1I0VA

Ribonuclease t1 in complex with 2'gmp (form i crystal)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 28
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i0vA00
9RNTA 1BSBA 3AHWA 1BVIA 1MGWA 1BRIA 4BU4A 1BANA 1BRJA 1BRSA 1RLSA 4J5GA 1RGFA 3URPA 1BRGA 1JBSA 1LRAA 1I8VA 1Q9EA 1JBRA 1T2IA 1UCJA 1I2GA 3AHSA 7RNTA 1GMQA 3GSPA 1HYFA 1B27A 1BNJA 1BUJA 1FUSA 1B20A 1BNFA 1FUTA 1X1YA 3KCHA 2KF6A 1BRNL 1B2SA 1A2PA 1TRPA 1RDSA 1I70A 1GOUA 1PY3A 1X1WA 1BRHA 1B3SA 1BNSA 1RMSA 1RGHA 1I3FA 1UCIA 1GMPA 2AAEA 1YNVX 3DH2A 1RN4A 1BIRA 1X1XA 1RGKA 1PYLA 2F56A 1BSEA 1RN1A 1GOVA 4BIRA 1GSPA 2KAAA 1B2ZA 4HAAA 2KF5A 2HOHA 3SYUA 3AGNA 1SARA 3BIRA 1UCLA 3D4AA 5RNTA 1BSCA 1BNEA 1BNRA 4HOHA 1I3IA 1TTOA 1RGCA 1RCKA 1RGGA 1ZGXA 2BU4A 2SARA 3D5GA 1BSDA 1BNIA 1HZ1A 1DETA 1LOVA 1IYYA 1G02A 3DGYA 2F5WA 1R4YA 1FYSA 1LOYA 7GSPA 3Q3FA 2AADA 1LOWA 8RNTA 1BRKA 2C4BA 3WR2A 1CH0A 2BIRA 1BSAA 4GSPA 1BOXA 1C54A 1GMRA 3A5EA 3AGOA 6GSPA 1MGRA 1B2UA 1RSNA 1UCKA 1YVSA 1B2MA 1RGAA 1JBTA 1B21A 1YGWA 3D5IA 1RGEA 5BU4A 5GSPA 1RTUA 3RNTA 1LNIA 4RNTA 1B2XA 1AQZA 3WHOA 1BAOA 6RNTA 1RNTA 5BIRA 1I2FA 1I2EA 2KF3A 2F4YA 1TRQA 2GSPA 1X1UA 1GOYA 1RHLA 1RNBA 2RNTA 3HOHA 1BGSA 2F5MA 1AY7A 1FW7A 1T2HA 1RCLA 2RBIA 5HOHA 1FZUA 4GHOA 4J5KA 1BU4A 2KF4A 1RGLA 1I0VA 1BNGA 3BU4A 1DE3A 1I0XA 2ZA4A
chains in the Genus database with same CATH superfamily
1EUIC 3F14A 3HX8A 9RNTA 3AHWA 1BVIA 3F7SA 1Q7Y4 1BRIA 4CDLA 3CCV3 1BANA 4HM1B 4J5GA 3FF0A 1AR0A 2D42A 1T5YA 2CG1A 1UW1A 3URPA 1BRGA 4WWUC 1I8VA 2ZL8A 1VQ73 4I5QA 5IF6A 1Q9EA 1YGEA 3LH4A 1NWWA 4EBGA 1I2GA 2YFJB 1TUHA 3Q90A 5FGOA 5G2GA 1HYFA 1RRHA 1UUVB 4O8SA 3X42A 3CC73 3EBYA 1YIJ3 3EHCA 4N6LA 3VF1A 4BTXA 5LC7A 3MYTA 1YIT3 1X1YA 2W9PA 3E99A 2KF6A 1LQGC 3BLZA 3EC9A 3NV0A 2SBLA 4HM0B 3ER7A 3K5TA 1Q864 1BRNL 1WTHA 2KCDA 3WOEB 1PY3A 4BTWA 1LQMB 1BRHA 1W2ZA 1ZO2A 3L0RA 3PCSA 2CWTA 1UUGB 4HM3B 3CCS3 2Q07A 2Z6BA 4KFFA 4WYKB 1G96A 2H0IA 1YJW3 3LT9A 1Z1SA 1GMPA 2RSXA 4EW5A 3NXJA 2XEPA 2CKFB 3S5CA 1RN4A 3OXAA 1GY5A 4KZ1A 3DXOA 1JB4A 1PYLA 2F56A 4N6MA 1E3VA 1KC84 3VGNA 1BSEA 2K54A 3F8XA 1JZOA 2R4IA 3G0KA 1UGHI 2HMLB 4R80A 3D3LA 3BIRA 4HKVB 5M1AA 1E3RA 1IVWA 3B4OA 3B7CA 1ROVA 1BSCA 1BNRA 1STDA 1BUQA 3NQYA 5TGNA 2SARA 1BSDA 3SLUA 1LOVA 1M1K4 3DGYA 1JB2A 1N5PA 2F5WA 2HMKB 2W6JH 3NX0A 4K61A 1WMPA 3Q3FA 1VQ83 2BT3A 4N3VA 1OHOA 1CH0A 2BIRA 4WYKA 2GEXA 5A0OB 3F8HA 4STDA 4KFEA 1W4NA 1ULJB 2P0MA 3A5EA 6GSPA 3G713 1SIHA 4X2HA 2C10A 3DGOA 4WFOA 3NQZA 1RGAA 2CX1A 1YGWA 3OWSA 3Q1CA 2BMOB 1N8R4 2F98A 4AKZA 3JVCA 3RNTA 1SJWA 3IMAB 2HMMB 1W6YA 4RNTA 2H0HA 3CCQ3 3CCU3 3CNMA 2CHCA 3TDGA 3UNLA 4FCJA 1AQZA 4BTYA 4U13A 1RKYA 1U5OA 1T3BA 3LTDA 1SPUA 2W04A 3EF8A 6RNTA 3WA2X 2QEX3 1VQ93 4N6OB 1ZS7A 2LYXA 1I2EA 3CC23 1V57A 3OV4A 1TRQA 4FMAA 3CME3 7STDA 2CX0A 3T8NA 2W0QA 3S29A 3ZFZA 2RNTA 1NDOB 3NBJA 1EA2A 3RGAA 3Q2PA 3HZPA 3KSED 1FW7A 5AI1A 4MEIA 1MOLA 1RCLA 3STDA 5CF1A 3GZXB 1FZUA 4GHOA 2BHMA 3FG1A 2KF4A 1BNGA 3BU4A 3WOFB 3NM7A 5DRVA 2YFIB 3CCJ3 5LC6A 2CK3H 1S723 1K734 4O2HA 2B24B 2GU3A 3NHXA 4MMYB 4R1KA 3ZG5A 1YHQ3 1VQ43 3F7XA 3KE7A 4AEQA 1OH0A 4EV5A 1MNLA 3FH1A 1JNQA 3PCRA 1IDPA 3DGNA 1JBRA 2K0MA 1T2IA 3H51A 1KSIA 2RGQA 3FF2A 4MMXB 6STDA 3MG2A 1GMQA 3FZWA 3GSPA 5AYRB 5BVBA 1B27A 1BNJA 2QGUA 4K1UA 1FGMA 1LNHA 1OGZA 2QA43 1VQL3 1AV4A 1I70A 2FNQA 3S67A 1X1WA 1B3SA 5M18A 3CXC2 4I4KA 1WMOA 1OHPA 3CU3A 1PFPA 3V92A 1RGHA 1I3FA 5D81A 3BNEA 3CCE3 1YJN3 3EB8A 3ZG0A 3FKAA 2P05A 3CCL3 1YNVX 1M1XB 3EJVA 3K9MC 3DH2A 4DKIA 1X1XA 1G0TA 3WDGB 1EQKA 2CFKA 2XFSA 1ZX2A 5ELJA 3SVAA 3K7CA 2IY2A 3RGRA 4HAAA 5JPUA 2KXGA 4HBRA 5I97A 3SYUA 3G6E3 4EV2A 2OOVA 1TJDA 3IPTA 5KP4A 3D4AA 5RNTA 1W02A 4N6NB 1DVCA 3CCM3 1IU7A 3BNDA 3WODG 5CXOA 1RGGA 2BU4A 1ZGXA 2FGTA 2XR8B 4CPKA 1BNIA 1AVLA 1E97A 1STFI 3PYJA 1MWRA 4O02B 2XH9A 1N9EA 2YFLB 4LYLB 3EX9A 3D9RA 3WMDA 5IG3A 2OTJ3 1FYSA 1IT7A 3SX1A 7GSPA 1HU9A 4CCVA 1LOWA 2PNCA 1IVVA 3OX9A 1W00A 2UUGC 2FXTA 1OHSA 1UDII 3ECFA 1Y4KA 1DMMA 3F40A 3UL6A 1VQN3 3CCR3 2GBXB 1GMRA 1QVF2 3MG1A 1O7GB 1VQK3 3NBBA 1UCKA 2INXA 3K63A 1B2MA 3NBRA 1TP6A 5JBSA 3S27A 1NJI4 1JB5A 2Y74A 2O9UX 1R4CA 3HIIA 2F99A 1GS3A 1RTUA 1TFKA 1EG9B 1QALA 2HMOB 2XSHB 3CNXA 3I563 3N8BA 1UUWB 4LSOA 2ML6A 5EVHA 1W2B2 3UL5A 1LXEA 1IK3A 3U1WA 1RNTA 3H3HA 3EQQB 4FMBA 1S5AA 2KF3A 5IERA 4HVNA 4N6V0 3ROBA 1A90A 2B1XB 3X3XA 1D6YA 1X1UA 1YVBI 5EEOA 5G1KA 2F5MA 4NHFA 1TIJA 1T2HA 2MF7A 1JKGB 1SQWA 3FCSB 3HK4A 2OTL3 3I553 1AVKA 1BU4A 5IG5A 3OW22 3FG3A 3JUNA 4RNZA 1NB3I 1I0XA 1DE3A 5G1LA 1WNHA 1TFOA 5JPPA 1MGWA 4QWTA 1ASKA 1L5GB 1OCVA 4HM8B 1IQYA 4BU4A 1IQXA 1JN5B 3IJEB 1D6UA 1O7HB 1M9GA 5D82A 4BL3A 1HKXA 2WGOA 1SIIA 3AMOA 3KKGA 4MJDA 5IG4A 1LRAA 1K28A 4R4KA 4BL2A 2L1SA 3A76A 3CPW2 1CYUA 2OCTA 5AYSC 4WHAA 1KD14 1F8NA 1IV7A 2GEYA 3AHSA 1NO3A 2D1WA 3JUMA 3KSPA 3LXUX 3QRDA 2GXFA 3PS8A 1BUJA 1V58A 1FUTA 3K0ZA 3BB9A 3DM8A 4HM7B 1TRPA 3JUQA 4IT7A 2A15A 2RCDA 1W6CA 5CLKA 3G8ZA 5KP3A 1UGIA 1W5ZA 3MG3A 4MMZB 2IUKA 2XRXB 1GY6A 1Q40A 1UCIA 3MSOA 5CF2A 2E2VA 1FGQA 1RJOA 3HI7A 5M19A 1JKGA 3G16A 3MWZA 4K90B 1IVXA 2OQEA 1RGKA 1US1A 2P38A 1GOVA 2KAAA 4FR9A 1W6GA 5ELUA 2KF5A 2HOHA 1JN5A 1N9JA 3LZAA 4EYCA 3FSDA 1UCLA 2GU1A 2QIYA 1NNVA 1UI7A 4Q53A 1NB5I 2P09A 1I3IA 2OQEC 2Z77A 1FGTA 1OUNA 2XFTA 1W7CA 4R9LA 1RCKA 3B8LA 3B4PA 4HM4B 1IQ8A 1IV9A 1W01A 1DETA 3EN1B 4XBTA 3OWUA 1G02A 1N8QA 3LTAA 5IEOA 2IYJA 3FG4A 3ALAA 2CFGA 1O7WB 1VZZA 2M7OA 3M8CA 2AADA 4RNYA 3DUKA 2WOHA 4O3VA 2C4BA 3N9HA 3T0UA 1VQ63 5AIIA 3WR2A 1A67A 4GSPA 5IENA 4L7KA 2PZVA 1CEWI 5AIGA 1C54A 1OF5A 5EQLA 3AGOA 3EN8A 4ORLA 2KRTA 4GL6A 1YVSA 2CW9A 4J8TA 5BU4A 5GSPA 2XGLA 4X2OA 1VQO3 3V98A 2CFWA 1Q814 5KP1A 2O3OA 4HZ9B 2HMJB 4IPBA 1DMNA 1LOXA 3SEDA 1O7PB 4LZIA 1QAKA 2BMQB 1BAOA 2OOVC 3DGMA 3MPHA 3KN4A 5BIRA 3G4S3 1I2FA 4RZMA 5AEWB 2F4YA 1QVG2 2LQVA 1UI8A 3DY5A 3CD63 1DMQA 2BMRB 2E2TA 3HOHA 5D83A 2Z7AA 3GRDA 1FGOA 4FMDA 2RBIA 3LTBA 2YX9A 5IG0A 1RN7A 3GZRA 2ZHXB 5AEUB 1J2BA 4J5KA 2CFDA 3AMOB 1RGLA 1I0VA 1Q7HA 4H3UA 3SOYA 3T8UA 1ULIB 2W03A 1TU5A 1GYBA 2C11A 1BSBA 1EKMA 4JRFA 2CIUA 3F9SA 1BRJA 1K41A 1BRSA 1RLSA 3LMLA 1RGFA 2XSOB 1K8A4 4FCMA 4AKYA 1JBSA 1FUWA 1IVUA 3UJMA 2CWUA 1JZDA 2H0GA 2CG0A 3WA3A 2IUJA 1UCJA 3CC43 1GD3A 1JV2B 4JF8A 4OUQA 4XDVA 3S28A 7RNTA 3EBTA 1CYVA 2W56B 4LGQA 3LYGA 4XDWA 1M904 2GBWB 1FUSA 3BNCA 1B20A 4H61A 1BNFA 1JRQA 1V74A 2P0XA 1CQSA 1Q40B 1B2SA 1A2PA 1EEJA 2BO9B 3GWRA 3KCHA 3KFQC 1QAFA 1RDSA 2CFLA 3NM2A 1MWUA 1VQP3 3GZBA 1GOUA 4KFDA 3EE1A 3V99A 4LMIA 1BNSA 1OPYA 1RMSA 2JDIH 2RFRA 3DGLA 3SXXA 3D79A 3QK9A 3PXMA 1QMAA 2AAEA 2JQ5A 5BXQA 1WQLB 1KQS2 2WGQA 1BIRA 2XF3A 2L4VA 4TX4A 1A2VA 4EC6A 1N5HA 3CPOA 1O7NB 2Z76A 4NREA 1RN1A 4BIRA 1OGXA 1GSPA 3UB1A 3DZLA 1B2ZA 4LEHA 2V1LA 8CHOA 2STDA 3RDEA 3CMA3 1DVDA 3AGNA 1SARA 4KVHA 1MWSA 5CK6A 5AIHA 5DREA 5FW5A 1BNEA 2UX0A 4HOHA 5STDA 1TTOA 3X3YA 3X3ZA 1RGCA 3BNBA 1JJ22 1OACA 3D5GA 1FGRA 1LVNA 3GZYB 1QJGA 3JUOA 2W9QA 5IEPA 3LT8A 3MKIA 4N6TA 2F86B 3SOAA 2W56A 1D6ZA 1HZ1A 4HM6B 3J7Yd 1ISKA 1IYYA 2ML5A 1U8CB 2WO0A 3PZWA 3FGYA 3I0YA 3MHEA 1OF5B 1R4YA 2I9WA 1RRLA 1LOYA 1K9M4 1O7MB 2W2CA 2J8XB 5HGRA 4XBYA 4IIAA 8RNTA 1BRKA 4HJLB 2ZDJA 4L8OA 3OWYA 3X40A 1BSAA 2K3DA 1BOXA 1C7HA 1MWTA 3JUPA 3LOYA 2E2UA 4G1MB 2CWVA 2Y73A 1Q824 1MGRA 3GAXA 1B2UA 3VSYA 1RSNA 2MC8A 3LTCA 4HYZA 5IW9A 1JBTA 1B21A 2CH9A 4RBNA 3D5IA 3NUVA 1RGEA 4XM4A 2CC3A 4OVMA 1VQQA 1PU4A 4ILFA 1LNIA 3KIIA 1B2XA 4PEJA 3PGBA 4FMCA 4N6UA 4CJNA 2BNGA 3O8YA 4NPBA 3WHOA 4FCZA 1DYUA 3X41A 1NU3A 4KT3B 1FA3A 2WOFA 2XGNA 1GY7A 1ROAA 3NV0B 4GB5A 4HZBB 4XBXA 4K1VA 1A2KA 3U97A 1WMNA 1GD4A 1KWIA 3N54B 3HIGA 2IA7A 2GSPA 4EXRA 1GOYA 4XB5A 1YJ93 1RHLA 4L8PA 4OK0A 1RNBA 2R41A 1BGSA 4WP5A 1AY7A 4HM5B 1YI23 1Q42A 2HMNB 5HOHA 4ZM8A 4J9AA 4HM2B 1IT8A 4R9KA 1VQ53 2OWPA 3KZTA 5AIFA 3DMCA 1VQM3 2UGIA 2ZA4A 3FLJA 2IMJA
chains in the Genus database with same CATH topology
9RNTA 1BSBA 3AHWA 1BVIA 1MGWA 1BRIA 4BU4A 1BANA 1BRJA 1BRSA 1RLSA 4J5GA 1RGFA 3URPA 1BRGA 1JBSA 1LRAA 1I8VA 1Q9EA 1JBRA 1T2IA 1UCJA 1I2GA 3AHSA 7RNTA 1GMQA 3GSPA 1HYFA 1B27A 1BNJA 1BUJA 1FUSA 1B20A 1BNFA 1FUTA 1X1YA 3KCHA 2KF6A 1BRNL 1B2SA 1A2PA 1TRPA 1RDSA 1I70A 1GOUA 1PY3A 1X1WA 1BRHA 1B3SA 1BNSA 1RMSA 1RGHA 1I3FA 1UCIA 1GMPA 2AAEA 1YNVX 3DH2A 1RN4A 1BIRA 1X1XA 1RGKA 1PYLA 2F56A 1BSEA 1RN1A 1GOVA 4BIRA 1GSPA 2KAAA 1B2ZA 4HAAA 2KF5A 2HOHA 3SYUA 3AGNA 1SARA 3BIRA 1UCLA 3D4AA 5RNTA 1BSCA 1BNEA 1BNRA 4HOHA 1I3IA 1TTOA 1RGCA 1RCKA 1RGGA 1ZGXA 2BU4A 2SARA 3D5GA 1BSDA 1BNIA 1HZ1A 1DETA 1LOVA 1IYYA 1G02A 3DGYA 2F5WA 1R4YA 1FYSA 1LOYA 7GSPA 3Q3FA 2AADA 1LOWA 8RNTA 1BRKA 2C4BA 3WR2A 1CH0A 2BIRA 1BSAA 4GSPA 1BOXA 1C54A 1GMRA 3A5EA 3AGOA 6GSPA 1MGRA 1B2UA 1RSNA 1UCKA 1YVSA 1B2MA 1RGAA 1JBTA 1B21A 1YGWA 3D5IA 1RGEA 5BU4A 5GSPA 1RTUA 3RNTA 1LNIA 4RNTA 1B2XA 1AQZA 3WHOA 1BAOA 6RNTA 1RNTA 5BIRA 1I2FA 1I2EA 2KF3A 2F4YA 1TRQA 2GSPA 1X1UA 1GOYA 1RHLA 1RNBA 2RNTA 3HOHA 1BGSA 2F5MA 1AY7A 1FW7A 1T2HA 1RCLA 2RBIA 5HOHA 1FZUA 4GHOA 4J5KA 1BU4A 2KF4A 1RGLA 1I0VA 1BNGA 3BU4A 1DE3A 1I0XA 2ZA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9RNT A;  1BSB A;  3AHW A;  1BVI A;  1MGW A;  1BRI A;  4BU4 A;  1BAN A;  1BRJ A;  1BRS A;  1RLS A;  4J5G A;  1RGF A;  3URP A;  1BRG A;  1JBS A;  1LRA A;  1I8V A;  1Q9E A;  1JBR A;  1T2I A;  1UCJ A;  1I2G A;  3AHS A;  7RNT A;  1GMQ A;  3GSP A;  1HYF A;  1B27 A;  1BNJ A;  1BUJ A;  1FUS A;  1B20 A;  1BNF A;  1FUT A;  1X1Y A;  3KCH A;  2KF6 A;  1BRN L;  1B2S A;  1A2P A;  1TRP A;  1RDS A;  1I70 A;  1GOU A;  1PY3 A;  1X1W A;  1BRH A;  1B3S A;  1BNS A;  1RMS A;  1RGH A;  1I3F A;  1UCI A;  1GMP A;  2AAE A;  1YNV X;  3DH2 A;  1RN4 A;  1BIR A;  1X1X A;  1RGK A;  1PYL A;  2F56 A;  1BSE A;  1RN1 A;  1GOV A;  4BIR A;  1GSP A;  2KAA A;  1B2Z A;  4HAA A;  2KF5 A;  2HOH A;  3SYU A;  3AGN A;  1SAR A;  3BIR A;  1UCL A;  3D4A A;  5RNT A;  1BSC A;  1BNE A;  1BNR A;  4HOH A;  1I3I A;  1TTO A;  1RGC A;  1RCK A;  1RGG A;  1ZGX A;  2BU4 A;  2SAR A;  3D5G A;  1BSD A;  1BNI A;  1HZ1 A;  1DET A;  1LOV A;  1IYY A;  1G02 A;  3DGY A;  2F5W A;  1R4Y A;  1FYS A;  1LOY A;  7GSP A;  3Q3F A;  2AAD A;  1LOW A;  8RNT A;  1BRK A;  2C4B A;  3WR2 A;  1CH0 A;  2BIR A;  1BSA A;  4GSP A;  1BOX A;  1C54 A;  1GMR A;  3A5E A;  3AGO A;  6GSP A;  1MGR A;  1B2U A;  1RSN A;  1UCK A;  1YVS A;  1B2M A;  1RGA A;  1JBT A;  1B21 A;  1YGW A;  3D5I A;  1RGE A;  5BU4 A;  5GSP A;  1RTU A;  3RNT A;  1LNI A;  4RNT A;  1B2X A;  1AQZ A;  3WHO A;  1BAO A;  6RNT A;  1RNT A;  5BIR A;  1I2F A;  1I2E A;  2KF3 A;  2F4Y A;  1TRQ A;  2GSP A;  1X1U A;  1GOY A;  1RHL A;  1RNB A;  2RNT A;  3HOH A;  1BGS A;  2F5M A;  1AY7 A;  1FW7 A;  1T2H A;  1RCL A;  2RBI A;  5HOH A;  1FZU A;  4GHO A;  4J5K A;  1BU4 A;  2KF4 A;  1RGL A;  1I0V A;  1BNG A;  3BU4 A;  1DE3 A;  1I0X A;  2ZA4 A; 
#chains in the Genus database with same CATH topology
 1EUI C;  3F14 A;  3HX8 A;  9RNT A;  3AHW A;  1BVI A;  3F7S A;  1Q7Y 4;  1BRI A;  4CDL A;  3CCV 3;  1BAN A;  4HM1 B;  4J5G A;  3FF0 A;  1AR0 A;  2D42 A;  1T5Y A;  2CG1 A;  1UW1 A;  3URP A;  1BRG A;  4WWU C;  1I8V A;  2ZL8 A;  1VQ7 3;  4I5Q A;  5IF6 A;  1Q9E A;  1YGE A;  3LH4 A;  1NWW A;  4EBG A;  1I2G A;  2YFJ B;  1TUH A;  3Q90 A;  5FGO A;  5G2G A;  1HYF A;  1RRH A;  1UUV B;  4O8S A;  3X42 A;  3CC7 3;  3EBY A;  1YIJ 3;  3EHC A;  4N6L A;  3VF1 A;  4BTX A;  5LC7 A;  3MYT A;  1YIT 3;  1X1Y A;  2W9P A;  3E99 A;  2KF6 A;  1LQG C;  3BLZ A;  3EC9 A;  3NV0 A;  2SBL A;  4HM0 B;  3ER7 A;  3K5T A;  1Q86 4;  1BRN L;  1WTH A;  2KCD A;  3WOE B;  1PY3 A;  4BTW A;  1LQM B;  1BRH A;  1W2Z A;  1ZO2 A;  3L0R A;  3PCS A;  2CWT A;  1UUG B;  4HM3 B;  3CCS 3;  2Q07 A;  2Z6B A;  4KFF A;  4WYK B;  1G96 A;  2H0I A;  1YJW 3;  3LT9 A;  1Z1S A;  1GMP A;  2RSX A;  4EW5 A;  3NXJ A;  2XEP A;  2CKF B;  3S5C A;  1RN4 A;  3OXA A;  1GY5 A;  4KZ1 A;  3DXO A;  1JB4 A;  1PYL A;  2F56 A;  4N6M A;  1E3V A;  1KC8 4;  3VGN A;  1BSE A;  2K54 A;  3F8X A;  1JZO A;  2R4I A;  3G0K A;  1UGH I;  2HML B;  4R80 A;  3D3L A;  3BIR A;  4HKV B;  5M1A A;  1E3R A;  1IVW A;  3B4O A;  3B7C A;  1ROV A;  1BSC A;  1BNR A;  1STD A;  1BUQ A;  3NQY A;  5TGN A;  2SAR A;  1BSD A;  3SLU A;  1LOV A;  1M1K 4;  3DGY A;  1JB2 A;  1N5P A;  2F5W A;  2HMK B;  2W6J H;  3NX0 A;  4K61 A;  1WMP A;  3Q3F A;  1VQ8 3;  2BT3 A;  4N3V A;  1OHO A;  1CH0 A;  2BIR A;  4WYK A;  2GEX A;  5A0O B;  3F8H A;  4STD A;  4KFE A;  1W4N A;  1ULJ B;  2P0M A;  3A5E A;  6GSP A;  3G71 3;  1SIH A;  4X2H A;  2C10 A;  3DGO A;  4WFO A;  3NQZ A;  1RGA A;  2CX1 A;  1YGW A;  3OWS A;  3Q1C A;  2BMO B;  1N8R 4;  2F98 A;  4AKZ A;  3JVC A;  3RNT A;  1SJW A;  3IMA B;  2HMM B;  1W6Y A;  4RNT A;  2H0H A;  3CCQ 3;  3CCU 3;  3CNM A;  2CHC A;  3TDG A;  3UNL A;  4FCJ A;  1AQZ A;  4BTY A;  4U13 A;  1RKY A;  1U5O A;  1T3B A;  3LTD A;  1SPU A;  2W04 A;  3EF8 A;  6RNT A;  3WA2 X;  2QEX 3;  1VQ9 3;  4N6O B;  1ZS7 A;  2LYX A;  1I2E A;  3CC2 3;  1V57 A;  3OV4 A;  1TRQ A;  4FMA A;  3CME 3;  7STD A;  2CX0 A;  3T8N A;  2W0Q A;  3S29 A;  3ZFZ A;  2RNT A;  1NDO B;  3NBJ A;  1EA2 A;  3RGA A;  3Q2P A;  3HZP A;  3KSE D;  1FW7 A;  5AI1 A;  4MEI A;  1MOL A;  1RCL A;  3STD A;  5CF1 A;  3GZX B;  1FZU A;  4GHO A;  2BHM A;  3FG1 A;  2KF4 A;  1BNG A;  3BU4 A;  3WOF B;  3NM7 A;  5DRV A;  2YFI B;  3CCJ 3;  5LC6 A;  2CK3 H;  1S72 3;  1K73 4;  4O2H A;  2B24 B;  2GU3 A;  3NHX A;  4MMY B;  4R1K A;  3ZG5 A;  1YHQ 3;  1VQ4 3;  3F7X A;  3KE7 A;  4AEQ A;  1OH0 A;  4EV5 A;  1MNL A;  3FH1 A;  1JNQ A;  3PCR A;  1IDP A;  3DGN A;  1JBR A;  2K0M A;  1T2I A;  3H51 A;  1KSI A;  2RGQ A;  3FF2 A;  4MMX B;  6STD A;  3MG2 A;  1GMQ A;  3FZW A;  3GSP A;  5AYR B;  5BVB A;  1B27 A;  1BNJ A;  2QGU A;  4K1U A;  1FGM A;  1LNH A;  1OGZ A;  2QA4 3;  1VQL 3;  1AV4 A;  1I70 A;  2FNQ A;  3S67 A;  1X1W A;  1B3S A;  5M18 A;  3CXC 2;  4I4K A;  1WMO A;  1OHP A;  3CU3 A;  1PFP A;  3V92 A;  1RGH A;  1I3F A;  5D81 A;  3BNE A;  3CCE 3;  1YJN 3;  3EB8 A;  3ZG0 A;  3FKA A;  2P05 A;  3CCL 3;  1YNV X;  1M1X B;  3EJV A;  3K9M C;  3DH2 A;  4DKI A;  1X1X A;  1G0T A;  3WDG B;  1EQK A;  2CFK A;  2XFS A;  1ZX2 A;  5ELJ A;  3SVA A;  3K7C A;  2IY2 A;  3RGR A;  4HAA A;  5JPU A;  2KXG A;  4HBR A;  5I97 A;  3SYU A;  3G6E 3;  4EV2 A;  2OOV A;  1TJD A;  3IPT A;  5KP4 A;  3D4A A;  5RNT A;  1W02 A;  4N6N B;  1DVC A;  3CCM 3;  1IU7 A;  3BND A;  3WOD G;  5CXO A;  1RGG A;  2BU4 A;  1ZGX A;  2FGT A;  2XR8 B;  4CPK A;  1BNI A;  1AVL A;  1E97 A;  1STF I;  3PYJ A;  1MWR A;  4O02 B;  2XH9 A;  1N9E A;  2YFL B;  4LYL B;  3EX9 A;  3D9R A;  3WMD A;  5IG3 A;  2OTJ 3;  1FYS A;  1IT7 A;  3SX1 A;  7GSP A;  1HU9 A;  4CCV A;  1LOW A;  2PNC A;  1IVV A;  3OX9 A;  1W00 A;  2UUG C;  2FXT A;  1OHS A;  1UDI I;  3ECF A;  1Y4K A;  1DMM A;  3F40 A;  3UL6 A;  1VQN 3;  3CCR 3;  2GBX B;  1GMR A;  1QVF 2;  3MG1 A;  1O7G B;  1VQK 3;  3NBB A;  1UCK A;  2INX A;  3K63 A;  1B2M A;  3NBR A;  1TP6 A;  5JBS A;  3S27 A;  1NJI 4;  1JB5 A;  2Y74 A;  2O9U X;  1R4C A;  3HII A;  2F99 A;  1GS3 A;  1RTU A;  1TFK A;  1EG9 B;  1QAL A;  2HMO B;  2XSH B;  3CNX A;  3I56 3;  3N8B A;  1UUW B;  4LSO A;  2ML6 A;  5EVH A;  1W2B 2;  3UL5 A;  1LXE A;  1IK3 A;  3U1W A;  1RNT A;  3H3H A;  3EQQ B;  4FMB A;  1S5A A;  2KF3 A;  5IER A;  4HVN A;  4N6V 0;  3ROB A;  1A90 A;  2B1X B;  3X3X A;  1D6Y A;  1X1U A;  1YVB I;  5EEO A;  5G1K A;  2F5M A;  4NHF A;  1TIJ A;  1T2H A;  2MF7 A;  1JKG B;  1SQW A;  3FCS B;  3HK4 A;  2OTL 3;  3I55 3;  1AVK A;  1BU4 A;  5IG5 A;  3OW2 2;  3FG3 A;  3JUN A;  4RNZ A;  1NB3 I;  1I0X A;  1DE3 A;  5G1L A;  1WNH A;  1TFO A;  5JPP A;  1MGW A;  4QWT A;  1ASK A;  1L5G B;  1OCV A;  4HM8 B;  1IQY A;  4BU4 A;  1IQX A;  1JN5 B;  3IJE B;  1D6U A;  1O7H B;  1M9G A;  5D82 A;  4BL3 A;  1HKX A;  2WGO A;  1SII A;  3AMO A;  3KKG A;  4MJD A;  5IG4 A;  1LRA A;  1K28 A;  4R4K A;  4BL2 A;  2L1S A;  3A76 A;  3CPW 2;  1CYU A;  2OCT A;  5AYS C;  4WHA A;  1KD1 4;  1F8N A;  1IV7 A;  2GEY A;  3AHS A;  1NO3 A;  2D1W A;  3JUM A;  3KSP A;  3LXU X;  3QRD A;  2GXF A;  3PS8 A;  1BUJ A;  1V58 A;  1FUT A;  3K0Z A;  3BB9 A;  3DM8 A;  4HM7 B;  1TRP A;  3JUQ A;  4IT7 A;  2A15 A;  2RCD A;  1W6C A;  5CLK A;  3G8Z A;  5KP3 A;  1UGI A;  1W5Z A;  3MG3 A;  4MMZ B;  2IUK A;  2XRX B;  1GY6 A;  1Q40 A;  1UCI A;  3MSO A;  5CF2 A;  2E2V A;  1FGQ A;  1RJO A;  3HI7 A;  5M19 A;  1JKG A;  3G16 A;  3MWZ A;  4K90 B;  1IVX A;  2OQE A;  1RGK A;  1US1 A;  2P38 A;  1GOV A;  2KAA A;  4FR9 A;  1W6G A;  5ELU A;  2KF5 A;  2HOH A;  1JN5 A;  1N9J A;  3LZA A;  4EYC A;  3FSD A;  1UCL A;  2GU1 A;  2QIY A;  1NNV A;  1UI7 A;  4Q53 A;  1NB5 I;  2P09 A;  1I3I A;  2OQE C;  2Z77 A;  1FGT A;  1OUN A;  2XFT A;  1W7C A;  4R9L A;  1RCK A;  3B8L A;  3B4P A;  4HM4 B;  1IQ8 A;  1IV9 A;  1W01 A;  1DET A;  3EN1 B;  4XBT A;  3OWU A;  1G02 A;  1N8Q A;  3LTA A;  5IEO A;  2IYJ A;  3FG4 A;  3ALA A;  2CFG A;  1O7W B;  1VZZ A;  2M7O A;  3M8C A;  2AAD A;  4RNY A;  3DUK A;  2WOH A;  4O3V A;  2C4B A;  3N9H A;  3T0U A;  1VQ6 3;  5AII A;  3WR2 A;  1A67 A;  4GSP A;  5IEN A;  4L7K A;  2PZV A;  1CEW I;  5AIG A;  1C54 A;  1OF5 A;  5EQL A;  3AGO A;  3EN8 A;  4ORL A;  2KRT A;  4GL6 A;  1YVS A;  2CW9 A;  4J8T A;  5BU4 A;  5GSP A;  2XGL A;  4X2O A;  1VQO 3;  3V98 A;  2CFW A;  1Q81 4;  5KP1 A;  2O3O A;  4HZ9 B;  2HMJ B;  4IPB A;  1DMN A;  1LOX A;  3SED A;  1O7P B;  4LZI A;  1QAK A;  2BMQ B;  1BAO A;  2OOV C;  3DGM A;  3MPH A;  3KN4 A;  5BIR A;  3G4S 3;  1I2F A;  4RZM A;  5AEW B;  2F4Y A;  1QVG 2;  2LQV A;  1UI8 A;  3DY5 A;  3CD6 3;  1DMQ A;  2BMR B;  2E2T A;  3HOH A;  5D83 A;  2Z7A A;  3GRD A;  1FGO A;  4FMD A;  2RBI A;  3LTB A;  2YX9 A;  5IG0 A;  1RN7 A;  3GZR A;  2ZHX B;  5AEU B;  1J2B A;  4J5K A;  2CFD A;  3AMO B;  1RGL A;  1I0V A;  1Q7H A;  4H3U A;  3SOY A;  3T8U A;  1ULI B;  2W03 A;  1TU5 A;  1GYB A;  2C11 A;  1BSB A;  1EKM A;  4JRF A;  2CIU A;  3F9S A;  1BRJ A;  1K41 A;  1BRS A;  1RLS A;  3LML A;  1RGF A;  2XSO B;  1K8A 4;  4FCM A;  4AKY A;  1JBS A;  1FUW A;  1IVU A;  3UJM A;  2CWU A;  1JZD A;  2H0G A;  2CG0 A;  3WA3 A;  2IUJ A;  1UCJ A;  3CC4 3;  1GD3 A;  1JV2 B;  4JF8 A;  4OUQ A;  4XDV A;  3S28 A;  7RNT A;  3EBT A;  1CYV A;  2W56 B;  4LGQ A;  3LYG A;  4XDW A;  1M90 4;  2GBW B;  1FUS A;  3BNC A;  1B20 A;  4H61 A;  1BNF A;  1JRQ A;  1V74 A;  2P0X A;  1CQS A;  1Q40 B;  1B2S A;  1A2P A;  1EEJ A;  2BO9 B;  3GWR A;  3KCH A;  3KFQ C;  1QAF A;  1RDS A;  2CFL A;  3NM2 A;  1MWU A;  1VQP 3;  3GZB A;  1GOU A;  4KFD A;  3EE1 A;  3V99 A;  4LMI A;  1BNS A;  1OPY A;  1RMS A;  2JDI H;  2RFR A;  3DGL A;  3SXX A;  3D79 A;  3QK9 A;  3PXM A;  1QMA A;  2AAE A;  2JQ5 A;  5BXQ A;  1WQL B;  1KQS 2;  2WGQ A;  1BIR A;  2XF3 A;  2L4V A;  4TX4 A;  1A2V A;  4EC6 A;  1N5H A;  3CPO A;  1O7N B;  2Z76 A;  4NRE A;  1RN1 A;  4BIR A;  1OGX A;  1GSP A;  3UB1 A;  3DZL A;  1B2Z A;  4LEH A;  2V1L A;  8CHO A;  2STD A;  3RDE A;  3CMA 3;  1DVD A;  3AGN A;  1SAR A;  4KVH A;  1MWS A;  5CK6 A;  5AIH A;  5DRE A;  5FW5 A;  1BNE A;  2UX0 A;  4HOH A;  5STD A;  1TTO A;  3X3Y A;  3X3Z A;  1RGC A;  3BNB A;  1JJ2 2;  1OAC A;  3D5G A;  1FGR A;  1LVN A;  3GZY B;  1QJG A;  3JUO A;  2W9Q A;  5IEP A;  3LT8 A;  3MKI A;  4N6T A;  2F86 B;  3SOA A;  2W56 A;  1D6Z A;  1HZ1 A;  4HM6 B;  3J7Y d;  1ISK A;  1IYY A;  2ML5 A;  1U8C B;  2WO0 A;  3PZW A;  3FGY A;  3I0Y A;  3MHE A;  1OF5 B;  1R4Y A;  2I9W A;  1RRL A;  1LOY A;  1K9M 4;  1O7M B;  2W2C A;  2J8X B;  5HGR A;  4XBY A;  4IIA A;  8RNT A;  1BRK A;  4HJL B;  2ZDJ A;  4L8O A;  3OWY A;  3X40 A;  1BSA A;  2K3D A;  1BOX A;  1C7H A;  1MWT A;  3JUP A;  3LOY A;  2E2U A;  4G1M B;  2CWV A;  2Y73 A;  1Q82 4;  1MGR A;  3GAX A;  1B2U A;  3VSY A;  1RSN A;  2MC8 A;  3LTC A;  4HYZ A;  5IW9 A;  1JBT A;  1B21 A;  2CH9 A;  4RBN A;  3D5I A;  3NUV A;  1RGE A;  4XM4 A;  2CC3 A;  4OVM A;  1VQQ A;  1PU4 A;  4ILF A;  1LNI A;  3KII A;  1B2X A;  4PEJ A;  3PGB A;  4FMC A;  4N6U A;  4CJN A;  2BNG A;  3O8Y A;  4NPB A;  3WHO A;  4FCZ A;  1DYU A;  3X41 A;  1NU3 A;  4KT3 B;  1FA3 A;  2WOF A;  2XGN A;  1GY7 A;  1ROA A;  3NV0 B;  4GB5 A;  4HZB B;  4XBX A;  4K1V A;  1A2K A;  3U97 A;  1WMN A;  1GD4 A;  1KWI A;  3N54 B;  3HIG A;  2IA7 A;  2GSP A;  4EXR A;  1GOY A;  4XB5 A;  1YJ9 3;  1RHL A;  4L8P A;  4OK0 A;  1RNB A;  2R41 A;  1BGS A;  4WP5 A;  1AY7 A;  4HM5 B;  1YI2 3;  1Q42 A;  2HMN B;  5HOH A;  4ZM8 A;  4J9A A;  4HM2 B;  1IT8 A;  4R9K A;  1VQ5 3;  2OWP A;  3KZT A;  5AIF A;  3DMC A;  1VQM 3;  2UGI A;  2ZA4 A;  3FLJ A;  2IMJ A; 
#chains in the Genus database with same CATH homology
 9RNT A;  1BSB A;  3AHW A;  1BVI A;  1MGW A;  1BRI A;  4BU4 A;  1BAN A;  1BRJ A;  1BRS A;  1RLS A;  4J5G A;  1RGF A;  3URP A;  1BRG A;  1JBS A;  1LRA A;  1I8V A;  1Q9E A;  1JBR A;  1T2I A;  1UCJ A;  1I2G A;  3AHS A;  7RNT A;  1GMQ A;  3GSP A;  1HYF A;  1B27 A;  1BNJ A;  1BUJ A;  1FUS A;  1B20 A;  1BNF A;  1FUT A;  1X1Y A;  3KCH A;  2KF6 A;  1BRN L;  1B2S A;  1A2P A;  1TRP A;  1RDS A;  1I70 A;  1GOU A;  1PY3 A;  1X1W A;  1BRH A;  1B3S A;  1BNS A;  1RMS A;  1RGH A;  1I3F A;  1UCI A;  1GMP A;  2AAE A;  1YNV X;  3DH2 A;  1RN4 A;  1BIR A;  1X1X A;  1RGK A;  1PYL A;  2F56 A;  1BSE A;  1RN1 A;  1GOV A;  4BIR A;  1GSP A;  2KAA A;  1B2Z A;  4HAA A;  2KF5 A;  2HOH A;  3SYU A;  3AGN A;  1SAR A;  3BIR A;  1UCL A;  3D4A A;  5RNT A;  1BSC A;  1BNE A;  1BNR A;  4HOH A;  1I3I A;  1TTO A;  1RGC A;  1RCK A;  1RGG A;  1ZGX A;  2BU4 A;  2SAR A;  3D5G A;  1BSD A;  1BNI A;  1HZ1 A;  1DET A;  1LOV A;  1IYY A;  1G02 A;  3DGY A;  2F5W A;  1R4Y A;  1FYS A;  1LOY A;  7GSP A;  3Q3F A;  2AAD A;  1LOW A;  8RNT A;  1BRK A;  2C4B A;  3WR2 A;  1CH0 A;  2BIR A;  1BSA A;  4GSP A;  1BOX A;  1C54 A;  1GMR A;  3A5E A;  3AGO A;  6GSP A;  1MGR A;  1B2U A;  1RSN A;  1UCK A;  1YVS A;  1B2M A;  1RGA A;  1JBT A;  1B21 A;  1YGW A;  3D5I A;  1RGE A;  5BU4 A;  5GSP A;  1RTU A;  3RNT A;  1LNI A;  4RNT A;  1B2X A;  1AQZ A;  3WHO A;  1BAO A;  6RNT A;  1RNT A;  5BIR A;  1I2F A;  1I2E A;  2KF3 A;  2F4Y A;  1TRQ A;  2GSP A;  1X1U A;  1GOY A;  1RHL A;  1RNB A;  2RNT A;  3HOH A;  1BGS A;  2F5M A;  1AY7 A;  1FW7 A;  1T2H A;  1RCL A;  2RBI A;  5HOH A;  1FZU A;  4GHO A;  4J5K A;  1BU4 A;  2KF4 A;  1RGL A;  1I0V A;  1BNG A;  3BU4 A;  1DE3 A;  1I0X A;  2ZA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...