4FR9A

Crystal structure of a blip-like protein (bf1215) from bacteroides fragilis nctc 9343 at 1.20 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
141
structure length
133
Chain Sequence
DDDTGYLPPSQAIQDALLYPNATAIWEQGVYYVADCQADGREEVWFDANANWLMTETELNSINNLPPAVLTAFMESSYNNWVVDDVVILEYPNEPSTEFVVTVEQGVDLYFSEGGGLLHEDVTNGDDTHWPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BF1215) from Bacteroides fragilis NCTC 9343 at 1.20 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Unknown function
total genus 24
structure length 133
sequence length 141
ec nomenclature
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11396 PepSY_like Putative beta-lactamase-inhibitor-like, PepSY-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.360 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4fr9A00
3U1WA 4IPBA 4K61A 4HBRA 4FR9A
chains in the Genus database with same CATH superfamily
2E2VA 4EV5A 4FMDA 3CU3A 1HU9A 1IT7A 1RTUA 3A76A 3HOHA 4KFFA 1UUGB 1GOYA 1VQO3 1WNHA 1CEWI 1RJOA 3DGOA 4AEQA 2KF6A 4BTYA 3WOFB 3JUNA 3OX9A 1QAKA 3X42A 4AKZA 1IQXA 1HZ1A 2F98A 1RNTA 3DGMA 1OUNA 4EC6A 8RNTA 1GSPA 1DMQA 3NX0A 1RNBA 3ROBA 1AV4A 1YGWA 3BB9A 3N9HA 1RGAA 4N6V0 4HM0B 3S5CA 3JUMA 3G6E3 4BIRA 1BNJA 4KFDA 4CPKA 5A0OB 1YNVX 1BU4A 1FUWA 2CH9A 2CFDA 1MOLA 2SARA 2GEYA 1TIJA 4MMXB 1LOXA 2IMJA 3DXOA 3X3ZA 2BHMA 1ZS7A 3N54B 1K28A 2K3DA 1YVBI 3D3LA 2ZL8A 3KKGA 4ZM8A 2KAAA 3S29A 3OW22 1STFI 1JN5A 2A15A 3CCR3 1D6ZA 1S5AA 1IVWA 1N9EA 1WQLB 4TX4A 1DE3A 1BNGA 1BSDA 3GAXA 4GSPA 3NXJA 1HYFA 2ZDJA 4HM1B 2CG1A 1TU5A 2BIRA 3F14A 3LTCA 4WYKA 2JDIH 2R41A 4R4KA 2OTJ3 4K1UA 3WHOA 5M19A 3OWYA 3SX1A 5AI1A 3K9MC 1OGXA 3VF1A 1VQ73 1G02A 1C7HA 1W00A 1M9GA 1ASKA 2KF3A 2Q07A 4HOHA 3UL6A 1V57A 2F4YA 4L7KA 4WFOA 2GEXA 3CXC2 1ZGXA 5AIHA 1FGRA 1ZO2A 1CQSA 2C10A 4G1MB 4GHOA 2QEX3 3AHWA 4HKVB 1N8QA 2KCDA 5IEOA 4N6MA 4HM2B 3NM2A 4XDVA 3S67A 1VQK3 4N6UA 3DGYA 1UUWB 3HK4A 2CHCA 1I8VA 3H3HA 1KD14 1UCKA 5IW9A 1OF5B 3G713 1A2VA 2CX1A 5HOHA 3LYGA 5G1LA 3F9SA 3LH4A 3B8LA 1TUHA 3FGYA 4BL3A 2CC3A 2O9UX 3UL5A 1LOVA 4H3UA 4OK0A 1O7PB 3MSOA 1SJWA 3F7XA 3LMLA 2WGQA 2MC8A 2XF3A 1YIJ3 1JBSA 3SLUA 1M1K4 4LGQA 3PZWA 1B3SA 2INXA 3O8YA 5GSPA 2CG0A 3V99A 1L5GB 4HM8B 1YJN3 1BSEA 2E2TA 2KXGA 4I4KA 3CCV3 1RGLA 1GMPA 1IK3A 3UB1A 2W0QA 4X2OA 3CCS3 4LZIA 5BIRA 2XGNA 1RGFA 3T0UA 1WMPA 1MNLA 3N8BA 3I553 3EN8A 6STDA 4EBGA 3A5EA 4R9LA 3EB8A 3OWSA 1B2UA 2RBIA 1ROAA 3BNEA 1O7HB 2BNGA 4BTWA 2HMJB 3FLJA 5TGNA 5IEPA 4FR9A 3X3YA 3LTAA 1JZOA 3SXXA 1GOUA 2CFWA 2RNTA 3FG1A 3IMAB 3CNMA 1SPUA 1B27A 4N6NB 5KP4A 2OTL3 5IG5A 1I70A 2AADA 1FYSA 1IVVA 2CK3H 4GL6A 4R1KA 1M1XB 4K1VA 3NBBA 3ECFA 5BU4A 1RGCA 2H0HA 3K63A 1EA2A 3PCRA 1OGZA 3IPTA 1UCLA 3D9RA 1IDPA 4JRFA 3GRDA 5AIFA 1JRQA 1GY5A 2BMQB 3F7SA 4WWUC 1RGEA 6RNTA 1NDOB 1I3IA 4R9KA 2RSXA 1RCKA 3V98A 3CPW2 3Q3FA 1MGWA 3EQQB 3PGBA 1D6UA 3HX8A 4Q53A 1BSCA 1TTOA 3RGRA 3CC73 3CCQ3 1Q814 1GD4A 1E97A 5EQLA 2CFKA 2HMKB 3FG3A 3NBJA 4LMIA 1NNVA 2KRTA 1FGQA 2STDA 1LQMB 1SARA 3NV0B 1T2HA 4KZ1A 4N6TA 1K8A4 1A67A 1GS3A 5AEWB 5JPPA 1TP6A 2C11A 2D42A 3AMOB 1BOXA 2D1WA 2W2CA 3AHSA 1BGSA 1EUIC 1K41A 2L4VA 2W9QA 4O3VA 1X1YA 2Z6BA 5FW5A 3DGNA 2HMLB 1X1WA 3CCJ3 2B24B 2P05A 4EXRA 1OHSA 1AVKA 1J2BA 1JB2A 2Y73A 3CPOA 3KN4A 4HVNA 1K734 4K61A 1D6YA 2HMOB 3BNBA 2XH9A 3KE7A 1JNQA 4LSOA 4HM3B 3PXMA 4O8SA 1GY6A 2B1XB 2P0MA 2GU1A 4O2HA 2CWVA 2KF5A 1Q7Y4 1NWWA 1RN1A 5IF6A 5CXOA 2R4IA 1CH0A 3FH1A 1YI23 8CHOA 1JKGB 3GZXB 5IG4A 1RLSA 2RCDA 1LOYA 4PEJA 5IERA 1IQYA 4O02B 3B7CA 4OVMA 3WODG 5BXQA 1RHLA 3HI7A 5D81A 4NPBA 3Q90A 1TFOA 4OUQA 4EV2A 1K9M4 1FGOA 5EVHA 5I97A 1NB5I 3G8ZA 2BU4A 1BRSA 3CME3 5IENA 1DVDA 3DGLA 1OF5A 3URPA 1JB5A 5CF1A 1RGGA 2GXFA 4HAAA 3SYUA 3KZTA 3WA2X 3D79A 1BRHA 3MPHA 2PZVA 2Z77A 1FGTA 1W4NA 2XSHB 2OWPA 3S28A 3VGNA 3GZYB 2CW9A 3NQZA 3S27A 2Z7AA 1VQ43 3FF0A 3T8NA 2CWTA 3ZG0A 1DYUA 3ZG5A 2P0XA 5AEUB 1LQGC 2BT3A 3EN1B 3K7CA 2GBXB 4XM4A 1E3RA 1IV7A 3X40A 2FXTA 3F8HA 1A90A 3NHXA 3NQYA 1Q9EA 3OWUA 1YHQ3 1RRHA 2OOVA 5JPUA 1GD3A 1WMNA 3NUVA 2XFSA 1RGKA 5CK6A 3UNLA 1EEJA 1E3VA 3MHEA 3GZRA 1BVIA 4CJNA 1G0TA 1AQZA 1JB4A 1G96A 5LC6A 5KP1A 3EBTA 1GMQA 2Y74A 3LT8A 1PYLA 2ML5A 3KFQC 2CIUA 1F8NA 4FMAA 6GSPA 4HZBB 2FGTA 4HYZA 2XR8B 2OCTA 3KSPA 1KC84 4EYCA 1QVF2 1WMOA 4FMBA 1QJGA 2AAEA 1BIRA 2WGOA 3H51A 3CCM3 4XBTA 2GBWB 3BNDA 3WR2A 1DETA 2CFLA 2LQVA 1UCIA 1U8CB 1STDA 4I5QA 4K90B 4NHFA 2PNCA 1US1A 3LTBA 2F5MA 2WOFA 4DKIA 1W5ZA 4AKYA 3EC9A 1OCVA 1W7CA 2F99A 2JQ5A 2W04A 1B2SA 1ROVA 4RNTA 3FCSB 9RNTA 1EQKA 3X3XA 5AIIA 5JBSA 3L0RA 5AIGA 1BRIA 2BMRB 3MYTA 3RNTA 3G4S3 1MWSA 1EKMA 1YVSA 1TRPA 4STDA 1IYYA 4HM7B 3T8UA 5FGOA 2YFIB 3WMDA 2QA43 1BRKA 1OHPA 3BIRA 1TJDA 3DH2A 3B4PA 3HZPA 2ZA4A 3HIIA 3UJMA 2L1SA 2QIYA 1SQWA 1N5PA 2XGLA 3I563 1UI7A 1X1XA 3NV0A 5IG3A 1Y4KA 3SOAA 1VQP3 4FCMA 1MWUA 3AMOA 2IUJA 2Z76A 3CC23 1ULIB 1B2XA 3JUQA 1I3FA 4HJLB 2IA7A 1UGIA 3D5GA 3IJEB 3J7Yd 1IVUA 3FZWA 1DMNA 4XDWA 2IUKA 4J8TA 2V1LA 1UW1A 1RCLA 1C54A 1O7NB 1W02A 2FNQA 2H0IA 5AYRB 1ISKA 3AGOA 1YJW3 2F5WA 1NO3A 1PFPA 3EBYA 3HIGA 5IG0A 1ZX2A 5BVBA 2OQEC 1BNRA 1N9JA 2GSPA 4J5KA 1BUQA 3AGNA 1JV2B 4HBRA 2W56B 3JVCA 4QWTA 1CYUA 3KIIA 4ILFA 3F40A 4HM5B 1I2FA 4RBNA 2F86B 3GWRA 3M8CA 3U1WA 4MEIA 1MGRA 2WOHA 3K5TA 3JUOA 4IIAA 1BRGA 1JKGA 1UDII 3DUKA 1FA3A 1NB3I 2W9PA 1FW7A 2RGQA 3EF8A 4HM6B 1TRQA 7RNTA 3CC43 1QALA 3VSYA 1I2EA 1DMMA 1I2GA 2C4BA 3E99A 1OACA 1T5YA 1LXEA 1O7WB 4HM4B 1CYVA 2IY2A 3BLZA 4ORLA 1IT8A 4N6OB 3WOEB 3DY5A 2MF7A 1Q7HA 1ULJB 3G0KA 4MMZB 4CCVA 7GSPA 4MJDA 3Q2PA 1BUJA 2W6JH 1T2IA 4J5GA 1UI8A 3BU4A 1O7GB 3WDGB 1VQ63 1BNSA 1BNIA 2E2UA 1Q40B 1BNEA 1RSNA 1UUVB 3CCE3 1VQM3 1JBTA 1RRLA 3FF2A 1KWIA 1HKXA 4L8OA 1BAOA 3D5IA 1QVG2 1QMAA 3I0YA 1NU3A 4FCJA 1PU4A 1Q824 1NJI4 3EHCA 3CNXA 1IQ8A 4EW5A 4XB5A 2GU3A 5LC7A 2SBLA 5EEOA 1T3BA 1X1UA 2BO9B 5DREA 1VQN3 3LXUX 3GZBA 1W6CA 2KF4A 1W6GA 3OXAA 2UX0A 3G16A 2YX9A 4R80A 5DRVA 2P09A 1AVLA 1RKYA 2P38A 3DZLA 1W6YA 1SIIA 1IV9A 1Q42A 1B2ZA 3DM8A 3FG4A 1OH0A 1TFKA 4JF8A 4N3VA 2BMOB 1A2KA 1BANA 5M1AA 1JBRA 1KQS2 2UGIA 1VQ93 1LOWA 4XBXA 1N5HA 1RDSA 3MG3A 4RZMA 3KSED 4WP5A 4FMCA 1AY7A 5RNTA 1RMSA 1DVCA 1IVXA 4J9AA 1JZDA 1QAFA 5M18A 4HZ9B 1OPYA 4LYLB 3CMA3 1S723 3SOYA 3V92A 5G2GA 1A2PA 4U13A 1Q864 2QGUA 7STDA 1R4CA 1JJ22 4RNYA 1B21A 1FGMA 2CWUA 3MG1A 1VQ53 3LOYA 3MKIA 4IPBA 1FUTA 1OHOA 1R4YA 1UGHI 3PS8A 1LNHA 2M7OA 1JN5B 1W2ZA 1I0XA 1V58A 2J8XB 3NM7A 1BNFA 2LYXA 5CLKA 5ELUA 1FUSA 5D82A 3X41A 1BRJA 3LT9A 3NBRA 4WYKB 1I0VA 2XEPA 1N8R4 1B2MA 2YFJB 3D4AA 1MWTA 4XBYA 1LVNA 3PCSA 1EG9B 2HMMB 1LRAA 3WA3A 3RDEA 1GYBA 1Z1SA 2CFGA 2OOVC 1VZZA 2UUGC 4NREA 3TDGA 1IU7A 3BNCA 1BRNL 1MWRA 2W56A 2XSOB 1M904 2CKFB 4RNZA 5HGRA 2OQEA 3EX9A 4CDLA 1GY7A 2ZHXB 1W2B2 3MWZA 3PYJA 1VQQA 1YGEA 5AYSC 2O3OA 3GSPA 3ALAA 1W01A 3B4OA 3LZAA 5ELJA 2CX0A 2YFLB 3QK9A 4MMYB 3JUPA 2F56A 1BSBA 2H0GA 1RN7A 3FSDA 4N6LA 5STDA 4FCZA 2IYJA 4KVHA 2XFTA 2W03A 1UCJA 3LTDA 2HMNB 4BTXA 1WTHA 2RFRA 4KFEA 1GMRA 1VQL3 3RGAA 5G1KA 2XRXB 3MG2A 1LNIA 3DMCA 4KT3B 3FKAA 3SEDA 4LEHA 3K0ZA 3U97A 2K0MA 3EE1A 1AR0A 2ML6A 4H61A 2K54A 3CCL3 1YJ93 2HOHA 1Q40A 1BSAA 5D83A 4WHAA 4BL2A 1SIHA 2WO0A 1O7MB 1RGHA 1GOVA 3OV4A 3ER7A 3CD63 4IT7A 2I9WA 3Q1CA 3SVAA 4X2HA 3STDA 3F8XA 1U5OA 1PY3A 1V74A 1KSIA 3CCU3 1VQ83 4L8PA 3KCHA 1RN4A 1YIT3 1FZUA 5CF2A 3EJVA 4BU4A 1B20A 3ZFZA 5KP3A 3QRDA 4GB5A
chains in the Genus database with same CATH topology
2E2VA 4EV5A 4FMDA 3CU3A 1HU9A 1IT7A 3A76A 4KFFA 1VQO3 1WNHA 1CEWI 1RJOA 3DGOA 4AEQA 4BTYA 3WOFB 3JUNA 3OX9A 1QAKA 3X42A 4AKZA 1IQXA 2F98A 3DGMA 1OUNA 4EC6A 1DMQA 3NX0A 3ROBA 1AV4A 3BB9A 3N9HA 4N6V0 4HM0B 3S5CA 3JUMA 3G6E3 4KFDA 5A0OB 1FUWA 2CH9A 2CFDA 1MOLA 2GEYA 1TIJA 4MMXB 1LOXA 2IMJA 3DXOA 3X3ZA 2BHMA 3N54B 1K28A 1YVBI 3D3LA 2ZL8A 3KKGA 4ZM8A 3S29A 3OW22 1STFI 1JN5A 2A15A 3CCR3 1D6ZA 1S5AA 1IVWA 1N9EA 1WQLB 4TX4A 3GAXA 3NXJA 2ZDJA 4HM1B 2CG1A 1TU5A 3LTCA 3F14A 4WYKA 2JDIH 2OTJ3 4R4KA 4K1UA 3OWYA 3SX1A 5AI1A 3K9MC 1OGXA 3VF1A 1VQ73 1C7HA 1W00A 1M9GA 1ASKA 3UL6A 2Q07A 4L7KA 4WFOA 2GEXA 3CXC2 5AIHA 1FGRA 1ZO2A 1CQSA 2C10A 4G1MB 2QEX3 4HKVB 1N8QA 2KCDA 5IEOA 4N6MA 4HM2B 3NM2A 4XDVA 3S67A 1VQK3 4N6UA 1UUWB 3HK4A 2CHCA 3H3HA 1KD14 5IW9A 3G713 1OF5B 1A2VA 3LYGA 3F9SA 3LH4A 3B8LA 1TUHA 3FGYA 2CC3A 2O9UX 3UL5A 4H3UA 4OK0A 1O7PB 3MSOA 1SJWA 3F7XA 3LMLA 2WGQA 2MC8A 2XF3A 1YIJ3 3SLUA 1M1K4 4LGQA 3PZWA 2INXA 3O8YA 2CG0A 3V99A 1L5GB 4HM8B 1YJN3 2E2TA 2KXGA 4I4KA 3CCV3 1IK3A 3UB1A 2W0QA 4X2OA 3CCS3 4LZIA 2XGNA 3T0UA 1WMPA 1MNLA 3N8BA 3I553 3EN8A 6STDA 4EBGA 4R9LA 3EB8A 3OWSA 3BNEA 1ROAA 1O7HB 2BNGA 4BTWA 2HMJB 3FLJA 5TGNA 5IEPA 4FR9A 3X3YA 3LTAA 3SXXA 2CFWA 3FG1A 3IMAB 3CNMA 1SPUA 4N6NB 5KP4A 2OTL3 5IG5A 1IVVA 2CK3H 4GL6A 4R1KA 1M1XB 4K1VA 3NBBA 3ECFA 3K63A 1EA2A 3PCRA 1OGZA 3IPTA 3D9RA 1IDPA 4JRFA 3GRDA 5AIFA 1JRQA 1GY5A 2BMQB 3F7SA 4WWUC 1NDOB 4R9KA 2RSXA 3V98A 3CPW2 3EQQB 3PGBA 1D6UA 3HX8A 4Q53A 3RGRA 3CC73 3CCQ3 1Q814 1GD4A 1E97A 5EQLA 2CFKA 2HMKB 3FG3A 3NBJA 4LMIA 2KRTA 1FGQA 2STDA 3NV0B 4KZ1A 4N6TA 1K8A4 1A67A 1GS3A 5AEWB 5JPPA 1TP6A 2C11A 2D42A 3AMOB 2D1WA 2W2CA 1K41A 2L4VA 2W9QA 4O3VA 2Z6BA 5FW5A 3DGNA 2HMLB 3CCJ3 2B24B 2P05A 4EXRA 1OHSA 1AVKA 1J2BA 1JB2A 2Y73A 3CPOA 3KN4A 4HVNA 1K734 4K61A 1D6YA 2HMOB 3BNBA 2XH9A 3KE7A 1JNQA 4LSOA 4HM3B 3PXMA 4O8SA 1GY6A 2B1XB 2P0MA 2GU1A 4O2HA 2CWVA 1Q7Y4 1NWWA 5IF6A 5CXOA 2R4IA 3FH1A 1YI23 8CHOA 1JKGB 3GZXB 5IG4A 2RCDA 4PEJA 5IERA 1IQYA 4O02B 3B7CA 4OVMA 3WODG 5BXQA 3HI7A 5D81A 3Q90A 1TFOA 4OUQA 4EV2A 1K9M4 1FGOA 5EVHA 5I97A 1NB5I 3G8ZA 1DVDA 3CME3 5IENA 3DGLA 1OF5A 1JB5A 5CF1A 3WA2X 2GXFA 3KZTA 3MPHA 3S28A 2PZVA 2Z77A 1FGTA 1W4NA 2XSHB 2OWPA 3VGNA 3GZYB 2CW9A 3NQZA 3S27A 2Z7AA 1VQ43 3FF0A 3T8NA 2CWTA 1DYUA 2P0XA 5AEUB 2BT3A 3EN1B 3K7CA 2GBXB 4XM4A 1E3RA 1IV7A 3X40A 2FXTA 3F8HA 1A90A 3NHXA 3NQYA 3OWUA 1YHQ3 1RRHA 2OOVA 5JPUA 1GD3A 1WMNA 3NUVA 2XFSA 5CK6A 3UNLA 1E3VA 3MHEA 3GZRA 1G96A 1JB4A 5LC6A 5KP1A 3EBTA 2Y74A 3LT8A 2ML5A 3KFQC 2CIUA 1F8NA 4FMAA 4HZBB 2FGTA 4HYZA 2XR8B 2OCTA 3KSPA 1KC84 4EYCA 1QVF2 1WMOA 4FMBA 2WGOA 1QJGA 3CCM3 3H51A 4XBTA 2GBWB 3BNDA 2CFLA 2LQVA 1U8CB 1STDA 4K90B 4NHFA 2PNCA 1US1A 3LTBA 2WOFA 1W5ZA 4AKYA 3EC9A 1OCVA 1W7CA 2F99A 2JQ5A 2W04A 1ROVA 3FCSB 1EQKA 3X3XA 5AIIA 5JBSA 3L0RA 5AIGA 2BMRB 3MYTA 3G4S3 1EKMA 4STDA 4HM7B 3T8UA 5FGOA 2YFIB 3WMDA 2QA43 1OHPA 3B4PA 3HZPA 3HIIA 3UJMA 2QIYA 1SQWA 1N5PA 2XGLA 3I563 1UI7A 3NV0A 5IG3A 1Y4KA 3SOAA 1VQP3 4FCMA 3AMOA 2IUJA 2Z76A 3CC23 1ULIB 3JUQA 4HJLB 2IA7A 3IJEB 3J7Yd 1IVUA 3FZWA 1DMNA 4XDWA 2IUKA 4J8TA 2V1LA 1UW1A 1O7NB 1W02A 2FNQA 5AYRB 1ISKA 1YJW3 1NO3A 1PFPA 3EBYA 3HIGA 5IG0A 1ZX2A 5BVBA 2OQEC 1N9JA 1BUQA 1JV2B 4HBRA 2W56B 3JVCA 4QWTA 1CYUA 3KIIA 3F40A 4HM5B 4RBNA 2F86B 3GWRA 3M8CA 3U1WA 4MEIA 2WOHA 3K5TA 3JUOA 4IIAA 1JKGA 3DUKA 1FA3A 1NB3I 2W9PA 2RGQA 3EF8A 4HM6B 3CC43 1QALA 3VSYA 1DMMA 3E99A 1OACA 1T5YA 1LXEA 1O7WB 4HM4B 1CYVA 3BLZA 4ORLA 1IT8A 4N6OB 3WOEB 3DY5A 2MF7A 1ULJB 3G0KA 4MMZB 4CCVA 4MJDA 3Q2PA 2W6JH 1UI8A 1O7GB 3WDGB 1VQ63 2E2UA 1Q40B 1UUVB 3CCE3 1VQM3 1RRLA 3FF2A 1KWIA 1HKXA 4L8OA 1QVG2 1QMAA 3I0YA 1NU3A 4FCJA 1PU4A 1Q824 1NJI4 3EHCA 3CNXA 1IQ8A 4XB5A 2GU3A 5LC7A 2SBLA 5EEOA 2BO9B 5DREA 1VQN3 3LXUX 3GZBA 1W6CA 1W6GA 3OXAA 2UX0A 3G16A 2YX9A 4R80A 5DRVA 2P09A 1AVLA 1RKYA 2P38A 3DZLA 1W6YA 1SIIA 1IV9A 1Q42A 3DM8A 3FG4A 1OH0A 1TFKA 4JF8A 4N3VA 2BMOB 1A2KA 1KQS2 1VQ93 4XBXA 1N5HA 3MG3A 4RZMA 3KSED 4WP5A 4FMCA 1DVCA 1IVXA 4J9AA 1QAFA 4HZ9B 1OPYA 3CMA3 1S723 3SOYA 3V92A 5G2GA 4U13A 1Q864 2QGUA 7STDA 1R4CA 1JJ22 4RNYA 1FGMA 2CWUA 3MG1A 1VQ53 3LOYA 3MKIA 4IPBA 1OHOA 3PS8A 1LNHA 2M7OA 1JN5B 1W2ZA 3NM7A 2LYXA 5CLKA 5ELUA 5D82A 3X41A 3LT9A 3NBRA 4WYKB 2XEPA 1N8R4 2YFJB 4XBYA 1LVNA 3PCSA 1EG9B 2HMMB 3WA3A 3RDEA 1GYBA 1Z1SA 2CFGA 2OOVC 1VZZA 4NREA 3TDGA 1IU7A 3BNCA 2W56A 2XSOB 1M904 2CKFB 4RNZA 5HGRA 2OQEA 3EX9A 4CDLA 1GY7A 1W2B2 3MWZA 3PYJA 1YGEA 5AYSC 2O3OA 3ALAA 1W01A 3B4OA 3LZAA 5ELJA 2YFLB 3QK9A 4MMYB 3JUPA 1RN7A 3FSDA 4N6LA 5STDA 4FCZA 4KVHA 2XFTA 2W03A 3LTDA 2HMNB 4BTXA 1WTHA 2RFRA 4KFEA 1VQL3 3RGAA 2XRXB 3MG2A 3DMCA 3FKAA 3SEDA 4LEHA 3K0ZA 3U97A 2K0MA 3EE1A 1AR0A 2ML6A 4H61A 2K54A 3CCL3 1YJ93 1Q40A 5D83A 4WHAA 1SIHA 2WO0A 1O7MB 3OV4A 3ER7A 3CD63 4IT7A 2I9WA 3Q1CA 3SVAA 4X2HA 3STDA 3F8XA 1U5OA 1V74A 1KSIA 3CCU3 1VQ83 4L8PA 1YIT3 5CF2A 3EJVA 5KP3A 3QRDA 4GB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1W A;  4IPB A;  4K61 A;  4HBR A;  4FR9 A; 
#chains in the Genus database with same CATH topology
 2E2V A;  4EV5 A;  4FMD A;  3CU3 A;  1HU9 A;  1IT7 A;  1RTU A;  3A76 A;  3HOH A;  4KFF A;  1UUG B;  1GOY A;  1VQO 3;  1WNH A;  1CEW I;  1RJO A;  3DGO A;  4AEQ A;  2KF6 A;  4BTY A;  3WOF B;  3JUN A;  3OX9 A;  1QAK A;  3X42 A;  4AKZ A;  1IQX A;  1HZ1 A;  2F98 A;  1RNT A;  3DGM A;  1OUN A;  4EC6 A;  8RNT A;  1GSP A;  1DMQ A;  3NX0 A;  1RNB A;  3ROB A;  1AV4 A;  1YGW A;  3BB9 A;  3N9H A;  1RGA A;  4N6V 0;  4HM0 B;  3S5C A;  3JUM A;  3G6E 3;  4BIR A;  1BNJ A;  4KFD A;  4CPK A;  5A0O B;  1YNV X;  1BU4 A;  1FUW A;  2CH9 A;  2CFD A;  1MOL A;  2SAR A;  2GEY A;  1TIJ A;  4MMX B;  1LOX A;  2IMJ A;  3DXO A;  3X3Z A;  2BHM A;  1ZS7 A;  3N54 B;  1K28 A;  2K3D A;  1YVB I;  3D3L A;  2ZL8 A;  3KKG A;  4ZM8 A;  2KAA A;  3S29 A;  3OW2 2;  1STF I;  1JN5 A;  2A15 A;  3CCR 3;  1D6Z A;  1S5A A;  1IVW A;  1N9E A;  1WQL B;  4TX4 A;  1DE3 A;  1BNG A;  1BSD A;  3GAX A;  4GSP A;  3NXJ A;  1HYF A;  2ZDJ A;  4HM1 B;  2CG1 A;  1TU5 A;  2BIR A;  3F14 A;  3LTC A;  4WYK A;  2JDI H;  2R41 A;  4R4K A;  2OTJ 3;  4K1U A;  3WHO A;  5M19 A;  3OWY A;  3SX1 A;  5AI1 A;  3K9M C;  1OGX A;  3VF1 A;  1VQ7 3;  1G02 A;  1C7H A;  1W00 A;  1M9G A;  1ASK A;  2KF3 A;  2Q07 A;  4HOH A;  3UL6 A;  1V57 A;  2F4Y A;  4L7K A;  4WFO A;  2GEX A;  3CXC 2;  1ZGX A;  5AIH A;  1FGR A;  1ZO2 A;  1CQS A;  2C10 A;  4G1M B;  4GHO A;  2QEX 3;  3AHW A;  4HKV B;  1N8Q A;  2KCD A;  5IEO A;  4N6M A;  4HM2 B;  3NM2 A;  4XDV A;  3S67 A;  1VQK 3;  4N6U A;  3DGY A;  1UUW B;  3HK4 A;  2CHC A;  1I8V A;  3H3H A;  1KD1 4;  1UCK A;  5IW9 A;  1OF5 B;  3G71 3;  1A2V A;  2CX1 A;  5HOH A;  3LYG A;  5G1L A;  3F9S A;  3LH4 A;  3B8L A;  1TUH A;  3FGY A;  4BL3 A;  2CC3 A;  2O9U X;  3UL5 A;  1LOV A;  4H3U A;  4OK0 A;  1O7P B;  3MSO A;  1SJW A;  3F7X A;  3LML A;  2WGQ A;  2MC8 A;  2XF3 A;  1YIJ 3;  1JBS A;  3SLU A;  1M1K 4;  4LGQ A;  3PZW A;  1B3S A;  2INX A;  3O8Y A;  5GSP A;  2CG0 A;  3V99 A;  1L5G B;  4HM8 B;  1YJN 3;  1BSE A;  2E2T A;  2KXG A;  4I4K A;  3CCV 3;  1RGL A;  1GMP A;  1IK3 A;  3UB1 A;  2W0Q A;  4X2O A;  3CCS 3;  4LZI A;  5BIR A;  2XGN A;  1RGF A;  3T0U A;  1WMP A;  1MNL A;  3N8B A;  3I55 3;  3EN8 A;  6STD A;  4EBG A;  3A5E A;  4R9L A;  3EB8 A;  3OWS A;  1B2U A;  2RBI A;  1ROA A;  3BNE A;  1O7H B;  2BNG A;  4BTW A;  2HMJ B;  3FLJ A;  5TGN A;  5IEP A;  4FR9 A;  3X3Y A;  3LTA A;  1JZO A;  3SXX A;  1GOU A;  2CFW A;  2RNT A;  3FG1 A;  3IMA B;  3CNM A;  1SPU A;  1B27 A;  4N6N B;  5KP4 A;  2OTL 3;  5IG5 A;  1I70 A;  2AAD A;  1FYS A;  1IVV A;  2CK3 H;  4GL6 A;  4R1K A;  1M1X B;  4K1V A;  3NBB A;  3ECF A;  5BU4 A;  1RGC A;  2H0H A;  3K63 A;  1EA2 A;  3PCR A;  1OGZ A;  3IPT A;  1UCL A;  3D9R A;  1IDP A;  4JRF A;  3GRD A;  5AIF A;  1JRQ A;  1GY5 A;  2BMQ B;  3F7S A;  4WWU C;  1RGE A;  6RNT A;  1NDO B;  1I3I A;  4R9K A;  2RSX A;  1RCK A;  3V98 A;  3CPW 2;  3Q3F A;  1MGW A;  3EQQ B;  3PGB A;  1D6U A;  3HX8 A;  4Q53 A;  1BSC A;  1TTO A;  3RGR A;  3CC7 3;  3CCQ 3;  1Q81 4;  1GD4 A;  1E97 A;  5EQL A;  2CFK A;  2HMK B;  3FG3 A;  3NBJ A;  4LMI A;  1NNV A;  2KRT A;  1FGQ A;  2STD A;  1LQM B;  1SAR A;  3NV0 B;  1T2H A;  4KZ1 A;  4N6T A;  1K8A 4;  1A67 A;  1GS3 A;  5AEW B;  5JPP A;  1TP6 A;  2C11 A;  2D42 A;  3AMO B;  1BOX A;  2D1W A;  2W2C A;  3AHS A;  1BGS A;  1EUI C;  1K41 A;  2L4V A;  2W9Q A;  4O3V A;  1X1Y A;  2Z6B A;  5FW5 A;  3DGN A;  2HML B;  1X1W A;  3CCJ 3;  2B24 B;  2P05 A;  4EXR A;  1OHS A;  1AVK A;  1J2B A;  1JB2 A;  2Y73 A;  3CPO A;  3KN4 A;  4HVN A;  1K73 4;  4K61 A;  1D6Y A;  2HMO B;  3BNB A;  2XH9 A;  3KE7 A;  1JNQ A;  4LSO A;  4HM3 B;  3PXM A;  4O8S A;  1GY6 A;  2B1X B;  2P0M A;  2GU1 A;  4O2H A;  2CWV A;  2KF5 A;  1Q7Y 4;  1NWW A;  1RN1 A;  5IF6 A;  5CXO A;  2R4I A;  1CH0 A;  3FH1 A;  1YI2 3;  8CHO A;  1JKG B;  3GZX B;  5IG4 A;  1RLS A;  2RCD A;  1LOY A;  4PEJ A;  5IER A;  1IQY A;  4O02 B;  3B7C A;  4OVM A;  3WOD G;  5BXQ A;  1RHL A;  3HI7 A;  5D81 A;  4NPB A;  3Q90 A;  1TFO A;  4OUQ A;  4EV2 A;  1K9M 4;  1FGO A;  5EVH A;  5I97 A;  1NB5 I;  3G8Z A;  2BU4 A;  1BRS A;  3CME 3;  5IEN A;  1DVD A;  3DGL A;  1OF5 A;  3URP A;  1JB5 A;  5CF1 A;  1RGG A;  2GXF A;  4HAA A;  3SYU A;  3KZT A;  3WA2 X;  3D79 A;  1BRH A;  3MPH A;  2PZV A;  2Z77 A;  1FGT A;  1W4N A;  2XSH B;  2OWP A;  3S28 A;  3VGN A;  3GZY B;  2CW9 A;  3NQZ A;  3S27 A;  2Z7A A;  1VQ4 3;  3FF0 A;  3T8N A;  2CWT A;  3ZG0 A;  1DYU A;  3ZG5 A;  2P0X A;  5AEU B;  1LQG C;  2BT3 A;  3EN1 B;  3K7C A;  2GBX B;  4XM4 A;  1E3R A;  1IV7 A;  3X40 A;  2FXT A;  3F8H A;  1A90 A;  3NHX A;  3NQY A;  1Q9E A;  3OWU A;  1YHQ 3;  1RRH A;  2OOV A;  5JPU A;  1GD3 A;  1WMN A;  3NUV A;  2XFS A;  1RGK A;  5CK6 A;  3UNL A;  1EEJ A;  1E3V A;  3MHE A;  3GZR A;  1BVI A;  4CJN A;  1G0T A;  1AQZ A;  1JB4 A;  1G96 A;  5LC6 A;  5KP1 A;  3EBT A;  1GMQ A;  2Y74 A;  3LT8 A;  1PYL A;  2ML5 A;  3KFQ C;  2CIU A;  1F8N A;  4FMA A;  6GSP A;  4HZB B;  2FGT A;  4HYZ A;  2XR8 B;  2OCT A;  3KSP A;  1KC8 4;  4EYC A;  1QVF 2;  1WMO A;  4FMB A;  1QJG A;  2AAE A;  1BIR A;  2WGO A;  3H51 A;  3CCM 3;  4XBT A;  2GBW B;  3BND A;  3WR2 A;  1DET A;  2CFL A;  2LQV A;  1UCI A;  1U8C B;  1STD A;  4I5Q A;  4K90 B;  4NHF A;  2PNC A;  1US1 A;  3LTB A;  2F5M A;  2WOF A;  4DKI A;  1W5Z A;  4AKY A;  3EC9 A;  1OCV A;  1W7C A;  2F99 A;  2JQ5 A;  2W04 A;  1B2S A;  1ROV A;  4RNT A;  3FCS B;  9RNT A;  1EQK A;  3X3X A;  5AII A;  5JBS A;  3L0R A;  5AIG A;  1BRI A;  2BMR B;  3MYT A;  3RNT A;  3G4S 3;  1MWS A;  1EKM A;  1YVS A;  1TRP A;  4STD A;  1IYY A;  4HM7 B;  3T8U A;  5FGO A;  2YFI B;  3WMD A;  2QA4 3;  1BRK A;  1OHP A;  3BIR A;  1TJD A;  3DH2 A;  3B4P A;  3HZP A;  2ZA4 A;  3HII A;  3UJM A;  2L1S A;  2QIY A;  1SQW A;  1N5P A;  2XGL A;  3I56 3;  1UI7 A;  1X1X A;  3NV0 A;  5IG3 A;  1Y4K A;  3SOA A;  1VQP 3;  4FCM A;  1MWU A;  3AMO A;  2IUJ A;  2Z76 A;  3CC2 3;  1ULI B;  1B2X A;  3JUQ A;  1I3F A;  4HJL B;  2IA7 A;  1UGI A;  3D5G A;  3IJE B;  3J7Y d;  1IVU A;  3FZW A;  1DMN A;  4XDW A;  2IUK A;  4J8T A;  2V1L A;  1UW1 A;  1RCL A;  1C54 A;  1O7N B;  1W02 A;  2FNQ A;  2H0I A;  5AYR B;  1ISK A;  3AGO A;  1YJW 3;  2F5W A;  1NO3 A;  1PFP A;  3EBY A;  3HIG A;  5IG0 A;  1ZX2 A;  5BVB A;  2OQE C;  1BNR A;  1N9J A;  2GSP A;  4J5K A;  1BUQ A;  3AGN A;  1JV2 B;  4HBR A;  2W56 B;  3JVC A;  4QWT A;  1CYU A;  3KII A;  4ILF A;  3F40 A;  4HM5 B;  1I2F A;  4RBN A;  2F86 B;  3GWR A;  3M8C A;  3U1W A;  4MEI A;  1MGR A;  2WOH A;  3K5T A;  3JUO A;  4IIA A;  1BRG A;  1JKG A;  1UDI I;  3DUK A;  1FA3 A;  1NB3 I;  2W9P A;  1FW7 A;  2RGQ A;  3EF8 A;  4HM6 B;  1TRQ A;  7RNT A;  3CC4 3;  1QAL A;  3VSY A;  1I2E A;  1DMM A;  1I2G A;  2C4B A;  3E99 A;  1OAC A;  1T5Y A;  1LXE A;  1O7W B;  4HM4 B;  1CYV A;  2IY2 A;  3BLZ A;  4ORL A;  1IT8 A;  4N6O B;  3WOE B;  3DY5 A;  2MF7 A;  1Q7H A;  1ULJ B;  3G0K A;  4MMZ B;  4CCV A;  7GSP A;  4MJD A;  3Q2P A;  1BUJ A;  2W6J H;  1T2I A;  4J5G A;  1UI8 A;  3BU4 A;  1O7G B;  3WDG B;  1VQ6 3;  1BNS A;  1BNI A;  2E2U A;  1Q40 B;  1BNE A;  1RSN A;  1UUV B;  3CCE 3;  1VQM 3;  1JBT A;  1RRL A;  3FF2 A;  1KWI A;  1HKX A;  4L8O A;  1BAO A;  3D5I A;  1QVG 2;  1QMA A;  3I0Y A;  1NU3 A;  4FCJ A;  1PU4 A;  1Q82 4;  1NJI 4;  3EHC A;  3CNX A;  1IQ8 A;  4EW5 A;  4XB5 A;  2GU3 A;  5LC7 A;  2SBL A;  5EEO A;  1T3B A;  1X1U A;  2BO9 B;  5DRE A;  1VQN 3;  3LXU X;  3GZB A;  1W6C A;  2KF4 A;  1W6G A;  3OXA A;  2UX0 A;  3G16 A;  2YX9 A;  4R80 A;  5DRV A;  2P09 A;  1AVL A;  1RKY A;  2P38 A;  3DZL A;  1W6Y A;  1SII A;  1IV9 A;  1Q42 A;  1B2Z A;  3DM8 A;  3FG4 A;  1OH0 A;  1TFK A;  4JF8 A;  4N3V A;  2BMO B;  1A2K A;  1BAN A;  5M1A A;  1JBR A;  1KQS 2;  2UGI A;  1VQ9 3;  1LOW A;  4XBX A;  1N5H A;  1RDS A;  3MG3 A;  4RZM A;  3KSE D;  4WP5 A;  4FMC A;  1AY7 A;  5RNT A;  1RMS A;  1DVC A;  1IVX A;  4J9A A;  1JZD A;  1QAF A;  5M18 A;  4HZ9 B;  1OPY A;  4LYL B;  3CMA 3;  1S72 3;  3SOY A;  3V92 A;  5G2G A;  1A2P A;  4U13 A;  1Q86 4;  2QGU A;  7STD A;  1R4C A;  1JJ2 2;  4RNY A;  1B21 A;  1FGM A;  2CWU A;  3MG1 A;  1VQ5 3;  3LOY A;  3MKI A;  4IPB A;  1FUT A;  1OHO A;  1R4Y A;  1UGH I;  3PS8 A;  1LNH A;  2M7O A;  1JN5 B;  1W2Z A;  1I0X A;  1V58 A;  2J8X B;  3NM7 A;  1BNF A;  2LYX A;  5CLK A;  5ELU A;  1FUS A;  5D82 A;  3X41 A;  1BRJ A;  3LT9 A;  3NBR A;  4WYK B;  1I0V A;  2XEP A;  1N8R 4;  1B2M A;  2YFJ B;  3D4A A;  1MWT A;  4XBY A;  1LVN A;  3PCS A;  1EG9 B;  2HMM B;  1LRA A;  3WA3 A;  3RDE A;  1GYB A;  1Z1S A;  2CFG A;  2OOV C;  1VZZ A;  2UUG C;  4NRE A;  3TDG A;  1IU7 A;  3BNC A;  1BRN L;  1MWR A;  2W56 A;  2XSO B;  1M90 4;  2CKF B;  4RNZ A;  5HGR A;  2OQE A;  3EX9 A;  4CDL A;  1GY7 A;  2ZHX B;  1W2B 2;  3MWZ A;  3PYJ A;  1VQQ A;  1YGE A;  5AYS C;  2O3O A;  3GSP A;  3ALA A;  1W01 A;  3B4O A;  3LZA A;  5ELJ A;  2CX0 A;  2YFL B;  3QK9 A;  4MMY B;  3JUP A;  2F56 A;  1BSB A;  2H0G A;  1RN7 A;  3FSD A;  4N6L A;  5STD A;  4FCZ A;  2IYJ A;  4KVH A;  2XFT A;  2W03 A;  1UCJ A;  3LTD A;  2HMN B;  4BTX A;  1WTH A;  2RFR A;  4KFE A;  1GMR A;  1VQL 3;  3RGA A;  5G1K A;  2XRX B;  3MG2 A;  1LNI A;  3DMC A;  4KT3 B;  3FKA A;  3SED A;  4LEH A;  3K0Z A;  3U97 A;  2K0M A;  3EE1 A;  1AR0 A;  2ML6 A;  4H61 A;  2K54 A;  3CCL 3;  1YJ9 3;  2HOH A;  1Q40 A;  1BSA A;  5D83 A;  4WHA A;  4BL2 A;  1SIH A;  2WO0 A;  1O7M B;  1RGH A;  1GOV A;  3OV4 A;  3ER7 A;  3CD6 3;  4IT7 A;  2I9W A;  3Q1C A;  3SVA A;  4X2H A;  3STD A;  3F8X A;  1U5O A;  1PY3 A;  1V74 A;  1KSI A;  3CCU 3;  1VQ8 3;  4L8P A;  3KCH A;  1RN4 A;  1YIT 3;  1FZU A;  5CF2 A;  3EJV A;  4BU4 A;  1B20 A;  3ZFZ A;  5KP3 A;  3QRD A;  4GB5 A; 
#chains in the Genus database with same CATH homology
 2E2V A;  4EV5 A;  4FMD A;  3CU3 A;  1HU9 A;  1IT7 A;  3A76 A;  4KFF A;  1VQO 3;  1WNH A;  1CEW I;  1RJO A;  3DGO A;  4AEQ A;  4BTY A;  3WOF B;  3JUN A;  3OX9 A;  1QAK A;  3X42 A;  4AKZ A;  1IQX A;  2F98 A;  3DGM A;  1OUN A;  4EC6 A;  1DMQ A;  3NX0 A;  3ROB A;  1AV4 A;  3BB9 A;  3N9H A;  4N6V 0;  4HM0 B;  3S5C A;  3JUM A;  3G6E 3;  4KFD A;  5A0O B;  1FUW A;  2CH9 A;  2CFD A;  1MOL A;  2GEY A;  1TIJ A;  4MMX B;  1LOX A;  2IMJ A;  3DXO A;  3X3Z A;  2BHM A;  3N54 B;  1K28 A;  1YVB I;  3D3L A;  2ZL8 A;  3KKG A;  4ZM8 A;  3S29 A;  3OW2 2;  1STF I;  1JN5 A;  2A15 A;  3CCR 3;  1D6Z A;  1S5A A;  1IVW A;  1N9E A;  1WQL B;  4TX4 A;  3GAX A;  3NXJ A;  2ZDJ A;  4HM1 B;  2CG1 A;  1TU5 A;  3LTC A;  3F14 A;  4WYK A;  2JDI H;  2OTJ 3;  4R4K A;  4K1U A;  3OWY A;  3SX1 A;  5AI1 A;  3K9M C;  1OGX A;  3VF1 A;  1VQ7 3;  1C7H A;  1W00 A;  1M9G A;  1ASK A;  3UL6 A;  2Q07 A;  4L7K A;  4WFO A;  2GEX A;  3CXC 2;  5AIH A;  1FGR A;  1ZO2 A;  1CQS A;  2C10 A;  4G1M B;  2QEX 3;  4HKV B;  1N8Q A;  2KCD A;  5IEO A;  4N6M A;  4HM2 B;  3NM2 A;  4XDV A;  3S67 A;  1VQK 3;  4N6U A;  1UUW B;  3HK4 A;  2CHC A;  3H3H A;  1KD1 4;  5IW9 A;  3G71 3;  1OF5 B;  1A2V A;  3LYG A;  3F9S A;  3LH4 A;  3B8L A;  1TUH A;  3FGY A;  2CC3 A;  2O9U X;  3UL5 A;  4H3U A;  4OK0 A;  1O7P B;  3MSO A;  1SJW A;  3F7X A;  3LML A;  2WGQ A;  2MC8 A;  2XF3 A;  1YIJ 3;  3SLU A;  1M1K 4;  4LGQ A;  3PZW A;  2INX A;  3O8Y A;  2CG0 A;  3V99 A;  1L5G B;  4HM8 B;  1YJN 3;  2E2T A;  2KXG A;  4I4K A;  3CCV 3;  1IK3 A;  3UB1 A;  2W0Q A;  4X2O A;  3CCS 3;  4LZI A;  2XGN A;  3T0U A;  1WMP A;  1MNL A;  3N8B A;  3I55 3;  3EN8 A;  6STD A;  4EBG A;  4R9L A;  3EB8 A;  3OWS A;  3BNE A;  1ROA A;  1O7H B;  2BNG A;  4BTW A;  2HMJ B;  3FLJ A;  5TGN A;  5IEP A;  4FR9 A;  3X3Y A;  3LTA A;  3SXX A;  2CFW A;  3FG1 A;  3IMA B;  3CNM A;  1SPU A;  4N6N B;  5KP4 A;  2OTL 3;  5IG5 A;  1IVV A;  2CK3 H;  4GL6 A;  4R1K A;  1M1X B;  4K1V A;  3NBB A;  3ECF A;  3K63 A;  1EA2 A;  3PCR A;  1OGZ A;  3IPT A;  3D9R A;  1IDP A;  4JRF A;  3GRD A;  5AIF A;  1JRQ A;  1GY5 A;  2BMQ B;  3F7S A;  4WWU C;  1NDO B;  4R9K A;  2RSX A;  3V98 A;  3CPW 2;  3EQQ B;  3PGB A;  1D6U A;  3HX8 A;  4Q53 A;  3RGR A;  3CC7 3;  3CCQ 3;  1Q81 4;  1GD4 A;  1E97 A;  5EQL A;  2CFK A;  2HMK B;  3FG3 A;  3NBJ A;  4LMI A;  2KRT A;  1FGQ A;  2STD A;  3NV0 B;  4KZ1 A;  4N6T A;  1K8A 4;  1A67 A;  1GS3 A;  5AEW B;  5JPP A;  1TP6 A;  2C11 A;  2D42 A;  3AMO B;  2D1W A;  2W2C A;  1K41 A;  2L4V A;  2W9Q A;  4O3V A;  2Z6B A;  5FW5 A;  3DGN A;  2HML B;  3CCJ 3;  2B24 B;  2P05 A;  4EXR A;  1OHS A;  1AVK A;  1J2B A;  1JB2 A;  2Y73 A;  3CPO A;  3KN4 A;  4HVN A;  1K73 4;  4K61 A;  1D6Y A;  2HMO B;  3BNB A;  2XH9 A;  3KE7 A;  1JNQ A;  4LSO A;  4HM3 B;  3PXM A;  4O8S A;  1GY6 A;  2B1X B;  2P0M A;  2GU1 A;  4O2H A;  2CWV A;  1Q7Y 4;  1NWW A;  5IF6 A;  5CXO A;  2R4I A;  3FH1 A;  1YI2 3;  8CHO A;  1JKG B;  3GZX B;  5IG4 A;  2RCD A;  4PEJ A;  5IER A;  1IQY A;  4O02 B;  3B7C A;  4OVM A;  3WOD G;  5BXQ A;  3HI7 A;  5D81 A;  3Q90 A;  1TFO A;  4OUQ A;  4EV2 A;  1K9M 4;  1FGO A;  5EVH A;  5I97 A;  1NB5 I;  3G8Z A;  1DVD A;  3CME 3;  5IEN A;  3DGL A;  1OF5 A;  1JB5 A;  5CF1 A;  3WA2 X;  2GXF A;  3KZT A;  3MPH A;  3S28 A;  2PZV A;  2Z77 A;  1FGT A;  1W4N A;  2XSH B;  2OWP A;  3VGN A;  3GZY B;  2CW9 A;  3NQZ A;  3S27 A;  2Z7A A;  1VQ4 3;  3FF0 A;  3T8N A;  2CWT A;  1DYU A;  2P0X A;  5AEU B;  2BT3 A;  3EN1 B;  3K7C A;  2GBX B;  4XM4 A;  1E3R A;  1IV7 A;  3X40 A;  2FXT A;  3F8H A;  1A90 A;  3NHX A;  3NQY A;  3OWU A;  1YHQ 3;  1RRH A;  2OOV A;  5JPU A;  1GD3 A;  1WMN A;  3NUV A;  2XFS A;  5CK6 A;  3UNL A;  1E3V A;  3MHE A;  3GZR A;  1G96 A;  1JB4 A;  5LC6 A;  5KP1 A;  3EBT A;  2Y74 A;  3LT8 A;  2ML5 A;  3KFQ C;  2CIU A;  1F8N A;  4FMA A;  4HZB B;  2FGT A;  4HYZ A;  2XR8 B;  2OCT A;  3KSP A;  1KC8 4;  4EYC A;  1QVF 2;  1WMO A;  4FMB A;  2WGO A;  1QJG A;  3CCM 3;  3H51 A;  4XBT A;  2GBW B;  3BND A;  2CFL A;  2LQV A;  1U8C B;  1STD A;  4K90 B;  4NHF A;  2PNC A;  1US1 A;  3LTB A;  2WOF A;  1W5Z A;  4AKY A;  3EC9 A;  1OCV A;  1W7C A;  2F99 A;  2JQ5 A;  2W04 A;  1ROV A;  3FCS B;  1EQK A;  3X3X A;  5AII A;  5JBS A;  3L0R A;  5AIG A;  2BMR B;  3MYT A;  3G4S 3;  1EKM A;  4STD A;  4HM7 B;  3T8U A;  5FGO A;  2YFI B;  3WMD A;  2QA4 3;  1OHP A;  3B4P A;  3HZP A;  3HII A;  3UJM A;  2QIY A;  1SQW A;  1N5P A;  2XGL A;  3I56 3;  1UI7 A;  3NV0 A;  5IG3 A;  1Y4K A;  3SOA A;  1VQP 3;  4FCM A;  3AMO A;  2IUJ A;  2Z76 A;  3CC2 3;  1ULI B;  3JUQ A;  4HJL B;  2IA7 A;  3IJE B;  3J7Y d;  1IVU A;  3FZW A;  1DMN A;  4XDW A;  2IUK A;  4J8T A;  2V1L A;  1UW1 A;  1O7N B;  1W02 A;  2FNQ A;  5AYR B;  1ISK A;  1YJW 3;  1NO3 A;  1PFP A;  3EBY A;  3HIG A;  5IG0 A;  1ZX2 A;  5BVB A;  2OQE C;  1N9J A;  1BUQ A;  1JV2 B;  4HBR A;  2W56 B;  3JVC A;  4QWT A;  1CYU A;  3KII A;  3F40 A;  4HM5 B;  4RBN A;  2F86 B;  3GWR A;  3M8C A;  3U1W A;  4MEI A;  2WOH A;  3K5T A;  3JUO A;  4IIA A;  1JKG A;  3DUK A;  1FA3 A;  1NB3 I;  2W9P A;  2RGQ A;  3EF8 A;  4HM6 B;  3CC4 3;  1QAL A;  3VSY A;  1DMM A;  3E99 A;  1OAC A;  1T5Y A;  1LXE A;  1O7W B;  4HM4 B;  1CYV A;  3BLZ A;  4ORL A;  1IT8 A;  4N6O B;  3WOE B;  3DY5 A;  2MF7 A;  1ULJ B;  3G0K A;  4MMZ B;  4CCV A;  4MJD A;  3Q2P A;  2W6J H;  1UI8 A;  1O7G B;  3WDG B;  1VQ6 3;  2E2U A;  1Q40 B;  1UUV B;  3CCE 3;  1VQM 3;  1RRL A;  3FF2 A;  1KWI A;  1HKX A;  4L8O A;  1QVG 2;  1QMA A;  3I0Y A;  1NU3 A;  4FCJ A;  1PU4 A;  1Q82 4;  1NJI 4;  3EHC A;  3CNX A;  1IQ8 A;  4XB5 A;  2GU3 A;  5LC7 A;  2SBL A;  5EEO A;  2BO9 B;  5DRE A;  1VQN 3;  3LXU X;  3GZB A;  1W6C A;  1W6G A;  3OXA A;  2UX0 A;  3G16 A;  2YX9 A;  4R80 A;  5DRV A;  2P09 A;  1AVL A;  1RKY A;  2P38 A;  3DZL A;  1W6Y A;  1SII A;  1IV9 A;  1Q42 A;  3DM8 A;  3FG4 A;  1OH0 A;  1TFK A;  4JF8 A;  4N3V A;  2BMO B;  1A2K A;  1KQS 2;  1VQ9 3;  4XBX A;  1N5H A;  3MG3 A;  4RZM A;  3KSE D;  4WP5 A;  4FMC A;  1DVC A;  1IVX A;  4J9A A;  1QAF A;  4HZ9 B;  1OPY A;  3CMA 3;  1S72 3;  3SOY A;  3V92 A;  5G2G A;  4U13 A;  1Q86 4;  2QGU A;  7STD A;  1R4C A;  1JJ2 2;  4RNY A;  1FGM A;  2CWU A;  3MG1 A;  1VQ5 3;  3LOY A;  3MKI A;  4IPB A;  1OHO A;  3PS8 A;  1LNH A;  2M7O A;  1JN5 B;  1W2Z A;  3NM7 A;  2LYX A;  5CLK A;  5ELU A;  5D82 A;  3X41 A;  3LT9 A;  3NBR A;  4WYK B;  2XEP A;  1N8R 4;  2YFJ B;  4XBY A;  1LVN A;  3PCS A;  1EG9 B;  2HMM B;  3WA3 A;  3RDE A;  1GYB A;  1Z1S A;  2CFG A;  2OOV C;  1VZZ A;  4NRE A;  3TDG A;  1IU7 A;  3BNC A;  2W56 A;  2XSO B;  1M90 4;  2CKF B;  4RNZ A;  5HGR A;  2OQE A;  3EX9 A;  4CDL A;  1GY7 A;  1W2B 2;  3MWZ A;  3PYJ A;  1YGE A;  5AYS C;  2O3O A;  3ALA A;  1W01 A;  3B4O A;  3LZA A;  5ELJ A;  2YFL B;  3QK9 A;  4MMY B;  3JUP A;  1RN7 A;  3FSD A;  4N6L A;  5STD A;  4FCZ A;  4KVH A;  2XFT A;  2W03 A;  3LTD A;  2HMN B;  4BTX A;  1WTH A;  2RFR A;  4KFE A;  1VQL 3;  3RGA A;  2XRX B;  3MG2 A;  3DMC A;  3FKA A;  3SED A;  4LEH A;  3K0Z A;  3U97 A;  2K0M A;  3EE1 A;  1AR0 A;  2ML6 A;  4H61 A;  2K54 A;  3CCL 3;  1YJ9 3;  1Q40 A;  5D83 A;  4WHA A;  1SIH A;  2WO0 A;  1O7M B;  3OV4 A;  3ER7 A;  3CD6 3;  4IT7 A;  2I9W A;  3Q1C A;  3SVA A;  4X2H A;  3STD A;  3F8X A;  1U5O A;  1V74 A;  1KSI A;  3CCU 3;  1VQ8 3;  4L8P A;  1YIT 3;  5CF2 A;  3EJV A;  5KP3 A;  3QRD A;  4GB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...