 5TGNA 1W5ZA 3JUQA 3N54B 3BNDA 1NNVA 4JRFA 5AYRB 1VQ73 4HJLB 1N8QA 8RNTA 1RTUA 3RDEA 4L8OA 2CG0A 2YFJB 3A5EA 1E3VA 4N3VA 4J9AA 1OPYA 5BU4A 3MWZA 6RNTA 4N6LA 3AHWA 5M1AA 4FCJA 5LC7A 3FG1A 5IG0A 3GZRA 4BU4A 4JF8A 1BNGA 1MOLA 3BLZA 1JKGA 3LTCA 2XEPA 2F86B 1M904 1BNRA 4H3UA 1IVXA 1FZUA 2JDIH 2CWUA 1JB5A 5IF6A 4K1VA 1NB3I 3DMCA 3G8ZA 1D6UA 1RRHA 2W9QA 2BIRA 3EQQB 2OCTA 1LQGC 4MEIA 2CX0A 1UGHI 1TFOA 2CK3H 3BNCA 3DGOA 3MG2A 3OWSA 1BNIA 2HOHA 1YHQ3 4WYKB 1V57A 1W6CA 3EJVA 5KP4A 5CXOA 5RNTA 4HVNA 4BL3A 2BU4A 2CFWA 2L4VA 1BRNL 1VQ43 2HMNB 4HM8B 2B1XB 3OWYA 1VQQA 4DKIA 4I5QA 3MKIA 1MGRA 5I97A 2PZVA 1K9M4 1B2XA 3HOHA 1IQYA 4CCVA 2CFGA 9RNTA 5LC6A 1VQO3 1O7GB 2GBXB 2OQEA 3NX0A 3DZLA 1JN5A 1C7HA 3EBYA 4R9KA 3EF8A 1OH0A 4XB5A 1SJWA 1UUGB 3G0KA 3VF1A 1BRHA 3UL5A 2W56B 3ALAA 2CHCA 4FCMA 1I0XA 5AIGA 3CCM3 3OWUA 2Y74A 3K7CA 1OACA 1LXEA 1YVSA 3N9HA 5HOHA 1Q42A 1RNBA 4HBRA 2LQVA 2WOHA 3V92A 4HAAA 3WOEB 1GYBA 3RGRA 5DRVA 3KCHA 3S5CA 5JPUA 3CCV3 2XH9A 5D83A 4O3VA 3Q1CA 3SX1A 1OGXA 4HOHA 3L0RA 1RGGA 5DREA 5IW9A 2KF5A 2XSHB 4L7KA 3CCE3 3SYUA 2A15A 1LOVA 4O8SA 1MWTA 1WMNA 1B2UA 3CCJ3 3FG3A 6STDA 4XBXA 3O8YA 1RN4A 1EA2A 1VQ93 2KCDA 4NREA 2P38A 3BNEA 5IENA 1IQXA 3LXUX 2V1LA 1IV7A 1OHOA 1QMAA 1PU4A 1YIT3 1D6YA 2O9UX 3G6E3 5D81A 3X41A 3I563 3NM2A 5AYSC 2RBIA 1EUIC 4J5GA 1DMNA 4FMBA 1DYUA 3GZXB 2UUGC 3PYJA 2QA43 1W2B2 4HKVB 4R9LA 3CC23 1UI8A 1NU3A 3NXJA 4HZBB 3DGNA 1LNIA 2CFDA 1MWUA 3U97A 3OW22 2OTJ3 1YGWA 4WP5A 4QWTA 3ZFZA 1JBRA 3K63A 1TFKA 1FGRA 3PCRA 1W6GA 1US1A 1Q7HA 3MYTA 4RBNA 3SXXA 7STDA 1JB4A 2W04A 5D82A 4NHFA 3QRDA 3CME3 4WYKA 1ZX2A 5EQLA 1S723 2BT3A 1CEWI 3DGLA 3DXOA 3G4S3 3CCS3 1GY6A 3D9RA 1T2IA 4OUQA 3CMA3 3WMDA 5AEWB 1UCJA 2E2TA 2BMQB 1OCVA 2BO9B 2Z76A 3BB9A 1W2ZA 2BMOB 1JRQA 1BNSA 1EEJA 3FH1A 4WWUC 1M1K4 1BIRA 1CQSA 2KRTA 3D5GA 4WHAA 3ZG0A 2XGNA 1WMPA 4HZ9B 1PY3A 2IUKA 1BVIA 3F40A 1EKMA 2CWVA 3NQYA 1GMRA 3T0UA 3S28A 2ML6A 4MJDA 4LGQA 4FMCA 3CCR3 2W56A 3F8XA 1RGLA 4PEJA 2GSPA 4R4KA 3X3YA 1I70A 1K41A 1YGEA 1TU5A 1OUNA 3T8NA 7RNTA 1JV2B 1SIIA 3MSOA 2XRXB 3FKAA 1JNQA 2O3OA 1NO3A 3D5IA 2YFLB 3J7Yd 1Q40B 1MNLA 1UGIA 1FGMA 4HM7B 1C54A 2OWPA 5IG4A 2XR8B 3QK9A 3ECFA 1LQMB 4LSOA 1TUHA 1UUWB 4OK0A 4WFOA 1R4YA 4I4KA 2ZHXB 4N6UA 1OF5B 4EBGA 1IYYA 4EC6A 4FCZA 3HIGA 2KAAA 2ZA4A 3F9SA 3ROBA 1RGAA 3HI7A 1WQLB 3IMAB 1DVCA 5A0OB 1KD14 1DMMA 3LZAA 4RNTA 2P09A 1BSAA 3UL6A 1IK3A 2CW9A 2W0QA 2F99A 1AV4A 1GS3A 1ZGXA 1BUJA 3WDGB 2ZL8A 3CCU3 3CNXA 2SBLA 3FSDA 4LZIA 3ER7A 1RRLA 1GOVA 1RN7A 1HKXA 1MWSA 1UCKA 1NJI4 4MMZB 4EW5A 2F56A 4IPBA 1L5GB 2L1SA 4KZ1A 1BANA 2CC3A 4K90B 3A76A 1AY7A 1ULIB 2PNCA 3MG3A 4HM3B 4XDWA 5IG3A 3D79A 1G96A 4MMXB 4XM4A 4BTWA 1BNEA 3S27A 2WGOA 2H0HA 2YFIB 3GSPA 1FUWA 3K9MC 1UW1A 4J5KA 1VQP3 1LRAA 1LOWA 1IU7A 1GOYA 2WO0A 1STDA 3UJMA 2UGIA 3GZYB 3VSYA 2IYJA 3KFQC 1CYUA 1G0TA 1N9EA 2GEXA 1RGHA 3CCQ3 5IEPA 1IT7A 4BL2A 2FXTA 1W4NA 3B4OA 3UNLA 3NHXA 3SVAA 5AIFA 5BVBA 3G713 1JZOA 2BMRB 1N8R4 2W2CA 1E3RA 1RCKA 2P0MA 1ASKA 3MPHA 1IVWA 3S67A 1KC84 2FGTA 2F5WA 1B3SA 1O7MB 2IMJA 2RNTA 4XBTA 3X42A 3B8LA 5CLKA 1V74A 2CX1A 3TDGA 3X3XA 1A2PA 3KN4A 1B21A 3CU3A 3HIIA 3KZTA 3CXC2 3CPW2 1VQK3 4LMIA 1TRQA 1YI23 2QGUA 4N6NB 1Q814 3NBRA 1I3FA 2K0MA 3AMOB 1VQ63 4FMDA 3PZWA 1NB5I 1LVNA 1U5OA 2JQ5A 1X1WA 1BOXA 1I2FA 4R1KA 4J8TA 4KFFA 3MG1A 1YNVX 5CF2A 4HM5B 2OOVC 2R4IA 2IUJA 1A2VA 1O7NB 4EV2A 5AIIA 1PFPA 3LMLA 1W00A 1VQM3 1BUQA 2GEYA 4TX4A 5G1LA 5G1KA 3V98A 2OTL3 1OF5A 3H51A 2KF6A 1I2EA 1S5AA 2QEX3 1YJW3 1ISKA 3LYGA 1HYFA 3X40A 3B4PA 2Z77A 4XDVA 3Q90A 4BTXA 1BSDA 3E99A 2CKFB 1M9GA 2SARA 5G2GA 4CDLA 1Q7Y4 3FCSB 3SOAA 3JUPA 4K1UA 5FW5A 1AR0A 1RGCA 3FF0A 4KT3B 4IIAA 2D1WA 1BNJA 4STDA 5CK6A 5AI1A 2CH9A 1FA3A 2CFKA 3NBBA 3CPOA 1G02A 3LTAA 1GSPA 1TRPA 3SOYA 3Q3FA 3DGMA 5AIHA 2KXGA 2W03A 1A90A 1NWWA 1DE3A 5JBSA 2D42A 2RCDA 1STFI 3ZG5A 3CC73 1KSIA 3HZPA 1BRIA 3PGBA 3LT9A 3CD63 1E97A 3VGNA 3JUOA 4IT7A 1QALA 3HK4A 4O02B 1UI7A 3B7CA 5M18A 1EG9B 2KF3A 1BGSA 3EE1A 3G16A 3SEDA 1Q824 1RGEA 1T5YA 4AKZA 1W01A 1V58A 3BU4A 4LEHA 4RZMA 3DY5A 2XF3A 4L8PA 5HGRA 5IERA 1J2BA 4R80A 1O7PB 1RCLA 2AAEA 1U8CB 3FGYA 1FYSA 1T2HA 3KIIA 3WA3A 3T8UA 3HX8A 1B27A 2XGLA 4N6TA 1N5PA 6GSPA 2LYXA 2QIYA 1QAKA 1KQS2 2GBWB 2Q07A 4GB5A 4GSPA 1HZ1A 1YIJ3 1Y4KA 2Z6BA 3EC9A 4HM1B 2RSXA 1I2GA 4FMAA 2OOVA 1GD3A 2ZDJA 3IJEB 1QJGA 3MHEA 1R4CA 3RNTA 3WOFB 4AKYA 5BXQA 4N6V0 1EQKA 3EHCA 5STDA 4NPBA 2HMMB 3H3HA 3NV0B 4KFEA 4N6MA 3FG4A 2INXA 1ROVA 4ILFA 2K3DA 1I3IA 3F14A 2GU1A 1X1YA 4CJNA 1N9JA 3Q2PA 5EVHA 3RGAA 1K8A4 1WMOA 3AGNA 2UX0A 5GSPA 3AMOA 3WR2A 2RFRA 1RLSA 1O7WB 3JUNA 2K54A 3CNMA 3JVCA 1BRSA 3AHSA 3BNBA 1B2MA 1IVVA 1GD4A 1I0VA 2H0IA 1O7HB 1VQN3 1MWRA 2XFSA 5IEOA 1RSNA 3U1WA 2HMKB 4GHOA 3S29A 8CHOA 3FF2A 4GL6A 1BSCA 1GY5A 3KSED 4KFDA 2P05A 4H61A 3LTDA 2W6JH 1B2SA 1DMQA 1OHSA 4K61A 2F98A 7GSPA 1RNTA 1QAFA 2MC8A 1GOUA 3OV4A 3OX9A 2HMJB 1K28A 2E2UA 3I553 1CYVA 1LNHA 3EB8A 2RGQA 5BIRA 3V99A 3SLUA 3K5TA 4MMYB 2I9WA 4ORLA 5ELJA 3DUKA 1W02A 1GMQA 2IA7A 3KKGA 1RJOA 3DH2A 2F5MA 3EN1B 1W6YA 3K0ZA 3EBTA 4X2OA 1JB2A 5EEOA 1FGQA 3WHOA 1AVKA 1BU4A 1HU9A 3EN8A 4RNZA 1ZS7A 1ROAA 1RMSA
chains in the Genus database with same CATH topology
1IT8A 1IDPA 4EYCA 1QVF2 2CWTA 1UUVB 1WTHA 2Z7AA 5JPPA 4EV5A 2CIUA 2GU3A 3PS8A 4RNYA 4BTYA 2C10A 2CG1A 4U13A 1SPUA 1JKGB 3LTBA 3LOYA 1YJN3 1Z1SA 1YVBI 3KE7A 4HM2B 3CC43 3DM8A 1Q864 5IG5A 1AVLA 4ZM8A 3CCL3 1M1XB 1Q40A 2B24B 3PXMA 3NM7A 4R9LA 2HMLB 1LOXA 3FZWA 2STDA 1SIHA 1OGZA 2Y73A 4N6OB 1OHPA 3GWRA 1NDOB 1SQWA 2CFLA 4XBYA 1QVG2 2YX9A 1VQ83 4KVHA 1ZO2A 2WGQA 3LT8A 4HM6B 4AEQA 3NUVA 3NV0A 3STDA 1FGTA 1A67A 1N5HA 3PCSA 3UB1A 1KWIA 4Q53A 4OVMA 3NQZA 5FGOA 3WA2X 1DVDA 5CF1A 1TIJA 2E2VA 2ML5A 5KP3A 1IVUA 2WOFA 1JN5B 2FNQA 3OXAA 5ELUA 1GY7A 1K734 1IV9A 2BHMA 2P0XA 2M7OA 1FGOA 3F7XA 2BNGA 2W9PA 3D3LA 1D6ZA 4HM4B 1TP6A 3F8HA 3F7SA 5AEUB 3LH4A 3GAXA 4HM0B 4G1MB 3NBJA 1VZZA 2XSOB 1W7CA 3EX9A 3GRDA 3GZBA 4O2HA 3I0YA 5KP1A 4FR9A 2XFTA 1YJ93 2MF7A 3KSPA 1VQ53 2GXFA 3M8CA 1RKYA 1WNHA 2OQEC 4HYZA 4EXRA 1VQL3 1ULJB 2C11A 1A2KA 3WODG 3N8BA 1IQ8A 3IPTA 2HMOB 3JUMA 3X3ZA 1JJ22 4X2HA 1F8NA 3FLJA 5TGNA 1W5ZA 3JUQA 3N54B 3BNDA 4JRFA 5AYRB 1VQ73 4HJLB 1N8QA 3RDEA 4L8OA 2CG0A 2YFJB 1E3VA 4N3VA 4J9AA 1OPYA 3MWZA 4N6LA 4FCJA 5LC7A 3FG1A 5IG0A 3GZRA 4JF8A 1MOLA 3BLZA 1JKGA 3LTCA 2XEPA 2F86B 1M904 4H3UA 1IVXA 2JDIH 2CWUA 1JB5A 5IF6A 4K1VA 1NB3I 3DMCA 3G8ZA 1D6UA 1RRHA 2W9QA 3EQQB 2OCTA 4MEIA 2CK3H 1TFOA 3BNCA 3DGOA 3MG2A 3OWSA 1YHQ3 4WYKB 1W6CA 3EJVA 5KP4A 5CXOA 4HVNA 2CFWA 2L4VA 1VQ43 2HMNB 4HM8B 2B1XB 3OWYA 3MKIA 5I97A 1K9M4 2PZVA 4CCVA 1IQYA 2CFGA 5LC6A 1VQO3 1O7GB 2GBXB 2OQEA 3NX0A 3DZLA 1JN5A 1C7HA 3EBYA 4R9KA 3EF8A 1OH0A 4XB5A 1SJWA 3G0KA 3VF1A 3UL5A 2W56B 3ALAA 2CHCA 4FCMA 5AIGA 3CCM3 3OWUA 2Y74A 3K7CA 1OACA 1LXEA 3N9HA 1Q42A 4HBRA 2LQVA 2WOHA 3V92A 3WOEB 1GYBA 3RGRA 5DRVA 3S5CA 5JPUA 3CCV3 2XH9A 5D83A 4O3VA 3Q1CA 3SX1A 1OGXA 3L0RA 5DREA 5IW9A 2XSHB 4L7KA 3CCE3 2A15A 4O8SA 1WMNA 3CCJ3 3FG3A 6STDA 4XBXA 3O8YA 1EA2A 1VQ93 2KCDA 4NREA 2P38A 3BNEA 5IENA 1IQXA 3LXUX 2V1LA 1IV7A 1OHOA 1QMAA 1PU4A 1YIT3 1D6YA 2O9UX 3G6E3 5D81A 3X41A 3I563 3NM2A 5AYSC 1DMNA 4FMBA 1DYUA 3GZXB 3PYJA 2QA43 1W2B2 4HKVB 3CC23 1UI8A 1NU3A 3NXJA 4HZBB 3DGNA 2CFDA 3U97A 3OW22 2OTJ3 4WP5A 4QWTA 3K63A 1TFKA 1FGRA 3PCRA 1W6GA 1US1A 3MYTA 4RBNA 3SXXA 7STDA 1JB4A 2W04A 5D82A 4NHFA 3QRDA 3CME3 4WYKA 1ZX2A 5EQLA 1S723 2BT3A 1CEWI 3DGLA 3DXOA 3G4S3 3CCS3 1GY6A 3D9RA 4OUQA 3CMA3 3WMDA 5AEWB 2E2TA 2BMQB 1OCVA 2BO9B 2Z76A 3BB9A 1W2ZA 2BMOB 1JRQA 3FH1A 4WWUC 1M1K4 1CQSA 2KRTA 4WHAA 2XGNA 1WMPA 4HZ9B 2IUKA 3NQYA 3T0UA 3F40A 1EKMA 2CWVA 3S28A 2ML6A 4MJDA 4LGQA 4FMCA 3CCR3 2W56A 3F8XA 3X3YA 4PEJA 4R4KA 1TU5A 1K41A 1YGEA 1OUNA 3T8NA 1JV2B 1SIIA 3MSOA 2XRXB 3FKAA 1JNQA 2O3OA 1NO3A 2YFLB 3J7Yd 1Q40B 1MNLA 1FGMA 4HM7B 2OWPA 5IG4A 2XR8B 3QK9A 3ECFA 4LSOA 1TUHA 1UUWB 4OK0A 4WFOA 4I4KA 4EBGA 4N6UA 1OF5B 4EC6A 4FCZA 3HIGA 3F9SA 3ROBA 5A0OB 1KD14 3HI7A 1WQLB 3IMAB 1DVCA 1DMMA 3LZAA 2P09A 3UL6A 1IK3A 2CW9A 2W0QA 2F99A 1AV4A 1GS3A 3WDGB 2ZL8A 3CCU3 3CNXA 2SBLA 3FSDA 4LZIA 3ER7A 1RRLA 1RN7A 1HKXA 1NJI4 4MMZB 4IPBA 1L5GB 4KZ1A 2CC3A 4K90B 3A76A 1ULIB 2PNCA 3MG3A 4HM3B 4XDWA 5IG3A 1G96A 4MMXB 4XM4A 4BTWA 3S27A 2WGOA 2YFIB 1FUWA 3K9MC 1UW1A 1VQP3 1IU7A 2WO0A 1STDA 3UJMA 3GZYB 3VSYA 3KFQC 1CYUA 1N9EA 2GEXA 3CCQ3 5IEPA 1IT7A 2FXTA 1W4NA 3B4OA 3UNLA 3NHXA 3SVAA 5AIFA 5BVBA 3G713 2BMRB 1N8R4 2W2CA 1E3RA 2P0MA 1ASKA 3MPHA 1IVWA 3S67A 1KC84 2FGTA 1O7MB 2IMJA 4XBTA 3X42A 3B8LA 5CLKA 1V74A 3TDGA 3X3XA 3KN4A 3CU3A 3HIIA 3KZTA 3CXC2 3CPW2 1VQK3 4LMIA 1YI23 2QGUA 4N6NB 1Q814 3NBRA 2K0MA 1VQ63 3AMOB 4FMDA 3PZWA 1NB5I 1LVNA 1U5OA 2JQ5A 4R1KA 4J8TA 4KFFA 3MG1A 5CF2A 4HM5B 2OOVC 2R4IA 2IUJA 1A2VA 1O7NB 4EV2A 5AIIA 1PFPA 3LMLA 1W00A 1VQM3 1BUQA 2GEYA 4TX4A 3V98A 2OTL3 1OF5A 3H51A 1S5AA 2QEX3 1YJW3 1ISKA 3LYGA 3X40A 3B4PA 2Z77A 4XDVA 3Q90A 4BTXA 4CDLA 3E99A 2CKFB 1M9GA 5G2GA 1Q7Y4 1FA3A 3FCSB 3SOAA 3JUPA 4K1UA 5FW5A 1AR0A 3FF0A 4IIAA 2D1WA 4STDA 5CK6A 5AI1A 2CH9A 2CFKA 3NBBA 3CPOA 3LTAA 3SOYA 3DGMA 5AIHA 2KXGA 2W03A 1A90A 1NWWA 5JBSA 2D42A 2RCDA 1STFI 3CC73 1KSIA 3HZPA 3PGBA 3CD63 3LT9A 1E97A 3VGNA 3JUOA 4IT7A 1QALA 3HK4A 4O02B 1UI7A 3B7CA 1EG9B 3EE1A 3G16A 3SEDA 1Q824 1T5YA 4AKZA 1W01A 4LEHA 4RZMA 3DY5A 2XF3A 4L8PA 5HGRA 5IERA 1J2BA 4R80A 1O7PB 3KIIA 1U8CB 3FGYA 3WA3A 3T8UA 3HX8A 2XGLA 4N6TA 1N5PA 2LYXA 2QIYA 1QAKA 1KQS2 2GBWB 2Q07A 4GB5A 1YIJ3 1Y4KA 2Z6BA 3EC9A 4HM1B 2RSXA 4FMAA 2OOVA 3WOFB 2ZDJA 3IJEB 1QJGA 3MHEA 1R4CA 4AKYA 5BXQA 1EQKA 4N6V0 3EHCA 5STDA 2HMMB 3H3HA 3NV0B 4KFEA 4N6MA 3FG4A 2INXA 1ROVA 3F14A 2GU1A 1N9JA 3Q2PA 5EVHA 3RGAA 1K8A4 1WMOA 2UX0A 3AMOA 2RFRA 1O7WB 3JUNA 2K54A 3CNMA 3JVCA 3BNBA 1IVVA 1GD4A 1O7HB 1VQN3 2XFSA 5IEOA 3U1WA 2HMKB 3S29A 8CHOA 3FF2A 4GL6A 3KSED 1GY5A 4KFDA 2P05A 4H61A 3LTDA 2W6JH 1OHSA 1DMQA 4K61A 2F98A 1QAFA 2MC8A 3OV4A 3OX9A 2HMJB 1K28A 2E2UA 3I553 1CYVA 1LNHA 3EB8A 2RGQA 3V99A 3SLUA 3K5TA 4MMYB 2I9WA 4ORLA 5ELJA 3DUKA 1W02A 2IA7A 3KKGA 1RJOA 3EN1B 1W6YA 3K0ZA 3EBTA 1JB2A 5EEOA 1FGQA 1AVKA 1HU9A 3EN8A 4RNZA 4X2OA 1ROAA 1GD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FR9 A;  4HBR A;  4K61 A;  4IPB A;  3U1W A; 
#chains in the Genus database with same CATH topology
 1IT8 A;  1BRG A;  1IDP A;  4EYC A;  1QVF 2;  2CWT A;  1UUV B;  1WTH A;  2C4B A;  2Z7A A;  3D4A A;  5JPP A;  2J8X B;  4EV5 A;  1BSE A;  2CIU A;  2GU3 A;  3PS8 A;  4RNY A;  4BTY A;  1AQZ A;  2C10 A;  2CG1 A;  4U13 A;  4CPK A;  1SPU A;  1JKG B;  3LTB A;  3LOY A;  1YJN 3;  1UCL A;  1Z1S A;  1SAR A;  1YVB I;  3KE7 A;  1FW7 A;  4HM2 B;  3CC4 3;  3DM8 A;  1Q86 4;  3URP A;  5IG5 A;  4BIR A;  3AGO A;  1AVL A;  4ZM8 A;  3CCL 3;  1T3B A;  1M1X B;  3DGY A;  1Q40 A;  2B24 B;  1Q9E A;  1RGF A;  1TTO A;  2HML B;  1LOX A;  1RDS A;  3NM7 A;  3PXM A;  3FZW A;  2STD A;  1SIH A;  1BRJ A;  1OGZ A;  1B2Z A;  1GMP A;  2Y73 A;  4N6O B;  1OHP A;  2R41 A;  1PYL A;  1I8V A;  1NDO B;  1SQW A;  3GWR A;  2CFL A;  4XBY A;  2IY2 A;  5M19 A;  2YX9 A;  1RGK A;  1QVG 2;  4KVH A;  1VQ8 3;  1ZO2 A;  2WGQ A;  3LT8 A;  4HM6 B;  4AEQ A;  3NUV A;  1JBT A;  2F4Y A;  3NV0 A;  3STD A;  1FGT A;  1A67 A;  1N5H A;  1TJD A;  3PCS A;  3UB1 A;  1KWI A;  4Q53 A;  4OVM A;  3NQZ A;  5FGO A;  3WA2 X;  1DVD A;  5CF1 A;  1TIJ A;  1DET A;  2E2V A;  2ML5 A;  5KP3 A;  1IVU A;  2WOF A;  1B20 A;  1JN5 B;  2FNQ A;  3OXA A;  1GY7 A;  4LYL B;  5ELU A;  1K73 4;  2AAD A;  1IV9 A;  2BHM A;  2P0X A;  1MGW A;  1BAO A;  2M7O A;  1FGO A;  1JBS A;  3F7X A;  2BNG A;  1RHL A;  2W9P A;  3D3L A;  1D6Z A;  4HM4 B;  1TP6 A;  1UDI I;  3F7S A;  3F8H A;  5AEU B;  3LH4 A;  3GAX A;  4HM0 B;  4G1M B;  1BNF A;  3NBJ A;  1VZZ A;  2XSO B;  1W7C A;  1UCI A;  3EX9 A;  3GRD A;  3GZB A;  1FUS A;  1CH0 A;  3I0Y A;  4O2H A;  5KP1 A;  1JZD A;  4FR9 A;  1FUT A;  2XFT A;  1YJ9 3;  2MF7 A;  1BSB A;  3KSP A;  1VQ5 3;  1X1X A;  1X1U A;  2GXF A;  3M8C A;  1BRK A;  1RKY A;  1WNH A;  2OQE C;  4HYZ A;  4EXR A;  1VQL 3;  1ULJ B;  2C11 A;  1A2K A;  3WOD G;  2KF4 A;  3N8B A;  1RN1 A;  3BIR A;  1IQ8 A;  3IPT A;  2HMO B;  3JUM A;  3X3Z A;  1JJ2 2;  2H0G A;  1F8N A;  4X2H A;  1LOY A;  3FLJ A;  5TGN A;  1W5Z A;  3JUQ A;  3N54 B;  3BND A;  1NNV A;  4JRF A;  5AYR B;  1VQ7 3;  4HJL B;  1N8Q A;  8RNT A;  1RTU A;  3RDE A;  4L8O A;  2CG0 A;  2YFJ B;  3A5E A;  1E3V A;  4N3V A;  4J9A A;  1OPY A;  5BU4 A;  3MWZ A;  6RNT A;  4N6L A;  3AHW A;  5M1A A;  4FCJ A;  5LC7 A;  3FG1 A;  5IG0 A;  3GZR A;  4BU4 A;  4JF8 A;  1BNG A;  1MOL A;  3BLZ A;  1JKG A;  3LTC A;  2XEP A;  2F86 B;  1M90 4;  1BNR A;  4H3U A;  1IVX A;  1FZU A;  2JDI H;  2CWU A;  1JB5 A;  5IF6 A;  4K1V A;  1NB3 I;  3DMC A;  3G8Z A;  1D6U A;  1RRH A;  2W9Q A;  2BIR A;  3EQQ B;  2OCT A;  1LQG C;  4MEI A;  2CX0 A;  1UGH I;  1TFO A;  2CK3 H;  3BNC A;  3DGO A;  3MG2 A;  3OWS A;  1BNI A;  2HOH A;  1YHQ 3;  4WYK B;  1V57 A;  1W6C A;  3EJV A;  5KP4 A;  5CXO A;  5RNT A;  4HVN A;  4BL3 A;  2BU4 A;  2CFW A;  2L4V A;  1BRN L;  1VQ4 3;  2HMN B;  4HM8 B;  2B1X B;  3OWY A;  1VQQ A;  4DKI A;  4I5Q A;  3MKI A;  1MGR A;  5I97 A;  2PZV A;  1K9M 4;  1B2X A;  3HOH A;  1IQY A;  4CCV A;  2CFG A;  9RNT A;  5LC6 A;  1VQO 3;  1O7G B;  2GBX B;  2OQE A;  3NX0 A;  3DZL A;  1JN5 A;  1C7H A;  3EBY A;  4R9K A;  3EF8 A;  1OH0 A;  4XB5 A;  1SJW A;  1UUG B;  3G0K A;  3VF1 A;  1BRH A;  3UL5 A;  2W56 B;  3ALA A;  2CHC A;  4FCM A;  1I0X A;  5AIG A;  3CCM 3;  3OWU A;  2Y74 A;  3K7C A;  1OAC A;  1LXE A;  1YVS A;  3N9H A;  5HOH A;  1Q42 A;  1RNB A;  4HBR A;  2LQV A;  2WOH A;  3V92 A;  4HAA A;  3WOE B;  1GYB A;  3RGR A;  5DRV A;  3KCH A;  3S5C A;  5JPU A;  3CCV 3;  2XH9 A;  5D83 A;  4O3V A;  3Q1C A;  3SX1 A;  1OGX A;  4HOH A;  3L0R A;  1RGG A;  5DRE A;  5IW9 A;  2KF5 A;  2XSH B;  4L7K A;  3CCE 3;  3SYU A;  2A15 A;  1LOV A;  4O8S A;  1MWT A;  1WMN A;  1B2U A;  3CCJ 3;  3FG3 A;  6STD A;  4XBX A;  3O8Y A;  1RN4 A;  1EA2 A;  1VQ9 3;  2KCD A;  4NRE A;  2P38 A;  3BNE A;  5IEN A;  1IQX A;  3LXU X;  2V1L A;  1IV7 A;  1OHO A;  1QMA A;  1PU4 A;  1YIT 3;  1D6Y A;  2O9U X;  3G6E 3;  5D81 A;  3X41 A;  3I56 3;  3NM2 A;  5AYS C;  2RBI A;  1EUI C;  4J5G A;  1DMN A;  4FMB A;  1DYU A;  3GZX B;  2UUG C;  3PYJ A;  2QA4 3;  1W2B 2;  4HKV B;  4R9L A;  3CC2 3;  1UI8 A;  1NU3 A;  3NXJ A;  4HZB B;  3DGN A;  1LNI A;  2CFD A;  1MWU A;  3U97 A;  3OW2 2;  2OTJ 3;  1YGW A;  4WP5 A;  4QWT A;  3ZFZ A;  1JBR A;  3K63 A;  1TFK A;  1FGR A;  3PCR A;  1W6G A;  1US1 A;  1Q7H A;  3MYT A;  4RBN A;  3SXX A;  7STD A;  1JB4 A;  2W04 A;  5D82 A;  4NHF A;  3QRD A;  3CME 3;  4WYK A;  1ZX2 A;  5EQL A;  1S72 3;  2BT3 A;  1CEW I;  3DGL A;  3DXO A;  3G4S 3;  3CCS 3;  1GY6 A;  3D9R A;  1T2I A;  4OUQ A;  3CMA 3;  3WMD A;  5AEW B;  1UCJ A;  2E2T A;  2BMQ B;  1OCV A;  2BO9 B;  2Z76 A;  3BB9 A;  1W2Z A;  2BMO B;  1JRQ A;  1BNS A;  1EEJ A;  3FH1 A;  4WWU C;  1M1K 4;  1BIR A;  1CQS A;  2KRT A;  3D5G A;  4WHA A;  3ZG0 A;  2XGN A;  1WMP A;  4HZ9 B;  1PY3 A;  2IUK A;  1BVI A;  3F40 A;  1EKM A;  2CWV A;  3NQY A;  1GMR A;  3T0U A;  3S28 A;  2ML6 A;  4MJD A;  4LGQ A;  4FMC A;  3CCR 3;  2W56 A;  3F8X A;  1RGL A;  4PEJ A;  2GSP A;  4R4K A;  3X3Y A;  1I70 A;  1K41 A;  1YGE A;  1TU5 A;  1OUN A;  3T8N A;  7RNT A;  1JV2 B;  1SII A;  3MSO A;  2XRX B;  3FKA A;  1JNQ A;  2O3O A;  1NO3 A;  3D5I A;  2YFL B;  3J7Y d;  1Q40 B;  1MNL A;  1UGI A;  1FGM A;  4HM7 B;  1C54 A;  2OWP A;  5IG4 A;  2XR8 B;  3QK9 A;  3ECF A;  1LQM B;  4LSO A;  1TUH A;  1UUW B;  4OK0 A;  4WFO A;  1R4Y A;  4I4K A;  2ZHX B;  4N6U A;  1OF5 B;  4EBG A;  1IYY A;  4EC6 A;  4FCZ A;  3HIG A;  2KAA A;  2ZA4 A;  3F9S A;  3ROB A;  1RGA A;  3HI7 A;  1WQL B;  3IMA B;  1DVC A;  5A0O B;  1KD1 4;  1DMM A;  3LZA A;  4RNT A;  2P09 A;  1BSA A;  3UL6 A;  1IK3 A;  2CW9 A;  2W0Q A;  2F99 A;  1AV4 A;  1GS3 A;  1ZGX A;  1BUJ A;  3WDG B;  2ZL8 A;  3CCU 3;  3CNX A;  2SBL A;  3FSD A;  4LZI A;  3ER7 A;  1RRL A;  1GOV A;  1RN7 A;  1HKX A;  1MWS A;  1UCK A;  1NJI 4;  4MMZ B;  4EW5 A;  2F56 A;  4IPB A;  1L5G B;  2L1S A;  4KZ1 A;  1BAN A;  2CC3 A;  4K90 B;  3A76 A;  1AY7 A;  1ULI B;  2PNC A;  3MG3 A;  4HM3 B;  4XDW A;  5IG3 A;  3D79 A;  1G96 A;  4MMX B;  4XM4 A;  4BTW A;  1BNE A;  3S27 A;  2WGO A;  2H0H A;  2YFI B;  3GSP A;  1FUW A;  3K9M C;  1UW1 A;  4J5K A;  1VQP 3;  1LRA A;  1LOW A;  1IU7 A;  1GOY A;  2WO0 A;  1STD A;  3UJM A;  2UGI A;  3GZY B;  3VSY A;  2IYJ A;  3KFQ C;  1CYU A;  1G0T A;  1N9E A;  2GEX A;  1RGH A;  3CCQ 3;  5IEP A;  1IT7 A;  4BL2 A;  2FXT A;  1W4N A;  3B4O A;  3UNL A;  3NHX A;  3SVA A;  5AIF A;  5BVB A;  3G71 3;  1JZO A;  2BMR B;  1N8R 4;  2W2C A;  1E3R A;  1RCK A;  2P0M A;  1ASK A;  3MPH A;  1IVW A;  3S67 A;  1KC8 4;  2FGT A;  2F5W A;  1B3S A;  1O7M B;  2IMJ A;  2RNT A;  4XBT A;  3X42 A;  3B8L A;  5CLK A;  1V74 A;  2CX1 A;  3TDG A;  3X3X A;  1A2P A;  3KN4 A;  1B21 A;  3CU3 A;  3HII A;  3KZT A;  3CXC 2;  3CPW 2;  1VQK 3;  4LMI A;  1TRQ A;  1YI2 3;  2QGU A;  4N6N B;  1Q81 4;  3NBR A;  1I3F A;  2K0M A;  3AMO B;  1VQ6 3;  4FMD A;  3PZW A;  1NB5 I;  1LVN A;  1U5O A;  2JQ5 A;  1X1W A;  1BOX A;  1I2F A;  4R1K A;  4J8T A;  4KFF A;  3MG1 A;  1YNV X;  5CF2 A;  4HM5 B;  2OOV C;  2R4I A;  2IUJ A;  1A2V A;  1O7N B;  4EV2 A;  5AII A;  1PFP A;  3LML A;  1W00 A;  1VQM 3;  1BUQ A;  2GEY A;  4TX4 A;  5G1L A;  5G1K A;  3V98 A;  2OTL 3;  1OF5 A;  3H51 A;  2KF6 A;  1I2E A;  1S5A A;  2QEX 3;  1YJW 3;  1ISK A;  3LYG A;  1HYF A;  3X40 A;  3B4P A;  2Z77 A;  4XDV A;  3Q90 A;  4BTX A;  1BSD A;  3E99 A;  2CKF B;  1M9G A;  2SAR A;  5G2G A;  4CDL A;  1Q7Y 4;  3FCS B;  3SOA A;  3JUP A;  4K1U A;  5FW5 A;  1AR0 A;  1RGC A;  3FF0 A;  4KT3 B;  4IIA A;  2D1W A;  1BNJ A;  4STD A;  5CK6 A;  5AI1 A;  2CH9 A;  1FA3 A;  2CFK A;  3NBB A;  3CPO A;  1G02 A;  3LTA A;  1GSP A;  1TRP A;  3SOY A;  3Q3F A;  3DGM A;  5AIH A;  2KXG A;  2W03 A;  1A90 A;  1NWW A;  1DE3 A;  5JBS A;  2D42 A;  2RCD A;  1STF I;  3ZG5 A;  3CC7 3;  1KSI A;  3HZP A;  1BRI A;  3PGB A;  3LT9 A;  3CD6 3;  1E97 A;  3VGN A;  3JUO A;  4IT7 A;  1QAL A;  3HK4 A;  4O02 B;  1UI7 A;  3B7C A;  5M18 A;  1EG9 B;  2KF3 A;  1BGS A;  3EE1 A;  3G16 A;  3SED A;  1Q82 4;  1RGE A;  1T5Y A;  4AKZ A;  1W01 A;  1V58 A;  3BU4 A;  4LEH A;  4RZM A;  3DY5 A;  2XF3 A;  4L8P A;  5HGR A;  5IER A;  1J2B A;  4R80 A;  1O7P B;  1RCL A;  2AAE A;  1U8C B;  3FGY A;  1FYS A;  1T2H A;  3KII A;  3WA3 A;  3T8U A;  3HX8 A;  1B27 A;  2XGL A;  4N6T A;  1N5P A;  6GSP A;  2LYX A;  2QIY A;  1QAK A;  1KQS 2;  2GBW B;  2Q07 A;  4GB5 A;  4GSP A;  1HZ1 A;  1YIJ 3;  1Y4K A;  2Z6B A;  3EC9 A;  4HM1 B;  2RSX A;  1I2G A;  4FMA A;  2OOV A;  1GD3 A;  2ZDJ A;  3IJE B;  1QJG A;  3MHE A;  1R4C A;  3RNT A;  3WOF B;  4AKY A;  5BXQ A;  4N6V 0;  1EQK A;  3EHC A;  5STD A;  4NPB A;  2HMM B;  3H3H A;  3NV0 B;  4KFE A;  4N6M A;  3FG4 A;  2INX A;  1ROV A;  4ILF A;  2K3D A;  1I3I A;  3F14 A;  2GU1 A;  1X1Y A;  4CJN A;  1N9J A;  3Q2P A;  5EVH A;  3RGA A;  1K8A 4;  1WMO A;  3AGN A;  2UX0 A;  5GSP A;  3AMO A;  3WR2 A;  2RFR A;  1RLS A;  1O7W B;  3JUN A;  2K54 A;  3CNM A;  3JVC A;  1BRS A;  3AHS A;  3BNB A;  1B2M A;  1IVV A;  1GD4 A;  1I0V A;  2H0I A;  1O7H B;  1VQN 3;  1MWR A;  2XFS A;  5IEO A;  1RSN A;  3U1W A;  2HMK B;  4GHO A;  3S29 A;  8CHO A;  3FF2 A;  4GL6 A;  1BSC A;  1GY5 A;  3KSE D;  4KFD A;  2P05 A;  4H61 A;  3LTD A;  2W6J H;  1B2S A;  1DMQ A;  1OHS A;  4K61 A;  2F98 A;  7GSP A;  1RNT A;  1QAF A;  2MC8 A;  1GOU A;  3OV4 A;  3OX9 A;  2HMJ B;  1K28 A;  2E2U A;  3I55 3;  1CYV A;  1LNH A;  3EB8 A;  2RGQ A;  5BIR A;  3V99 A;  3SLU A;  3K5T A;  4MMY B;  2I9W A;  4ORL A;  5ELJ A;  3DUK A;  1W02 A;  1GMQ A;  2IA7 A;  3KKG A;  1RJO A;  3DH2 A;  2F5M A;  3EN1 B;  1W6Y A;  3K0Z A;  3EBT A;  4X2O A;  1JB2 A;  5EEO A;  1FGQ A;  3WHO A;  1AVK A;  1BU4 A;  1HU9 A;  3EN8 A;  4RNZ A;  1ZS7 A;  1ROA A;  1RMS A; 
#chains in the Genus database with same CATH homology
 1IT8 A;  1IDP A;  4EYC A;  1QVF 2;  2CWT A;  1UUV B;  1WTH A;  2Z7A A;  5JPP A;  4EV5 A;  2CIU A;  2GU3 A;  3PS8 A;  4RNY A;  4BTY A;  2C10 A;  2CG1 A;  4U13 A;  1SPU A;  1JKG B;  3LTB A;  3LOY A;  1YJN 3;  1Z1S A;  1YVB I;  3KE7 A;  4HM2 B;  3CC4 3;  3DM8 A;  1Q86 4;  5IG5 A;  1AVL A;  4ZM8 A;  3CCL 3;  1M1X B;  1Q40 A;  2B24 B;  3PXM A;  3NM7 A;  4R9L A;  2HML B;  1LOX A;  3FZW A;  2STD A;  1SIH A;  1OGZ A;  2Y73 A;  4N6O B;  1OHP A;  3GWR A;  1NDO B;  1SQW A;  2CFL A;  4XBY A;  1QVG 2;  2YX9 A;  1VQ8 3;  4KVH A;  1ZO2 A;  2WGQ A;  3LT8 A;  4HM6 B;  4AEQ A;  3NUV A;  3NV0 A;  3STD A;  1FGT A;  1A67 A;  1N5H A;  3PCS A;  3UB1 A;  1KWI A;  4Q53 A;  4OVM A;  3NQZ A;  5FGO A;  3WA2 X;  1DVD A;  5CF1 A;  1TIJ A;  2E2V A;  2ML5 A;  5KP3 A;  1IVU A;  2WOF A;  1JN5 B;  2FNQ A;  3OXA A;  5ELU A;  1GY7 A;  1K73 4;  1IV9 A;  2BHM A;  2P0X A;  2M7O A;  1FGO A;  3F7X A;  2BNG A;  2W9P A;  3D3L A;  1D6Z A;  4HM4 B;  1TP6 A;  3F8H A;  3F7S A;  5AEU B;  3LH4 A;  3GAX A;  4HM0 B;  4G1M B;  3NBJ A;  1VZZ A;  2XSO B;  1W7C A;  3EX9 A;  3GRD A;  3GZB A;  4O2H A;  3I0Y A;  5KP1 A;  4FR9 A;  2XFT A;  1YJ9 3;  2MF7 A;  3KSP A;  1VQ5 3;  2GXF A;  3M8C A;  1RKY A;  1WNH A;  2OQE C;  4HYZ A;  4EXR A;  1VQL 3;  1ULJ B;  2C11 A;  1A2K A;  3WOD G;  3N8B A;  1IQ8 A;  3IPT A;  2HMO B;  3JUM A;  3X3Z A;  1JJ2 2;  4X2H A;  1F8N A;  3FLJ A;  5TGN A;  1W5Z A;  3JUQ A;  3N54 B;  3BND A;  4JRF A;  5AYR B;  1VQ7 3;  4HJL B;  1N8Q A;  3RDE A;  4L8O A;  2CG0 A;  2YFJ B;  1E3V A;  4N3V A;  4J9A A;  1OPY A;  3MWZ A;  4N6L A;  4FCJ A;  5LC7 A;  3FG1 A;  5IG0 A;  3GZR A;  4JF8 A;  1MOL A;  3BLZ A;  1JKG A;  3LTC A;  2XEP A;  2F86 B;  1M90 4;  4H3U A;  1IVX A;  2JDI H;  2CWU A;  1JB5 A;  5IF6 A;  4K1V A;  1NB3 I;  3DMC A;  3G8Z A;  1D6U A;  1RRH A;  2W9Q A;  3EQQ B;  2OCT A;  4MEI A;  2CK3 H;  1TFO A;  3BNC A;  3DGO A;  3MG2 A;  3OWS A;  1YHQ 3;  4WYK B;  1W6C A;  3EJV A;  5KP4 A;  5CXO A;  4HVN A;  2CFW A;  2L4V A;  1VQ4 3;  2HMN B;  4HM8 B;  2B1X B;  3OWY A;  3MKI A;  5I97 A;  1K9M 4;  2PZV A;  4CCV A;  1IQY A;  2CFG A;  5LC6 A;  1VQO 3;  1O7G B;  2GBX B;  2OQE A;  3NX0 A;  3DZL A;  1JN5 A;  1C7H A;  3EBY A;  4R9K A;  3EF8 A;  1OH0 A;  4XB5 A;  1SJW A;  3G0K A;  3VF1 A;  3UL5 A;  2W56 B;  3ALA A;  2CHC A;  4FCM A;  5AIG A;  3CCM 3;  3OWU A;  2Y74 A;  3K7C A;  1OAC A;  1LXE A;  3N9H A;  1Q42 A;  4HBR A;  2LQV A;  2WOH A;  3V92 A;  3WOE B;  1GYB A;  3RGR A;  5DRV A;  3S5C A;  5JPU A;  3CCV 3;  2XH9 A;  5D83 A;  4O3V A;  3Q1C A;  3SX1 A;  1OGX A;  3L0R A;  5DRE A;  5IW9 A;  2XSH B;  4L7K A;  3CCE 3;  2A15 A;  4O8S A;  1WMN A;  3CCJ 3;  3FG3 A;  6STD A;  4XBX A;  3O8Y A;  1EA2 A;  1VQ9 3;  2KCD A;  4NRE A;  2P38 A;  3BNE A;  5IEN A;  1IQX A;  3LXU X;  2V1L A;  1IV7 A;  1OHO A;  1QMA A;  1PU4 A;  1YIT 3;  1D6Y A;  2O9U X;  3G6E 3;  5D81 A;  3X41 A;  3I56 3;  3NM2 A;  5AYS C;  1DMN A;  4FMB A;  1DYU A;  3GZX B;  3PYJ A;  2QA4 3;  1W2B 2;  4HKV B;  3CC2 3;  1UI8 A;  1NU3 A;  3NXJ A;  4HZB B;  3DGN A;  2CFD A;  3U97 A;  3OW2 2;  2OTJ 3;  4WP5 A;  4QWT A;  3K63 A;  1TFK A;  1FGR A;  3PCR A;  1W6G A;  1US1 A;  3MYT A;  4RBN A;  3SXX A;  7STD A;  1JB4 A;  2W04 A;  5D82 A;  4NHF A;  3QRD A;  3CME 3;  4WYK A;  1ZX2 A;  5EQL A;  1S72 3;  2BT3 A;  1CEW I;  3DGL A;  3DXO A;  3G4S 3;  3CCS 3;  1GY6 A;  3D9R A;  4OUQ A;  3CMA 3;  3WMD A;  5AEW B;  2E2T A;  2BMQ B;  1OCV A;  2BO9 B;  2Z76 A;  3BB9 A;  1W2Z A;  2BMO B;  1JRQ A;  3FH1 A;  4WWU C;  1M1K 4;  1CQS A;  2KRT A;  4WHA A;  2XGN A;  1WMP A;  4HZ9 B;  2IUK A;  3NQY A;  3T0U A;  3F40 A;  1EKM A;  2CWV A;  3S28 A;  2ML6 A;  4MJD A;  4LGQ A;  4FMC A;  3CCR 3;  2W56 A;  3F8X A;  3X3Y A;  4PEJ A;  4R4K A;  1TU5 A;  1K41 A;  1YGE A;  1OUN A;  3T8N A;  1JV2 B;  1SII A;  3MSO A;  2XRX B;  3FKA A;  1JNQ A;  2O3O A;  1NO3 A;  2YFL B;  3J7Y d;  1Q40 B;  1MNL A;  1FGM A;  4HM7 B;  2OWP A;  5IG4 A;  2XR8 B;  3QK9 A;  3ECF A;  4LSO A;  1TUH A;  1UUW B;  4OK0 A;  4WFO A;  4I4K A;  4EBG A;  4N6U A;  1OF5 B;  4EC6 A;  4FCZ A;  3HIG A;  3F9S A;  3ROB A;  5A0O B;  1KD1 4;  3HI7 A;  1WQL B;  3IMA B;  1DVC A;  1DMM A;  3LZA A;  2P09 A;  3UL6 A;  1IK3 A;  2CW9 A;  2W0Q A;  2F99 A;  1AV4 A;  1GS3 A;  3WDG B;  2ZL8 A;  3CCU 3;  3CNX A;  2SBL A;  3FSD A;  4LZI A;  3ER7 A;  1RRL A;  1RN7 A;  1HKX A;  1NJI 4;  4MMZ B;  4IPB A;  1L5G B;  4KZ1 A;  2CC3 A;  4K90 B;  3A76 A;  1ULI B;  2PNC A;  3MG3 A;  4HM3 B;  4XDW A;  5IG3 A;  1G96 A;  4MMX B;  4XM4 A;  4BTW A;  3S27 A;  2WGO A;  2YFI B;  1FUW A;  3K9M C;  1UW1 A;  1VQP 3;  1IU7 A;  2WO0 A;  1STD A;  3UJM A;  3GZY B;  3VSY A;  3KFQ C;  1CYU A;  1N9E A;  2GEX A;  3CCQ 3;  5IEP A;  1IT7 A;  2FXT A;  1W4N A;  3B4O A;  3UNL A;  3NHX A;  3SVA A;  5AIF A;  5BVB A;  3G71 3;  2BMR B;  1N8R 4;  2W2C A;  1E3R A;  2P0M A;  1ASK A;  3MPH A;  1IVW A;  3S67 A;  1KC8 4;  2FGT A;  1O7M B;  2IMJ A;  4XBT A;  3X42 A;  3B8L A;  5CLK A;  1V74 A;  3TDG A;  3X3X A;  3KN4 A;  3CU3 A;  3HII A;  3KZT A;  3CXC 2;  3CPW 2;  1VQK 3;  4LMI A;  1YI2 3;  2QGU A;  4N6N B;  1Q81 4;  3NBR A;  2K0M A;  1VQ6 3;  3AMO B;  4FMD A;  3PZW A;  1NB5 I;  1LVN A;  1U5O A;  2JQ5 A;  4R1K A;  4J8T A;  4KFF A;  3MG1 A;  5CF2 A;  4HM5 B;  2OOV C;  2R4I A;  2IUJ A;  1A2V A;  1O7N B;  4EV2 A;  5AII A;  1PFP A;  3LML A;  1W00 A;  1VQM 3;  1BUQ A;  2GEY A;  4TX4 A;  3V98 A;  2OTL 3;  1OF5 A;  3H51 A;  1S5A A;  2QEX 3;  1YJW 3;  1ISK A;  3LYG A;  3X40 A;  3B4P A;  2Z77 A;  4XDV A;  3Q90 A;  4BTX A;  4CDL A;  3E99 A;  2CKF B;  1M9G A;  5G2G A;  1Q7Y 4;  1FA3 A;  3FCS B;  3SOA A;  3JUP A;  4K1U A;  5FW5 A;  1AR0 A;  3FF0 A;  4IIA A;  2D1W A;  4STD A;  5CK6 A;  5AI1 A;  2CH9 A;  2CFK A;  3NBB A;  3CPO A;  3LTA A;  3SOY A;  3DGM A;  5AIH A;  2KXG A;  2W03 A;  1A90 A;  1NWW A;  5JBS A;  2D42 A;  2RCD A;  1STF I;  3CC7 3;  1KSI A;  3HZP A;  3PGB A;  3CD6 3;  3LT9 A;  1E97 A;  3VGN A;  3JUO A;  4IT7 A;  1QAL A;  3HK4 A;  4O02 B;  1UI7 A;  3B7C A;  1EG9 B;  3EE1 A;  3G16 A;  3SED A;  1Q82 4;  1T5Y A;  4AKZ A;  1W01 A;  4LEH A;  4RZM A;  3DY5 A;  2XF3 A;  4L8P A;  5HGR A;  5IER A;  1J2B A;  4R80 A;  1O7P B;  3KII A;  1U8C B;  3FGY A;  3WA3 A;  3T8U A;  3HX8 A;  2XGL A;  4N6T A;  1N5P A;  2LYX A;  2QIY A;  1QAK A;  1KQS 2;  2GBW B;  2Q07 A;  4GB5 A;  1YIJ 3;  1Y4K A;  2Z6B A;  3EC9 A;  4HM1 B;  2RSX A;  4FMA A;  2OOV A;  3WOF B;  2ZDJ A;  3IJE B;  1QJG A;  3MHE A;  1R4C A;  4AKY A;  5BXQ A;  1EQK A;  4N6V 0;  3EHC A;  5STD A;  2HMM B;  3H3H A;  3NV0 B;  4KFE A;  4N6M A;  3FG4 A;  2INX A;  1ROV A;  3F14 A;  2GU1 A;  1N9J A;  3Q2P A;  5EVH A;  3RGA A;  1K8A 4;  1WMO A;  2UX0 A;  3AMO A;  2RFR A;  1O7W B;  3JUN A;  2K54 A;  3CNM A;  3JVC A;  3BNB A;  1IVV A;  1GD4 A;  1O7H B;  1VQN 3;  2XFS A;  5IEO A;  3U1W A;  2HMK B;  3S29 A;  8CHO A;  3FF2 A;  4GL6 A;  3KSE D;  1GY5 A;  4KFD A;  2P05 A;  4H61 A;  3LTD A;  2W6J H;  1OHS A;  1DMQ A;  4K61 A;  2F98 A;  1QAF A;  2MC8 A;  3OV4 A;  3OX9 A;  2HMJ B;  1K28 A;  2E2U A;  3I55 3;  1CYV A;  1LNH A;  3EB8 A;  2RGQ A;  3V99 A;  3SLU A;  3K5T A;  4MMY B;  2I9W A;  4ORL A;  5ELJ A;  3DUK A;  1W02 A;  2IA7 A;  3KKG A;  1RJO A;  3EN1 B;  1W6Y A;  3K0Z A;  3EBT A;  1JB2 A;  5EEO A;  1FGQ A;  1AVK A;  1HU9 A;  3EN8 A;  4RNZ A;  4X2O A;  1ROA A;  1GD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...