3NX0A

Hinge-loop mutation can be used to control 3d domain swapping and amyloidogenesis of human cystatin c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
GPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQINAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-C
publication title Hinge-loop mutation can be used to control 3D domain swapping and amyloidogenesis of human cystatin C.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nx0A00
2O9UX 3NX0A 4TX4A 1GD4A 2BO9B 5ELJA 1DVDA 4EYCA 1R4CA 1CYUA 1DVCA 2KXGA 1RN7A 3Q2PA 1N5PA 3PS8A 1MNLA 1WNHA 3K9MC 3SVAA 4CCVA 3PYJA 3PXMA 3UL6A 1NB3I 1A90A 5EQLA 3GAXA 5LC7A 3KSED 1PFPA 1STFI 1N9JA 1YVBI 4N6MA 1N5HA 4LZIA 1FUWA 3KFQC 5ELUA 2W9QA 1MOLA 4ZM8A 3MWZA 4N6UA 1M9GA 2W9PA 1IV9A 1TIJA 3IMAB 4IT7A 2OCTA 4N6LA 5A0OB 1A67A 1LXEA 5LC6A 1GD3A 1ROAA 4N6OB 1CEWI 3QRDA 1FA3A 1IV7A 4N6TA 1EQKA 1NB5I 1G96A 4N6V0 2CH9A 3S67A 3UL5A 1CYVA 3L0RA 3LH4A 1KWIA 4N6NB
chains in the Genus database with same CATH superfamily
3JUNA 3FF0A 4TX4A 1I3IA 5G1LA 5GSPA 1BNRA 3NV0B 1I8VA 4EXRA 2RNTA 1BRHA 1GY6A 2CWVA 3MPHA 3CD63 3AMOA 4HKVB 3PZWA 3I553 3CC43 1GMPA 4WFOA 1VQK3 1OF5B 1OHPA 3EHCA 4IIAA 1MWSA 2PZVA 4HM1B 3G6E3 4O3VA 1U5OA 1GOYA 1GMRA 3CCU3 1QVG2 3Q2PA 5DRVA 3LTAA 7RNTA 4HM8B 1M904 1V74A 1B3SA 2H0IA 4HM7B 3CXC2 2WGOA 2WO0A 3ZG0A 1VQL3 3DGOA 1X1UA 2KAAA 1LOWA 1BNSA 4CCVA 3X3YA 1KQS2 3EB8A 4RZMA 1W6YA 2W2CA 3NM2A 3OV4A 4GL6A 1UCJA 5AEWB 1DMNA 1JBTA 4LMIA 1EEJA 2B24B 2CK3H 4HZ9B 1W02A 4XM4A 3UL6A 2CX1A 2E2VA 3WOFB 3D5IA 1LOXA 4U13A 1D6YA 3WR2A 4KZ1A 2CFGA 5M18A 1MGWA 1A2PA 5AYSC 3KSED 1PFPA 3J7Yd 1IVWA 1N9JA 1YVBI 4HBRA 1GOUA 3NBJA 1B2XA 1HU9A 1X1YA 3DH2A 3KKGA 3AGOA 1FUWA 3CNMA 2QA43 3S28A 1Z1SA 1QALA 3F7XA 1ASKA 3GZBA 5FW5A 1BSAA 1Q42A 1BNGA 1TFKA 2WOHA 1VQN3 3UJMA 1DMMA 4HM0B 4CPKA 1AR0A 1OCVA 2F56A 3JUPA 3PCSA 2BIRA 3KE7A 1RSNA 1W4NA 1UUGB 5CF1A 1EKMA 1UI8A 3EQQB 1IVUA 1FGOA 3D3LA 3GZXB 2F5WA 2F4YA 2OWPA 4L8OA 1MWRA 4HOHA 1FUTA 3NBBA 5DREA 3DZLA 1I0XA 3CU3A 4MJDA 3K0ZA 1IV9A 1JB4A 3DGNA 3LMLA 4RNTA 4LGQA 3V92A 1RGAA 4IT7A 3GRDA 3EN8A 2PNCA 3NHXA 4NPBA 5AIHA 2P0MA 1GD3A 2BMOB 1NU3A 5IF6A 1QVF2 6GSPA 1PYLA 2FNQA 3RNTA 4N6OB 1YI23 1N9EA 2A15A 1VQ73 3LTBA 1I3FA 2CFWA 3RGRA 1IV7A 1MGRA 4FMDA 5IEPA 1GS3A 1G96A 2GBWB 1TU5A 3DGYA 4N6V0 3RGAA 1JKGA 2XR8B 1O7MB 1O7PB 2SARA 3DGLA 4O02B 4RBNA 4XBTA 1ISKA 2YFJB 1D6UA 1FGQA 3CCE3 1BOXA 4ILFA 4WP5A 4GSPA 3LH4A 4KVHA 1B2MA 1F8NA 3AMOB 3FF2A 3NX0A 5G2GA 4R1KA 3X42A 3B7CA 1OUNA 1VQ63 1IQYA 3ZG5A 3EBYA 2Q07A 2RCDA 4MEIA 4OK0A 2CHCA 2CG0A 5TGNA 1QMAA 2AAEA 1K734 1O7WB 2OTL3 1DVDA 1KC84 3A76A 3KIIA 4KFDA 4HM3B 1B2SA 3LT9A 4AEQA 2HOHA 3K5TA 4I4KA 3V99A 4BIRA 2GXFA 5JPPA 3CCL3 1AY7A 1CYUA 2O3OA 1Y4KA 2CFDA 3WODG 4KT3B 3NUVA 1JRQA 1TRPA 1RMSA 1TRQA 1BSEA 2ZL8A 4XBXA 2W56A 2WOFA 2KXGA 4G1MB 2F5MA 1G02A 5AIGA 3FGYA 2W0QA 3EX9A 5KP1A 1YJ93 3X41A 4KFFA 1UDII 1RGLA 1MNLA 3PS8A 4BTXA 2WGQA 4LEHA 3DY5A 4WWUC 1OHSA 3KSPA 1VQQA 3E99A 4DKIA 3K9MC 1T2IA 3G0KA 3DUKA 4BTWA 5BVBA 1M1K4 1IVVA 3BNDA 3G8ZA 3SOYA 2INXA 2B1XB 3Q3FA 5JPUA 1AQZA 1LRAA 4X2HA 4MMZB 1IK3A 1BRKA 3NQZA 3FLJA 6STDA 2MF7A 2Z7AA 1RGFA 2RGQA 1B20A 1Q40A 2IMJA 4QWTA 3I0YA 1CH0A 3F8HA 4CDLA 4N6MA 1UI7A 1N5HA 1SIIA 1UCIA 3GZRA 4BTYA 3Q1CA 4XBYA 2IYJA 1ULIB 1JN5A 2K0MA 4I5QA 2W04A 3ECFA 1HZ1A 1ULJB 1JBRA 3KFQC 3HIGA 1E3VA 1RRLA 3F7SA 3G16A 3F8XA 4K1UA 1OGXA 1T2HA 1KD14 1IDPA 3VGNA 3CCM3 3EBTA 1W7CA 5IG0A 1JB2A 5M19A 1MOLA 2RBIA 1BNIA 1QJGA 3CCR3 5AYRB 2D42A 2FGTA 1WQLB 1YHQ3 1C54A 4GB5A 1FW7A 4ZM8A 4RNZA 2P05A 1FGMA 2P0XA 2KF5A 3WMDA 1AV4A 2W9PA 1B2UA 2CG1A 3SEDA 3FH1A 3N9HA 4AKYA 1W00A 1PY3A 2I9WA 1O7HB 2CIUA 1GMQA 1RJOA 1TIJA 2LQVA 2ML6A 5BU4A 3CC23 1BNEA 3D79A 4J5KA 4N6LA 1ROVA 4L8PA 1RCKA 3SOAA 5A0OB 1A67A 3FG1A 3WA3A 2IUJA 2OTJ3 4JF8A 1IT8A 3B8LA 1VQO3 3MG2A 3G4S3 1ROAA 3KZTA 3G713 3QK9A 1B27A 1JKGB 1WMPA 2KRTA 2XFTA 1D6ZA 2JQ5A 3IJEB 1BSCA 3EF8A 4HVNA 4HYZA 1Q864 1UUVB 1OPYA 1LOVA 3TDGA 7GSPA 2XH9A 9RNTA 2HMMB 3WOEB 1BU4A 5CF2A 4EV5A 5M1AA 2GSPA 5IERA 3NXJA 1TTOA 3SLUA 1J2BA 1YGWA 2ZDJA 1GOVA 4FCMA 4H3UA 1LVNA 3BLZA 5EVHA 4ORLA 3F40A 1K8A4 3ROBA 1YVSA 2O9UX 1VQ93 3F9SA 2BO9B 1US1A 2SBLA 3EJVA 3ER7A 3N8BA 4OVMA 1YIT3 2XSHB 5STDA 4OUQA 4BL2A 2P09A 2ZHXB 1OACA 2W56B 1QAFA 1JBSA 1N8QA 1Q9EA 1X1WA 4FMCA 1YJW3 3MKIA 3BNCA 1R4YA 4O2HA 3EC9A 2K3DA 4H61A 1R4CA 3B4OA 4O8SA 3D4AA 1NWWA 5IG4A 3I563 1AVLA 3JVCA 1EUIC 1DVCA 1QAKA 2QIYA 2W6JH 2V1LA 1I2GA 2BNGA 2GEXA 3BB9A 3JUMA 1AVKA 1VZZA 1BSDA 2C4BA 5KP3A 1UW1A 1VQP3 2XRXB 1RKYA 1VQ43 2BMQB 4R9LA 8RNTA 1WNHA 2XGLA 3S27A 2HMLB 2F86B 1A2VA 5IEOA 5CK6A 2L4VA 4L7KA 1VQ53 1BUJA 1FZUA 1TFOA 3VF1A 1BRNL 1GY7A 1Q40B 3D9RA 3GWRA 1RTUA 1KSIA 1ZGXA 4K1VA 1I2EA 2ZA4A 3WHOA 4HM6B 5JBSA 3PYJA 4LYLB 1UGIA 2R4IA 1PU4A 2Z77A 3CCV3 1RGGA 3T8UA 3WA2X 5BXQA 1JN5B 2RSXA 3CCJ3 4X2OA 1TP6A 4WHAA 3OX9A 1BAOA 2QEX3 1BRIA 4HJLB 2CWTA 2RFRA 5HOHA 4EC6A 1STFI 1BRGA 1IQ8A 2YX9A 3F14A 1DYUA 2UUGC 2C11A 2XEPA 3RDEA 1Q7Y4 1EG9B 5AEUB 2Y73A 1DETA 1DMQA 2H0GA 3DMCA 3JUOA 1SPUA 1NDOB 1FUSA 1TUHA 1W6GA 3BNBA 3CNXA 4HAAA 4STDA 5G1KA 2AADA 1YJN3 2M7OA 1IYYA 5FGOA 1RGEA 1BNJA 3FG3A 3IPTA 4BL3A 2XGNA 1JB5A 3EN1B 1LQMB 3K63A 2BT3A 1B21A 1BVIA 1RLSA 2IA7A 3AGNA 3H51A 1BANA 3PGBA 5D81A 3UB1A 4CJNA 7STDA 5IG3A 1VQM3 1YIJ3 1STDA 1RN4A 2QGUA 3FG4A 1JZOA 2OQEA 5AI1A 3X3ZA 1Q824 4WYKA 2OCTA 1HYFA 2STDA 3HK4A 3ZFZA 2KF3A 5BIRA 3CMA3 2D1WA 5LC6A 1JV2B 1K41A 2W03A 1T5YA 3BIRA 3BNEA 3FZWA 4XDVA 4MMYB 1JZDA 3STDA 1L5GB 2CKFB 5CLKA 2HMKB 2CC3A 3CC73 2HMNB 2C10A 1IVXA 1CEWI 1NNVA 3DXOA 4HM2B 4BU4A 1FA3A 4N6TA 2KF6A 1X1XA 1G0TA 3LTDA 1NB5I 1BRJA 1RN1A 3O8YA 1IU7A 5KP4A 2OQEC 4Q53A 3EE1A 3UL5A 2UX0A 5IW9A 1VQ83 1CYVA 4IPBA 1MWUA 1O7GB 3MYTA 4R4KA 1ZX2A 1LNIA 2ML5A 1FYSA 1O7NB 4FCZA 1A2KA 3D5GA 5CXOA 1GD4A 3M8CA 1GY5A 3PCRA 5ELJA 1YGEA 2CFLA 3ALAA 1CQSA 1GYBA 3LOYA 4FMBA 2F98A 1V58A 3K7CA 2E2UA 4XB5A 2KF4A 3HIIA 4FMAA 1SQWA 4R9KA 3UNLA 3GSPA 4EYCA 3MG3A 2J8XB 2GBXB 2XFSA 2Y74A 2IY2A 3MG1A 1JJ22 1YNVX 5EEOA 1W5ZA 3NV0A 2BHMA 2CX0A 1W2ZA 3LYGA 3T8NA 1FGRA 3DGMA 2YFIB 1U8CB 1UCKA 1W6CA 3N54B 3NBRA 3Q90A 8CHOA 1RN7A 1N5PA 1RNTA 1EA2A 3B4PA 1OF5A 4K90B 1T3BA 2GU3A 3MSOA 3CCS3 2XSOB 3A5EA 4LSOA 3SVAA 1SIHA 4JRFA 2YFLB 3H3HA 3V98A 1N8R4 1UGHI 3NM7A 1BNFA 2OOVA 1C7HA 3HOHA 2XF3A 1BGSA 1BSBA 1UCLA 3PXMA 6RNTA 1E3RA 3LXUX 3S5CA 1NB3I 4K61A 1A90A 1LNHA 1WMOA 4HM4B 5EQLA 3CME3 1W2B2 2BU4A 2CWUA 3GAXA 1ZS7A 5LC7A 2UGIA 1OGZA 5IENA 1I0VA 1FGTA 3OXAA 3X3XA 3SX1A 1RNBA 1BUQA 4LZIA 1OHOA 3U1WA 2R41A 3DM8A 5D83A 3U97A 2HMOB 4HZBB 3CPOA 2K54A 1TJDA 5ELUA 1I2FA 2OOVC 4R80A 3CCQ3 3HX8A 2Z6BA 4PEJA 2W9QA 3AHSA 2L1SA 2CFKA 1MWTA 4EBGA 4J5GA 5IG5A 1BIRA 3OWYA 3NQYA 1I70A 3OW22 2GEYA 1Q814 1RGKA 3HI7A 3LTCA 4FCJA 1HKXA 1BRSA 4WYKB 4NREA 3FCSB 3MWZA 3VSYA 3T0UA 3LZAA 3WDGB 1DE3A 4N6UA 1M9GA 2E2TA 3X40A 2GU1A 4XDWA 1RGHA 2IUKA 3HZPA 4KFEA 1V57A 2CW9A 3MHEA 3SXXA 2MC8A 1GSPA 3KCHA 1SJWA 3KN4A 2FXTA 4MMXB 3IMAB 1B2ZA 5AIIA 1JNQA 1IQXA 1NO3A 2Z76A 4J9AA 1OH0A 4NHFA 5I97A 4EV2A 1NJI4 1S723 3LT8A 1IT7A 1LQGC 1WMNA 1LXEA 3CPW2 5AIFA 3AHWA 5D82A 1RHLA 2KCDA 3GZYB 1E97A 3BU4A 3FKAA 1LOYA 1RDSA 3FSDA 3SYUA 1RGCA 1UUWB 1M1XB 4AKZA 4HM5B 1RCLA 1W01A 2H0HA 2JDIH 1SARA 3QRDA 3JUQA 1EQKA 2BMRB 3OWUA 1S5AA 3URPA 1RRHA 4RNYA 4EW5A 3OWSA 1Q7HA 2CH9A 2HMJB 2P38A 4N3VA 5RNTA 3S29A 4J8TA 5HGRA 3S67A 1ZO2A 4FR9A 2LYXA 3L0RA 4GHOA 2F99A 1K9M4 1KWIA 1K28A 1WTHA 4N6NB
chains in the Genus database with same CATH topology
3JUNA 3FF0A 4TX4A 3NV0B 4EXRA 1GY6A 2CWVA 3MPHA 3CD63 3AMOA 4HKVB 3PZWA 3I553 3CC43 4WFOA 1VQK3 1OF5B 1OHPA 3EHCA 4IIAA 2PZVA 4HM1B 3G6E3 4O3VA 1U5OA 3CCU3 1QVG2 3Q2PA 5DRVA 3LTAA 1M904 4HM8B 1V74A 4HM7B 3CXC2 2WGOA 2WO0A 1VQL3 3DGOA 4CCVA 3X3YA 1KQS2 3EB8A 4RZMA 1W6YA 2W2CA 3NM2A 3OV4A 4GL6A 5AEWB 1DMNA 4LMIA 2B24B 2CK3H 4HZ9B 1W02A 4XM4A 3UL6A 2E2VA 3WOFB 1LOXA 4U13A 1D6YA 4KZ1A 2CFGA 5AYSC 3KSED 1PFPA 3J7Yd 1IVWA 1N9JA 1YVBI 4HBRA 3NBJA 1HU9A 3KKGA 1FUWA 3CNMA 2QA43 3S28A 1Z1SA 1QALA 3F7XA 1ASKA 3GZBA 5FW5A 1TFKA 1Q42A 1VQN3 2WOHA 3UJMA 1DMMA 4HM0B 1AR0A 1OCVA 3JUPA 3PCSA 3KE7A 1W4NA 5CF1A 1EKMA 1UI8A 3EQQB 1IVUA 1FGOA 3D3LA 3GZXB 2OWPA 4L8OA 3NBBA 5DREA 3DZLA 3CU3A 4MJDA 3K0ZA 1IV9A 1JB4A 3DGNA 3LMLA 3V92A 4LGQA 4IT7A 3GRDA 3EN8A 2PNCA 3NHXA 5AIHA 2P0MA 1GD3A 2BMOB 1NU3A 5IF6A 1QVF2 2FNQA 4N6OB 1YI23 1N9EA 2A15A 1VQ73 3LTBA 2CFWA 3RGRA 1IV7A 4FMDA 5IEPA 1GS3A 1G96A 2GBWB 1TU5A 4N6V0 3RGAA 1JKGA 2XR8B 1O7MB 1O7PB 3DGLA 4O02B 4RBNA 4XBTA 1ISKA 2YFJB 1D6UA 1FGQA 3CCE3 4WP5A 3LH4A 4KVHA 1F8NA 3AMOB 3FF2A 3NX0A 5G2GA 4R1KA 3X42A 3B7CA 1OUNA 1VQ63 1IQYA 3EBYA 2Q07A 2RCDA 4MEIA 4OK0A 2CHCA 2CG0A 5TGNA 1QMAA 1K734 2OTL3 1O7WB 1DVDA 1KC84 3A76A 3KIIA 4KFDA 4HM3B 3LT9A 4AEQA 3K5TA 4I4KA 3V99A 2GXFA 5JPPA 3CCL3 1CYUA 2O3OA 1Y4KA 2CFDA 3WODG 3NUVA 1JRQA 2ZL8A 4XBXA 2W56A 2WOFA 2KXGA 4G1MB 5AIGA 3FGYA 2W0QA 3EX9A 5KP1A 1YJ93 3X41A 4KFFA 3PS8A 1MNLA 4BTXA 2WGQA 4LEHA 3DY5A 4WWUC 1OHSA 3KSPA 3E99A 3K9MC 3G0KA 3DUKA 4BTWA 5BVBA 1M1K4 1IVVA 3BNDA 3G8ZA 3SOYA 2INXA 2B1XB 5JPUA 4X2HA 4MMZB 1IK3A 3NQZA 3FLJA 6STDA 2MF7A 2Z7AA 2RGQA 1Q40A 2IMJA 4QWTA 3I0YA 3F8HA 4CDLA 4N6MA 1UI7A 1N5HA 1SIIA 3GZRA 4BTYA 3Q1CA 4XBYA 1ULIB 1JN5A 2K0MA 2W04A 3ECFA 1ULJB 3KFQC 3HIGA 1E3VA 1RRLA 3F7SA 3G16A 3F8XA 4K1UA 1OGXA 1KD14 1IDPA 3VGNA 3CCM3 3EBTA 1W7CA 5IG0A 1JB2A 1MOLA 1QJGA 3CCR3 5AYRB 2D42A 2FGTA 1WQLB 1YHQ3 4GB5A 4ZM8A 4RNZA 2P05A 1FGMA 2P0XA 3WMDA 1AV4A 2W9PA 2CG1A 3SEDA 3FH1A 3N9HA 4AKYA 1W00A 2ML6A 2I9WA 1O7HB 2CIUA 1TIJA 1RJOA 2LQVA 3CC23 4N6LA 1ROVA 4L8PA 3SOAA 5A0OB 1A67A 3FG1A 3WA3A 2IUJA 2OTJ3 4JF8A 1IT8A 3B8LA 1VQO3 3MG2A 3G4S3 1ROAA 3KZTA 3G713 3QK9A 1JKGB 1WMPA 2KRTA 2XFTA 1D6ZA 2JQ5A 3IJEB 3EF8A 4HVNA 4HYZA 1Q864 1UUVB 1OPYA 3TDGA 2XH9A 2HMMB 3WOEB 5CF2A 4EV5A 5IERA 3NXJA 3SLUA 1J2BA 2ZDJA 4FCMA 4H3UA 1LVNA 3BLZA 5EVHA 4ORLA 3F40A 1K8A4 3ROBA 2O9UX 1VQ93 3F9SA 2BO9B 1US1A 2SBLA 3EJVA 3ER7A 3N8BA 4OVMA 1YIT3 2XSHB 5STDA 4OUQA 2P09A 1OACA 2W56B 1QAFA 1N8QA 4FMCA 1YJW3 3MKIA 3BNCA 4O2HA 3EC9A 4H61A 1R4CA 3B4OA 4O8SA 1NWWA 5IG4A 3I563 1AVLA 3JVCA 1QAKA 1DVCA 3JUMA 2QIYA 2W6JH 2V1LA 2GEXA 2BNGA 3BB9A 1AVKA 1VZZA 5KP3A 1UW1A 1VQP3 2XRXB 1RKYA 1VQ43 2BMQB 4R9LA 1WNHA 2XGLA 3S27A 2HMLB 2F86B 1A2VA 5IEOA 5CK6A 2L4VA 4L7KA 1VQ53 1TFOA 3VF1A 1GY7A 1Q40B 3D9RA 3GWRA 1KSIA 4K1VA 4HM6B 5JBSA 3PYJA 2R4IA 1PU4A 2Z77A 3CCV3 3T8UA 3WA2X 5BXQA 1JN5B 2RSXA 3CCJ3 4X2OA 1TP6A 4WHAA 3OX9A 2QEX3 4HJLB 2CWTA 2RFRA 4EC6A 1STFI 1IQ8A 2YX9A 3F14A 1DYUA 2C11A 2XEPA 3RDEA 1Q7Y4 1EG9B 5AEUB 2Y73A 1DMQA 3DMCA 3JUOA 1SPUA 1NDOB 1TUHA 1W6GA 3BNBA 3CNXA 4STDA 1YJN3 2M7OA 5FGOA 3FG3A 3IPTA 2XGNA 1JB5A 3EN1B 3K63A 2BT3A 2IA7A 3UB1A 3H51A 3PGBA 5D81A 7STDA 5IG3A 1VQM3 1YIJ3 1STDA 2QGUA 3FG4A 2OQEA 5AI1A 3X3ZA 1Q824 4WYKA 2OCTA 2STDA 3HK4A 3CMA3 2D1WA 5LC6A 1JV2B 1K41A 2W03A 1T5YA 3BNEA 3FZWA 4XDVA 4MMYB 3STDA 1L5GB 2CKFB 5CLKA 2HMKB 2CC3A 3CC73 2HMNB 2C10A 1IVXA 1CEWI 3DXOA 4HM2B 1FA3A 4N6TA 3LTDA 1NB5I 3O8YA 1IU7A 5KP4A 2OQEC 4Q53A 3EE1A 3UL5A 2UX0A 5IW9A 1VQ83 1CYVA 4IPBA 1O7GB 3MYTA 4R4KA 1ZX2A 2ML5A 1O7NB 4FCZA 1A2KA 5CXOA 1GD4A 3M8CA 1GY5A 3PCRA 5ELJA 1YGEA 2CFLA 3ALAA 1CQSA 1GYBA 3LOYA 4FMBA 2F98A 3K7CA 2E2UA 4XB5A 3HIIA 4FMAA 1SQWA 4R9KA 3UNLA 4EYCA 3MG3A 2XFSA 2GBXB 2Y74A 3MG1A 1JJ22 5EEOA 1W5ZA 3NV0A 2BHMA 1W2ZA 3LYGA 3T8NA 1FGRA 3DGMA 2YFIB 1U8CB 1W6CA 3N54B 3NBRA 3Q90A 8CHOA 1RN7A 1N5PA 1EA2A 3B4PA 1OF5A 4K90B 2GU3A 3MSOA 3CCS3 2XSOB 4LSOA 3SVAA 1SIHA 4JRFA 2YFLB 3H3HA 3V98A 1N8R4 3NM7A 2OOVA 1C7HA 2XF3A 3PXMA 1E3RA 3LXUX 3S5CA 1NB3I 4K61A 1A90A 1LNHA 1WMOA 4HM4B 5EQLA 3CME3 1W2B2 2CWUA 3GAXA 5LC7A 5IENA 1OGZA 3OXAA 1FGTA 3X3XA 3SX1A 1BUQA 4LZIA 1OHOA 3U1WA 3DM8A 5D83A 3U97A 2HMOB 4HZBB 3CPOA 2K54A 5ELUA 2OOVC 4R80A 3CCQ3 3HX8A 2Z6BA 4PEJA 2W9QA 2CFKA 5IG5A 4EBGA 3OWYA 3NQYA 3OW22 2GEYA 1Q814 3HI7A 3LTCA 4FCJA 1HKXA 4WYKB 4NREA 3FCSB 3MWZA 3VSYA 3T0UA 3LZAA 3WDGB 4N6UA 1M9GA 2E2TA 3X40A 2GU1A 4XDWA 4KFEA 2IUKA 3HZPA 2CW9A 3MHEA 3SXXA 2MC8A 1SJWA 3KN4A 2FXTA 4MMXB 3IMAB 5AIIA 1JNQA 1IQXA 1NO3A 2Z76A 4J9AA 1OH0A 4NHFA 5I97A 4EV2A 1NJI4 1S723 3LT8A 1IT7A 1WMNA 1LXEA 3CPW2 5AIFA 5D82A 2KCDA 3GZYB 1E97A 3FKAA 3FSDA 1UUWB 1M1XB 4AKZA 4HM5B 1W01A 2JDIH 3QRDA 3JUQA 1EQKA 2BMRB 3OWUA 1S5AA 1RRHA 4RNYA 3OWSA 2CH9A 2HMJB 2P38A 4N3VA 3S29A 4J8TA 5HGRA 3S67A 1ZO2A 4FR9A 2LYXA 3L0RA 2F99A 1K9M4 1KWIA 1K28A 1WTHA 4N6NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9U X;  3NX0 A;  4TX4 A;  1GD4 A;  2BO9 B;  5ELJ A;  1DVD A;  4EYC A;  1R4C A;  1CYU A;  1DVC A;  2KXG A;  1RN7 A;  3Q2P A;  1N5P A;  3PS8 A;  1MNL A;  1WNH A;  3K9M C;  3SVA A;  4CCV A;  3PYJ A;  3PXM A;  3UL6 A;  1NB3 I;  1A90 A;  5EQL A;  3GAX A;  5LC7 A;  3KSE D;  1PFP A;  1STF I;  1N9J A;  1YVB I;  4N6M A;  1N5H A;  4LZI A;  1FUW A;  3KFQ C;  5ELU A;  2W9Q A;  1MOL A;  4ZM8 A;  3MWZ A;  4N6U A;  1M9G A;  2W9P A;  1IV9 A;  1TIJ A;  3IMA B;  4IT7 A;  2OCT A;  4N6L A;  5A0O B;  1A67 A;  1LXE A;  5LC6 A;  1GD3 A;  1ROA A;  4N6O B;  1CEW I;  3QRD A;  1FA3 A;  1IV7 A;  4N6T A;  1EQK A;  1NB5 I;  1G96 A;  4N6V 0;  2CH9 A;  3S67 A;  3UL5 A;  1CYV A;  3L0R A;  3LH4 A;  1KWI A;  4N6N B; 
#chains in the Genus database with same CATH topology
 3JUN A;  3FF0 A;  4TX4 A;  1I3I A;  5G1L A;  5GSP A;  1BNR A;  3NV0 B;  1I8V A;  4EXR A;  2RNT A;  1BRH A;  1GY6 A;  2CWV A;  3MPH A;  3CD6 3;  3AMO A;  4HKV B;  3PZW A;  3I55 3;  3CC4 3;  1GMP A;  4WFO A;  1VQK 3;  1OF5 B;  1OHP A;  3EHC A;  4IIA A;  1MWS A;  2PZV A;  4HM1 B;  3G6E 3;  4O3V A;  1U5O A;  1GOY A;  1GMR A;  3CCU 3;  1QVG 2;  3Q2P A;  5DRV A;  3LTA A;  7RNT A;  4HM8 B;  1M90 4;  1V74 A;  1B3S A;  2H0I A;  4HM7 B;  3CXC 2;  2WGO A;  2WO0 A;  3ZG0 A;  1VQL 3;  3DGO A;  1X1U A;  2KAA A;  1LOW A;  1BNS A;  4CCV A;  3X3Y A;  1KQS 2;  3EB8 A;  4RZM A;  1W6Y A;  2W2C A;  3NM2 A;  3OV4 A;  4GL6 A;  1UCJ A;  5AEW B;  1DMN A;  1JBT A;  4LMI A;  1EEJ A;  2B24 B;  2CK3 H;  4HZ9 B;  1W02 A;  4XM4 A;  3UL6 A;  2CX1 A;  2E2V A;  3WOF B;  3D5I A;  1LOX A;  4U13 A;  1D6Y A;  3WR2 A;  4KZ1 A;  2CFG A;  5M18 A;  1MGW A;  1A2P A;  5AYS C;  3KSE D;  1PFP A;  3J7Y d;  1IVW A;  1N9J A;  1YVB I;  4HBR A;  1GOU A;  3NBJ A;  1B2X A;  1HU9 A;  1X1Y A;  3DH2 A;  3KKG A;  3AGO A;  1FUW A;  3CNM A;  2QA4 3;  3S28 A;  1Z1S A;  1QAL A;  3F7X A;  1ASK A;  3GZB A;  5FW5 A;  1BSA A;  1Q42 A;  1BNG A;  1TFK A;  2WOH A;  1VQN 3;  3UJM A;  1DMM A;  4HM0 B;  4CPK A;  1AR0 A;  1OCV A;  2F56 A;  3JUP A;  3PCS A;  2BIR A;  3KE7 A;  1RSN A;  1W4N A;  1UUG B;  5CF1 A;  1EKM A;  1UI8 A;  3EQQ B;  1IVU A;  1FGO A;  3D3L A;  3GZX B;  2F5W A;  2F4Y A;  2OWP A;  4L8O A;  1MWR A;  4HOH A;  1FUT A;  3NBB A;  5DRE A;  3DZL A;  1I0X A;  3CU3 A;  4MJD A;  3K0Z A;  1IV9 A;  1JB4 A;  3DGN A;  3LML A;  4RNT A;  4LGQ A;  3V92 A;  1RGA A;  4IT7 A;  3GRD A;  3EN8 A;  2PNC A;  3NHX A;  4NPB A;  5AIH A;  2P0M A;  1GD3 A;  2BMO B;  1NU3 A;  5IF6 A;  1QVF 2;  6GSP A;  1PYL A;  2FNQ A;  3RNT A;  4N6O B;  1YI2 3;  1N9E A;  2A15 A;  1VQ7 3;  3LTB A;  1I3F A;  2CFW A;  3RGR A;  1IV7 A;  1MGR A;  4FMD A;  5IEP A;  1GS3 A;  1G96 A;  2GBW B;  1TU5 A;  3DGY A;  4N6V 0;  3RGA A;  1JKG A;  2XR8 B;  1O7M B;  1O7P B;  2SAR A;  3DGL A;  4O02 B;  4RBN A;  4XBT A;  1ISK A;  2YFJ B;  1D6U A;  1FGQ A;  3CCE 3;  1BOX A;  4ILF A;  4WP5 A;  4GSP A;  3LH4 A;  4KVH A;  1B2M A;  1F8N A;  3AMO B;  3FF2 A;  3NX0 A;  5G2G A;  4R1K A;  3X42 A;  3B7C A;  1OUN A;  1VQ6 3;  1IQY A;  3ZG5 A;  3EBY A;  2Q07 A;  2RCD A;  4MEI A;  4OK0 A;  2CHC A;  2CG0 A;  5TGN A;  1QMA A;  2AAE A;  1K73 4;  1O7W B;  2OTL 3;  1DVD A;  1KC8 4;  3A76 A;  3KII A;  4KFD A;  4HM3 B;  1B2S A;  3LT9 A;  4AEQ A;  2HOH A;  3K5T A;  4I4K A;  3V99 A;  4BIR A;  2GXF A;  5JPP A;  3CCL 3;  1AY7 A;  1CYU A;  2O3O A;  1Y4K A;  2CFD A;  3WOD G;  4KT3 B;  3NUV A;  1JRQ A;  1TRP A;  1RMS A;  1TRQ A;  1BSE A;  2ZL8 A;  4XBX A;  2W56 A;  2WOF A;  2KXG A;  4G1M B;  2F5M A;  1G02 A;  5AIG A;  3FGY A;  2W0Q A;  3EX9 A;  5KP1 A;  1YJ9 3;  3X41 A;  4KFF A;  1UDI I;  1RGL A;  1MNL A;  3PS8 A;  4BTX A;  2WGQ A;  4LEH A;  3DY5 A;  4WWU C;  1OHS A;  3KSP A;  1VQQ A;  3E99 A;  4DKI A;  3K9M C;  1T2I A;  3G0K A;  3DUK A;  4BTW A;  5BVB A;  1M1K 4;  1IVV A;  3BND A;  3G8Z A;  3SOY A;  2INX A;  2B1X B;  3Q3F A;  5JPU A;  1AQZ A;  1LRA A;  4X2H A;  4MMZ B;  1IK3 A;  1BRK A;  3NQZ A;  3FLJ A;  6STD A;  2MF7 A;  2Z7A A;  1RGF A;  2RGQ A;  1B20 A;  1Q40 A;  2IMJ A;  4QWT A;  3I0Y A;  1CH0 A;  3F8H A;  4CDL A;  4N6M A;  1UI7 A;  1N5H A;  1SII A;  1UCI A;  3GZR A;  4BTY A;  3Q1C A;  4XBY A;  2IYJ A;  1ULI B;  1JN5 A;  2K0M A;  4I5Q A;  2W04 A;  3ECF A;  1HZ1 A;  1ULJ B;  1JBR A;  3KFQ C;  3HIG A;  1E3V A;  1RRL A;  3F7S A;  3G16 A;  3F8X A;  4K1U A;  1OGX A;  1T2H A;  1KD1 4;  1IDP A;  3VGN A;  3CCM 3;  3EBT A;  1W7C A;  5IG0 A;  1JB2 A;  5M19 A;  1MOL A;  2RBI A;  1BNI A;  1QJG A;  3CCR 3;  5AYR B;  2D42 A;  2FGT A;  1WQL B;  1YHQ 3;  1C54 A;  4GB5 A;  1FW7 A;  4ZM8 A;  4RNZ A;  2P05 A;  1FGM A;  2P0X A;  2KF5 A;  3WMD A;  1AV4 A;  2W9P A;  1B2U A;  2CG1 A;  3SED A;  3FH1 A;  3N9H A;  4AKY A;  1W00 A;  1PY3 A;  2I9W A;  1O7H B;  2CIU A;  1GMQ A;  1RJO A;  1TIJ A;  2LQV A;  2ML6 A;  5BU4 A;  3CC2 3;  1BNE A;  3D79 A;  4J5K A;  4N6L A;  1ROV A;  4L8P A;  1RCK A;  3SOA A;  5A0O B;  1A67 A;  3FG1 A;  3WA3 A;  2IUJ A;  2OTJ 3;  4JF8 A;  1IT8 A;  3B8L A;  1VQO 3;  3MG2 A;  3G4S 3;  1ROA A;  3KZT A;  3G71 3;  3QK9 A;  1B27 A;  1JKG B;  1WMP A;  2KRT A;  2XFT A;  1D6Z A;  2JQ5 A;  3IJE B;  1BSC A;  3EF8 A;  4HVN A;  4HYZ A;  1Q86 4;  1UUV B;  1OPY A;  1LOV A;  3TDG A;  7GSP A;  2XH9 A;  9RNT A;  2HMM B;  3WOE B;  1BU4 A;  5CF2 A;  4EV5 A;  5M1A A;  2GSP A;  5IER A;  3NXJ A;  1TTO A;  3SLU A;  1J2B A;  1YGW A;  2ZDJ A;  1GOV A;  4FCM A;  4H3U A;  1LVN A;  3BLZ A;  5EVH A;  4ORL A;  3F40 A;  1K8A 4;  3ROB A;  1YVS A;  2O9U X;  1VQ9 3;  3F9S A;  2BO9 B;  1US1 A;  2SBL A;  3EJV A;  3ER7 A;  3N8B A;  4OVM A;  1YIT 3;  2XSH B;  5STD A;  4OUQ A;  4BL2 A;  2P09 A;  2ZHX B;  1OAC A;  2W56 B;  1QAF A;  1JBS A;  1N8Q A;  1Q9E A;  1X1W A;  4FMC A;  1YJW 3;  3MKI A;  3BNC A;  1R4Y A;  4O2H A;  3EC9 A;  2K3D A;  4H61 A;  1R4C A;  3B4O A;  4O8S A;  3D4A A;  1NWW A;  5IG4 A;  3I56 3;  1AVL A;  3JVC A;  1EUI C;  1DVC A;  1QAK A;  2QIY A;  2W6J H;  2V1L A;  1I2G A;  2BNG A;  2GEX A;  3BB9 A;  3JUM A;  1AVK A;  1VZZ A;  1BSD A;  2C4B A;  5KP3 A;  1UW1 A;  1VQP 3;  2XRX B;  1RKY A;  1VQ4 3;  2BMQ B;  4R9L A;  8RNT A;  1WNH A;  2XGL A;  3S27 A;  2HML B;  2F86 B;  1A2V A;  5IEO A;  5CK6 A;  2L4V A;  4L7K A;  1VQ5 3;  1BUJ A;  1FZU A;  1TFO A;  3VF1 A;  1BRN L;  1GY7 A;  1Q40 B;  3D9R A;  3GWR A;  1RTU A;  1KSI A;  1ZGX A;  4K1V A;  1I2E A;  2ZA4 A;  3WHO A;  4HM6 B;  5JBS A;  3PYJ A;  4LYL B;  1UGI A;  2R4I A;  1PU4 A;  2Z77 A;  3CCV 3;  1RGG A;  3T8U A;  3WA2 X;  5BXQ A;  1JN5 B;  2RSX A;  3CCJ 3;  4X2O A;  1TP6 A;  4WHA A;  3OX9 A;  1BAO A;  2QEX 3;  1BRI A;  4HJL B;  2CWT A;  2RFR A;  5HOH A;  4EC6 A;  1STF I;  1BRG A;  1IQ8 A;  2YX9 A;  3F14 A;  1DYU A;  2UUG C;  2C11 A;  2XEP A;  3RDE A;  1Q7Y 4;  1EG9 B;  5AEU B;  2Y73 A;  1DET A;  1DMQ A;  2H0G A;  3DMC A;  3JUO A;  1SPU A;  1NDO B;  1FUS A;  1TUH A;  1W6G A;  3BNB A;  3CNX A;  4HAA A;  4STD A;  5G1K A;  2AAD A;  1YJN 3;  2M7O A;  1IYY A;  5FGO A;  1RGE A;  1BNJ A;  3FG3 A;  3IPT A;  4BL3 A;  2XGN A;  1JB5 A;  3EN1 B;  1LQM B;  3K63 A;  2BT3 A;  1B21 A;  1BVI A;  1RLS A;  2IA7 A;  3AGN A;  3H51 A;  1BAN A;  3PGB A;  5D81 A;  3UB1 A;  4CJN A;  7STD A;  5IG3 A;  1VQM 3;  1YIJ 3;  1STD A;  1RN4 A;  2QGU A;  3FG4 A;  1JZO A;  2OQE A;  5AI1 A;  3X3Z A;  1Q82 4;  4WYK A;  2OCT A;  1HYF A;  2STD A;  3HK4 A;  3ZFZ A;  2KF3 A;  5BIR A;  3CMA 3;  2D1W A;  5LC6 A;  1JV2 B;  1K41 A;  2W03 A;  1T5Y A;  3BIR A;  3BNE A;  3FZW A;  4XDV A;  4MMY B;  1JZD A;  3STD A;  1L5G B;  2CKF B;  5CLK A;  2HMK B;  2CC3 A;  3CC7 3;  2HMN B;  2C10 A;  1IVX A;  1CEW I;  1NNV A;  3DXO A;  4HM2 B;  4BU4 A;  1FA3 A;  4N6T A;  2KF6 A;  1X1X A;  1G0T A;  3LTD A;  1NB5 I;  1BRJ A;  1RN1 A;  3O8Y A;  1IU7 A;  5KP4 A;  2OQE C;  4Q53 A;  3EE1 A;  3UL5 A;  2UX0 A;  5IW9 A;  1VQ8 3;  1CYV A;  4IPB A;  1MWU A;  1O7G B;  3MYT A;  4R4K A;  1ZX2 A;  1LNI A;  2ML5 A;  1FYS A;  1O7N B;  4FCZ A;  1A2K A;  3D5G A;  5CXO A;  1GD4 A;  3M8C A;  1GY5 A;  3PCR A;  5ELJ A;  1YGE A;  2CFL A;  3ALA A;  1CQS A;  1GYB A;  3LOY A;  4FMB A;  2F98 A;  1V58 A;  3K7C A;  2E2U A;  4XB5 A;  2KF4 A;  3HII A;  4FMA A;  1SQW A;  4R9K A;  3UNL A;  3GSP A;  4EYC A;  3MG3 A;  2J8X B;  2GBX B;  2XFS A;  2Y74 A;  2IY2 A;  3MG1 A;  1JJ2 2;  1YNV X;  5EEO A;  1W5Z A;  3NV0 A;  2BHM A;  2CX0 A;  1W2Z A;  3LYG A;  3T8N A;  1FGR A;  3DGM A;  2YFI B;  1U8C B;  1UCK A;  1W6C A;  3N54 B;  3NBR A;  3Q90 A;  8CHO A;  1RN7 A;  1N5P A;  1RNT A;  1EA2 A;  3B4P A;  1OF5 A;  4K90 B;  1T3B A;  2GU3 A;  3MSO A;  3CCS 3;  2XSO B;  3A5E A;  4LSO A;  3SVA A;  1SIH A;  4JRF A;  2YFL B;  3H3H A;  3V98 A;  1N8R 4;  1UGH I;  3NM7 A;  1BNF A;  2OOV A;  1C7H A;  3HOH A;  2XF3 A;  1BGS A;  1BSB A;  1UCL A;  3PXM A;  6RNT A;  1E3R A;  3LXU X;  3S5C A;  1NB3 I;  4K61 A;  1A90 A;  1LNH A;  1WMO A;  4HM4 B;  5EQL A;  3CME 3;  1W2B 2;  2BU4 A;  2CWU A;  3GAX A;  1ZS7 A;  5LC7 A;  2UGI A;  1OGZ A;  5IEN A;  1I0V A;  1FGT A;  3OXA A;  3X3X A;  3SX1 A;  1RNB A;  1BUQ A;  4LZI A;  1OHO A;  3U1W A;  2R41 A;  3DM8 A;  5D83 A;  3U97 A;  2HMO B;  4HZB B;  3CPO A;  2K54 A;  1TJD A;  5ELU A;  1I2F A;  2OOV C;  4R80 A;  3CCQ 3;  3HX8 A;  2Z6B A;  4PEJ A;  2W9Q A;  3AHS A;  2L1S A;  2CFK A;  1MWT A;  4EBG A;  4J5G A;  5IG5 A;  1BIR A;  3OWY A;  3NQY A;  1I70 A;  3OW2 2;  2GEY A;  1Q81 4;  1RGK A;  3HI7 A;  3LTC A;  4FCJ A;  1HKX A;  1BRS A;  4WYK B;  4NRE A;  3FCS B;  3MWZ A;  3VSY A;  3T0U A;  3LZA A;  3WDG B;  1DE3 A;  4N6U A;  1M9G A;  2E2T A;  3X40 A;  2GU1 A;  4XDW A;  1RGH A;  2IUK A;  3HZP A;  4KFE A;  1V57 A;  2CW9 A;  3MHE A;  3SXX A;  2MC8 A;  1GSP A;  3KCH A;  1SJW A;  3KN4 A;  2FXT A;  4MMX B;  3IMA B;  1B2Z A;  5AII A;  1JNQ A;  1IQX A;  1NO3 A;  2Z76 A;  4J9A A;  1OH0 A;  4NHF A;  5I97 A;  4EV2 A;  1NJI 4;  1S72 3;  3LT8 A;  1IT7 A;  1LQG C;  1WMN A;  1LXE A;  3CPW 2;  5AIF A;  3AHW A;  5D82 A;  1RHL A;  2KCD A;  3GZY B;  1E97 A;  3BU4 A;  3FKA A;  1LOY A;  1RDS A;  3FSD A;  3SYU A;  1RGC A;  1UUW B;  1M1X B;  4AKZ A;  4HM5 B;  1RCL A;  1W01 A;  2H0H A;  2JDI H;  1SAR A;  3QRD A;  3JUQ A;  1EQK A;  2BMR B;  3OWU A;  1S5A A;  3URP A;  1RRH A;  4RNY A;  4EW5 A;  3OWS A;  1Q7H A;  2CH9 A;  2HMJ B;  2P38 A;  4N3V A;  5RNT A;  3S29 A;  4J8T A;  5HGR A;  3S67 A;  1ZO2 A;  4FR9 A;  2LYX A;  3L0R A;  4GHO A;  2F99 A;  1K9M 4;  1KWI A;  1K28 A;  1WTH A;  4N6N B; 
#chains in the Genus database with same CATH homology
 3JUN A;  3FF0 A;  4TX4 A;  3NV0 B;  4EXR A;  1GY6 A;  2CWV A;  3MPH A;  3CD6 3;  3AMO A;  4HKV B;  3PZW A;  3I55 3;  3CC4 3;  4WFO A;  1VQK 3;  1OF5 B;  1OHP A;  3EHC A;  4IIA A;  2PZV A;  4HM1 B;  3G6E 3;  4O3V A;  1U5O A;  3CCU 3;  1QVG 2;  3Q2P A;  5DRV A;  3LTA A;  1M90 4;  4HM8 B;  1V74 A;  4HM7 B;  3CXC 2;  2WGO A;  2WO0 A;  1VQL 3;  3DGO A;  4CCV A;  3X3Y A;  1KQS 2;  3EB8 A;  4RZM A;  1W6Y A;  2W2C A;  3NM2 A;  3OV4 A;  4GL6 A;  5AEW B;  1DMN A;  4LMI A;  2B24 B;  2CK3 H;  4HZ9 B;  1W02 A;  4XM4 A;  3UL6 A;  2E2V A;  3WOF B;  1LOX A;  4U13 A;  1D6Y A;  4KZ1 A;  2CFG A;  5AYS C;  3KSE D;  1PFP A;  3J7Y d;  1IVW A;  1N9J A;  1YVB I;  4HBR A;  3NBJ A;  1HU9 A;  3KKG A;  1FUW A;  3CNM A;  2QA4 3;  3S28 A;  1Z1S A;  1QAL A;  3F7X A;  1ASK A;  3GZB A;  5FW5 A;  1TFK A;  1Q42 A;  1VQN 3;  2WOH A;  3UJM A;  1DMM A;  4HM0 B;  1AR0 A;  1OCV A;  3JUP A;  3PCS A;  3KE7 A;  1W4N A;  5CF1 A;  1EKM A;  1UI8 A;  3EQQ B;  1IVU A;  1FGO A;  3D3L A;  3GZX B;  2OWP A;  4L8O A;  3NBB A;  5DRE A;  3DZL A;  3CU3 A;  4MJD A;  3K0Z A;  1IV9 A;  1JB4 A;  3DGN A;  3LML A;  3V92 A;  4LGQ A;  4IT7 A;  3GRD A;  3EN8 A;  2PNC A;  3NHX A;  5AIH A;  2P0M A;  1GD3 A;  2BMO B;  1NU3 A;  5IF6 A;  1QVF 2;  2FNQ A;  4N6O B;  1YI2 3;  1N9E A;  2A15 A;  1VQ7 3;  3LTB A;  2CFW A;  3RGR A;  1IV7 A;  4FMD A;  5IEP A;  1GS3 A;  1G96 A;  2GBW B;  1TU5 A;  4N6V 0;  3RGA A;  1JKG A;  2XR8 B;  1O7M B;  1O7P B;  3DGL A;  4O02 B;  4RBN A;  4XBT A;  1ISK A;  2YFJ B;  1D6U A;  1FGQ A;  3CCE 3;  4WP5 A;  3LH4 A;  4KVH A;  1F8N A;  3AMO B;  3FF2 A;  3NX0 A;  5G2G A;  4R1K A;  3X42 A;  3B7C A;  1OUN A;  1VQ6 3;  1IQY A;  3EBY A;  2Q07 A;  2RCD A;  4MEI A;  4OK0 A;  2CHC A;  2CG0 A;  5TGN A;  1QMA A;  1K73 4;  2OTL 3;  1O7W B;  1DVD A;  1KC8 4;  3A76 A;  3KII A;  4KFD A;  4HM3 B;  3LT9 A;  4AEQ A;  3K5T A;  4I4K A;  3V99 A;  2GXF A;  5JPP A;  3CCL 3;  1CYU A;  2O3O A;  1Y4K A;  2CFD A;  3WOD G;  3NUV A;  1JRQ A;  2ZL8 A;  4XBX A;  2W56 A;  2WOF A;  2KXG A;  4G1M B;  5AIG A;  3FGY A;  2W0Q A;  3EX9 A;  5KP1 A;  1YJ9 3;  3X41 A;  4KFF A;  3PS8 A;  1MNL A;  4BTX A;  2WGQ A;  4LEH A;  3DY5 A;  4WWU C;  1OHS A;  3KSP A;  3E99 A;  3K9M C;  3G0K A;  3DUK A;  4BTW A;  5BVB A;  1M1K 4;  1IVV A;  3BND A;  3G8Z A;  3SOY A;  2INX A;  2B1X B;  5JPU A;  4X2H A;  4MMZ B;  1IK3 A;  3NQZ A;  3FLJ A;  6STD A;  2MF7 A;  2Z7A A;  2RGQ A;  1Q40 A;  2IMJ A;  4QWT A;  3I0Y A;  3F8H A;  4CDL A;  4N6M A;  1UI7 A;  1N5H A;  1SII A;  3GZR A;  4BTY A;  3Q1C A;  4XBY A;  1ULI B;  1JN5 A;  2K0M A;  2W04 A;  3ECF A;  1ULJ B;  3KFQ C;  3HIG A;  1E3V A;  1RRL A;  3F7S A;  3G16 A;  3F8X A;  4K1U A;  1OGX A;  1KD1 4;  1IDP A;  3VGN A;  3CCM 3;  3EBT A;  1W7C A;  5IG0 A;  1JB2 A;  1MOL A;  1QJG A;  3CCR 3;  5AYR B;  2D42 A;  2FGT A;  1WQL B;  1YHQ 3;  4GB5 A;  4ZM8 A;  4RNZ A;  2P05 A;  1FGM A;  2P0X A;  3WMD A;  1AV4 A;  2W9P A;  2CG1 A;  3SED A;  3FH1 A;  3N9H A;  4AKY A;  1W00 A;  2ML6 A;  2I9W A;  1O7H B;  2CIU A;  1TIJ A;  1RJO A;  2LQV A;  3CC2 3;  4N6L A;  1ROV A;  4L8P A;  3SOA A;  5A0O B;  1A67 A;  3FG1 A;  3WA3 A;  2IUJ A;  2OTJ 3;  4JF8 A;  1IT8 A;  3B8L A;  1VQO 3;  3MG2 A;  3G4S 3;  1ROA A;  3KZT A;  3G71 3;  3QK9 A;  1JKG B;  1WMP A;  2KRT A;  2XFT A;  1D6Z A;  2JQ5 A;  3IJE B;  3EF8 A;  4HVN A;  4HYZ A;  1Q86 4;  1UUV B;  1OPY A;  3TDG A;  2XH9 A;  2HMM B;  3WOE B;  5CF2 A;  4EV5 A;  5IER A;  3NXJ A;  3SLU A;  1J2B A;  2ZDJ A;  4FCM A;  4H3U A;  1LVN A;  3BLZ A;  5EVH A;  4ORL A;  3F40 A;  1K8A 4;  3ROB A;  2O9U X;  1VQ9 3;  3F9S A;  2BO9 B;  1US1 A;  2SBL A;  3EJV A;  3ER7 A;  3N8B A;  4OVM A;  1YIT 3;  2XSH B;  5STD A;  4OUQ A;  2P09 A;  1OAC A;  2W56 B;  1QAF A;  1N8Q A;  4FMC A;  1YJW 3;  3MKI A;  3BNC A;  4O2H A;  3EC9 A;  4H61 A;  1R4C A;  3B4O A;  4O8S A;  1NWW A;  5IG4 A;  3I56 3;  1AVL A;  3JVC A;  1QAK A;  1DVC A;  3JUM A;  2QIY A;  2W6J H;  2V1L A;  2GEX A;  2BNG A;  3BB9 A;  1AVK A;  1VZZ A;  5KP3 A;  1UW1 A;  1VQP 3;  2XRX B;  1RKY A;  1VQ4 3;  2BMQ B;  4R9L A;  1WNH A;  2XGL A;  3S27 A;  2HML B;  2F86 B;  1A2V A;  5IEO A;  5CK6 A;  2L4V A;  4L7K A;  1VQ5 3;  1TFO A;  3VF1 A;  1GY7 A;  1Q40 B;  3D9R A;  3GWR A;  1KSI A;  4K1V A;  4HM6 B;  5JBS A;  3PYJ A;  2R4I A;  1PU4 A;  2Z77 A;  3CCV 3;  3T8U A;  3WA2 X;  5BXQ A;  1JN5 B;  2RSX A;  3CCJ 3;  4X2O A;  1TP6 A;  4WHA A;  3OX9 A;  2QEX 3;  4HJL B;  2CWT A;  2RFR A;  4EC6 A;  1STF I;  1IQ8 A;  2YX9 A;  3F14 A;  1DYU A;  2C11 A;  2XEP A;  3RDE A;  1Q7Y 4;  1EG9 B;  5AEU B;  2Y73 A;  1DMQ A;  3DMC A;  3JUO A;  1SPU A;  1NDO B;  1TUH A;  1W6G A;  3BNB A;  3CNX A;  4STD A;  1YJN 3;  2M7O A;  5FGO A;  3FG3 A;  3IPT A;  2XGN A;  1JB5 A;  3EN1 B;  3K63 A;  2BT3 A;  2IA7 A;  3UB1 A;  3H51 A;  3PGB A;  5D81 A;  7STD A;  5IG3 A;  1VQM 3;  1YIJ 3;  1STD A;  2QGU A;  3FG4 A;  2OQE A;  5AI1 A;  3X3Z A;  1Q82 4;  4WYK A;  2OCT A;  2STD A;  3HK4 A;  3CMA 3;  2D1W A;  5LC6 A;  1JV2 B;  1K41 A;  2W03 A;  1T5Y A;  3BNE A;  3FZW A;  4XDV A;  4MMY B;  3STD A;  1L5G B;  2CKF B;  5CLK A;  2HMK B;  2CC3 A;  3CC7 3;  2HMN B;  2C10 A;  1IVX A;  1CEW I;  3DXO A;  4HM2 B;  1FA3 A;  4N6T A;  3LTD A;  1NB5 I;  3O8Y A;  1IU7 A;  5KP4 A;  2OQE C;  4Q53 A;  3EE1 A;  3UL5 A;  2UX0 A;  5IW9 A;  1VQ8 3;  1CYV A;  4IPB A;  1O7G B;  3MYT A;  4R4K A;  1ZX2 A;  2ML5 A;  1O7N B;  4FCZ A;  1A2K A;  5CXO A;  1GD4 A;  3M8C A;  1GY5 A;  3PCR A;  5ELJ A;  1YGE A;  2CFL A;  3ALA A;  1CQS A;  1GYB A;  3LOY A;  4FMB A;  2F98 A;  3K7C A;  2E2U A;  4XB5 A;  3HII A;  4FMA A;  1SQW A;  4R9K A;  3UNL A;  4EYC A;  3MG3 A;  2XFS A;  2GBX B;  2Y74 A;  3MG1 A;  1JJ2 2;  5EEO A;  1W5Z A;  3NV0 A;  2BHM A;  1W2Z A;  3LYG A;  3T8N A;  1FGR A;  3DGM A;  2YFI B;  1U8C B;  1W6C A;  3N54 B;  3NBR A;  3Q90 A;  8CHO A;  1RN7 A;  1N5P A;  1EA2 A;  3B4P A;  1OF5 A;  4K90 B;  2GU3 A;  3MSO A;  3CCS 3;  2XSO B;  4LSO A;  3SVA A;  1SIH A;  4JRF A;  2YFL B;  3H3H A;  3V98 A;  1N8R 4;  3NM7 A;  2OOV A;  1C7H A;  2XF3 A;  3PXM A;  1E3R A;  3LXU X;  3S5C A;  1NB3 I;  4K61 A;  1A90 A;  1LNH A;  1WMO A;  4HM4 B;  5EQL A;  3CME 3;  1W2B 2;  2CWU A;  3GAX A;  5LC7 A;  5IEN A;  1OGZ A;  3OXA A;  1FGT A;  3X3X A;  3SX1 A;  1BUQ A;  4LZI A;  1OHO A;  3U1W A;  3DM8 A;  5D83 A;  3U97 A;  2HMO B;  4HZB B;  3CPO A;  2K54 A;  5ELU A;  2OOV C;  4R80 A;  3CCQ 3;  3HX8 A;  2Z6B A;  4PEJ A;  2W9Q A;  2CFK A;  5IG5 A;  4EBG A;  3OWY A;  3NQY A;  3OW2 2;  2GEY A;  1Q81 4;  3HI7 A;  3LTC A;  4FCJ A;  1HKX A;  4WYK B;  4NRE A;  3FCS B;  3MWZ A;  3VSY A;  3T0U A;  3LZA A;  3WDG B;  4N6U A;  1M9G A;  2E2T A;  3X40 A;  2GU1 A;  4XDW A;  4KFE A;  2IUK A;  3HZP A;  2CW9 A;  3MHE A;  3SXX A;  2MC8 A;  1SJW A;  3KN4 A;  2FXT A;  4MMX B;  3IMA B;  5AII A;  1JNQ A;  1IQX A;  1NO3 A;  2Z76 A;  4J9A A;  1OH0 A;  4NHF A;  5I97 A;  4EV2 A;  1NJI 4;  1S72 3;  3LT8 A;  1IT7 A;  1WMN A;  1LXE A;  3CPW 2;  5AIF A;  5D82 A;  2KCD A;  3GZY B;  1E97 A;  3FKA A;  3FSD A;  1UUW B;  1M1X B;  4AKZ A;  4HM5 B;  1W01 A;  2JDI H;  3QRD A;  3JUQ A;  1EQK A;  2BMR B;  3OWU A;  1S5A A;  1RRH A;  4RNY A;  3OWS A;  2CH9 A;  2HMJ B;  2P38 A;  4N3V A;  3S29 A;  4J8T A;  5HGR A;  3S67 A;  1ZO2 A;  4FR9 A;  2LYX A;  3L0R A;  2F99 A;  1K9M 4;  1KWI A;  1K28 A;  1WTH A;  4N6N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...