1I0VA

Ribonuclease t1 in complex with 2'gmp (form i crystal)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 28
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i0vA00
1BRSA 1BNSA 1T2HA 1BSAA 8RNTA 3URPA 2ZA4A 2C4BA 1B3SA 2BU4A 1UCKA 2KAAA 1I0VA 3GSPA 7GSPA 1B20A 3BIRA 1MGWA 1BRHA 1DETA 3RNTA 1RNBA 2KF6A 1PYLA 1I2EA 1GOUA 1RDSA 1BNRA 1FUSA 1BU4A 1BSBA 1CH0A 1BNJA 1RGGA 1B2UA 3AHWA 4BIRA 1DE3A 1HYFA 2F5MA 1RGHA 1YGWA 1X1XA 2GSPA 1BRIA 1RGEA 2F4YA 2RNTA 1SARA 4GHOA 2SARA 6RNTA 3Q3FA 1X1UA 1RGAA 1X1YA 4J5GA 1JBTA 1BANA 1I70A 1I3FA 3KCHA 1GMPA 1BNEA 1I8VA 1Q9EA 2HOHA 3HOHA 2AADA 1BNGA 1I2GA 1RGFA 4RNTA 1BNFA 4HOHA 3DH2A 1GMQA 1BSCA 1JBSA 1RMSA 4HAAA 4BU4A 1GSPA 2BIRA 1FZUA 3SYUA 1FW7A 1R4YA 3A5EA 1FUTA 1A2PA 1GOVA 1G02A 1YVSA 3AGOA 4J5KA 1BIRA 1BNIA 1RGKA 1TTOA 1BRNL 1I2FA 1B21A 1RN4A 1FYSA 1RSNA 1RLSA 1BSDA 2KF3A 7RNTA 1RGCA 1MGRA 1GOYA 3WHOA 1JBRA 3D5GA 1B2MA 1C54A 1TRQA 2F56A 1RCLA 1HZ1A 5BIRA 1X1WA 3AHSA 1I0XA 1AY7A 1UCIA 1ZGXA 2AAEA 4GSPA 1BVIA 2RBIA 1BRJA 1B2XA 1GMRA 3DGYA 2KF4A 1BAOA 1AQZA 1LRAA 1T2IA 9RNTA 1B2SA 5GSPA 1RTUA 1RHLA 1RGLA 1B27A 6GSPA 1UCLA 1BSEA 3BU4A 1LOWA 3WR2A 1LOYA 1IYYA 1BOXA 1LNIA 1RN1A 3AGNA 1I3IA 5BU4A 1LOVA 1TRPA 2F5WA 1BGSA 1YNVX 1BUJA 1RNTA 1BRGA 2KF5A 1RCKA 3D5IA 3D4AA 1PY3A 1BRKA 1B2ZA 5RNTA 5HOHA 1UCJA
chains in the Genus database with same CATH superfamily
1DVCA 1T3BA 4JRFA 5JBSA 3GZBA 1T2HA 2HMMB 3TDGA 1WMOA 1RKYA 3DXOA 2ZDJA 2Y73A 1US1A 1I0VA 1LXEA 1WQLB 4EXRA 3BLZA 3GSPA 1IK3A 1TUHA 1RRLA 3BIRA 1VQ43 2OQEA 2BHMA 1STDA 2Y74A 3RNTA 1RNBA 2HMJB 1YJW3 1E3VA 1VQQA 2KXGA 1N8QA 3MYTA 5AYRB 1BU4A 1MWRA 3FCSB 3FZWA 1OPYA 1GD3A 3JUQA 3JUNA 4WHAA 3AMOB 4AEQA 1O7MB 3N8BA 2HMNB 3WA2X 3DZLA 1OF5B 1N9EA 3EE1A 1BRIA 1RGEA 2BO9B 2E2TA 2F98A 2W04A 4O3VA 3SEDA 4GHOA 1NDOB 3PZWA 2OTJ3 3I563 3VGNA 1OGXA 1QVG2 2UGIA 2CWVA 4N6V0 3SVAA 3X41A 1A67A 1IVWA 1GMPA 3S29A 1W01A 1M904 3K5TA 4L7KA 2HOHA 4OUQA 4R9KA 1IVXA 2RSXA 4MEIA 1I2GA 4XB5A 4R80A 2W56A 1LOXA 1STFI 1RGFA 2O3OA 1WTHA 4RNYA 3T0UA 3N9HA 2SBLA 1RMSA 4HAAA 1AV4A 3OV4A 1R4YA 1JJ22 1F8NA 5D83A 2CFLA 4BTYA 1QMAA 1GOVA 2CK3H 1VQK3 1G02A 1M9GA 1QALA 1YVSA 4J5KA 4CCVA 1BIRA 3FGYA 5AIGA 4LZIA 4MJDA 1EA2A 3S67A 1TTOA 2Q07A 3NQZA 1I2FA 1RSNA 1RLSA 2YFLB 3BNBA 2C11A 3B4PA 3BNCA 3PCSA 3IMAB 5FW5A 4EBGA 5IERA 1QVF2 1DMNA 2RCDA 4OVMA 4L8PA 3AMOA 4G1MB 3ROBA 1O7PB 4HKVB 3CCL3 3SXXA 5M19A 3D3LA 3CU3A 2I9WA 1OF5A 3CMA3 3DUKA 1W4NA 3MHEA 1NB5I 3MPHA 1RCLA 1U5OA 1O7NB 1NNVA 4LYLB 5CF2A 1IU7A 1IT8A 1EKMA 1AY7A 1ZGXA 4GSPA 3MSOA 4HM6B 4EYCA 1BVIA 2OOVC 1V58A 4QWTA 1OGZA 5IEOA 5HGRA 4U13A 1JB4A 1GY6A 1T5YA 2YFJB 2XF3A 4KFDA 3DMCA 4KFEA 4EV2A 5KP1A 1T2IA 2C10A 1NB3I 1RHLA 5EEOA 2R4IA 1Q42A 3CCV3 2GXFA 1B27A 2XH9A 2BMRB 5IENA 6GSPA 2CWTA 2WOHA 1BOXA 3EB8A 2CFWA 4EV5A 1I3IA 5BU4A 1LOVA 1GY7A 2BNGA 2CX1A 2F5WA 3B7CA 4H61A 4XBTA 5TGNA 3X40A 1VQ73 1IQXA 1YI23 4R1KA 1VQN3 1BRGA 5ELUA 2ZHXB 1OHPA 3D5IA 5IG5A 1TJDA 2LQVA 1OACA 1BRKA 3K9MC 4FCZA 4HM0B 1UDII 3U1WA 3CME3 5D81A 5HOHA 3PXMA 2J8XB 4MMXB 5IW9A 1BRSA 2HMOB 4H3UA 1TIJA 3CCU3 1KC84 1BSAA 2OTL3 8RNTA 3Q2PA 5FGOA 5G2GA 4I4KA 2C4BA 1B3SA 2H0IA 2KAAA 2GBWB 3JVCA 3PYJA 4BL3A 1K734 2H0HA 3ECFA 1V74A 3QK9A 3CC73 1B20A 2CKFB 1Q814 1MGWA 1SIIA 3EC9A 2ZL8A 4WWUC 5JPUA 1PYLA 1TP6A 2UX0A 2CH9A 3NX0A 3UB1A 1BSBA 2BT3A 1CH0A 1N8R4 1RGGA 1W6YA 1B2UA 1FGQA 2JDIH 3EJVA 1MWSA 4BIRA 1DE3A 3IJEB 1ISKA 2CFDA 1LVNA 1YGWA 2GSPA 2UUGC 1YJ93 1E3RA 2XEPA 1NJI4 2RNTA 3FSDA 3CNXA 3I0YA 3NM2A 1SARA 5G1LA 2SARA 1FGMA 2CW9A 1GS3A 2OWPA 2H0GA 2W2CA 3K0ZA 1X1UA 4J5GA 3GZRA 1I70A 4O8SA 3JUOA 1K9M4 2AADA 1UI7A 1NWWA 3EQQB 1VZZA 4LMIA 3E99A 3EN8A 1IVVA 1BNFA 3GZXB 1KWIA 3K7CA 1MNLA 3DGNA 1SIHA 4KFFA 1JBSA 1IQYA 3PCRA 1M1K4 1C7HA 5KP3A 1FW7A 3G4S3 3FH1A 3A5EA 3EBYA 2M7OA 3LTBA 1SJWA 3FG4A 4LEHA 4WFOA 3AGOA 5DRVA 3FG3A 4FMAA 3LT9A 1TFKA 1BNIA 2K0MA 3LTAA 4MMYB 5CLKA 3S27A 4X2OA 4HM4B 4WYKB 1BRNL 4XM4A 3CCJ3 1Q824 2QGUA 3WOFB 3BNDA 3FLJA 4GB5A 4EW5A 2E2UA 2IA7A 3HX8A 3O8YA 1VQM3 2F86B 1JRQA 4ZM8A 4CJNA 5IG4A 3F9SA 1KSIA 3WHOA 3D5GA 1OHSA 4BTWA 4WP5A 4HBRA 1TRQA 3WDGB 5LC7A 3NXJA 1K41A 3WMDA 1DYUA 1HZ1A 2O9UX 3FG1A 2CX0A 2B24B 2RFRA 2D42A 3SX1A 1FUWA 1I0XA 3F7SA 3DGLA 3T8NA 1AVLA 2RBIA 3U97A 2INXA 3QRDA 1BRJA 1WMNA 2YX9A 1SQWA 3G713 2QEX3 3UL5A 3LYGA 3CD63 3DGYA 2KF4A 3KZTA 3MG2A 1EG9B 1N5HA 3V98A 1BAOA 9RNTA 2MF7A 3EBTA 3V99A 1B2SA 2CFGA 1IVUA 2B1XB 3OX9A 2FXTA 3ER7A 3S28A 1RGLA 3MKIA 3I553 2L4VA 3OXAA 1UCLA 1BSEA 1W00A 3CNMA 4K90B 3SLUA 3BU4A 4AKZA 4EC6A 5D82A 3HZPA 1IYYA 1RN1A 1UUWB 3OWSA 2OOVA 2IUJA 3G6E3 1TRPA 3CPW2 4N6MA 3FF2A 2CHCA 1DMMA 4GL6A 5IEPA 1Q7Y4 4FR9A 1EEJA 1RCKA 3D4AA 3MG1A 5EVHA 2QA43 5IG0A 5EQLA 1W2ZA 1PU4A 2Z6BA 1S5AA 3G0KA 4O02B 1TU5A 1BNSA 1FGTA 5IG3A 3URPA 3DGMA 2WOFA 2BU4A 1JZDA 1UCKA 1AVKA 1Q7HA 3CCQ3 5KP4A 1Q40B 4XDWA 1BRHA 1DETA 2ML6A 3LTDA 5M1AA 2KF6A 4XDVA 1GOUA 2CIUA 1RDSA 1IV9A 3B8LA 1CEWI 4J9AA 4MMZB 1U8CB 1VQO3 2XGLA 1BNRA 1IT7A 2CG1A 1ZX2A 3GZYB 4N6TA 1VQP3 3LTCA 4CDLA 1OHOA 1W5ZA 2Z7AA 3AHWA 1UUVB 4O2HA 1KQS2 4IPBA 3JUMA 3KE7A 1ASKA 3UNLA 5BVBA 3D79A 3Q3FA 3NBJA 2P05A 3KN4A 4FCMA 1YHQ3 1O7HB 1MWUA 1JN5B 3EHCA 1BANA 2D1WA 5IF6A 1I3FA 3D9RA 3CCM3 4L8OA 1Q9EA 1JB2A 3HOHA 3OW22 1BNGA 1MWTA 3H51A 1OH0A 4HM2B 4RNTA 1S723 3DM8A 3DH2A 3LH4A 1G96A 1GMQA 4OK0A 1ZS7A 3WODG 1GSPA 4X2HA 1FZUA 1LQMB 3STDA 3V92A 1A90A 3MG3A 1MOLA 1VQ93 3NBBA 4HM3B 1A2PA 3LMLA 2CC3A 4STDA 3EN1B 1D6ZA 3LT8A 2HMKB 1O7WB 5AYSC 3L0RA 4XBXA 3Q90A 1RGKA 1JKGB 4HZ9B 1LNHA 1RN7A 1Q40A 1VQL3 3SOAA 1B21A 4FMDA 1RN4A 3CXC2 2XFSA 1BSDA 5AIIA 2P0MA 1W02A 5DREA 1V57A 5A0OB 1E97A 1FGOA 3HI7A 1FA3A 3LOYA 1GOYA 1K28A 2P0XA 3F40A 3KIIA 5BXQA 1JBRA 2XSHB 1B2MA 1IQ8A 5JPPA 2W9QA 3KKGA 4ILFA 3K63A 2WO0A 4TX4A 3ZG0A 5BIRA 4R4KA 3GWRA 2W9PA 1X1WA 2L1SA 3X42A 1JZOA 3EX9A 1UCIA 4K1UA 2AAEA 1JN5A 2RGQA 2PNCA 4IT7A 5AIHA 1DVDA 4N6UA 1GYBA 3NM7A 1K8A4 1GMRA 2KRTA 3HK4A 3M8CA 1EQKA 1IDPA 1AQZA 1LRAA 4FMCA 3X3YA 3GAXA 4HJLB 1JB5A 3B4OA 3N54B 5GSPA 1W2B2 1VQ83 3HIIA 4J8TA 2A15A 1W7CA 3KFQC 1HU9A 2FNQA 1LOWA 1LOYA 1LNIA 4KVHA 3ZFZA 3G16A 3PS8A 3BB9A 2OCTA 3NBRA 1BGSA 3NHXA 4HYZA 3CC23 1YNVX 1BUJA 1RNTA 4KZ1A 2P09A 5AEWB 2OQEC 2JQ5A 3F8HA 1YJN3 1PY3A 1JKGA 4LGQA 1B2ZA 1WMPA 5RNTA 2E2VA 1UCJA 3PGBA 3RGAA 5CF1A 1SPUA 3LXUX 1RRHA 3X3ZA 1ROAA 4BTXA 2ZA4A 3CCR3 1ROVA 1L5GB 1FGRA 1G0TA 8CHOA 1Q864 3CC43 3MWZA 2GEXA 3GRDA 4N6NB 3KSPA 7GSPA 2XRXB 3OWUA 3F8XA 4HM8B 4N3VA 3UJMA 3A76A 1YVBI 1I2EA 4Q53A 1UGHI 4IIAA 1VQ53 1FUSA 1ZO2A 4HM7B 3S5CA 2R41A 2Z77A 4ORLA 1YIJ3 1BNJA 4I5QA 3ZG5A 4RBNA 1OUNA 4N6LA 1GY5A 5AI1A 1HYFA 1AR0A 1RGHA 2F5MA 1X1XA 3X3XA 1EUIC 3DGOA 2F4YA 3F14A 2CWUA 3G8ZA 3NQYA 4WYKA 4K1VA 3RDEA 2XGNA 2FGTA 4CPKA 6RNTA 2CFKA 2ML5A 1YGEA 5STDA 1RGAA 1X1YA 4NPBA 3FKAA 4RZMA 6STDA 1JBTA 1J2BA 3KCHA 3DY5A 3BNEA 1O7GB 1BNEA 1I8VA 1JNQA 1GD4A 1M1XB 1Z1SA 1PFPA 4N6OB 2MC8A 3WOEB 1UI8A 3CCE3 2W6JH 2STDA 1NO3A 2GU1A 2IYJA 2PZVA 4HOHA 2P38A 2IY2A 1BSCA 4HZBB 4BU4A 3CCS3 2BIRA 3SYUA 3F7XA 1RJOA 2K3DA 2W03A 1A2VA 3EF8A 1FUTA 2WGQA 1Y4KA 3CPOA 3SOYA 1VQ63 3Q1CA 2K54A 1W6GA 1NU3A 1BUQA 2V1LA 2IUKA 3NV0B 2IMJA 1JV2B 3VSYA 5I97A 1LQGC 1FYSA 3J7Yd 4HM5B 2KF3A 7RNTA 1RGCA 3H3HA 1DMQA 1TFOA 2BMQB 2Z76A 3NUVA 1MGRA 5G1KA 1N9JA 1ULIB 4BL2A 2HMLB 3HIGA 2BMOB 2QIYA 1UGIA 3KSED 1QAKA 4NREA 1C54A 5AEUB 2F56A 1D6YA 1ULJB 1W6CA 1CYVA 1HKXA 3JUPA 1CQSA 3AHSA 1WNHA 3OWYA 1CYUA 4LSOA 1IV7A 4RNZA 2XR8B 1QAFA 1B2XA 2F99A 1D6UA 3WA3A 4AKYA 4JF8A 2XFTA 2WGOA 7STDA 1KD14 5CXOA 1R4CA 3VF1A 2W0QA 3ALAA 2YFIB 1RTUA 2GEYA 1A2KA 2GBXB 2LYXA 3T8UA 3UL6A 3WR2A 1YIT3 4HM1B 5AIFA 3AGNA 4FMBA 1N5PA 5CK6A 2KCDA 3FF0A 4FCJA 1QJGA 2W56B 4PEJA 2XSOB 4KT3B 5LC6A 2CG0A 4K61A 2KF5A 3LZAA 1OCVA 4HVNA 5ELJA 5M18A 4DKIA 4NHFA 1UUGB 3NV0A 3RGRA 4R9LA 1UW1A 4XBYA 2GU3A 3IPTA
chains in the Genus database with same CATH topology
1BRSA 1BNSA 1T2HA 1BSAA 8RNTA 3URPA 2ZA4A 2C4BA 1B3SA 2BU4A 1UCKA 2KAAA 1I0VA 3GSPA 7GSPA 1B20A 3BIRA 1MGWA 1BRHA 1DETA 3RNTA 1RNBA 2KF6A 1PYLA 1I2EA 1GOUA 1RDSA 1BNRA 1FUSA 1BU4A 1BSBA 1CH0A 1BNJA 1RGGA 1B2UA 3AHWA 4BIRA 1DE3A 1HYFA 2F5MA 1RGHA 1YGWA 1X1XA 2GSPA 1BRIA 1RGEA 2F4YA 2RNTA 1SARA 4GHOA 2SARA 6RNTA 3Q3FA 1X1UA 1RGAA 1X1YA 4J5GA 1JBTA 1BANA 1I70A 1I3FA 3KCHA 1GMPA 1BNEA 1I8VA 1Q9EA 2HOHA 3HOHA 2AADA 1BNGA 1I2GA 1RGFA 4RNTA 1BNFA 4HOHA 3DH2A 1GMQA 1BSCA 1JBSA 1RMSA 4HAAA 4BU4A 1GSPA 2BIRA 1FZUA 3SYUA 1FW7A 1R4YA 3A5EA 1FUTA 1A2PA 1GOVA 1G02A 1YVSA 3AGOA 4J5KA 1BIRA 1BNIA 1RGKA 1TTOA 1BRNL 1I2FA 1B21A 1RN4A 1FYSA 1RSNA 1RLSA 1BSDA 2KF3A 7RNTA 1RGCA 1MGRA 1GOYA 3WHOA 1JBRA 3D5GA 1B2MA 1C54A 1TRQA 2F56A 1RCLA 1HZ1A 5BIRA 1X1WA 3AHSA 1I0XA 1AY7A 1UCIA 1ZGXA 2AAEA 4GSPA 1BVIA 2RBIA 1BRJA 1B2XA 1GMRA 3DGYA 2KF4A 1BAOA 1AQZA 1LRAA 1T2IA 9RNTA 1B2SA 5GSPA 1RTUA 1RHLA 1RGLA 1B27A 6GSPA 1UCLA 1BSEA 3BU4A 1LOWA 3WR2A 1LOYA 1IYYA 1BOXA 1LNIA 1RN1A 3AGNA 1I3IA 5BU4A 1LOVA 1TRPA 2F5WA 1BGSA 1YNVX 1BUJA 1RNTA 1BRGA 2KF5A 1RCKA 3D5IA 3D4AA 1PY3A 1BRKA 1B2ZA 5RNTA 5HOHA 1UCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRS A;  1BNS A;  1T2H A;  1BSA A;  8RNT A;  3URP A;  2ZA4 A;  2C4B A;  1B3S A;  2BU4 A;  1UCK A;  2KAA A;  1I0V A;  3GSP A;  7GSP A;  1B20 A;  3BIR A;  1MGW A;  1BRH A;  1DET A;  3RNT A;  1RNB A;  2KF6 A;  1PYL A;  1I2E A;  1GOU A;  1RDS A;  1BNR A;  1FUS A;  1BU4 A;  1BSB A;  1CH0 A;  1BNJ A;  1RGG A;  1B2U A;  3AHW A;  4BIR A;  1DE3 A;  1HYF A;  2F5M A;  1RGH A;  1YGW A;  1X1X A;  2GSP A;  1BRI A;  1RGE A;  2F4Y A;  2RNT A;  1SAR A;  4GHO A;  2SAR A;  6RNT A;  3Q3F A;  1X1U A;  1RGA A;  1X1Y A;  4J5G A;  1JBT A;  1BAN A;  1I70 A;  1I3F A;  3KCH A;  1GMP A;  1BNE A;  1I8V A;  1Q9E A;  2HOH A;  3HOH A;  2AAD A;  1BNG A;  1I2G A;  1RGF A;  4RNT A;  1BNF A;  4HOH A;  3DH2 A;  1GMQ A;  1BSC A;  1JBS A;  1RMS A;  4HAA A;  4BU4 A;  1GSP A;  2BIR A;  1FZU A;  3SYU A;  1FW7 A;  1R4Y A;  3A5E A;  1FUT A;  1A2P A;  1GOV A;  1G02 A;  1YVS A;  3AGO A;  4J5K A;  1BIR A;  1BNI A;  1RGK A;  1TTO A;  1BRN L;  1I2F A;  1B21 A;  1RN4 A;  1FYS A;  1RSN A;  1RLS A;  1BSD A;  2KF3 A;  7RNT A;  1RGC A;  1MGR A;  1GOY A;  3WHO A;  1JBR A;  3D5G A;  1B2M A;  1C54 A;  1TRQ A;  2F56 A;  1RCL A;  1HZ1 A;  5BIR A;  1X1W A;  3AHS A;  1I0X A;  1AY7 A;  1UCI A;  1ZGX A;  2AAE A;  4GSP A;  1BVI A;  2RBI A;  1BRJ A;  1B2X A;  1GMR A;  3DGY A;  2KF4 A;  1BAO A;  1AQZ A;  1LRA A;  1T2I A;  9RNT A;  1B2S A;  5GSP A;  1RTU A;  1RHL A;  1RGL A;  1B27 A;  6GSP A;  1UCL A;  1BSE A;  3BU4 A;  1LOW A;  3WR2 A;  1LOY A;  1IYY A;  1BOX A;  1LNI A;  1RN1 A;  3AGN A;  1I3I A;  5BU4 A;  1LOV A;  1TRP A;  2F5W A;  1BGS A;  1YNV X;  1BUJ A;  1RNT A;  1BRG A;  2KF5 A;  1RCK A;  3D5I A;  3D4A A;  1PY3 A;  1BRK A;  1B2Z A;  5RNT A;  5HOH A;  1UCJ A; 
#chains in the Genus database with same CATH topology
 1DVC A;  1T3B A;  4JRF A;  5JBS A;  3GZB A;  1T2H A;  2HMM B;  3TDG A;  1WMO A;  1RKY A;  3DXO A;  2ZDJ A;  2Y73 A;  1US1 A;  1I0V A;  1LXE A;  1WQL B;  4EXR A;  3BLZ A;  3GSP A;  1IK3 A;  1TUH A;  1RRL A;  3BIR A;  1VQ4 3;  2OQE A;  2BHM A;  1STD A;  2Y74 A;  3RNT A;  1RNB A;  2HMJ B;  1YJW 3;  1E3V A;  1VQQ A;  2KXG A;  1N8Q A;  3MYT A;  5AYR B;  1BU4 A;  1MWR A;  3FCS B;  3FZW A;  1OPY A;  1GD3 A;  3JUQ A;  3JUN A;  4WHA A;  3AMO B;  4AEQ A;  1O7M B;  3N8B A;  2HMN B;  3WA2 X;  3DZL A;  1OF5 B;  1N9E A;  3EE1 A;  1BRI A;  1RGE A;  2BO9 B;  2E2T A;  2F98 A;  2W04 A;  4O3V A;  3SED A;  4GHO A;  1NDO B;  3PZW A;  2OTJ 3;  3I56 3;  3VGN A;  1OGX A;  1QVG 2;  2UGI A;  2CWV A;  4N6V 0;  3SVA A;  3X41 A;  1A67 A;  1IVW A;  1GMP A;  3S29 A;  1W01 A;  1M90 4;  3K5T A;  4L7K A;  2HOH A;  4OUQ A;  4R9K A;  1IVX A;  2RSX A;  4MEI A;  1I2G A;  4XB5 A;  4R80 A;  2W56 A;  1LOX A;  1STF I;  1RGF A;  2O3O A;  1WTH A;  4RNY A;  3T0U A;  3N9H A;  2SBL A;  1RMS A;  4HAA A;  1AV4 A;  3OV4 A;  1R4Y A;  1JJ2 2;  1F8N A;  5D83 A;  2CFL A;  4BTY A;  1QMA A;  1GOV A;  2CK3 H;  1VQK 3;  1G02 A;  1M9G A;  1QAL A;  1YVS A;  4J5K A;  4CCV A;  1BIR A;  3FGY A;  5AIG A;  4LZI A;  4MJD A;  1EA2 A;  3S67 A;  1TTO A;  2Q07 A;  3NQZ A;  1I2F A;  1RSN A;  1RLS A;  2YFL B;  3BNB A;  2C11 A;  3B4P A;  3BNC A;  3PCS A;  3IMA B;  5FW5 A;  4EBG A;  5IER A;  1QVF 2;  1DMN A;  2RCD A;  4OVM A;  4L8P A;  3AMO A;  4G1M B;  3ROB A;  1O7P B;  4HKV B;  3CCL 3;  3SXX A;  5M19 A;  3D3L A;  3CU3 A;  2I9W A;  1OF5 A;  3CMA 3;  3DUK A;  1W4N A;  3MHE A;  1NB5 I;  3MPH A;  1RCL A;  1U5O A;  1O7N B;  1NNV A;  4LYL B;  5CF2 A;  1IU7 A;  1IT8 A;  1EKM A;  1AY7 A;  1ZGX A;  4GSP A;  3MSO A;  4HM6 B;  4EYC A;  1BVI A;  2OOV C;  1V58 A;  4QWT A;  1OGZ A;  5IEO A;  5HGR A;  4U13 A;  1JB4 A;  1GY6 A;  1T5Y A;  2YFJ B;  2XF3 A;  4KFD A;  3DMC A;  4KFE A;  4EV2 A;  5KP1 A;  1T2I A;  2C10 A;  1NB3 I;  1RHL A;  5EEO A;  2R4I A;  1Q42 A;  3CCV 3;  2GXF A;  1B27 A;  2XH9 A;  2BMR B;  5IEN A;  6GSP A;  2CWT A;  2WOH A;  1BOX A;  3EB8 A;  2CFW A;  4EV5 A;  1I3I A;  5BU4 A;  1LOV A;  1GY7 A;  2BNG A;  2CX1 A;  2F5W A;  3B7C A;  4H61 A;  4XBT A;  5TGN A;  3X40 A;  1VQ7 3;  1IQX A;  1YI2 3;  4R1K A;  1VQN 3;  1BRG A;  5ELU A;  2ZHX B;  1OHP A;  3D5I A;  5IG5 A;  1TJD A;  2LQV A;  1OAC A;  1BRK A;  3K9M C;  4FCZ A;  4HM0 B;  1UDI I;  3U1W A;  3CME 3;  5D81 A;  5HOH A;  3PXM A;  2J8X B;  4MMX B;  5IW9 A;  1BRS A;  2HMO B;  4H3U A;  1TIJ A;  3CCU 3;  1KC8 4;  1BSA A;  2OTL 3;  8RNT A;  3Q2P A;  5FGO A;  5G2G A;  4I4K A;  2C4B A;  1B3S A;  2H0I A;  2KAA A;  2GBW B;  3JVC A;  3PYJ A;  4BL3 A;  1K73 4;  2H0H A;  3ECF A;  1V74 A;  3QK9 A;  3CC7 3;  1B20 A;  2CKF B;  1Q81 4;  1MGW A;  1SII A;  3EC9 A;  2ZL8 A;  4WWU C;  5JPU A;  1PYL A;  1TP6 A;  2UX0 A;  2CH9 A;  3NX0 A;  3UB1 A;  1BSB A;  2BT3 A;  1CH0 A;  1N8R 4;  1RGG A;  1W6Y A;  1B2U A;  1FGQ A;  2JDI H;  3EJV A;  1MWS A;  4BIR A;  1DE3 A;  3IJE B;  1ISK A;  2CFD A;  1LVN A;  1YGW A;  2GSP A;  2UUG C;  1YJ9 3;  1E3R A;  2XEP A;  1NJI 4;  2RNT A;  3FSD A;  3CNX A;  3I0Y A;  3NM2 A;  1SAR A;  5G1L A;  2SAR A;  1FGM A;  2CW9 A;  1GS3 A;  2OWP A;  2H0G A;  2W2C A;  3K0Z A;  1X1U A;  4J5G A;  3GZR A;  1I70 A;  4O8S A;  3JUO A;  1K9M 4;  2AAD A;  1UI7 A;  1NWW A;  3EQQ B;  1VZZ A;  4LMI A;  3E99 A;  3EN8 A;  1IVV A;  1BNF A;  3GZX B;  1KWI A;  3K7C A;  1MNL A;  3DGN A;  1SIH A;  4KFF A;  1JBS A;  1IQY A;  3PCR A;  1M1K 4;  1C7H A;  5KP3 A;  1FW7 A;  3G4S 3;  3FH1 A;  3A5E A;  3EBY A;  2M7O A;  3LTB A;  1SJW A;  3FG4 A;  4LEH A;  4WFO A;  3AGO A;  5DRV A;  3FG3 A;  4FMA A;  3LT9 A;  1TFK A;  1BNI A;  2K0M A;  3LTA A;  4MMY B;  5CLK A;  3S27 A;  4X2O A;  4HM4 B;  4WYK B;  1BRN L;  4XM4 A;  3CCJ 3;  1Q82 4;  2QGU A;  3WOF B;  3BND A;  3FLJ A;  4GB5 A;  4EW5 A;  2E2U A;  2IA7 A;  3HX8 A;  3O8Y A;  1VQM 3;  2F86 B;  1JRQ A;  4ZM8 A;  4CJN A;  5IG4 A;  3F9S A;  1KSI A;  3WHO A;  3D5G A;  1OHS A;  4BTW A;  4WP5 A;  4HBR A;  1TRQ A;  3WDG B;  5LC7 A;  3NXJ A;  1K41 A;  3WMD A;  1DYU A;  1HZ1 A;  2O9U X;  3FG1 A;  2CX0 A;  2B24 B;  2RFR A;  2D42 A;  3SX1 A;  1FUW A;  1I0X A;  3F7S A;  3DGL A;  3T8N A;  1AVL A;  2RBI A;  3U97 A;  2INX A;  3QRD A;  1BRJ A;  1WMN A;  2YX9 A;  1SQW A;  3G71 3;  2QEX 3;  3UL5 A;  3LYG A;  3CD6 3;  3DGY A;  2KF4 A;  3KZT A;  3MG2 A;  1EG9 B;  1N5H A;  3V98 A;  1BAO A;  9RNT A;  2MF7 A;  3EBT A;  3V99 A;  1B2S A;  2CFG A;  1IVU A;  2B1X B;  3OX9 A;  2FXT A;  3ER7 A;  3S28 A;  1RGL A;  3MKI A;  3I55 3;  2L4V A;  3OXA A;  1UCL A;  1BSE A;  1W00 A;  3CNM A;  4K90 B;  3SLU A;  3BU4 A;  4AKZ A;  4EC6 A;  5D82 A;  3HZP A;  1IYY A;  1RN1 A;  1UUW B;  3OWS A;  2OOV A;  2IUJ A;  3G6E 3;  1TRP A;  3CPW 2;  4N6M A;  3FF2 A;  2CHC A;  1DMM A;  4GL6 A;  5IEP A;  1Q7Y 4;  4FR9 A;  1EEJ A;  1RCK A;  3D4A A;  3MG1 A;  5EVH A;  2QA4 3;  5IG0 A;  5EQL A;  1W2Z A;  1PU4 A;  2Z6B A;  1S5A A;  3G0K A;  4O02 B;  1TU5 A;  1BNS A;  1FGT A;  5IG3 A;  3URP A;  3DGM A;  2WOF A;  2BU4 A;  1JZD A;  1UCK A;  1AVK A;  1Q7H A;  3CCQ 3;  5KP4 A;  1Q40 B;  4XDW A;  1BRH A;  1DET A;  2ML6 A;  3LTD A;  5M1A A;  2KF6 A;  4XDV A;  1GOU A;  2CIU A;  1RDS A;  1IV9 A;  3B8L A;  1CEW I;  4J9A A;  4MMZ B;  1U8C B;  1VQO 3;  2XGL A;  1BNR A;  1IT7 A;  2CG1 A;  1ZX2 A;  3GZY B;  4N6T A;  1VQP 3;  3LTC A;  4CDL A;  1OHO A;  1W5Z A;  2Z7A A;  3AHW A;  1UUV B;  4O2H A;  1KQS 2;  4IPB A;  3JUM A;  3KE7 A;  1ASK A;  3UNL A;  5BVB A;  3D79 A;  3Q3F A;  3NBJ A;  2P05 A;  3KN4 A;  4FCM A;  1YHQ 3;  1O7H B;  1MWU A;  1JN5 B;  3EHC A;  1BAN A;  2D1W A;  5IF6 A;  1I3F A;  3D9R A;  3CCM 3;  4L8O A;  1Q9E A;  1JB2 A;  3HOH A;  3OW2 2;  1BNG A;  1MWT A;  3H51 A;  1OH0 A;  4HM2 B;  4RNT A;  1S72 3;  3DM8 A;  3DH2 A;  3LH4 A;  1G96 A;  1GMQ A;  4OK0 A;  1ZS7 A;  3WOD G;  1GSP A;  4X2H A;  1FZU A;  1LQM B;  3STD A;  3V92 A;  1A90 A;  3MG3 A;  1MOL A;  1VQ9 3;  3NBB A;  4HM3 B;  1A2P A;  3LML A;  2CC3 A;  4STD A;  3EN1 B;  1D6Z A;  3LT8 A;  2HMK B;  1O7W B;  5AYS C;  3L0R A;  4XBX A;  3Q90 A;  1RGK A;  1JKG B;  4HZ9 B;  1LNH A;  1RN7 A;  1Q40 A;  1VQL 3;  3SOA A;  1B21 A;  4FMD A;  1RN4 A;  3CXC 2;  2XFS A;  1BSD A;  5AII A;  2P0M A;  1W02 A;  5DRE A;  1V57 A;  5A0O B;  1E97 A;  1FGO A;  3HI7 A;  1FA3 A;  3LOY A;  1GOY A;  1K28 A;  2P0X A;  3F40 A;  3KII A;  5BXQ A;  1JBR A;  2XSH B;  1B2M A;  1IQ8 A;  5JPP A;  2W9Q A;  3KKG A;  4ILF A;  3K63 A;  2WO0 A;  4TX4 A;  3ZG0 A;  5BIR A;  4R4K A;  3GWR A;  2W9P A;  1X1W A;  2L1S A;  3X42 A;  1JZO A;  3EX9 A;  1UCI A;  4K1U A;  2AAE A;  1JN5 A;  2RGQ A;  2PNC A;  4IT7 A;  5AIH A;  1DVD A;  4N6U A;  1GYB A;  3NM7 A;  1K8A 4;  1GMR A;  2KRT A;  3HK4 A;  3M8C A;  1EQK A;  1IDP A;  1AQZ A;  1LRA A;  4FMC A;  3X3Y A;  3GAX A;  4HJL B;  1JB5 A;  3B4O A;  3N54 B;  5GSP A;  1W2B 2;  1VQ8 3;  3HII A;  4J8T A;  2A15 A;  1W7C A;  3KFQ C;  1HU9 A;  2FNQ A;  1LOW A;  1LOY A;  1LNI A;  4KVH A;  3ZFZ A;  3G16 A;  3PS8 A;  3BB9 A;  2OCT A;  3NBR A;  1BGS A;  3NHX A;  4HYZ A;  3CC2 3;  1YNV X;  1BUJ A;  1RNT A;  4KZ1 A;  2P09 A;  5AEW B;  2OQE C;  2JQ5 A;  3F8H A;  1YJN 3;  1PY3 A;  1JKG A;  4LGQ A;  1B2Z A;  1WMP A;  5RNT A;  2E2V A;  1UCJ A;  3PGB A;  3RGA A;  5CF1 A;  1SPU A;  3LXU X;  1RRH A;  3X3Z A;  1ROA A;  4BTX A;  2ZA4 A;  3CCR 3;  1ROV A;  1L5G B;  1FGR A;  1G0T A;  8CHO A;  1Q86 4;  3CC4 3;  3MWZ A;  2GEX A;  3GRD A;  4N6N B;  3KSP A;  7GSP A;  2XRX B;  3OWU A;  3F8X A;  4HM8 B;  4N3V A;  3UJM A;  3A76 A;  1YVB I;  1I2E A;  4Q53 A;  1UGH I;  4IIA A;  1VQ5 3;  1FUS A;  1ZO2 A;  4HM7 B;  3S5C A;  2R41 A;  2Z77 A;  4ORL A;  1YIJ 3;  1BNJ A;  4I5Q A;  3ZG5 A;  4RBN A;  1OUN A;  4N6L A;  1GY5 A;  5AI1 A;  1HYF A;  1AR0 A;  1RGH A;  2F5M A;  1X1X A;  3X3X A;  1EUI C;  3DGO A;  2F4Y A;  3F14 A;  2CWU A;  3G8Z A;  3NQY A;  4WYK A;  4K1V A;  3RDE A;  2XGN A;  2FGT A;  4CPK A;  6RNT A;  2CFK A;  2ML5 A;  1YGE A;  5STD A;  1RGA A;  1X1Y A;  4NPB A;  3FKA A;  4RZM A;  6STD A;  1JBT A;  1J2B A;  3KCH A;  3DY5 A;  3BNE A;  1O7G B;  1BNE A;  1I8V A;  1JNQ A;  1GD4 A;  1M1X B;  1Z1S A;  1PFP A;  4N6O B;  2MC8 A;  3WOE B;  1UI8 A;  3CCE 3;  2W6J H;  2STD A;  1NO3 A;  2GU1 A;  2IYJ A;  2PZV A;  4HOH A;  2P38 A;  2IY2 A;  1BSC A;  4HZB B;  4BU4 A;  3CCS 3;  2BIR A;  3SYU A;  3F7X A;  1RJO A;  2K3D A;  2W03 A;  1A2V A;  3EF8 A;  1FUT A;  2WGQ A;  1Y4K A;  3CPO A;  3SOY A;  1VQ6 3;  3Q1C A;  2K54 A;  1W6G A;  1NU3 A;  1BUQ A;  2V1L A;  2IUK A;  3NV0 B;  2IMJ A;  1JV2 B;  3VSY A;  5I97 A;  1LQG C;  1FYS A;  3J7Y d;  4HM5 B;  2KF3 A;  7RNT A;  1RGC A;  3H3H A;  1DMQ A;  1TFO A;  2BMQ B;  2Z76 A;  3NUV A;  1MGR A;  5G1K A;  1N9J A;  1ULI B;  4BL2 A;  2HML B;  3HIG A;  2BMO B;  2QIY A;  1UGI A;  3KSE D;  1QAK A;  4NRE A;  1C54 A;  5AEU B;  2F56 A;  1D6Y A;  1ULJ B;  1W6C A;  1CYV A;  1HKX A;  3JUP A;  1CQS A;  3AHS A;  1WNH A;  3OWY A;  1CYU A;  4LSO A;  1IV7 A;  4RNZ A;  2XR8 B;  1QAF A;  1B2X A;  2F99 A;  1D6U A;  3WA3 A;  4AKY A;  4JF8 A;  2XFT A;  2WGO A;  7STD A;  1KD1 4;  5CXO A;  1R4C A;  3VF1 A;  2W0Q A;  3ALA A;  2YFI B;  1RTU A;  2GEY A;  1A2K A;  2GBX B;  2LYX A;  3T8U A;  3UL6 A;  3WR2 A;  1YIT 3;  4HM1 B;  5AIF A;  3AGN A;  4FMB A;  1N5P A;  5CK6 A;  2KCD A;  3FF0 A;  4FCJ A;  1QJG A;  2W56 B;  4PEJ A;  2XSO B;  4KT3 B;  5LC6 A;  2CG0 A;  4K61 A;  2KF5 A;  3LZA A;  1OCV A;  4HVN A;  5ELJ A;  5M18 A;  4DKI A;  4NHF A;  1UUG B;  3NV0 A;  3RGR A;  4R9L A;  1UW1 A;  4XBY A;  2GU3 A;  3IPT A; 
#chains in the Genus database with same CATH homology
 1BRS A;  1BNS A;  1T2H A;  1BSA A;  8RNT A;  3URP A;  2ZA4 A;  2C4B A;  1B3S A;  2BU4 A;  1UCK A;  2KAA A;  1I0V A;  3GSP A;  7GSP A;  1B20 A;  3BIR A;  1MGW A;  1BRH A;  1DET A;  3RNT A;  1RNB A;  2KF6 A;  1PYL A;  1I2E A;  1GOU A;  1RDS A;  1BNR A;  1FUS A;  1BU4 A;  1BSB A;  1CH0 A;  1BNJ A;  1RGG A;  1B2U A;  3AHW A;  4BIR A;  1DE3 A;  1HYF A;  2F5M A;  1RGH A;  1YGW A;  1X1X A;  2GSP A;  1BRI A;  1RGE A;  2F4Y A;  2RNT A;  1SAR A;  4GHO A;  2SAR A;  6RNT A;  3Q3F A;  1X1U A;  1RGA A;  1X1Y A;  4J5G A;  1JBT A;  1BAN A;  1I70 A;  1I3F A;  3KCH A;  1GMP A;  1BNE A;  1I8V A;  1Q9E A;  2HOH A;  3HOH A;  2AAD A;  1BNG A;  1I2G A;  1RGF A;  4RNT A;  1BNF A;  4HOH A;  3DH2 A;  1GMQ A;  1BSC A;  1JBS A;  1RMS A;  4HAA A;  4BU4 A;  1GSP A;  2BIR A;  1FZU A;  3SYU A;  1FW7 A;  1R4Y A;  3A5E A;  1FUT A;  1A2P A;  1GOV A;  1G02 A;  1YVS A;  3AGO A;  4J5K A;  1BIR A;  1BNI A;  1RGK A;  1TTO A;  1BRN L;  1I2F A;  1B21 A;  1RN4 A;  1FYS A;  1RSN A;  1RLS A;  1BSD A;  2KF3 A;  7RNT A;  1RGC A;  1MGR A;  1GOY A;  3WHO A;  1JBR A;  3D5G A;  1B2M A;  1C54 A;  1TRQ A;  2F56 A;  1RCL A;  1HZ1 A;  5BIR A;  1X1W A;  3AHS A;  1I0X A;  1AY7 A;  1UCI A;  1ZGX A;  2AAE A;  4GSP A;  1BVI A;  2RBI A;  1BRJ A;  1B2X A;  1GMR A;  3DGY A;  2KF4 A;  1BAO A;  1AQZ A;  1LRA A;  1T2I A;  9RNT A;  1B2S A;  5GSP A;  1RTU A;  1RHL A;  1RGL A;  1B27 A;  6GSP A;  1UCL A;  1BSE A;  3BU4 A;  1LOW A;  3WR2 A;  1LOY A;  1IYY A;  1BOX A;  1LNI A;  1RN1 A;  3AGN A;  1I3I A;  5BU4 A;  1LOV A;  1TRP A;  2F5W A;  1BGS A;  1YNV X;  1BUJ A;  1RNT A;  1BRG A;  2KF5 A;  1RCK A;  3D5I A;  3D4A A;  1PY3 A;  1BRK A;  1B2Z A;  5RNT A;  5HOH A;  1UCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...