1I0VA

Ribonuclease t1 in complex with 2'gmp (form i crystal)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 28
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i0vA00
3WHOA 1R4YA 3D4AA 1B2MA 1BRIA 5HOHA 1BRJA 1BSAA 3D5GA 1BIRA 1RCLA 1LOWA 3GSPA 1PY3A 1MGWA 1RGFA 1YVSA 1RDSA 3HOHA 1I8VA 3AHSA 3Q3FA 1RNTA 3DH2A 2AADA 3SYUA 3D5IA 1BANA 1RMSA 1RSNA 1GOVA 1LOYA 5GSPA 2KF5A 1FUSA 3KCHA 1YNVX 1BUJA 1GSPA 1RGHA 1BSBA 1BOXA 1RGGA 1PYLA 2KF3A 1YGWA 1GMPA 6RNTA 1FZUA 1UCIA 1I3FA 3AGNA 4BIRA 3A5EA 1HYFA 1X1XA 2ZA4A 1I2GA 1BSDA 1LOVA 1MGRA 1BRNL 1GOUA 1B3SA 2RNTA 1UCLA 1FW7A 3BU4A 4J5KA 1BNGA 1X1WA 6GSPA 1JBTA 3URPA 4HOHA 2F56A 1BRSA 1TRPA 1I2EA 1RN1A 1RTUA 1FYSA 2BU4A 1RCKA 2F5MA 2KAAA 1I2FA 1CH0A 2KF6A 3DGYA 5BU4A 1BNEA 1A2PA 1BAOA 1B2ZA 1G02A 1GMRA 3AGOA 1C54A 1I70A 2AAEA 2C4BA 1BNIA 2HOHA 1UCJA 1AY7A 1FUTA 1TRQA 1BNFA 5BIRA 1I0VA 7GSPA 1I3IA 1BRHA 5RNTA 1B21A 1LNIA 2RBIA 1GOYA 2BIRA 1RNBA 1B2XA 1TTOA 1RGAA 1BSEA 3BIRA 1BU4A 1RGLA 9RNTA 1T2IA 1BNJA 1AQZA 1DETA 1LRAA 1BRGA 4RNTA 8RNTA 1RLSA 1BRKA 1X1UA 1GMQA 1I0XA 1Q9EA 1RN4A 1RGEA 4GHOA 1DE3A 7RNTA 1RGKA 1UCKA 2GSPA 2SARA 1JBRA 1HZ1A 1T2HA 1B20A 1RHLA 2F4YA 1B2SA 1BGSA 1RGCA 1B2UA 2KF4A 1B27A 3WR2A 3RNTA 1BVIA 1ZGXA 2F5WA 4BU4A 1X1YA 4HAAA 1SARA 4J5GA 1JBSA 1BNSA 1BNRA 1BSCA 3AHWA 4GSPA 1IYYA
chains in the Genus database with same CATH superfamily
5BVBA 3T0UA 1GS3A 5D82A 1B2MA 2HMMB 3BNBA 3NQZA 1JNQA 1NNVA 2Z6BA 3DY5A 1V58A 4CDLA 5HOHA 1LOWA 1J2BA 1TFKA 2D1WA 1G96A 1AV4A 5AIIA 1LOXA 2GU1A 3T8UA 2CX1A 4R9LA 3H3HA 1JZDA 3HOHA 3SVAA 5DRVA 3V99A 2O9UX 3CCJ3 2FNQA 2CG0A 1RNTA 3SOYA 1MOLA 1O7MB 4O3VA 3CMA3 1IVWA 1K28A 1UW1A 2XR8B 3CCU3 4N6OB 1RMSA 3S5CA 3FKAA 2INXA 5GSPA 5FW5A 4IT7A 4RZMA 3ALAA 2CG1A 1Z1SA 1RGHA 1JJ22 1ROVA 2XEPA 5AIHA 1K9M4 2RFRA 2W6JH 4MEIA 3G6E3 1W6YA 3CPW2 2CIUA 1PYLA 3X42A 3J7Yd 1HU9A 1FZUA 1OH0A 3BNCA 3CCR3 3JUQA 1JB2A 1I2GA 1BSDA 1M9GA 2P09A 4HM8B 3CCQ3 2A15A 2Z76A 1NU3A 1BRNL 4FMAA 1YGEA 1DVCA 2PNCA 2IUKA 4AKZA 3GZYB 1QVF2 2YFLB 2GBXB 5TGNA 3BU4A 1SPUA 3NV0A 3EE1A 1BNGA 1YVBI 1JBTA 4JF8A 2GBWB 4HBRA 3NM7A 3N8BA 1Q42A 1GD3A 1SIIA 2LYXA 3V92A 1RN1A 2KAAA 1SJWA 3MG2A 1NB3I 1ASKA 1DMNA 1CH0A 2CWVA 1FGOA 1DMMA 1W02A 1BNEA 5IERA 1A2PA 3AGOA 3I0YA 4FR9A 4G1MB 1TP6A 1TJDA 1Q814 2KRTA 4XDWA 4HM3B 2C4BA 1YI23 1O7NB 1AY7A 3MHEA 3FF0A 1RKYA 2W56A 4XB5A 3K9MC 1I0VA 1VQK3 4I5QA 5IG4A 4WHAA 3CU3A 1B21A 2ML5A 3LXUX 4N3VA 3VGNA 4AEQA 1A2VA 1JB4A 1WMNA 3KFQC 4KZ1A 5LC7A 1GOYA 4N6NB 1ZS7A 2BIRA 3HZPA 1B2XA 1ULJB 4LEHA 4WYKA 3BIRA 3E99A 3NQYA 3D3LA 4L7KA 4XM4A 1FGRA 2OQEA 5IG0A 1BNJA 3EN1B 3IPTA 1LRAA 3WODG 1OHSA 4HM7B 5STDA 1BRKA 2OOVC 4IPBA 1OACA 4FMCA 1X1UA 4X2HA 1WTHA 2OWPA 1FA3A 4X2OA 3I553 1T3BA 2BMOB 3ZG5A 1ISKA 7STDA 1HZ1A 1T2HA 2OCTA 1AVKA 1RHLA 2F4YA 3CNMA 4HM5B 4EXRA 4R9KA 3PS8A 1BGSA 3PCSA 3WOFB 3QK9A 4HM6B 1ROAA 2CFKA 1GY5A 2F86B 1BVIA 5D81A 3F8XA 1VQL3 3FCSB 1MWTA 3D9RA 4FMDA 4BU4A 3JUOA 4BTWA 1X1YA 4HAAA 3CPOA 1SARA 1TFOA 1EA2A 1QAFA 1JBSA 1W01A 3Q2PA 4AKYA 1MNLA 2CH9A 1OPYA 3CME3 1BNRA 1UI7A 4IIAA 2OQEC 3HIGA 4R80A 2WGQA 2XRXB 1N8R4 3LH4A 3WHOA 1R4YA 1U8CB 3D4AA 4L8OA 5IF6A 4NREA 1VQN3 1BIRA 1RCLA 2P05A 3D79A 1T5YA 3GSPA 2SBLA 3B7CA 3LTCA 3ER7A 1IQXA 1D6ZA 1KWIA 1MWRA 1RGFA 2BNGA 2C11A 3EJVA 3PYJA 2Y73A 3EHCA 1GY6A 2W03A 3FGYA 4LMIA 2FGTA 1I8VA 4NHFA 1YIT3 1ZX2A 2GU3A 2IY2A 3S27A 4WFOA 3WMDA 3D5IA 1OCVA 1O7WB 1LOYA 1DMQA 3UJMA 5IENA 1A2KA 1LQMB 1O7PB 3KE7A 4GL6A 1FUSA 1UUWB 2QIYA 2QA43 1YNVX 1BUJA 3G8ZA 1NO3A 2XFSA 1IT7A 3AMOB 3G4S3 1IDPA 1ZO2A 4RNYA 1WMPA 3BLZA 1N9JA 4ZM8A 4HKVB 4ORLA 2KF3A 4WWUC 1YGWA 3CD63 1VQ43 3AGNA 1IV7A 4ILFA 3V98A 4BTXA 1VZZA 1HYFA 3OWUA 1A90A 4N6TA 1VQ73 3KIIA 5G1LA 3X3ZA 5M19A 1C7HA 3PCRA 2K0MA 3WA3A 1YIJ3 5AYRB 1GOUA 1YHQ3 4RBNA 2LQVA 2CX0A 1UCLA 3EN8A 2CFDA 3GWRA 1PFPA 3FG1A 1X1WA 3KZTA 3KN4A 4HOHA 5HGRA 3ROBA 1VQ53 1BRSA 1UI8A 2WOHA 3STDA 1I2EA 2P0MA 3LTBA 1N5HA 4L8PA 5EVHA 3T8NA 4EV2A 3KSPA 4WP5A 1LVNA 5DREA 1Y4KA 2H0IA 4LZIA 1GMRA 2CFWA 3LZAA 1VQQA 1UGIA 2ML6A 1BNIA 3NXJA 3QRDA 1UCJA 1TRQA 1BNFA 1Q40B 1WNHA 2FXTA 1GD4A 5BIRA 1W6GA 4PEJA 2W0QA 3LOYA 3EC9A 1NJI4 4EV5A 2BHMA 3OXAA 3X40A 4FCJA 2STDA 1WMOA 2BMQB 1G0TA 1BUQA 3OWSA 4GB5A 1BU4A 1US1A 3ZG0A 2OOVA 5IEOA 3DGMA 1AQZA 4EBGA 2JDIH 4FCMA 1BRGA 1W6CA 1D6YA 2MF7A 1AR0A 2KXGA 1E3VA 2ZDJA 3N54B 3OV4A 3EBTA 5CXOA 1RN4A 1RGEA 3N9HA 2Z7AA 5JPUA 1K8A4 3SEDA 2WOFA 1JN5B 3UL5A 1JBRA 1S5AA 4HJLB 3CXC2 5I97A 1RGCA 3LTAA 1B2UA 3U97A 4KFEA 3F7XA 3K63A 3TDGA 2HMNB 3MKIA 4K61A 3FH1A 3NBBA 5KP4A 4LYLB 3WR2A 3HX8A 1QJGA 1RRHA 3RDEA 3G16A 1OGZA 4Q53A 3RNTA 2K54A 3GAXA 5ELJA 2UGIA 2XSOB 5A0OB 3MSOA 4N6V0 1IVXA 2CW9A 2C10A 4J5GA 4MJDA 4H3UA 3DZLA 3K0ZA 1KQS2 1BSCA 1O7HB 2IUJA 5D83A 1AVLA 5G2GA 1SQWA 3B8LA 3UB1A 4BL3A 2IYJA 1BRIA 1OGXA 1UGHI 2O3OA 3KSED 3MPHA 3MYTA 4H61A 1YJN3 2W9QA 2XGLA 1RN7A 1PY3A 3CC23 1MGWA 1DVDA 1RDSA 1TUHA 3EQQB 4FMBA 2MC8A 1IT8A 2ZHXB 3AHSA 3OX9A 3Q3FA 3RGRA 4O2HA 1CYVA 3H51A 1N8QA 1IVVA 1JZOA 1MWUA 1QMAA 3BNDA 3DH2A 3DMCA 2QEX3 2Y74A 3SYUA 1CQSA 1BANA 1N5PA 1RSNA 1WQLB 1GOVA 3OW22 2UUGC 3A76A 5FGOA 2OTL3 2E2VA 2BO9B 4HM4B 3KCHA 4NPBA 5CK6A 5BXQA 1GSPA 4HYZA 1N9EA 3NX0A 1W2B2 5M18A 1BSBA 1TU5A 1D6UA 2V1LA 4J8TA 4DKIA 4K90B 3EX9A 1RGGA 5IG5A 1GMPA 3NBRA 6RNTA 1UCIA 3SX1A 3GZBA 3A5EA 3F9SA 1X1XA 2JQ5A 2E2TA 1W4NA 2RSXA 1W2ZA 2L1SA 2J8XB 3LMLA 4HM0B 1LOVA 4EYCA 2ZL8A 1JKGA 3BNEA 3G0KA 1B3SA 2XFTA 2RNTA 3DUKA 3AMOA 4R1KA 4KVHA 3HIIA 1Q824 3KKGA 4J5KA 1VQ83 1QALA 4O8SA 4CCVA 1SIHA 6GSPA 1VQ93 2RCDA 2R41A 3EBYA 3JUPA 4RNZA 1NWWA 5KP3A 1L5GB 3X3YA 3I563 3Q90A 5AIGA 1OF5A 1JKGB 4N6MA 5AI1A 1Q864 4OVMA 3DGYA 3PXMA 5EQLA 3GZXB 3K5TA 3CNXA 1BAOA 3NBJA 3ECFA 1C54A 2IMJA 1I70A 2YFIB 3F14A 4I4KA 3X3XA 1YJW3 4KFFA 2YFJB 1EG9B 4XDVA 7GSPA 4QWTA 1OF5B 1BRHA 5RNTA 4K1UA 4XBYA 3CC43 3MG3A 2RBIA 2GXFA 1IQ8A 1Q7HA 1ULIB 1TTOA 1EQKA 3SOAA 1RGAA 3CCV3 2GEYA 2HMJB 2UX0A 1DETA 1Q40A 3B4OA 3GRDA 1RLSA 3SXXA 1W5ZA 6STDA 1GMQA 1I0XA 2K3DA 1CYUA 3NUVA 1EUIC 7RNTA 1RGKA 1UCKA 2GSPA 2WGOA 4OK0A 1VQP3 2W2CA 1W00A 1NDOB 3LYGA 1JV2B 1GY7A 1JRQA 3JUMA 2H0GA 1STFI 3DGLA 1B27A 3FZWA 3VF1A 1YJ93 2HMOB 2KCDA 5LC6A 1ZGXA 4MMXB 2W9PA 3OWYA 1JN5A 1STDA 4KT3B 1M904 2PZVA 3S67A 3MG1A 2CC3A 1M1K4 4GSPA 1O7GB 2WO0A 2CFLA 3UNLA 3GZRA 2Q07A 1BRJA 1BSAA 2F98A 3D5GA 4O02B 5AYSC 3CC73 1IU7A 2GEXA 1V57A 1FGMA 1YVSA 1FUWA 1R4CA 3JVCA 1E97A 2CWTA 3CCL3 1GYBA 1VQM3 3BB9A 4K1VA 2F99A 5JBSA 3U1WA 2AADA 1Q7Y4 3LTDA 5KP1A 3NHXA 2KF5A 1NB5I 1W7CA 2B24B 2CK3H 2P38A 3DM8A 3DXOA 3Q1CA 4MMZB 4OUQA 1PU4A 2R4IA 3JUNA 3K7CA 4JRFA 5ELUA 3F7SA 2XF3A 3F8HA 5AEWB 4J9AA 3NV0B 2M7OA 1BOXA 1KD14 3IJEB 3MWZA 1A67A 3FG4A 1I3FA 4U13A 4BIRA 1M1XB 1OHOA 2OTJ3 2ZA4A 4HM2B 4LSOA 1EEJA 3NM2A 2Z77A 4R4KA 4CPKA 5IEPA 1KC84 4HZ9B 3DGNA 3LT9A 1UUGB 1OUNA 2CHCA 3FF2A 4KFDA 5CLKA 1MGRA 1FGTA 2BMRB 4STDA 2CKFB 4TX4A 4HZBB 2YX9A 1UUVB 4CJNA 1FW7A 5CF2A 2W56B 2XGNA 3URPA 4EC6A 2F56A 1QAKA 1OHPA 2CFGA 1TRPA 3EF8A 1KSIA 4EW5A 1K41A 1RTUA 2F5MA 1FYSA 2BU4A 1RCKA 3B4PA 2BT3A 1I2FA 2KF6A 3CCS3 1K734 4WYKB 2XSHB 3WA2X 5BU4A 2RGQA 2B1XB 3ZFZA 1G02A 1B2ZA 3HK4A 2AAEA 3M8CA 5G1KA 3VSYA 2HOHA 1FUTA 1FGQA 1MWSA 1IVUA 1I3IA 3PGBA 1LXEA 1LNIA 3G713 1UDII 3CCM3 4N6LA 3CCE3 1TIJA 3O8YA 4BTYA 1RNBA 3SLUA 3DGOA 5IG3A 1BSEA 3S28A 1RGLA 5M1AA 2HMKB 9RNTA 1JB5A 1T2IA 2QGUA 2W04A 2L4VA 4LGQA 5AIFA 4HVNA 4RNTA 1EKMA 4MMYB 3UL6A 8RNTA 3RGAA 1IQYA 3PZWA 1IV9A 1V74A 4BL2A 1S723 2P0XA 8CHOA 1IK3A 1Q9EA 1RJOA 2XH9A 3IMAB 4GHOA 1DE3A 1RRLA 2SARA 3WDGB 1HKXA 1B20A 3HI7A 3L0RA 3FG3A 2I9WA 1B2SA 1U5OA 1QVG2 2IA7A 5JPPA 1VQO3 2KF4A 2E2UA 2CWUA 3F40A 3FSDA 1F8NA 5AEUB 1LNHA 4HM1B 5CF1A 2D42A 1DYUA 2H0HA 1E3RA 2F5WA 4XBXA 3S29A 3EB8A 4N6UA 4XBTA 4FCZA 3WOEB 5IW9A 3FLJA 1BNSA 1LQGC 3LT8A 1VQ63 1CEWI 2HMLB 3AHWA 5EEOA 3X41A 1IYYA
chains in the Genus database with same CATH topology
3WHOA 1R4YA 3D4AA 1B2MA 1BRIA 5HOHA 1BRJA 1BSAA 3D5GA 1BIRA 1RCLA 1LOWA 3GSPA 1PY3A 1MGWA 1RGFA 1YVSA 1RDSA 3HOHA 1I8VA 3AHSA 3Q3FA 1RNTA 3DH2A 2AADA 3SYUA 3D5IA 1BANA 1RMSA 1RSNA 1GOVA 1LOYA 5GSPA 2KF5A 1FUSA 3KCHA 1YNVX 1BUJA 1GSPA 1RGHA 1BSBA 1BOXA 1RGGA 1PYLA 2KF3A 1YGWA 1GMPA 6RNTA 1FZUA 1UCIA 1I3FA 3AGNA 4BIRA 3A5EA 1HYFA 1X1XA 2ZA4A 1I2GA 1BSDA 1LOVA 1MGRA 1BRNL 1GOUA 1B3SA 2RNTA 1UCLA 1FW7A 3BU4A 4J5KA 1BNGA 1X1WA 6GSPA 1JBTA 3URPA 4HOHA 2F56A 1BRSA 1TRPA 1I2EA 1RN1A 1RTUA 1FYSA 2BU4A 1RCKA 2F5MA 2KAAA 1I2FA 1CH0A 2KF6A 3DGYA 5BU4A 1BNEA 1A2PA 1BAOA 1B2ZA 1G02A 1GMRA 3AGOA 1C54A 1I70A 2AAEA 2C4BA 1BNIA 2HOHA 1UCJA 1AY7A 1FUTA 1TRQA 1BNFA 5BIRA 1I0VA 7GSPA 1I3IA 1BRHA 5RNTA 1B21A 1LNIA 2RBIA 1GOYA 2BIRA 1RNBA 1B2XA 1TTOA 1RGAA 1BSEA 3BIRA 1BU4A 1RGLA 9RNTA 1T2IA 1BNJA 1AQZA 1DETA 1LRAA 1BRGA 4RNTA 8RNTA 1RLSA 1BRKA 1X1UA 1GMQA 1I0XA 1Q9EA 1RN4A 1RGEA 4GHOA 1DE3A 7RNTA 1RGKA 1UCKA 2GSPA 2SARA 1JBRA 1HZ1A 1T2HA 1B20A 1RHLA 2F4YA 1B2SA 1BGSA 1RGCA 1B2UA 2KF4A 1B27A 3WR2A 3RNTA 1BVIA 1ZGXA 2F5WA 4BU4A 1X1YA 4HAAA 1SARA 4J5GA 1JBSA 1BNSA 1BNRA 1BSCA 3AHWA 4GSPA 1IYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHO A;  1R4Y A;  3D4A A;  1B2M A;  1BRI A;  5HOH A;  1BRJ A;  1BSA A;  3D5G A;  1BIR A;  1RCL A;  1LOW A;  3GSP A;  1PY3 A;  1MGW A;  1RGF A;  1YVS A;  1RDS A;  3HOH A;  1I8V A;  3AHS A;  3Q3F A;  1RNT A;  3DH2 A;  2AAD A;  3SYU A;  3D5I A;  1BAN A;  1RMS A;  1RSN A;  1GOV A;  1LOY A;  5GSP A;  2KF5 A;  1FUS A;  3KCH A;  1YNV X;  1BUJ A;  1GSP A;  1RGH A;  1BSB A;  1BOX A;  1RGG A;  1PYL A;  2KF3 A;  1YGW A;  1GMP A;  6RNT A;  1FZU A;  1UCI A;  1I3F A;  3AGN A;  4BIR A;  3A5E A;  1HYF A;  1X1X A;  2ZA4 A;  1I2G A;  1BSD A;  1LOV A;  1MGR A;  1BRN L;  1GOU A;  1B3S A;  2RNT A;  1UCL A;  1FW7 A;  3BU4 A;  4J5K A;  1BNG A;  1X1W A;  6GSP A;  1JBT A;  3URP A;  4HOH A;  2F56 A;  1BRS A;  1TRP A;  1I2E A;  1RN1 A;  1RTU A;  1FYS A;  2BU4 A;  1RCK A;  2F5M A;  2KAA A;  1I2F A;  1CH0 A;  2KF6 A;  3DGY A;  5BU4 A;  1BNE A;  1A2P A;  1BAO A;  1B2Z A;  1G02 A;  1GMR A;  3AGO A;  1C54 A;  1I70 A;  2AAE A;  2C4B A;  1BNI A;  2HOH A;  1UCJ A;  1AY7 A;  1FUT A;  1TRQ A;  1BNF A;  5BIR A;  1I0V A;  7GSP A;  1I3I A;  1BRH A;  5RNT A;  1B21 A;  1LNI A;  2RBI A;  1GOY A;  2BIR A;  1RNB A;  1B2X A;  1TTO A;  1RGA A;  1BSE A;  3BIR A;  1BU4 A;  1RGL A;  9RNT A;  1T2I A;  1BNJ A;  1AQZ A;  1DET A;  1LRA A;  1BRG A;  4RNT A;  8RNT A;  1RLS A;  1BRK A;  1X1U A;  1GMQ A;  1I0X A;  1Q9E A;  1RN4 A;  1RGE A;  4GHO A;  1DE3 A;  7RNT A;  1RGK A;  1UCK A;  2GSP A;  2SAR A;  1JBR A;  1HZ1 A;  1T2H A;  1B20 A;  1RHL A;  2F4Y A;  1B2S A;  1BGS A;  1RGC A;  1B2U A;  2KF4 A;  1B27 A;  3WR2 A;  3RNT A;  1BVI A;  1ZGX A;  2F5W A;  4BU4 A;  1X1Y A;  4HAA A;  1SAR A;  4J5G A;  1JBS A;  1BNS A;  1BNR A;  1BSC A;  3AHW A;  4GSP A;  1IYY A; 
#chains in the Genus database with same CATH topology
 5BVB A;  3T0U A;  1GS3 A;  5D82 A;  1B2M A;  2HMM B;  3BNB A;  3NQZ A;  1JNQ A;  1NNV A;  2Z6B A;  3DY5 A;  1V58 A;  4CDL A;  5HOH A;  1LOW A;  1J2B A;  1TFK A;  2D1W A;  1G96 A;  1AV4 A;  5AII A;  1LOX A;  2GU1 A;  3T8U A;  2CX1 A;  4R9L A;  3H3H A;  1JZD A;  3HOH A;  3SVA A;  5DRV A;  3V99 A;  2O9U X;  3CCJ 3;  2FNQ A;  2CG0 A;  1RNT A;  3SOY A;  1MOL A;  1O7M B;  4O3V A;  3CMA 3;  1IVW A;  1K28 A;  1UW1 A;  2XR8 B;  3CCU 3;  4N6O B;  1RMS A;  3S5C A;  3FKA A;  2INX A;  5GSP A;  5FW5 A;  4IT7 A;  4RZM A;  3ALA A;  2CG1 A;  1Z1S A;  1RGH A;  1JJ2 2;  1ROV A;  2XEP A;  5AIH A;  1K9M 4;  2RFR A;  2W6J H;  4MEI A;  3G6E 3;  1W6Y A;  3CPW 2;  2CIU A;  1PYL A;  3X42 A;  3J7Y d;  1HU9 A;  1FZU A;  1OH0 A;  3BNC A;  3CCR 3;  3JUQ A;  1JB2 A;  1I2G A;  1BSD A;  1M9G A;  2P09 A;  4HM8 B;  3CCQ 3;  2A15 A;  2Z76 A;  1NU3 A;  1BRN L;  4FMA A;  1YGE A;  1DVC A;  2PNC A;  2IUK A;  4AKZ A;  3GZY B;  1QVF 2;  2YFL B;  2GBX B;  5TGN A;  3BU4 A;  1SPU A;  3NV0 A;  3EE1 A;  1BNG A;  1YVB I;  1JBT A;  4JF8 A;  2GBW B;  4HBR A;  3NM7 A;  3N8B A;  1Q42 A;  1GD3 A;  1SII A;  2LYX A;  3V92 A;  1RN1 A;  2KAA A;  1SJW A;  3MG2 A;  1NB3 I;  1ASK A;  1DMN A;  1CH0 A;  2CWV A;  1FGO A;  1DMM A;  1W02 A;  1BNE A;  5IER A;  1A2P A;  3AGO A;  3I0Y A;  4FR9 A;  4G1M B;  1TP6 A;  1TJD A;  1Q81 4;  2KRT A;  4XDW A;  4HM3 B;  2C4B A;  1YI2 3;  1O7N B;  1AY7 A;  3MHE A;  3FF0 A;  1RKY A;  2W56 A;  4XB5 A;  3K9M C;  1I0V A;  1VQK 3;  4I5Q A;  5IG4 A;  4WHA A;  3CU3 A;  1B21 A;  2ML5 A;  3LXU X;  4N3V A;  3VGN A;  4AEQ A;  1A2V A;  1JB4 A;  1WMN A;  3KFQ C;  4KZ1 A;  5LC7 A;  1GOY A;  4N6N B;  1ZS7 A;  2BIR A;  3HZP A;  1B2X A;  1ULJ B;  4LEH A;  4WYK A;  3BIR A;  3E99 A;  3NQY A;  3D3L A;  4L7K A;  4XM4 A;  1FGR A;  2OQE A;  5IG0 A;  1BNJ A;  3EN1 B;  3IPT A;  1LRA A;  3WOD G;  1OHS A;  4HM7 B;  5STD A;  1BRK A;  2OOV C;  4IPB A;  1OAC A;  4FMC A;  1X1U A;  4X2H A;  1WTH A;  2OWP A;  1FA3 A;  4X2O A;  3I55 3;  1T3B A;  2BMO B;  3ZG5 A;  1ISK A;  7STD A;  1HZ1 A;  1T2H A;  2OCT A;  1AVK A;  1RHL A;  2F4Y A;  3CNM A;  4HM5 B;  4EXR A;  4R9K A;  3PS8 A;  1BGS A;  3PCS A;  3WOF B;  3QK9 A;  4HM6 B;  1ROA A;  2CFK A;  1GY5 A;  2F86 B;  1BVI A;  5D81 A;  3F8X A;  1VQL 3;  3FCS B;  1MWT A;  3D9R A;  4FMD A;  4BU4 A;  3JUO A;  4BTW A;  1X1Y A;  4HAA A;  3CPO A;  1SAR A;  1TFO A;  1EA2 A;  1QAF A;  1JBS A;  1W01 A;  3Q2P A;  4AKY A;  1MNL A;  2CH9 A;  1OPY A;  3CME 3;  1BNR A;  1UI7 A;  4IIA A;  2OQE C;  3HIG A;  4R80 A;  2WGQ A;  2XRX B;  1N8R 4;  3LH4 A;  3WHO A;  1R4Y A;  1U8C B;  3D4A A;  4L8O A;  5IF6 A;  4NRE A;  1VQN 3;  1BIR A;  1RCL A;  2P05 A;  3D79 A;  1T5Y A;  3GSP A;  2SBL A;  3B7C A;  3LTC A;  3ER7 A;  1IQX A;  1D6Z A;  1KWI A;  1MWR A;  1RGF A;  2BNG A;  2C11 A;  3EJV A;  3PYJ A;  2Y73 A;  3EHC A;  1GY6 A;  2W03 A;  3FGY A;  4LMI A;  2FGT A;  1I8V A;  4NHF A;  1YIT 3;  1ZX2 A;  2GU3 A;  2IY2 A;  3S27 A;  4WFO A;  3WMD A;  3D5I A;  1OCV A;  1O7W B;  1LOY A;  1DMQ A;  3UJM A;  5IEN A;  1A2K A;  1LQM B;  1O7P B;  3KE7 A;  4GL6 A;  1FUS A;  1UUW B;  2QIY A;  2QA4 3;  1YNV X;  1BUJ A;  3G8Z A;  1NO3 A;  2XFS A;  1IT7 A;  3AMO B;  3G4S 3;  1IDP A;  1ZO2 A;  4RNY A;  1WMP A;  3BLZ A;  1N9J A;  4ZM8 A;  4HKV B;  4ORL A;  2KF3 A;  4WWU C;  1YGW A;  3CD6 3;  1VQ4 3;  3AGN A;  1IV7 A;  4ILF A;  3V98 A;  4BTX A;  1VZZ A;  1HYF A;  3OWU A;  1A90 A;  4N6T A;  1VQ7 3;  3KII A;  5G1L A;  3X3Z A;  5M19 A;  1C7H A;  3PCR A;  2K0M A;  3WA3 A;  1YIJ 3;  5AYR B;  1GOU A;  1YHQ 3;  4RBN A;  2LQV A;  2CX0 A;  1UCL A;  3EN8 A;  2CFD A;  3GWR A;  1PFP A;  3FG1 A;  1X1W A;  3KZT A;  3KN4 A;  4HOH A;  5HGR A;  3ROB A;  1VQ5 3;  1BRS A;  1UI8 A;  2WOH A;  3STD A;  1I2E A;  2P0M A;  3LTB A;  1N5H A;  4L8P A;  5EVH A;  3T8N A;  4EV2 A;  3KSP A;  4WP5 A;  1LVN A;  5DRE A;  1Y4K A;  2H0I A;  4LZI A;  1GMR A;  2CFW A;  3LZA A;  1VQQ A;  1UGI A;  2ML6 A;  1BNI A;  3NXJ A;  3QRD A;  1UCJ A;  1TRQ A;  1BNF A;  1Q40 B;  1WNH A;  2FXT A;  1GD4 A;  5BIR A;  1W6G A;  4PEJ A;  2W0Q A;  3LOY A;  3EC9 A;  1NJI 4;  4EV5 A;  2BHM A;  3OXA A;  3X40 A;  4FCJ A;  2STD A;  1WMO A;  2BMQ B;  1G0T A;  1BUQ A;  3OWS A;  4GB5 A;  1BU4 A;  1US1 A;  3ZG0 A;  2OOV A;  5IEO A;  3DGM A;  1AQZ A;  4EBG A;  2JDI H;  4FCM A;  1BRG A;  1W6C A;  1D6Y A;  2MF7 A;  1AR0 A;  2KXG A;  1E3V A;  2ZDJ A;  3N54 B;  3OV4 A;  3EBT A;  5CXO A;  1RN4 A;  1RGE A;  3N9H A;  2Z7A A;  5JPU A;  1K8A 4;  3SED A;  2WOF A;  1JN5 B;  3UL5 A;  1JBR A;  1S5A A;  4HJL B;  3CXC 2;  5I97 A;  1RGC A;  3LTA A;  1B2U A;  3U97 A;  4KFE A;  3F7X A;  3K63 A;  3TDG A;  2HMN B;  3MKI A;  4K61 A;  3FH1 A;  3NBB A;  5KP4 A;  4LYL B;  3WR2 A;  3HX8 A;  1QJG A;  1RRH A;  3RDE A;  3G16 A;  1OGZ A;  4Q53 A;  3RNT A;  2K54 A;  3GAX A;  5ELJ A;  2UGI A;  2XSO B;  5A0O B;  3MSO A;  4N6V 0;  1IVX A;  2CW9 A;  2C10 A;  4J5G A;  4MJD A;  4H3U A;  3DZL A;  3K0Z A;  1KQS 2;  1BSC A;  1O7H B;  2IUJ A;  5D83 A;  1AVL A;  5G2G A;  1SQW A;  3B8L A;  3UB1 A;  4BL3 A;  2IYJ A;  1BRI A;  1OGX A;  1UGH I;  2O3O A;  3KSE D;  3MPH A;  3MYT A;  4H61 A;  1YJN 3;  2W9Q A;  2XGL A;  1RN7 A;  1PY3 A;  3CC2 3;  1MGW A;  1DVD A;  1RDS A;  1TUH A;  3EQQ B;  4FMB A;  2MC8 A;  1IT8 A;  2ZHX B;  3AHS A;  3OX9 A;  3Q3F A;  3RGR A;  4O2H A;  1CYV A;  3H51 A;  1N8Q A;  1IVV A;  1JZO A;  1MWU A;  1QMA A;  3BND A;  3DH2 A;  3DMC A;  2QEX 3;  2Y74 A;  3SYU A;  1CQS A;  1BAN A;  1N5P A;  1RSN A;  1WQL B;  1GOV A;  3OW2 2;  2UUG C;  3A76 A;  5FGO A;  2OTL 3;  2E2V A;  2BO9 B;  4HM4 B;  3KCH A;  4NPB A;  5CK6 A;  5BXQ A;  1GSP A;  4HYZ A;  1N9E A;  3NX0 A;  1W2B 2;  5M18 A;  1BSB A;  1TU5 A;  1D6U A;  2V1L A;  4J8T A;  4DKI A;  4K90 B;  3EX9 A;  1RGG A;  5IG5 A;  1GMP A;  3NBR A;  6RNT A;  1UCI A;  3SX1 A;  3GZB A;  3A5E A;  3F9S A;  1X1X A;  2JQ5 A;  2E2T A;  1W4N A;  2RSX A;  1W2Z A;  2L1S A;  2J8X B;  3LML A;  4HM0 B;  1LOV A;  4EYC A;  2ZL8 A;  1JKG A;  3BNE A;  3G0K A;  1B3S A;  2XFT A;  2RNT A;  3DUK A;  3AMO A;  4R1K A;  4KVH A;  3HII A;  1Q82 4;  3KKG A;  4J5K A;  1VQ8 3;  1QAL A;  4O8S A;  4CCV A;  1SIH A;  6GSP A;  1VQ9 3;  2RCD A;  2R41 A;  3EBY A;  3JUP A;  4RNZ A;  1NWW A;  5KP3 A;  1L5G B;  3X3Y A;  3I56 3;  3Q90 A;  5AIG A;  1OF5 A;  1JKG B;  4N6M A;  5AI1 A;  1Q86 4;  4OVM A;  3DGY A;  3PXM A;  5EQL A;  3GZX B;  3K5T A;  3CNX A;  1BAO A;  3NBJ A;  3ECF A;  1C54 A;  2IMJ A;  1I70 A;  2YFI B;  3F14 A;  4I4K A;  3X3X A;  1YJW 3;  4KFF A;  2YFJ B;  1EG9 B;  4XDV A;  7GSP A;  4QWT A;  1OF5 B;  1BRH A;  5RNT A;  4K1U A;  4XBY A;  3CC4 3;  3MG3 A;  2RBI A;  2GXF A;  1IQ8 A;  1Q7H A;  1ULI B;  1TTO A;  1EQK A;  3SOA A;  1RGA A;  3CCV 3;  2GEY A;  2HMJ B;  2UX0 A;  1DET A;  1Q40 A;  3B4O A;  3GRD A;  1RLS A;  3SXX A;  1W5Z A;  6STD A;  1GMQ A;  1I0X A;  2K3D A;  1CYU A;  3NUV A;  1EUI C;  7RNT A;  1RGK A;  1UCK A;  2GSP A;  2WGO A;  4OK0 A;  1VQP 3;  2W2C A;  1W00 A;  1NDO B;  3LYG A;  1JV2 B;  1GY7 A;  1JRQ A;  3JUM A;  2H0G A;  1STF I;  3DGL A;  1B27 A;  3FZW A;  3VF1 A;  1YJ9 3;  2HMO B;  2KCD A;  5LC6 A;  1ZGX A;  4MMX B;  2W9P A;  3OWY A;  1JN5 A;  1STD A;  4KT3 B;  1M90 4;  2PZV A;  3S67 A;  3MG1 A;  2CC3 A;  1M1K 4;  4GSP A;  1O7G B;  2WO0 A;  2CFL A;  3UNL A;  3GZR A;  2Q07 A;  1BRJ A;  1BSA A;  2F98 A;  3D5G A;  4O02 B;  5AYS C;  3CC7 3;  1IU7 A;  2GEX A;  1V57 A;  1FGM A;  1YVS A;  1FUW A;  1R4C A;  3JVC A;  1E97 A;  2CWT A;  3CCL 3;  1GYB A;  1VQM 3;  3BB9 A;  4K1V A;  2F99 A;  5JBS A;  3U1W A;  2AAD A;  1Q7Y 4;  3LTD A;  5KP1 A;  3NHX A;  2KF5 A;  1NB5 I;  1W7C A;  2B24 B;  2CK3 H;  2P38 A;  3DM8 A;  3DXO A;  3Q1C A;  4MMZ B;  4OUQ A;  1PU4 A;  2R4I A;  3JUN A;  3K7C A;  4JRF A;  5ELU A;  3F7S A;  2XF3 A;  3F8H A;  5AEW B;  4J9A A;  3NV0 B;  2M7O A;  1BOX A;  1KD1 4;  3IJE B;  3MWZ A;  1A67 A;  3FG4 A;  1I3F A;  4U13 A;  4BIR A;  1M1X B;  1OHO A;  2OTJ 3;  2ZA4 A;  4HM2 B;  4LSO A;  1EEJ A;  3NM2 A;  2Z77 A;  4R4K A;  4CPK A;  5IEP A;  1KC8 4;  4HZ9 B;  3DGN A;  3LT9 A;  1UUG B;  1OUN A;  2CHC A;  3FF2 A;  4KFD A;  5CLK A;  1MGR A;  1FGT A;  2BMR B;  4STD A;  2CKF B;  4TX4 A;  4HZB B;  2YX9 A;  1UUV B;  4CJN A;  1FW7 A;  5CF2 A;  2W56 B;  2XGN A;  3URP A;  4EC6 A;  2F56 A;  1QAK A;  1OHP A;  2CFG A;  1TRP A;  3EF8 A;  1KSI A;  4EW5 A;  1K41 A;  1RTU A;  2F5M A;  1FYS A;  2BU4 A;  1RCK A;  3B4P A;  2BT3 A;  1I2F A;  2KF6 A;  3CCS 3;  1K73 4;  4WYK B;  2XSH B;  3WA2 X;  5BU4 A;  2RGQ A;  2B1X B;  3ZFZ A;  1G02 A;  1B2Z A;  3HK4 A;  2AAE A;  3M8C A;  5G1K A;  3VSY A;  2HOH A;  1FUT A;  1FGQ A;  1MWS A;  1IVU A;  1I3I A;  3PGB A;  1LXE A;  1LNI A;  3G71 3;  1UDI I;  3CCM 3;  4N6L A;  3CCE 3;  1TIJ A;  3O8Y A;  4BTY A;  1RNB A;  3SLU A;  3DGO A;  5IG3 A;  1BSE A;  3S28 A;  1RGL A;  5M1A A;  2HMK B;  9RNT A;  1JB5 A;  1T2I A;  2QGU A;  2W04 A;  2L4V A;  4LGQ A;  5AIF A;  4HVN A;  4RNT A;  1EKM A;  4MMY B;  3UL6 A;  8RNT A;  3RGA A;  1IQY A;  3PZW A;  1IV9 A;  1V74 A;  4BL2 A;  1S72 3;  2P0X A;  8CHO A;  1IK3 A;  1Q9E A;  1RJO A;  2XH9 A;  3IMA B;  4GHO A;  1DE3 A;  1RRL A;  2SAR A;  3WDG B;  1HKX A;  1B20 A;  3HI7 A;  3L0R A;  3FG3 A;  2I9W A;  1B2S A;  1U5O A;  1QVG 2;  2IA7 A;  5JPP A;  1VQO 3;  2KF4 A;  2E2U A;  2CWU A;  3F40 A;  3FSD A;  1F8N A;  5AEU B;  1LNH A;  4HM1 B;  5CF1 A;  2D42 A;  1DYU A;  2H0H A;  1E3R A;  2F5W A;  4XBX A;  3S29 A;  3EB8 A;  4N6U A;  4XBT A;  4FCZ A;  3WOE B;  5IW9 A;  3FLJ A;  1BNS A;  1LQG C;  3LT8 A;  1VQ6 3;  1CEW I;  2HML B;  3AHW A;  5EEO A;  3X41 A;  1IYY A; 
#chains in the Genus database with same CATH homology
 3WHO A;  1R4Y A;  3D4A A;  1B2M A;  1BRI A;  5HOH A;  1BRJ A;  1BSA A;  3D5G A;  1BIR A;  1RCL A;  1LOW A;  3GSP A;  1PY3 A;  1MGW A;  1RGF A;  1YVS A;  1RDS A;  3HOH A;  1I8V A;  3AHS A;  3Q3F A;  1RNT A;  3DH2 A;  2AAD A;  3SYU A;  3D5I A;  1BAN A;  1RMS A;  1RSN A;  1GOV A;  1LOY A;  5GSP A;  2KF5 A;  1FUS A;  3KCH A;  1YNV X;  1BUJ A;  1GSP A;  1RGH A;  1BSB A;  1BOX A;  1RGG A;  1PYL A;  2KF3 A;  1YGW A;  1GMP A;  6RNT A;  1FZU A;  1UCI A;  1I3F A;  3AGN A;  4BIR A;  3A5E A;  1HYF A;  1X1X A;  2ZA4 A;  1I2G A;  1BSD A;  1LOV A;  1MGR A;  1BRN L;  1GOU A;  1B3S A;  2RNT A;  1UCL A;  1FW7 A;  3BU4 A;  4J5K A;  1BNG A;  1X1W A;  6GSP A;  1JBT A;  3URP A;  4HOH A;  2F56 A;  1BRS A;  1TRP A;  1I2E A;  1RN1 A;  1RTU A;  1FYS A;  2BU4 A;  1RCK A;  2F5M A;  2KAA A;  1I2F A;  1CH0 A;  2KF6 A;  3DGY A;  5BU4 A;  1BNE A;  1A2P A;  1BAO A;  1B2Z A;  1G02 A;  1GMR A;  3AGO A;  1C54 A;  1I70 A;  2AAE A;  2C4B A;  1BNI A;  2HOH A;  1UCJ A;  1AY7 A;  1FUT A;  1TRQ A;  1BNF A;  5BIR A;  1I0V A;  7GSP A;  1I3I A;  1BRH A;  5RNT A;  1B21 A;  1LNI A;  2RBI A;  1GOY A;  2BIR A;  1RNB A;  1B2X A;  1TTO A;  1RGA A;  1BSE A;  3BIR A;  1BU4 A;  1RGL A;  9RNT A;  1T2I A;  1BNJ A;  1AQZ A;  1DET A;  1LRA A;  1BRG A;  4RNT A;  8RNT A;  1RLS A;  1BRK A;  1X1U A;  1GMQ A;  1I0X A;  1Q9E A;  1RN4 A;  1RGE A;  4GHO A;  1DE3 A;  7RNT A;  1RGK A;  1UCK A;  2GSP A;  2SAR A;  1JBR A;  1HZ1 A;  1T2H A;  1B20 A;  1RHL A;  2F4Y A;  1B2S A;  1BGS A;  1RGC A;  1B2U A;  2KF4 A;  1B27 A;  3WR2 A;  3RNT A;  1BVI A;  1ZGX A;  2F5W A;  4BU4 A;  1X1Y A;  4HAA A;  1SAR A;  4J5G A;  1JBS A;  1BNS A;  1BNR A;  1BSC A;  3AHW A;  4GSP A;  1IYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...