1I0VA

Ribonuclease t1 in complex with 2'gmp (form i crystal)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 28
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i0vA00
1HZ1A 1BNIA 1SARA 5BIRA 1B3SA 1GMQA 1B2SA 3BIRA 1BU4A 1RSNA 1TRQA 1C54A 1BRGA 1BNFA 1CH0A 1X1YA 3RNTA 1X1UA 2KF5A 1BSAA 1UCJA 2RBIA 1DETA 1BSEA 1TTOA 1BGSA 1FYSA 1G02A 1RNBA 1YGWA 2BIRA 3DH2A 3WHOA 5BU4A 1BSCA 1LRAA 1RDSA 1BAOA 2AAEA 1RNTA 2F5MA 1RGAA 1BNEA 5HOHA 2F5WA 1B2ZA 1FZUA 4GSPA 1LOYA 2HOHA 1RCKA 1DE3A 1JBSA 1BVIA 2KF4A 1BRNL 1UCLA 3A5EA 1RMSA 1I3IA 1AQZA 6RNTA 2KAAA 1X1WA 2SARA 1BRSA 1GOYA 1AY7A 3D5IA 1I2EA 1I8VA 1T2IA 1BNSA 1ZGXA 9RNTA 1R4YA 1BUJA 4HAAA 1BIRA 6GSPA 1FUSA 1LOVA 1RGHA 1BRIA 4RNTA 1Q9EA 4J5KA 2RNTA 4BIRA 1B21A 1TRPA 1I2GA 1I0VA 2AADA 1MGRA 1BSDA 1RGLA 1RTUA 2F4YA 1A2PA 3DGYA 1IYYA 3Q3FA 1RGKA 1MGWA 1B2UA 1BRKA 1RN4A 1T2HA 4GHOA 1JBTA 1RHLA 3SYUA 2GSPA 8RNTA 2BU4A 1X1XA 3KCHA 4BU4A 1BOXA 2KF3A 1RCLA 3BU4A 1BNGA 4HOHA 3WR2A 1I2FA 1RN1A 1JBRA 2C4BA 1BRJA 1HYFA 1BSBA 7GSPA 7RNTA 1RGCA 1LOWA 1PYLA 1BNRA 1I70A 1RLSA 1BNJA 3AHWA 1LNIA 1UCIA 1BANA 1GMRA 1B20A 1YVSA 1FW7A 1RGEA 2ZA4A 1RGFA 2KF6A 1FUTA 3AHSA 3AGOA 1BRHA 1B2MA 3GSPA 1RGGA 3HOHA 1GOUA 1GSPA 3D5GA 2F56A 1GOVA 1YNVX 3D4AA 5GSPA 1B2XA 1GMPA 1UCKA 1PY3A 3URPA 1I0XA 3AGNA 4J5GA 5RNTA 1B27A 1I3FA
chains in the Genus database with same CATH superfamily
3CC43 1TIJA 3KN4A 1B3SA 1K8A4 1SPUA 1JB2A 1O7GB 3CPW2 1BU4A 3LT9A 2KCDA 5I97A 1BRGA 1SQWA 3MHEA 1FA3A 2D1WA 3RNTA 3AMOB 3X41A 3CNMA 3MPHA 5CLKA 3FG1A 3RGAA 4MMYB 1LQMB 1DETA 1U8CB 2IUKA 1US1A 3BB9A 1AVLA 1GY6A 1Q7HA 2HMNB 3B7CA 3MG2A 2GU1A 3OWYA 1LRAA 2CX1A 3GRDA 2HMJB 3GZRA 5EVHA 3CCV3 2CX0A 4J9AA 3X3XA 1JV2B 1N9EA 3FG4A 5HOHA 5TGNA 4I4KA 3OW22 4K61A 1W01A 1IDPA 2HOHA 3CPOA 1UI8A 1PU4A 1DE3A 3IJEB 3CME3 3J7Yd 1FGTA 1JBSA 3A5EA 2GXFA 3ALAA 4AKYA 2W56B 4L7KA 1Q40A 5IW9A 4K1VA 5LC6A 6RNTA 1OPYA 1Q42A 3DM8A 4MMXB 4GL6A 5M18A 1ASKA 1BRSA 2SARA 3NBRA 1MWRA 4R9KA 3S27A 3D5IA 1IVXA 2IA7A 4XBXA 2WOFA 4FMAA 5AEWB 1VQ43 1JB5A 1GYBA 3F40A 2OOVC 3K9MC 1IV9A 5IENA 4HAAA 2Z7AA 1G96A 5EEOA 2Y74A 1LOVA 2W6JH 4FCZA 3LTBA 5M1AA 1JN5A 4BIRA 5BU4A 5BXQA 1T5YA 2AADA 1MGRA 5DRVA 2CC3A 2W03A 1RKYA 2HMMB 2IYJA 4LYLB 1AR0A 3CCM3 2FNQA 1W4NA 3Q3FA 2BHMA 5FW5A 1JZDA 3K7CA 3LXUX 1B2UA 2O9UX 4MMZB 5G1LA 1RN4A 3S29A 4WP5A 1RHLA 3SYUA 1R4CA 3LYGA 3M8CA 3F7SA 4N3VA 2RCDA 4BU4A 1BOXA 4NREA 5M19A 1RCLA 1BNGA 3UNLA 1RN1A 4HZBB 1E97A 1HYFA 4N6MA 7RNTA 3CCL3 2L4VA 2RFRA 3PXMA 4K1UA 3BLZA 3K5TA 2J8XB 4STDA 3N54B 4L8PA 3KSPA 3FCSB 2GU3A 4EYCA 1YVBI 1Q824 1JRQA 1RLSA 3O8YA 1OACA 1ZX2A 2ML5A 2XSOB 1W6YA 2CG1A 1LNIA 4N6LA 4H3UA 1GMRA 1B20A 2HMKB 3N9HA 1UUVB 3NQYA 1KQS2 1W2B2 1FW7A 3HIGA 4N6OB 3WOEB 3KFQC 2Z77A 5D81A 2XF3A 1RGFA 1NO3A 1FGQA 1VQ73 3PZWA 1ULJB 1HU9A 1FUTA 3NM2A 3L0RA 4K90B 3AHSA 3OWSA 2LYXA 3VSYA 1N8QA 4BTXA 1BRHA 1B2MA 2ZL8A 1YJ93 1EUIC 1IT7A 3G8ZA 1GSPA 1SIIA 4KFDA 1GOVA 1YNVX 2P0XA 4X2HA 2Y73A 5AYRB 3I553 5GSPA 4O8SA 1VQK3 1A2KA 1KWIA 3KIIA 3U97A 1PY3A 3H3HA 1IU7A 1V58A 3AMOA 1I0XA 4J5GA 3JUPA 2CFGA 3URPA 4EV5A 5RNTA 1B27A 2R41A 1BANA 1YJW3 1K734 4WYKA 1UDII 1K41A 2CWTA 1STDA 3X3ZA 3SOYA 1CH0A 1X1YA 2XSHB 2M7OA 4HM5B 5STDA 1Z1SA 1NJI4 3IMAB 2QGUA 1F8NA 5AIHA 3G713 3JUQA 2GBWB 1SIHA 3MWZA 4KVHA 3DH2A 4N6NB 2OOVA 1N5PA 4OK0A 3F9SA 4IT7A 1RDSA 4IPBA 1K28A 3FG3A 5LC7A 3K0ZA 1ZO2A 2AAEA 5G2GA 4QWTA 4KFFA 2F5MA 2R4IA 3BNEA 5JBSA 4XDVA 3GZYB 1RGAA 3NQZA 4R9LA 2ML6A 3S5CA 3PYJA 2HMLB 1DMNA 2F5WA 4XBYA 4J8TA 2W2CA 2W04A 3NX0A 1RCKA 2UUGC 1OGZA 4KT3B 5IG3A 1IQYA 1STFI 1UCLA 3IPTA 1N9JA 3GAXA 1UGIA 3TDGA 4LSOA 1I3IA 4PEJA 3CCJ3 1Q7Y4 1JJ22 1MWTA 2CH9A 4HVNA 1KSIA 1X1WA 2BMQB 2CWVA 3F8HA 4R4KA 1WNHA 2Q07A 1M904 4WYKB 1W02A 3LOYA 1T2IA 1BUJA 1WMPA 3EN1B 5AIGA 3T8UA 1BIRA 3HZPA 3DMCA 3SEDA 1YJN3 4HJLB 1RGHA 1UUGB 3CNXA 1YIJ3 1VQ53 1NB3I 5CXOA 5DREA 2RNTA 5ELUA 1B21A 3EB8A 4HM4B 5JPPA 1JKGA 1TFKA 2JQ5A 2K54A 2BMOB 2ZDJA 3FGYA 1TU5A 1SJWA 2MF7A 2YFLB 2IMJA 1NU3A 1IK3A 3S67A 2O3OA 3WA3A 1O7HB 4WFOA 1JNQA 4RZMA 2YFJB 2PZVA 3Q2PA 3NV0A 1OUNA 1O7NB 1LNHA 2KF3A 5AI1A 5IF6A 1IT8A 3GZBA 2GBXB 2SBLA 2CHCA 3NHXA 5KP3A 1I2FA 2C4BA 1BRJA 3CCE3 3DUKA 7GSPA 3SXXA 2KXGA 1ULIB 2GEYA 4EC6A 1QVG2 1GD3A 4HBRA 2RSXA 1ROAA 4CJNA 5FGOA 1D6ZA 1UGHI 2MC8A 3FLJA 1BNJA 2P05A 3EX9A 3CMA3 1UUWB 3MG3A 3GZXB 3Q90A 2H0IA 3I563 1VQP3 2GEXA 1OF5A 2INXA 4EXRA 3X40A 4FMBA 1M1K4 1RN7A 3LTAA 4FCJA 2W0QA 1OHPA 1T3BA 2KF6A 1JKGB 3EJVA 8CHOA 1J2BA 1EKMA 4ILFA 2CFKA 5G1KA 3CC73 4NPBA 3G4S3 1HKXA 1GOUA 2V1LA 7STDA 1NB5I 2OTL3 2LQVA 1KD14 1CEWI 3NV0B 3D9RA 1FUWA 1IQXA 1UCKA 2F86B 1TJDA 2XFTA 3CXC2 3ZG5A 1C54A 1HZ1A 1BNIA 1OGXA 4RNZA 5BIRA 4OVMA 1B2SA 1L5GB 3HK4A 3FF0A 3BIRA 1W5ZA 1OCVA 1TRQA 1W6CA 2E2UA 3EE1A 3EF8A 3ER7A 2KF5A 3NUVA 3F14A 2CIUA 1UCJA 3X42A 1BSEA 1VQM3 2E2TA 1TTOA 2OCTA 1S5AA 1FYSA 4FCMA 1VQ83 1RNBA 1TUHA 3LH4A 1QAFA 1OF5B 2C10A 5CK6A 3LMLA 3UL5A 1BSCA 3BNCA 3ECFA 1AVKA 5JPUA 2XEPA 3CC23 2WGQA 1RNTA 1FGMA 2CKFB 3SOAA 1BNEA 4HM3B 1D6UA 1QAKA 1CYVA 2F98A 3NXJA 1FZUA 3DGOA 4L8OA 5IG5A 1LOYA 1RRHA 2P38A 3DXOA 1FGRA 1GD4A 1BVIA 2KF4A 3PGBA 4BL2A 1AQZA 1RRLA 4BL3A 2W9QA 1O7WB 3EBTA 1DVCA 2WO0A 3BNBA 3WDGB 1M9GA 1MOLA 1O7PB 2C11A 4LMIA 2P0MA 4R1KA 4XBTA 1AY7A 1YIT3 1QVF2 4LGQA 1I2EA 1NWWA 1BNSA 1R4YA 3S28A 3EHCA 3K63A 3EBYA 1UI7A 4CDLA 6GSPA 1FUSA 3I0YA 5IEPA 2QEX3 5IG0A 1Q814 1Q9EA 2UX0A 1WQLB 3UJMA 3GWRA 4O02B 1I2GA 4XDWA 1I0VA 2K0MA 4FR9A 1RGLA 4GB5A 3UL6A 1A2PA 2I9WA 3DGYA 1D6YA 1BUQA 2QIYA 1RGKA 3QK9A 2YX9A 2B1XB 1T2HA 4FMCA 1G0TA 2GSPA 4RNYA 1QALA 2BU4A 1X1XA 3KCHA 1GY5A 3OV4A 2RGQA 3FKAA 2XGLA 3OWUA 4HM0B 5AYSC 4CPKA 3BU4A 3MSOA 3LZAA 2Z76A 5KP4A 1A67A 1YGEA 1K9M4 3CCU3 1JBRA 3FSDA 4I5QA 4R80A 3WOFB 4JRFA 1LOWA 3QRDA 4KZ1A 1S723 5D82A 1IQ8A 1W2ZA 2K3DA 4HKVB 4HYZA 1PYLA 3G6E3 3ZFZA 1M1XB 1I70A 3DGMA 3STDA 1EQKA 4WHAA 3B4OA 3D3LA 3MG1A 3U1WA 4CCVA 1LXEA 3LT8A 4HM7B 3E99A 1YI23 3SLUA 4FMDA 1QJGA 3G16A 3EC9A 3BNDA 1DMMA 3D79A 1U5OA 4XB5A 4HZ9B 3VF1A 3KE7A 1RGEA 1NNVA 1EA2A 1VZZA 3JVCA 3T8NA 4LEHA 3LTCA 3NM7A 4AEQA 1CQSA 1DYUA 3OX9A 3CD63 1TFOA 2QA43 1MWUA 2CK3H 1JB4A 3NBBA 2XFSA 1W6GA 4U13A 1VQN3 1LQGC 4NHFA 3GSPA 1RGGA 1NDOB 3HOHA 1QMAA 1RJOA 3F7XA 4XM4A 2OTJ3 3D5GA 3D4AA 2FXTA 2XGNA 4G1MB 1WMNA 1B2XA 4EW5A 4ORLA 3CU3A 5A0OB 4N6V0 4Q53A 2CFLA 2BMRB 1GS3A 1VQ63 3KKGA 1ZS7A 1I3FA 1SARA 3Q1CA 3KSED 1GMQA 1KC84 1RSNA 1TP6A 4MEIA 1BNFA 3SVAA 1OHSA 2A15A 1X1UA 1BSAA 1C7HA 2RBIA 1V74A 3H51A 5KP1A 4AKZA 5CF1A 1BGSA 2BO9B 1G02A 3DGLA 4HM8B 3KZTA 1YGWA 3EN8A 3ZG0A 4EV2A 2HMOB 2BIRA 3WHOA 3HX8A 5IG4A 1W00A 2JDIH 5HGRA 2CW9A 1BAOA 4H61A 4BTYA 3FF2A 5EQLA 1ISKA 1DVDA 2WGOA 4EBGA 2IY2A 1OH0A 1B2ZA 3SX1A 4GSPA 2CWUA 1MWSA 3DGNA 3N8BA 4MJDA 2FGTA 1BRNL 1PFPA 3FZWA 1IV7A 3CCS3 1V57A 1W7CA 2Z6BA 5AEUB 1RMSA 4O3VA 3HIIA 5CF2A 2D42A 2KAAA 4N6UA 1LOXA 1Y4KA 2WOHA 3RGRA 1GOYA 3OXAA 4N6TA 3HI7A 3JUNA 4WWUC 1I8VA 1N5HA 1ZGXA 5D83A 9RNTA 1FGOA 1IVVA 1OHOA 1Q40B 2XRXB 2CFDA 3PS8A 1O7MB 3G0KA 4DKIA 2F99A 3T0UA 1BRIA 4RNTA 2IUJA 4J5KA 3CCR3 2H0GA 1TRPA 2XH9A 2OQEA 6STDA 1BSDA 2BT3A 5AIIA 1RTUA 1A2VA 2F4YA 2OWPA 3JUMA 3DZLA 4BTWA 1E3VA 1VQL3 3B4PA 3JUOA 1IYYA 1MGWA 3V98A 1ROVA 1UW1A 2ZHXB 4OUQA 1BRKA 1JBTA 1IVWA 2L1SA 4GHOA 4HM2B 5IERA 3ROBA 1JN5B 2CFWA 2PNCA 1VQQA 2W9PA 4X2OA 1AV4A 5AIFA 3WMDA 8RNTA 1VQ93 1CYUA 1GY7A 5IEOA 1Q864 3B8LA 4HOHA 3WR2A 3NBJA 1BSBA 2KRTA 3MKIA 3PCRA 4HM6B 4LZIA 1RGCA 1LVNA 3CCQ3 1A90A 5ELJA 1WTHA 1YHQ3 1BNRA 3RDEA 3V99A 2XR8B 1EEJA 3AHWA 1VQO3 1UCIA 3X3YA 3PCSA 2P09A 3MYTA 1IVUA 1YVSA 2B24B 3LTDA 2E2VA 4RBNA 3V92A 4TX4A 2ZA4A 1MNLA 2H0HA 3VGNA 2BNGA 5BVBA 1EG9B 3A76A 4ZM8A 1N8R4 3EQQB 3WA2X 3AGOA 2YFIB 4IIAA 2UGIA 1WMOA 3DY5A 4HM1B 1E3RA 4JF8A 2F56A 2STDA 2W56A 3FH1A 3UB1A 4KFEA 3WODG 4O2HA 1GMPA 2CG0A 1DMQA 2OQEC 3AGNA 3F8XA 1JZOA
chains in the Genus database with same CATH topology
1HZ1A 1BNIA 1SARA 5BIRA 1B3SA 1GMQA 1B2SA 3BIRA 1BU4A 1RSNA 1TRQA 1C54A 1BRGA 1BNFA 1CH0A 1X1YA 3RNTA 1X1UA 2KF5A 1BSAA 1UCJA 2RBIA 1DETA 1BSEA 1TTOA 1BGSA 1FYSA 1G02A 1RNBA 1YGWA 2BIRA 3DH2A 3WHOA 5BU4A 1BSCA 1LRAA 1RDSA 1BAOA 2AAEA 1RNTA 2F5MA 1RGAA 1BNEA 5HOHA 2F5WA 1B2ZA 1FZUA 4GSPA 1LOYA 2HOHA 1RCKA 1DE3A 1JBSA 1BVIA 2KF4A 1BRNL 1UCLA 3A5EA 1RMSA 1I3IA 1AQZA 6RNTA 2KAAA 1X1WA 2SARA 1BRSA 1GOYA 1AY7A 3D5IA 1I2EA 1I8VA 1T2IA 1BNSA 1ZGXA 9RNTA 1R4YA 1BUJA 4HAAA 1BIRA 6GSPA 1FUSA 1LOVA 1RGHA 1BRIA 4RNTA 1Q9EA 4J5KA 2RNTA 4BIRA 1B21A 1TRPA 1I2GA 1I0VA 2AADA 1MGRA 1BSDA 1RGLA 1RTUA 2F4YA 1A2PA 3DGYA 1IYYA 3Q3FA 1RGKA 1MGWA 1B2UA 1BRKA 1RN4A 1T2HA 4GHOA 1JBTA 1RHLA 3SYUA 2GSPA 8RNTA 2BU4A 1X1XA 3KCHA 4BU4A 1BOXA 2KF3A 1RCLA 3BU4A 1BNGA 4HOHA 3WR2A 1I2FA 1RN1A 1JBRA 2C4BA 1BRJA 1HYFA 1BSBA 7GSPA 7RNTA 1RGCA 1LOWA 1PYLA 1BNRA 1I70A 1RLSA 1BNJA 3AHWA 1LNIA 1UCIA 1BANA 1GMRA 1B20A 1YVSA 1FW7A 1RGEA 2ZA4A 1RGFA 2KF6A 1FUTA 3AHSA 3AGOA 1BRHA 1B2MA 3GSPA 1RGGA 3HOHA 1GOUA 1GSPA 3D5GA 2F56A 1GOVA 1YNVX 3D4AA 5GSPA 1B2XA 1GMPA 1UCKA 1PY3A 3URPA 1I0XA 3AGNA 4J5GA 5RNTA 1B27A 1I3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ1 A;  1BNI A;  1SAR A;  5BIR A;  1B3S A;  1GMQ A;  1B2S A;  3BIR A;  1BU4 A;  1RSN A;  1TRQ A;  1C54 A;  1BRG A;  1BNF A;  1CH0 A;  1X1Y A;  3RNT A;  1X1U A;  2KF5 A;  1BSA A;  1UCJ A;  2RBI A;  1DET A;  1BSE A;  1TTO A;  1BGS A;  1FYS A;  1G02 A;  1RNB A;  1YGW A;  2BIR A;  3DH2 A;  3WHO A;  5BU4 A;  1BSC A;  1LRA A;  1RDS A;  1BAO A;  2AAE A;  1RNT A;  2F5M A;  1RGA A;  1BNE A;  5HOH A;  2F5W A;  1B2Z A;  1FZU A;  4GSP A;  1LOY A;  2HOH A;  1RCK A;  1DE3 A;  1JBS A;  1BVI A;  2KF4 A;  1BRN L;  1UCL A;  3A5E A;  1RMS A;  1I3I A;  1AQZ A;  6RNT A;  2KAA A;  1X1W A;  2SAR A;  1BRS A;  1GOY A;  1AY7 A;  3D5I A;  1I2E A;  1I8V A;  1T2I A;  1BNS A;  1ZGX A;  9RNT A;  1R4Y A;  1BUJ A;  4HAA A;  1BIR A;  6GSP A;  1FUS A;  1LOV A;  1RGH A;  1BRI A;  4RNT A;  1Q9E A;  4J5K A;  2RNT A;  4BIR A;  1B21 A;  1TRP A;  1I2G A;  1I0V A;  2AAD A;  1MGR A;  1BSD A;  1RGL A;  1RTU A;  2F4Y A;  1A2P A;  3DGY A;  1IYY A;  3Q3F A;  1RGK A;  1MGW A;  1B2U A;  1BRK A;  1RN4 A;  1T2H A;  4GHO A;  1JBT A;  1RHL A;  3SYU A;  2GSP A;  8RNT A;  2BU4 A;  1X1X A;  3KCH A;  4BU4 A;  1BOX A;  2KF3 A;  1RCL A;  3BU4 A;  1BNG A;  4HOH A;  3WR2 A;  1I2F A;  1RN1 A;  1JBR A;  2C4B A;  1BRJ A;  1HYF A;  1BSB A;  7GSP A;  7RNT A;  1RGC A;  1LOW A;  1PYL A;  1BNR A;  1I70 A;  1RLS A;  1BNJ A;  3AHW A;  1LNI A;  1UCI A;  1BAN A;  1GMR A;  1B20 A;  1YVS A;  1FW7 A;  1RGE A;  2ZA4 A;  1RGF A;  2KF6 A;  1FUT A;  3AHS A;  3AGO A;  1BRH A;  1B2M A;  3GSP A;  1RGG A;  3HOH A;  1GOU A;  1GSP A;  3D5G A;  2F56 A;  1GOV A;  1YNV X;  3D4A A;  5GSP A;  1B2X A;  1GMP A;  1UCK A;  1PY3 A;  3URP A;  1I0X A;  3AGN A;  4J5G A;  5RNT A;  1B27 A;  1I3F A; 
#chains in the Genus database with same CATH topology
 3CC4 3;  1TIJ A;  3KN4 A;  1B3S A;  1K8A 4;  1SPU A;  1JB2 A;  1O7G B;  3CPW 2;  1BU4 A;  3LT9 A;  2KCD A;  5I97 A;  1BRG A;  1SQW A;  3MHE A;  1FA3 A;  2D1W A;  3RNT A;  3AMO B;  3X41 A;  3CNM A;  3MPH A;  5CLK A;  3FG1 A;  3RGA A;  4MMY B;  1LQM B;  1DET A;  1U8C B;  2IUK A;  1US1 A;  3BB9 A;  1AVL A;  1GY6 A;  1Q7H A;  2HMN B;  3B7C A;  3MG2 A;  2GU1 A;  3OWY A;  1LRA A;  2CX1 A;  3GRD A;  2HMJ B;  3GZR A;  5EVH A;  3CCV 3;  2CX0 A;  4J9A A;  3X3X A;  1JV2 B;  1N9E A;  3FG4 A;  5HOH A;  5TGN A;  4I4K A;  3OW2 2;  4K61 A;  1W01 A;  1IDP A;  2HOH A;  3CPO A;  1UI8 A;  1PU4 A;  1DE3 A;  3IJE B;  3CME 3;  3J7Y d;  1FGT A;  1JBS A;  3A5E A;  2GXF A;  3ALA A;  4AKY A;  2W56 B;  4L7K A;  1Q40 A;  5IW9 A;  4K1V A;  5LC6 A;  6RNT A;  1OPY A;  1Q42 A;  3DM8 A;  4MMX B;  4GL6 A;  5M18 A;  1ASK A;  1BRS A;  2SAR A;  3NBR A;  1MWR A;  4R9K A;  3S27 A;  3D5I A;  1IVX A;  2IA7 A;  4XBX A;  2WOF A;  4FMA A;  5AEW B;  1VQ4 3;  1JB5 A;  1GYB A;  3F40 A;  2OOV C;  3K9M C;  1IV9 A;  5IEN A;  4HAA A;  2Z7A A;  1G96 A;  5EEO A;  2Y74 A;  1LOV A;  2W6J H;  4FCZ A;  3LTB A;  5M1A A;  1JN5 A;  4BIR A;  5BU4 A;  5BXQ A;  1T5Y A;  2AAD A;  1MGR A;  5DRV A;  2CC3 A;  2W03 A;  1RKY A;  2HMM B;  2IYJ A;  4LYL B;  1AR0 A;  3CCM 3;  2FNQ A;  1W4N A;  3Q3F A;  2BHM A;  5FW5 A;  1JZD A;  3K7C A;  3LXU X;  1B2U A;  2O9U X;  4MMZ B;  5G1L A;  1RN4 A;  3S29 A;  4WP5 A;  1RHL A;  3SYU A;  1R4C A;  3LYG A;  3M8C A;  3F7S A;  4N3V A;  2RCD A;  4BU4 A;  1BOX A;  4NRE A;  5M19 A;  1RCL A;  1BNG A;  3UNL A;  1RN1 A;  4HZB B;  1E97 A;  1HYF A;  4N6M A;  7RNT A;  3CCL 3;  2L4V A;  2RFR A;  3PXM A;  4K1U A;  3BLZ A;  3K5T A;  2J8X B;  4STD A;  3N54 B;  4L8P A;  3KSP A;  3FCS B;  2GU3 A;  4EYC A;  1YVB I;  1Q82 4;  1JRQ A;  1RLS A;  3O8Y A;  1OAC A;  1ZX2 A;  2ML5 A;  2XSO B;  1W6Y A;  2CG1 A;  1LNI A;  4N6L A;  4H3U A;  1GMR A;  1B20 A;  2HMK B;  3N9H A;  1UUV B;  3NQY A;  1KQS 2;  1W2B 2;  1FW7 A;  3HIG A;  4N6O B;  3WOE B;  3KFQ C;  2Z77 A;  5D81 A;  2XF3 A;  1RGF A;  1NO3 A;  1FGQ A;  1VQ7 3;  3PZW A;  1ULJ B;  1HU9 A;  1FUT A;  3NM2 A;  3L0R A;  4K90 B;  3AHS A;  3OWS A;  2LYX A;  3VSY A;  1N8Q A;  4BTX A;  1BRH A;  1B2M A;  2ZL8 A;  1YJ9 3;  1EUI C;  1IT7 A;  3G8Z A;  1GSP A;  1SII A;  4KFD A;  1GOV A;  1YNV X;  2P0X A;  4X2H A;  2Y73 A;  5AYR B;  3I55 3;  5GSP A;  4O8S A;  1VQK 3;  1A2K A;  1KWI A;  3KII A;  3U97 A;  1PY3 A;  3H3H A;  1IU7 A;  1V58 A;  3AMO A;  1I0X A;  4J5G A;  3JUP A;  2CFG A;  3URP A;  4EV5 A;  5RNT A;  1B27 A;  2R41 A;  1BAN A;  1YJW 3;  1K73 4;  4WYK A;  1UDI I;  1K41 A;  2CWT A;  1STD A;  3X3Z A;  3SOY A;  1CH0 A;  1X1Y A;  2XSH B;  2M7O A;  4HM5 B;  5STD A;  1Z1S A;  1NJI 4;  3IMA B;  2QGU A;  1F8N A;  5AIH A;  3G71 3;  3JUQ A;  2GBW B;  1SIH A;  3MWZ A;  4KVH A;  3DH2 A;  4N6N B;  2OOV A;  1N5P A;  4OK0 A;  3F9S A;  4IT7 A;  1RDS A;  4IPB A;  1K28 A;  3FG3 A;  5LC7 A;  3K0Z A;  1ZO2 A;  2AAE A;  5G2G A;  4QWT A;  4KFF A;  2F5M A;  2R4I A;  3BNE A;  5JBS A;  4XDV A;  3GZY B;  1RGA A;  3NQZ A;  4R9L A;  2ML6 A;  3S5C A;  3PYJ A;  2HML B;  1DMN A;  2F5W A;  4XBY A;  4J8T A;  2W2C A;  2W04 A;  3NX0 A;  1RCK A;  2UUG C;  1OGZ A;  4KT3 B;  5IG3 A;  1IQY A;  1STF I;  1UCL A;  3IPT A;  1N9J A;  3GAX A;  1UGI A;  3TDG A;  4LSO A;  1I3I A;  4PEJ A;  3CCJ 3;  1Q7Y 4;  1JJ2 2;  1MWT A;  2CH9 A;  4HVN A;  1KSI A;  1X1W A;  2BMQ B;  2CWV A;  3F8H A;  4R4K A;  1WNH A;  2Q07 A;  1M90 4;  4WYK B;  1W02 A;  3LOY A;  1T2I A;  1BUJ A;  1WMP A;  3EN1 B;  5AIG A;  3T8U A;  1BIR A;  3HZP A;  3DMC A;  3SED A;  1YJN 3;  4HJL B;  1RGH A;  1UUG B;  3CNX A;  1YIJ 3;  1VQ5 3;  1NB3 I;  5CXO A;  5DRE A;  2RNT A;  5ELU A;  1B21 A;  3EB8 A;  4HM4 B;  5JPP A;  1JKG A;  1TFK A;  2JQ5 A;  2K54 A;  2BMO B;  2ZDJ A;  3FGY A;  1TU5 A;  1SJW A;  2MF7 A;  2YFL B;  2IMJ A;  1NU3 A;  1IK3 A;  3S67 A;  2O3O A;  3WA3 A;  1O7H B;  4WFO A;  1JNQ A;  4RZM A;  2YFJ B;  2PZV A;  3Q2P A;  3NV0 A;  1OUN A;  1O7N B;  1LNH A;  2KF3 A;  5AI1 A;  5IF6 A;  1IT8 A;  3GZB A;  2GBX B;  2SBL A;  2CHC A;  3NHX A;  5KP3 A;  1I2F A;  2C4B A;  1BRJ A;  3CCE 3;  3DUK A;  7GSP A;  3SXX A;  2KXG A;  1ULI B;  2GEY A;  4EC6 A;  1QVG 2;  1GD3 A;  4HBR A;  2RSX A;  1ROA A;  4CJN A;  5FGO A;  1D6Z A;  1UGH I;  2MC8 A;  3FLJ A;  1BNJ A;  2P05 A;  3EX9 A;  3CMA 3;  1UUW B;  3MG3 A;  3GZX B;  3Q90 A;  2H0I A;  3I56 3;  1VQP 3;  2GEX A;  1OF5 A;  2INX A;  4EXR A;  3X40 A;  4FMB A;  1M1K 4;  1RN7 A;  3LTA A;  4FCJ A;  2W0Q A;  1OHP A;  1T3B A;  2KF6 A;  1JKG B;  3EJV A;  8CHO A;  1J2B A;  1EKM A;  4ILF A;  2CFK A;  5G1K A;  3CC7 3;  4NPB A;  3G4S 3;  1HKX A;  1GOU A;  2V1L A;  7STD A;  1NB5 I;  2OTL 3;  2LQV A;  1KD1 4;  1CEW I;  3NV0 B;  3D9R A;  1FUW A;  1IQX A;  1UCK A;  2F86 B;  1TJD A;  2XFT A;  3CXC 2;  3ZG5 A;  1C54 A;  1HZ1 A;  1BNI A;  1OGX A;  4RNZ A;  5BIR A;  4OVM A;  1B2S A;  1L5G B;  3HK4 A;  3FF0 A;  3BIR A;  1W5Z A;  1OCV A;  1TRQ A;  1W6C A;  2E2U A;  3EE1 A;  3EF8 A;  3ER7 A;  2KF5 A;  3NUV A;  3F14 A;  2CIU A;  1UCJ A;  3X42 A;  1BSE A;  1VQM 3;  2E2T A;  1TTO A;  2OCT A;  1S5A A;  1FYS A;  4FCM A;  1VQ8 3;  1RNB A;  1TUH A;  3LH4 A;  1QAF A;  1OF5 B;  2C10 A;  5CK6 A;  3LML A;  3UL5 A;  1BSC A;  3BNC A;  3ECF A;  1AVK A;  5JPU A;  2XEP A;  3CC2 3;  2WGQ A;  1RNT A;  1FGM A;  2CKF B;  3SOA A;  1BNE A;  4HM3 B;  1D6U A;  1QAK A;  1CYV A;  2F98 A;  3NXJ A;  1FZU A;  3DGO A;  4L8O A;  5IG5 A;  1LOY A;  1RRH A;  2P38 A;  3DXO A;  1FGR A;  1GD4 A;  1BVI A;  2KF4 A;  3PGB A;  4BL2 A;  1AQZ A;  1RRL A;  4BL3 A;  2W9Q A;  1O7W B;  3EBT A;  1DVC A;  2WO0 A;  3BNB A;  3WDG B;  1M9G A;  1MOL A;  1O7P B;  2C11 A;  4LMI A;  2P0M A;  4R1K A;  4XBT A;  1AY7 A;  1YIT 3;  1QVF 2;  4LGQ A;  1I2E A;  1NWW A;  1BNS A;  1R4Y A;  3S28 A;  3EHC A;  3K63 A;  3EBY A;  1UI7 A;  4CDL A;  6GSP A;  1FUS A;  3I0Y A;  5IEP A;  2QEX 3;  5IG0 A;  1Q81 4;  1Q9E A;  2UX0 A;  1WQL B;  3UJM A;  3GWR A;  4O02 B;  1I2G A;  4XDW A;  1I0V A;  2K0M A;  4FR9 A;  1RGL A;  4GB5 A;  3UL6 A;  1A2P A;  2I9W A;  3DGY A;  1D6Y A;  1BUQ A;  2QIY A;  1RGK A;  3QK9 A;  2YX9 A;  2B1X B;  1T2H A;  4FMC A;  1G0T A;  2GSP A;  4RNY A;  1QAL A;  2BU4 A;  1X1X A;  3KCH A;  1GY5 A;  3OV4 A;  2RGQ A;  3FKA A;  2XGL A;  3OWU A;  4HM0 B;  5AYS C;  4CPK A;  3BU4 A;  3MSO A;  3LZA A;  2Z76 A;  5KP4 A;  1A67 A;  1YGE A;  1K9M 4;  3CCU 3;  1JBR A;  3FSD A;  4I5Q A;  4R80 A;  3WOF B;  4JRF A;  1LOW A;  3QRD A;  4KZ1 A;  1S72 3;  5D82 A;  1IQ8 A;  1W2Z A;  2K3D A;  4HKV B;  4HYZ A;  1PYL A;  3G6E 3;  3ZFZ A;  1M1X B;  1I70 A;  3DGM A;  3STD A;  1EQK A;  4WHA A;  3B4O A;  3D3L A;  3MG1 A;  3U1W A;  4CCV A;  1LXE A;  3LT8 A;  4HM7 B;  3E99 A;  1YI2 3;  3SLU A;  4FMD A;  1QJG A;  3G16 A;  3EC9 A;  3BND A;  1DMM A;  3D79 A;  1U5O A;  4XB5 A;  4HZ9 B;  3VF1 A;  3KE7 A;  1RGE A;  1NNV A;  1EA2 A;  1VZZ A;  3JVC A;  3T8N A;  4LEH A;  3LTC A;  3NM7 A;  4AEQ A;  1CQS A;  1DYU A;  3OX9 A;  3CD6 3;  1TFO A;  2QA4 3;  1MWU A;  2CK3 H;  1JB4 A;  3NBB A;  2XFS A;  1W6G A;  4U13 A;  1VQN 3;  1LQG C;  4NHF A;  3GSP A;  1RGG A;  1NDO B;  3HOH A;  1QMA A;  1RJO A;  3F7X A;  4XM4 A;  2OTJ 3;  3D5G A;  3D4A A;  2FXT A;  2XGN A;  4G1M B;  1WMN A;  1B2X A;  4EW5 A;  4ORL A;  3CU3 A;  5A0O B;  4N6V 0;  4Q53 A;  2CFL A;  2BMR B;  1GS3 A;  1VQ6 3;  3KKG A;  1ZS7 A;  1I3F A;  1SAR A;  3Q1C A;  3KSE D;  1GMQ A;  1KC8 4;  1RSN A;  1TP6 A;  4MEI A;  1BNF A;  3SVA A;  1OHS A;  2A15 A;  1X1U A;  1BSA A;  1C7H A;  2RBI A;  1V74 A;  3H51 A;  5KP1 A;  4AKZ A;  5CF1 A;  1BGS A;  2BO9 B;  1G02 A;  3DGL A;  4HM8 B;  3KZT A;  1YGW A;  3EN8 A;  3ZG0 A;  4EV2 A;  2HMO B;  2BIR A;  3WHO A;  3HX8 A;  5IG4 A;  1W00 A;  2JDI H;  5HGR A;  2CW9 A;  1BAO A;  4H61 A;  4BTY A;  3FF2 A;  5EQL A;  1ISK A;  1DVD A;  2WGO A;  4EBG A;  2IY2 A;  1OH0 A;  1B2Z A;  3SX1 A;  4GSP A;  2CWU A;  1MWS A;  3DGN A;  3N8B A;  4MJD A;  2FGT A;  1BRN L;  1PFP A;  3FZW A;  1IV7 A;  3CCS 3;  1V57 A;  1W7C A;  2Z6B A;  5AEU B;  1RMS A;  4O3V A;  3HII A;  5CF2 A;  2D42 A;  2KAA A;  4N6U A;  1LOX A;  1Y4K A;  2WOH A;  3RGR A;  1GOY A;  3OXA A;  4N6T A;  3HI7 A;  3JUN A;  4WWU C;  1I8V A;  1N5H A;  1ZGX A;  5D83 A;  9RNT A;  1FGO A;  1IVV A;  1OHO A;  1Q40 B;  2XRX B;  2CFD A;  3PS8 A;  1O7M B;  3G0K A;  4DKI A;  2F99 A;  3T0U A;  1BRI A;  4RNT A;  2IUJ A;  4J5K A;  3CCR 3;  2H0G A;  1TRP A;  2XH9 A;  2OQE A;  6STD A;  1BSD A;  2BT3 A;  5AII A;  1RTU A;  1A2V A;  2F4Y A;  2OWP A;  3JUM A;  3DZL A;  4BTW A;  1E3V A;  1VQL 3;  3B4P A;  3JUO A;  1IYY A;  1MGW A;  3V98 A;  1ROV A;  1UW1 A;  2ZHX B;  4OUQ A;  1BRK A;  1JBT A;  1IVW A;  2L1S A;  4GHO A;  4HM2 B;  5IER A;  3ROB A;  1JN5 B;  2CFW A;  2PNC A;  1VQQ A;  2W9P A;  4X2O A;  1AV4 A;  5AIF A;  3WMD A;  8RNT A;  1VQ9 3;  1CYU A;  1GY7 A;  5IEO A;  1Q86 4;  3B8L A;  4HOH A;  3WR2 A;  3NBJ A;  1BSB A;  2KRT A;  3MKI A;  3PCR A;  4HM6 B;  4LZI A;  1RGC A;  1LVN A;  3CCQ 3;  1A90 A;  5ELJ A;  1WTH A;  1YHQ 3;  1BNR A;  3RDE A;  3V99 A;  2XR8 B;  1EEJ A;  3AHW A;  1VQO 3;  1UCI A;  3X3Y A;  3PCS A;  2P09 A;  3MYT A;  1IVU A;  1YVS A;  2B24 B;  3LTD A;  2E2V A;  4RBN A;  3V92 A;  4TX4 A;  2ZA4 A;  1MNL A;  2H0H A;  3VGN A;  2BNG A;  5BVB A;  1EG9 B;  3A76 A;  4ZM8 A;  1N8R 4;  3EQQ B;  3WA2 X;  3AGO A;  2YFI B;  4IIA A;  2UGI A;  1WMO A;  3DY5 A;  4HM1 B;  1E3R A;  4JF8 A;  2F56 A;  2STD A;  2W56 A;  3FH1 A;  3UB1 A;  4KFE A;  3WOD G;  4O2H A;  1GMP A;  2CG0 A;  1DMQ A;  2OQE C;  3AGN A;  3F8X A;  1JZO A; 
#chains in the Genus database with same CATH homology
 1HZ1 A;  1BNI A;  1SAR A;  5BIR A;  1B3S A;  1GMQ A;  1B2S A;  3BIR A;  1BU4 A;  1RSN A;  1TRQ A;  1C54 A;  1BRG A;  1BNF A;  1CH0 A;  1X1Y A;  3RNT A;  1X1U A;  2KF5 A;  1BSA A;  1UCJ A;  2RBI A;  1DET A;  1BSE A;  1TTO A;  1BGS A;  1FYS A;  1G02 A;  1RNB A;  1YGW A;  2BIR A;  3DH2 A;  3WHO A;  5BU4 A;  1BSC A;  1LRA A;  1RDS A;  1BAO A;  2AAE A;  1RNT A;  2F5M A;  1RGA A;  1BNE A;  5HOH A;  2F5W A;  1B2Z A;  1FZU A;  4GSP A;  1LOY A;  2HOH A;  1RCK A;  1DE3 A;  1JBS A;  1BVI A;  2KF4 A;  1BRN L;  1UCL A;  3A5E A;  1RMS A;  1I3I A;  1AQZ A;  6RNT A;  2KAA A;  1X1W A;  2SAR A;  1BRS A;  1GOY A;  1AY7 A;  3D5I A;  1I2E A;  1I8V A;  1T2I A;  1BNS A;  1ZGX A;  9RNT A;  1R4Y A;  1BUJ A;  4HAA A;  1BIR A;  6GSP A;  1FUS A;  1LOV A;  1RGH A;  1BRI A;  4RNT A;  1Q9E A;  4J5K A;  2RNT A;  4BIR A;  1B21 A;  1TRP A;  1I2G A;  1I0V A;  2AAD A;  1MGR A;  1BSD A;  1RGL A;  1RTU A;  2F4Y A;  1A2P A;  3DGY A;  1IYY A;  3Q3F A;  1RGK A;  1MGW A;  1B2U A;  1BRK A;  1RN4 A;  1T2H A;  4GHO A;  1JBT A;  1RHL A;  3SYU A;  2GSP A;  8RNT A;  2BU4 A;  1X1X A;  3KCH A;  4BU4 A;  1BOX A;  2KF3 A;  1RCL A;  3BU4 A;  1BNG A;  4HOH A;  3WR2 A;  1I2F A;  1RN1 A;  1JBR A;  2C4B A;  1BRJ A;  1HYF A;  1BSB A;  7GSP A;  7RNT A;  1RGC A;  1LOW A;  1PYL A;  1BNR A;  1I70 A;  1RLS A;  1BNJ A;  3AHW A;  1LNI A;  1UCI A;  1BAN A;  1GMR A;  1B20 A;  1YVS A;  1FW7 A;  1RGE A;  2ZA4 A;  1RGF A;  2KF6 A;  1FUT A;  3AHS A;  3AGO A;  1BRH A;  1B2M A;  3GSP A;  1RGG A;  3HOH A;  1GOU A;  1GSP A;  3D5G A;  2F56 A;  1GOV A;  1YNV X;  3D4A A;  5GSP A;  1B2X A;  1GMP A;  1UCK A;  1PY3 A;  3URP A;  1I0X A;  3AGN A;  4J5G A;  5RNT A;  1B27 A;  1I3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...