1BOXA

N39s mutant of rnase sa from streptomyces aureofaciens
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
VSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQSRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Contribution of a conserved asparagine to the conformational stability of ribonucleases Sa, Ba, and T1.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 23
structure length 95
sequence length 95
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1boxA00
1I3FA 4GSPA 4J5KA 1RCLA 1B20A 9RNTA 1GOUA 4J5GA 1YVSA 1B2XA 1RGAA 1BUJA 1GOVA 2F5WA 1PYLA 1DETA 3SYUA 1BRJA 1BGSA 1BRNL 5RNTA 1TRQA 1X1WA 3AHWA 1BSDA 1FYSA 1FUSA 3DGYA 5HOHA 1RN1A 1T2HA 1RHLA 1MGRA 1I2FA 1LOVA 4HAAA 1I0VA 1A2PA 1I3IA 1I70A 1BNIA 1ZGXA 2RBIA 3D4AA 1RLSA 1RGCA 1HZ1A 1I0XA 1LOWA 3WR2A 1B2UA 2KAAA 1C54A 1SARA 1RCKA 1LRAA 3D5IA 1BNRA 1X1YA 1Q9EA 1RSNA 3HOHA 1RMSA 1B2ZA 1RN4A 1I2GA 1B21A 1BNEA 2SARA 1FZUA 1JBSA 1RGHA 1GMPA 1I8VA 4BU4A 1BVIA 2KF6A 1MGWA 1BSEA 1IYYA 1RNTA 1RNBA 1BANA 1FUTA 2F5MA 1X1XA 1B27A 3GSPA 1BSBA 1DE3A 2F56A 1BRGA 1GMQA 2F4YA 1UCJA 1JBTA 1RTUA 5GSPA 1G02A 1RGLA 2AADA 1T2IA 1RGEA 1RGGA 1B3SA 1UCKA 1YGWA 4RNTA 7GSPA 4BIRA 1FW7A 2GSPA 6GSPA 1LNIA 1UCLA 1B2MA 3AHSA 1RGFA 2BU4A 1BRSA 3DH2A 2RNTA 1BIRA 1TRPA 3KCHA 1BNJA 1PY3A 1GOYA 1BU4A 1BSAA 1B2SA 4HOHA 1AQZA 1R4YA 2KF5A 7RNTA 1AY7A 1YNVX 2AAEA 3AGOA 1BNGA 1BRIA 1GSPA 1GMRA 2C4BA 1BOXA 1BRHA 1UCIA 1BRKA 3Q3FA 2HOHA 3URPA 5BU4A 1CH0A 2ZA4A 3RNTA 2BIRA 2KF4A 1BAOA 3BIRA 8RNTA 3AGNA 3WHOA 3D5GA 5BIRA 1BNSA 3BU4A 4GHOA 1LOYA 1BSCA 1RGKA 3A5EA 1HYFA 1JBRA 1I2EA 1RDSA 1TTOA 2KF3A 1X1UA 6RNTA 1BNFA
chains in the Genus database with same CATH superfamily
3NV0B 1MWRA 1UGHI 1A90A 4JRFA 1UUGB 1YVSA 4WHAA 3CCR3 3K5TA 3DUKA 4K90B 3NQZA 1JJ22 4HM7B 3Q1CA 3PXMA 3SYUA 2KRTA 4EW5A 1AVLA 3S67A 2GEXA 1E3VA 2PZVA 2Z77A 1IV9A 2UUGC 1YI23 5LC7A 3SOYA 3LT9A 2W04A 3DMCA 3JUPA 1IT7A 4L8OA 1G96A 4FR9A 4U13A 3BB9A 3GZXB 1MGRA 5G1LA 3G4S3 3NBJA 3CD63 1Q7Y4 2XR8B 3MSOA 4J8TA 4X2OA 3EX9A 1O7PB 2BMRB 1ZGXA 2RBIA 1MWUA 1TIJA 3OWSA 4HM5B 2RSXA 2V1LA 1IVWA 3D4AA 4FCMA 3S5CA 2P05A 4R80A 2W0QA 1HZ1A 1W00A 2W9QA 3V98A 4LSOA 1OHOA 1IQ8A 3X3YA 3LTDA 2CK3H 1EA2A 1LRAA 3D5IA 5ELJA 3X3XA 2C11A 1RMSA 1W4NA 4O8SA 5KP1A 2P0XA 2GXFA 2L4VA 3LTAA 3F8HA 1BNEA 3LOYA 4MMZB 3DXOA 3T0UA 3SOAA 2CW9A 1KQS2 3K9MC 2CHCA 1I8VA 2KCDA 3L0RA 2ZDJA 1IK3A 4BU4A 1DVCA 1W5ZA 2Z7AA 4L8PA 3KIIA 3PCSA 1BANA 1FUTA 2F5MA 3FF0A 3CCU3 3GZBA 3WMDA 2F4YA 3EHCA 1UCJA 1W6YA 1PU4A 1FGRA 5GSPA 3NBRA 1CYVA 1RGEA 3DGLA 3IMAB 1SQWA 1UCKA 4HM4B 8CHOA 4STDA 5G2GA 3GAXA 4XDVA 3MHEA 2L1SA 4CJNA 4LEHA 1N9EA 1FW7A 1GYBA 2GEYA 3F40A 3KFQC 6GSPA 4IPBA 1B2MA 1TFKA 3VF1A 1OH0A 2YFJB 1W7CA 3OWYA 5IEPA 1Y4KA 1ZS7A 3BNEA 5KP3A 4CDLA 1BIRA 1TRPA 1PY3A 4N6MA 1J2BA 1MWTA 2ZL8A 3PGBA 3BNDA 2KF5A 1JZDA 3VGNA 7RNTA 1BNGA 1BRIA 3PCRA 1GMRA 1N8R4 5BVBA 3DGOA 3FG1A 3MG3A 5M19A 1BRHA 1MOLA 2BMOB 3UNLA 4FMCA 1VQN3 2P0MA 1AVKA 1PFPA 5KP4A 1UCIA 2P38A 2H0HA 2XGLA 1CH0A 4PEJA 3WOEB 4WWUC 3RNTA 2Y74A 5FW5A 1U8CB 1YGEA 2J8XB 3BIRA 1JB4A 2F98A 2W9PA 5AEWB 2W6JH 1FGQA 3WHOA 1VQ63 1MWSA 4R4KA 3HIGA 1OHSA 1W01A 1V58A 3MPHA 1M1XB 3WODG 1RGKA 1VQQA 3FCSB 1TTOA 2H0IA 1CYUA 3EQQB 2HOHA 2A15A 1STFI 2W56A 1UI8A 1YIJ3 3I563 4GSPA 9RNTA 3B8LA 3GZYB 1YVBI 1C7HA 1T3BA 2CFKA 3LYGA 2OOVA 1IVVA 1VQ93 1SPUA 1SJWA 3OWUA 4O2HA 2LQVA 2F5WA 1PYLA 1DETA 2STDA 2HMNB 3OX9A 1NU3A 1QAKA 3D9RA 5IF6A 3CPW2 1TFOA 1IT8A 5D82A 3AHWA 3FLJA 4HM0B 1DMQA 1OHPA 3N54B 2W56B 1JB5A 5D83A 3S29A 2YFIB 1VZZA 1FUSA 3DY5A 3S28A 3UL6A 1RN1A 1Q814 1QAFA 5HGRA 1K734 3DGMA 1QVG2 2P09A 2XSHB 1LOVA 3IPTA 1GD4A 1I70A 3UL5A 4N6V0 3EF8A 1UUVB 5AEUB 2FGTA 4WP5A 2MC8A 5IG3A 1EKMA 1RJOA 3E99A 3KN4A 3NM2A 1WMOA 1SIIA 3RGRA 4TX4A 3QRDA 4HJLB 3VSYA 3ZG0A 2F86B 1DMNA 1GY6A 1LOWA 4HM8B 3B4PA 3WR2A 1C54A 1RCKA 2K0MA 2OQEA 1VQM3 2WOHA 3WDGB 1BNRA 3KZTA 3X3ZA 1YIT3 3HOHA 3LH4A 5AYSC 1I2GA 3FG3A 4EC6A 1NWWA 3X40A 1Q42A 1U5OA 2Z6BA 1D6ZA 3B4OA 3NUVA 1KSIA 2O9UX 1N8QA 1S5AA 3SXXA 2E2TA 4MMYB 6STDA 1RNBA 1X1XA 5FGOA 4MMXB 1Q40A 2ML6A 1K9M4 1DE3A 1BRGA 1E97A 3BLZA 4O3VA 1WNHA 1GMQA 4XDWA 3EBTA 5CLKA 1TP6A 1G02A 2BO9B 3Q90A 1IU7A 1KC84 1JV2B 2AADA 1T2IA 1Z1SA 4HZBB 4AKZA 2CG0A 3A76A 3I0YA 1STDA 2XFTA 5CF1A 1ULIB 1CQSA 1W6CA 2YFLB 4EV5A 4BL2A 4OVMA 1JZOA 1OGXA 2GSPA 1RKYA 2D1WA 1UCLA 1F8NA 2CFGA 3AHSA 4K1UA 4Q53A 3CXC2 1Q40B 3EN1B 2OTL3 2BU4A 1BRSA 4LYLB 3EB8A 3JUOA 3CCL3 3EC9A 4HVNA 2IUJA 1UGIA 3KCHA 3KE7A 1BNJA 3MG1A 1GOYA 4ZM8A 1YJW3 2GU1A 3ALAA 3FGYA 1FGMA 4RNZA 1N9JA 2CX1A 1AQZA 4NPBA 1OF5A 2AAEA 3G8ZA 2IA7A 4KFDA 2RGQA 2M7OA 5JPPA 3O8YA 1V74A 2CFDA 1LQGC 2XFSA 3N8BA 4LGQA 3LXUX 1HKXA 1BRKA 1JRQA 1ROVA 1LQMB 1L5GB 1EQKA 3F8XA 5STDA 5BU4A 4BTXA 1V57A 4QWTA 2JQ5A 1WMNA 1OF5B 3DGNA 4N6UA 5CXOA 8RNTA 1KD14 1QJGA 1VQP3 1JKGA 2PNCA 3LTBA 3NXJA 2UGIA 1QVF2 2K54A 3A5EA 1UI7A 2HMKB 3D3LA 1VQK3 3ECFA 1VQL3 1RDSA 2OQEC 1NB5I 1BNFA 2HMLB 1I3FA 4RZMA 4J5KA 2BMQB 1RCLA 2CKFB 4I4KA 4WYKA 5DRVA 3SEDA 3V99A 5IG5A 2ZHXB 7STDA 1TU5A 3CPOA 4KZ1A 1ROAA 1S723 1JKGB 2HMJB 1GOVA 4K1VA 2WOFA 3H3HA 2O3OA 5A0OB 3X41A 3EBYA 3BNCA 1BRNL 3N9HA 3HZPA 1TRQA 1X1WA 2QIYA 3FSDA 3JUMA 2WO0A 1FYSA 2W2CA 4WYKB 3DGYA 1Q7HA 4I5QA 1RHLA 1LVNA 1YJ93 5AIIA 1LOXA 4LMIA 1I2FA 3KSPA 3NBBA 1G0TA 1A2VA 3K63A 4HAAA 5BXQA 1I3IA 2UX0A 1WTHA 3FG4A 4FMBA 1NNVA 1BNIA 1LNHA 3GWRA 2XF3A 3SX1A 1UDII 1YHQ3 1RLSA 3HX8A 3WOFB 1I0XA 3G16A 1IVUA 3ER7A 1KWIA 3DM8A 1B2UA 1GY5A 3M8CA 3SLUA 1NB3I 1VQ83 1D6UA 4XBXA 5LC6A 1CEWI 2CWVA 2FNQA 1X1YA 5DREA 1Q9EA 5G1KA 3J7Yd 3JVCA 3T8UA 1RN4A 3HI7A 3HIIA 2SARA 3DZLA 2K3DA 3UJMA 2JDIH 1FGOA 3FF2A 4J9AA 3STDA 5EEOA 4HM1B 2KF6A 4XBTA 4EXRA 1M1K4 1BSEA 3K0ZA 2W03A 2HMOB 3EJVA 1ZX2A 4GL6A 4RNYA 2QA43 1BSBA 2E2UA 2F56A 3UB1A 2BNGA 5M18A 4XM4A 1Q864 4K61A 2BT3A 1RTUA 4KVHA 2QEX3 4R9LA 5AIHA 5EVHA 1UW1A 2H0GA 1YGWA 2CC3A 4RNTA 3CCM3 5JBSA 3F7XA 3NV0A 4L7KA 1E3RA 4RBNA 1R4CA 1T5YA 2GU3A 1Q824 4N6OB 1FUWA 1O7WB 2I9WA 1LNIA 2CFLA 3CU3A 2FXTA 1AR0A 2XGNA 3KSED 1JN5A 4WFOA 1RGFA 3PYJA 3DH2A 2MF7A 3SVAA 1IVXA 4R9KA 1DVDA 4AKYA 3QK9A 5IG4A 1BSAA 3OV4A 5AIGA 1B2SA 4HOHA 1K28A 3AGOA 3WA2X 3D79A 3I553 4XBYA 1BUQA 1BOXA 1JN5B 1TUHA 4IT7A 5ELUA 2CG1A 3Q3FA 3U97A 3CCQ3 2CH9A 5TGNA 2CWUA 4OUQA 2ZA4A 2Y73A 4MJDA 2XSOB 1W6GA 5D81A 3ZFZA 3CC23 4HYZA 2BIRA 3OXAA 1EEJA 1EG9B 2RCDA 2KF4A 3TDGA 3EE1A 5IERA 1GD3A 2OOVC 3D5GA 1BNSA 3BU4A 2KXGA 4N6NB 1HU9A 1BSCA 1OACA 2CFWA 3NX0A 1HYFA 2ML5A 4G1MB 5IEOA 4EBGA 1I2EA 4EV2A 3CCV3 1X1UA 6RNTA 1AV4A 2INXA 2D42A 1B20A 3MKIA 1GOUA 3V92A 3AMOA 3X42A 4J5GA 4BTWA 2IUKA 4KFEA 4ORLA 4HBRA 1B2XA 1RGAA 3F9SA 5IW9A 1NJI4 2B24B 1BUJA 4IIAA 2OTJ3 4CPKA 1IQXA 4HKVB 1BRJA 3G6E3 3F7SA 1BGSA 2YX9A 1W2ZA 3G0KA 5RNTA 3NQYA 3S27A 3LT8A 3GRDA 1BSDA 2GBXB 2WGQA 1SIHA 5HOHA 1T2HA 1QALA 3AMOB 2IYJA 3FKAA 2OWPA 4FCJA 4FCZA 3EN8A 2SBLA 1N5PA 3MWZA 4HM3B 5CK6A 2R41A 2CWTA 4FMDA 1I0VA 1IV7A 4HM6B 4R1KA 1A2PA 2IMJA 1QMAA 3MG2A 4NREA 5I97A 3CC43 2E2VA 1W02A 2C10A 3CCS3 3KKGA 3CME3 5M1AA 3WA3A 3BNBA 4FMAA 4XB5A 2OCTA 1K8A4 2QGUA 1RGCA 2LYXA 4N3VA 5EQLA 1JB2A 1OGZA 2KAAA 1SARA 1NDOB 3LTCA 5AYRB 3FH1A 1FGTA 3NM7A 3JUQA 3CCE3 1RSNA 1O7MB 1B2ZA 1FA3A 4H61A 1B21A 1OPYA 1TJDA 4O02B 3CNXA 3ROBA 3K7CA 1FZUA 1RN7A 1JBSA 3NHXA 1RGHA 1GMPA 1IDPA 1ASKA 1BVIA 1A67A 1MGWA 1MNLA 3U1WA 1RNTA 4BTYA 1IYYA 1WQLB 4KT3B 1A2KA 1B27A 3GSPA 1NO3A 1JNQA 1VQ73 1O7GB 3GZRA 1JBTA 4N6LA 1K41A 1ZO2A 5IG0A 4HM2B 4CCVA 3PZWA 1RGLA 1RGGA 1B3SA 2HMMB 3F14A 3LZAA 1GS3A 4BIRA 7GSPA 4ILFA 1M904 1RRLA 2CIUA 3T8NA 1O7NB 2IY2A 1YJN3 4NHFA 1VQ53 3ZG5A 1EUIC 3RGAA 3CCJ3 2BHMA 3CC73 2RNTA 4KFFA 3HK4A 1M9GA 2WGOA 1VQO3 1US1A 1BU4A 1OUNA 2XEPA 1ISKA 5IENA 5JPUA 1R4YA 1AY7A 1YNVX 1GSPA 2GBWB 3FZWA 4AEQA 5CF2A 1O7HB 1LXEA 2C4BA 3Q2PA 5AI1A 2XH9A 4EYCA 3G713 3JUNA 1W2B2 4LZIA 1N5HA 1IQYA 2B1XB 1OCVA 4N6TA 1RRHA 2Q07A 3H51A 5AIFA 3URPA 1GY7A 3MYTA 1UUWB 2R4IA 4MEIA 4JF8A 4HZ9B 3PS8A 1VQ43 3CMA3 1BAOA 1D6YA 1DMMA 3AGNA 3CNMA 1ULJB 4X2HA 2RFRA 5BIRA 4H3UA 3RDEA 4DKIA 1WMPA 2XRXB 1DYUA 4GHOA 3OW22 1LOYA 2CX0A 2F99A 3B7CA 4OK0A 2Z76A 1JBRA 4BL3A 3IJEB 2KF3A 3LMLA 4GB5A
chains in the Genus database with same CATH topology
1I3FA 4GSPA 4J5KA 1RCLA 1B20A 9RNTA 1GOUA 4J5GA 1YVSA 1B2XA 1RGAA 1BUJA 1GOVA 2F5WA 1PYLA 1DETA 3SYUA 1BRJA 1BGSA 1BRNL 5RNTA 1TRQA 1X1WA 3AHWA 1BSDA 1FYSA 1FUSA 3DGYA 5HOHA 1RN1A 1T2HA 1RHLA 1MGRA 1I2FA 1LOVA 4HAAA 1I0VA 1A2PA 1I3IA 1I70A 1BNIA 1ZGXA 2RBIA 3D4AA 1RLSA 1RGCA 1HZ1A 1I0XA 1LOWA 3WR2A 1B2UA 2KAAA 1C54A 1SARA 1RCKA 1LRAA 3D5IA 1BNRA 1X1YA 1Q9EA 1RSNA 3HOHA 1RMSA 1B2ZA 1RN4A 1I2GA 1B21A 1BNEA 2SARA 1FZUA 1JBSA 1RGHA 1GMPA 1I8VA 4BU4A 1BVIA 2KF6A 1MGWA 1BSEA 1IYYA 1RNTA 1RNBA 1BANA 1FUTA 2F5MA 1X1XA 1B27A 3GSPA 1BSBA 1DE3A 2F56A 1BRGA 1GMQA 2F4YA 1UCJA 1JBTA 1RTUA 5GSPA 1G02A 1RGLA 2AADA 1T2IA 1RGEA 1RGGA 1B3SA 1UCKA 1YGWA 4RNTA 7GSPA 4BIRA 1FW7A 2GSPA 6GSPA 1LNIA 1UCLA 1B2MA 3AHSA 1RGFA 2BU4A 1BRSA 3DH2A 2RNTA 1BIRA 1TRPA 3KCHA 1BNJA 1PY3A 1GOYA 1BU4A 1BSAA 1B2SA 4HOHA 1AQZA 1R4YA 2KF5A 7RNTA 1AY7A 1YNVX 2AAEA 3AGOA 1BNGA 1BRIA 1GSPA 1GMRA 2C4BA 1BOXA 1BRHA 1UCIA 1BRKA 3Q3FA 2HOHA 3URPA 5BU4A 1CH0A 2ZA4A 3RNTA 2BIRA 2KF4A 1BAOA 3BIRA 8RNTA 3AGNA 3WHOA 3D5GA 5BIRA 1BNSA 3BU4A 4GHOA 1LOYA 1BSCA 1RGKA 3A5EA 1HYFA 1JBRA 1I2EA 1RDSA 1TTOA 2KF3A 1X1UA 6RNTA 1BNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3F A;  4GSP A;  4J5K A;  1RCL A;  1B20 A;  9RNT A;  1GOU A;  4J5G A;  1YVS A;  1B2X A;  1RGA A;  1BUJ A;  1GOV A;  2F5W A;  1PYL A;  1DET A;  3SYU A;  1BRJ A;  1BGS A;  1BRN L;  5RNT A;  1TRQ A;  1X1W A;  3AHW A;  1BSD A;  1FYS A;  1FUS A;  3DGY A;  5HOH A;  1RN1 A;  1T2H A;  1RHL A;  1MGR A;  1I2F A;  1LOV A;  4HAA A;  1I0V A;  1A2P A;  1I3I A;  1I70 A;  1BNI A;  1ZGX A;  2RBI A;  3D4A A;  1RLS A;  1RGC A;  1HZ1 A;  1I0X A;  1LOW A;  3WR2 A;  1B2U A;  2KAA A;  1C54 A;  1SAR A;  1RCK A;  1LRA A;  3D5I A;  1BNR A;  1X1Y A;  1Q9E A;  1RSN A;  3HOH A;  1RMS A;  1B2Z A;  1RN4 A;  1I2G A;  1B21 A;  1BNE A;  2SAR A;  1FZU A;  1JBS A;  1RGH A;  1GMP A;  1I8V A;  4BU4 A;  1BVI A;  2KF6 A;  1MGW A;  1BSE A;  1IYY A;  1RNT A;  1RNB A;  1BAN A;  1FUT A;  2F5M A;  1X1X A;  1B27 A;  3GSP A;  1BSB A;  1DE3 A;  2F56 A;  1BRG A;  1GMQ A;  2F4Y A;  1UCJ A;  1JBT A;  1RTU A;  5GSP A;  1G02 A;  1RGL A;  2AAD A;  1T2I A;  1RGE A;  1RGG A;  1B3S A;  1UCK A;  1YGW A;  4RNT A;  7GSP A;  4BIR A;  1FW7 A;  2GSP A;  6GSP A;  1LNI A;  1UCL A;  1B2M A;  3AHS A;  1RGF A;  2BU4 A;  1BRS A;  3DH2 A;  2RNT A;  1BIR A;  1TRP A;  3KCH A;  1BNJ A;  1PY3 A;  1GOY A;  1BU4 A;  1BSA A;  1B2S A;  4HOH A;  1AQZ A;  1R4Y A;  2KF5 A;  7RNT A;  1AY7 A;  1YNV X;  2AAE A;  3AGO A;  1BNG A;  1BRI A;  1GSP A;  1GMR A;  2C4B A;  1BOX A;  1BRH A;  1UCI A;  1BRK A;  3Q3F A;  2HOH A;  3URP A;  5BU4 A;  1CH0 A;  2ZA4 A;  3RNT A;  2BIR A;  2KF4 A;  1BAO A;  3BIR A;  8RNT A;  3AGN A;  3WHO A;  3D5G A;  5BIR A;  1BNS A;  3BU4 A;  4GHO A;  1LOY A;  1BSC A;  1RGK A;  3A5E A;  1HYF A;  1JBR A;  1I2E A;  1RDS A;  1TTO A;  2KF3 A;  1X1U A;  6RNT A;  1BNF A; 
#chains in the Genus database with same CATH topology
 3NV0 B;  1MWR A;  1UGH I;  1A90 A;  4JRF A;  1UUG B;  1YVS A;  4WHA A;  3CCR 3;  3K5T A;  3DUK A;  4K90 B;  3NQZ A;  1JJ2 2;  4HM7 B;  3Q1C A;  3PXM A;  3SYU A;  2KRT A;  4EW5 A;  1AVL A;  3S67 A;  2GEX A;  1E3V A;  2PZV A;  2Z77 A;  1IV9 A;  2UUG C;  1YI2 3;  5LC7 A;  3SOY A;  3LT9 A;  2W04 A;  3DMC A;  3JUP A;  1IT7 A;  4L8O A;  1G96 A;  4FR9 A;  4U13 A;  3BB9 A;  3GZX B;  1MGR A;  5G1L A;  3G4S 3;  3NBJ A;  3CD6 3;  1Q7Y 4;  2XR8 B;  3MSO A;  4J8T A;  4X2O A;  3EX9 A;  1O7P B;  2BMR B;  1ZGX A;  2RBI A;  1MWU A;  1TIJ A;  3OWS A;  4HM5 B;  2RSX A;  2V1L A;  1IVW A;  3D4A A;  4FCM A;  3S5C A;  2P05 A;  4R80 A;  2W0Q A;  1HZ1 A;  1W00 A;  2W9Q A;  3V98 A;  4LSO A;  1OHO A;  1IQ8 A;  3X3Y A;  3LTD A;  2CK3 H;  1EA2 A;  1LRA A;  3D5I A;  5ELJ A;  3X3X A;  2C11 A;  1RMS A;  1W4N A;  4O8S A;  5KP1 A;  2P0X A;  2GXF A;  2L4V A;  3LTA A;  3F8H A;  1BNE A;  3LOY A;  4MMZ B;  3DXO A;  3T0U A;  3SOA A;  2CW9 A;  1KQS 2;  3K9M C;  2CHC A;  1I8V A;  2KCD A;  3L0R A;  2ZDJ A;  1IK3 A;  4BU4 A;  1DVC A;  1W5Z A;  2Z7A A;  4L8P A;  3KII A;  3PCS A;  1BAN A;  1FUT A;  2F5M A;  3FF0 A;  3CCU 3;  3GZB A;  3WMD A;  2F4Y A;  3EHC A;  1UCJ A;  1W6Y A;  1PU4 A;  1FGR A;  5GSP A;  3NBR A;  1CYV A;  1RGE A;  3DGL A;  3IMA B;  1SQW A;  1UCK A;  4HM4 B;  8CHO A;  4STD A;  5G2G A;  3GAX A;  4XDV A;  3MHE A;  2L1S A;  4CJN A;  4LEH A;  1N9E A;  1FW7 A;  1GYB A;  2GEY A;  3F40 A;  3KFQ C;  6GSP A;  4IPB A;  1B2M A;  1TFK A;  3VF1 A;  1OH0 A;  2YFJ B;  1W7C A;  3OWY A;  5IEP A;  1Y4K A;  1ZS7 A;  3BNE A;  5KP3 A;  4CDL A;  1BIR A;  1TRP A;  1PY3 A;  4N6M A;  1J2B A;  1MWT A;  2ZL8 A;  3PGB A;  3BND A;  2KF5 A;  1JZD A;  3VGN A;  7RNT A;  1BNG A;  1BRI A;  3PCR A;  1GMR A;  1N8R 4;  5BVB A;  3DGO A;  3FG1 A;  3MG3 A;  5M19 A;  1BRH A;  1MOL A;  2BMO B;  3UNL A;  4FMC A;  1VQN 3;  2P0M A;  1AVK A;  1PFP A;  5KP4 A;  1UCI A;  2P38 A;  2H0H A;  2XGL A;  1CH0 A;  4PEJ A;  3WOE B;  4WWU C;  3RNT A;  2Y74 A;  5FW5 A;  1U8C B;  1YGE A;  2J8X B;  3BIR A;  1JB4 A;  2F98 A;  2W9P A;  5AEW B;  2W6J H;  1FGQ A;  3WHO A;  1VQ6 3;  1MWS A;  4R4K A;  3HIG A;  1OHS A;  1W01 A;  1V58 A;  3MPH A;  1M1X B;  3WOD G;  1RGK A;  1VQQ A;  3FCS B;  1TTO A;  2H0I A;  1CYU A;  3EQQ B;  2HOH A;  2A15 A;  1STF I;  2W56 A;  1UI8 A;  1YIJ 3;  3I56 3;  4GSP A;  9RNT A;  3B8L A;  3GZY B;  1YVB I;  1C7H A;  1T3B A;  2CFK A;  3LYG A;  2OOV A;  1IVV A;  1VQ9 3;  1SPU A;  1SJW A;  3OWU A;  4O2H A;  2LQV A;  2F5W A;  1PYL A;  1DET A;  2STD A;  2HMN B;  3OX9 A;  1NU3 A;  1QAK A;  3D9R A;  5IF6 A;  3CPW 2;  1TFO A;  1IT8 A;  5D82 A;  3AHW A;  3FLJ A;  4HM0 B;  1DMQ A;  1OHP A;  3N54 B;  2W56 B;  1JB5 A;  5D83 A;  3S29 A;  2YFI B;  1VZZ A;  1FUS A;  3DY5 A;  3S28 A;  3UL6 A;  1RN1 A;  1Q81 4;  1QAF A;  5HGR A;  1K73 4;  3DGM A;  1QVG 2;  2P09 A;  2XSH B;  1LOV A;  3IPT A;  1GD4 A;  1I70 A;  3UL5 A;  4N6V 0;  3EF8 A;  1UUV B;  5AEU B;  2FGT A;  4WP5 A;  2MC8 A;  5IG3 A;  1EKM A;  1RJO A;  3E99 A;  3KN4 A;  3NM2 A;  1WMO A;  1SII A;  3RGR A;  4TX4 A;  3QRD A;  4HJL B;  3VSY A;  3ZG0 A;  2F86 B;  1DMN A;  1GY6 A;  1LOW A;  4HM8 B;  3B4P A;  3WR2 A;  1C54 A;  1RCK A;  2K0M A;  2OQE A;  1VQM 3;  2WOH A;  3WDG B;  1BNR A;  3KZT A;  3X3Z A;  1YIT 3;  3HOH A;  3LH4 A;  5AYS C;  1I2G A;  3FG3 A;  4EC6 A;  1NWW A;  3X40 A;  1Q42 A;  1U5O A;  2Z6B A;  1D6Z A;  3B4O A;  3NUV A;  1KSI A;  2O9U X;  1N8Q A;  1S5A A;  3SXX A;  2E2T A;  4MMY B;  6STD A;  1RNB A;  1X1X A;  5FGO A;  4MMX B;  1Q40 A;  2ML6 A;  1K9M 4;  1DE3 A;  1BRG A;  1E97 A;  3BLZ A;  4O3V A;  1WNH A;  1GMQ A;  4XDW A;  3EBT A;  5CLK A;  1TP6 A;  1G02 A;  2BO9 B;  3Q90 A;  1IU7 A;  1KC8 4;  1JV2 B;  2AAD A;  1T2I A;  1Z1S A;  4HZB B;  4AKZ A;  2CG0 A;  3A76 A;  3I0Y A;  1STD A;  2XFT A;  5CF1 A;  1ULI B;  1CQS A;  1W6C A;  2YFL B;  4EV5 A;  4BL2 A;  4OVM A;  1JZO A;  1OGX A;  2GSP A;  1RKY A;  2D1W A;  1UCL A;  1F8N A;  2CFG A;  3AHS A;  4K1U A;  4Q53 A;  3CXC 2;  1Q40 B;  3EN1 B;  2OTL 3;  2BU4 A;  1BRS A;  4LYL B;  3EB8 A;  3JUO A;  3CCL 3;  3EC9 A;  4HVN A;  2IUJ A;  1UGI A;  3KCH A;  3KE7 A;  1BNJ A;  3MG1 A;  1GOY A;  4ZM8 A;  1YJW 3;  2GU1 A;  3ALA A;  3FGY A;  1FGM A;  4RNZ A;  1N9J A;  2CX1 A;  1AQZ A;  4NPB A;  1OF5 A;  2AAE A;  3G8Z A;  2IA7 A;  4KFD A;  2RGQ A;  2M7O A;  5JPP A;  3O8Y A;  1V74 A;  2CFD A;  1LQG C;  2XFS A;  3N8B A;  4LGQ A;  3LXU X;  1HKX A;  1BRK A;  1JRQ A;  1ROV A;  1LQM B;  1L5G B;  1EQK A;  3F8X A;  5STD A;  5BU4 A;  4BTX A;  1V57 A;  4QWT A;  2JQ5 A;  1WMN A;  1OF5 B;  3DGN A;  4N6U A;  5CXO A;  8RNT A;  1KD1 4;  1QJG A;  1VQP 3;  1JKG A;  2PNC A;  3LTB A;  3NXJ A;  2UGI A;  1QVF 2;  2K54 A;  3A5E A;  1UI7 A;  2HMK B;  3D3L A;  1VQK 3;  3ECF A;  1VQL 3;  1RDS A;  2OQE C;  1NB5 I;  1BNF A;  2HML B;  1I3F A;  4RZM A;  4J5K A;  2BMQ B;  1RCL A;  2CKF B;  4I4K A;  4WYK A;  5DRV A;  3SED A;  3V99 A;  5IG5 A;  2ZHX B;  7STD A;  1TU5 A;  3CPO A;  4KZ1 A;  1ROA A;  1S72 3;  1JKG B;  2HMJ B;  1GOV A;  4K1V A;  2WOF A;  3H3H A;  2O3O A;  5A0O B;  3X41 A;  3EBY A;  3BNC A;  1BRN L;  3N9H A;  3HZP A;  1TRQ A;  1X1W A;  2QIY A;  3FSD A;  3JUM A;  2WO0 A;  1FYS A;  2W2C A;  4WYK B;  3DGY A;  1Q7H A;  4I5Q A;  1RHL A;  1LVN A;  1YJ9 3;  5AII A;  1LOX A;  4LMI A;  1I2F A;  3KSP A;  3NBB A;  1G0T A;  1A2V A;  3K63 A;  4HAA A;  5BXQ A;  1I3I A;  2UX0 A;  1WTH A;  3FG4 A;  4FMB A;  1NNV A;  1BNI A;  1LNH A;  3GWR A;  2XF3 A;  3SX1 A;  1UDI I;  1YHQ 3;  1RLS A;  3HX8 A;  3WOF B;  1I0X A;  3G16 A;  1IVU A;  3ER7 A;  1KWI A;  3DM8 A;  1B2U A;  1GY5 A;  3M8C A;  3SLU A;  1NB3 I;  1VQ8 3;  1D6U A;  4XBX A;  5LC6 A;  1CEW I;  2CWV A;  2FNQ A;  1X1Y A;  5DRE A;  1Q9E A;  5G1K A;  3J7Y d;  3JVC A;  3T8U A;  1RN4 A;  3HI7 A;  3HII A;  2SAR A;  3DZL A;  2K3D A;  3UJM A;  2JDI H;  1FGO A;  3FF2 A;  4J9A A;  3STD A;  5EEO A;  4HM1 B;  2KF6 A;  4XBT A;  4EXR A;  1M1K 4;  1BSE A;  3K0Z A;  2W03 A;  2HMO B;  3EJV A;  1ZX2 A;  4GL6 A;  4RNY A;  2QA4 3;  1BSB A;  2E2U A;  2F56 A;  3UB1 A;  2BNG A;  5M18 A;  4XM4 A;  1Q86 4;  4K61 A;  2BT3 A;  1RTU A;  4KVH A;  2QEX 3;  4R9L A;  5AIH A;  5EVH A;  1UW1 A;  2H0G A;  1YGW A;  2CC3 A;  4RNT A;  3CCM 3;  5JBS A;  3F7X A;  3NV0 A;  4L7K A;  1E3R A;  4RBN A;  1R4C A;  1T5Y A;  2GU3 A;  1Q82 4;  4N6O B;  1FUW A;  1O7W B;  2I9W A;  1LNI A;  2CFL A;  3CU3 A;  2FXT A;  1AR0 A;  2XGN A;  3KSE D;  1JN5 A;  4WFO A;  1RGF A;  3PYJ A;  3DH2 A;  2MF7 A;  3SVA A;  1IVX A;  4R9K A;  1DVD A;  4AKY A;  3QK9 A;  5IG4 A;  1BSA A;  3OV4 A;  5AIG A;  1B2S A;  4HOH A;  1K28 A;  3AGO A;  3WA2 X;  3D79 A;  3I55 3;  4XBY A;  1BUQ A;  1BOX A;  1JN5 B;  1TUH A;  4IT7 A;  5ELU A;  2CG1 A;  3Q3F A;  3U97 A;  3CCQ 3;  2CH9 A;  5TGN A;  2CWU A;  4OUQ A;  2ZA4 A;  2Y73 A;  4MJD A;  2XSO B;  1W6G A;  5D81 A;  3ZFZ A;  3CC2 3;  4HYZ A;  2BIR A;  3OXA A;  1EEJ A;  1EG9 B;  2RCD A;  2KF4 A;  3TDG A;  3EE1 A;  5IER A;  1GD3 A;  2OOV C;  3D5G A;  1BNS A;  3BU4 A;  2KXG A;  4N6N B;  1HU9 A;  1BSC A;  1OAC A;  2CFW A;  3NX0 A;  1HYF A;  2ML5 A;  4G1M B;  5IEO A;  4EBG A;  1I2E A;  4EV2 A;  3CCV 3;  1X1U A;  6RNT A;  1AV4 A;  2INX A;  2D42 A;  1B20 A;  3MKI A;  1GOU A;  3V92 A;  3AMO A;  3X42 A;  4J5G A;  4BTW A;  2IUK A;  4KFE A;  4ORL A;  4HBR A;  1B2X A;  1RGA A;  3F9S A;  5IW9 A;  1NJI 4;  2B24 B;  1BUJ A;  4IIA A;  2OTJ 3;  4CPK A;  1IQX A;  4HKV B;  1BRJ A;  3G6E 3;  3F7S A;  1BGS A;  2YX9 A;  1W2Z A;  3G0K A;  5RNT A;  3NQY A;  3S27 A;  3LT8 A;  3GRD A;  1BSD A;  2GBX B;  2WGQ A;  1SIH A;  5HOH A;  1T2H A;  1QAL A;  3AMO B;  2IYJ A;  3FKA A;  2OWP A;  4FCJ A;  4FCZ A;  3EN8 A;  2SBL A;  1N5P A;  3MWZ A;  4HM3 B;  5CK6 A;  2R41 A;  2CWT A;  4FMD A;  1I0V A;  1IV7 A;  4HM6 B;  4R1K A;  1A2P A;  2IMJ A;  1QMA A;  3MG2 A;  4NRE A;  5I97 A;  3CC4 3;  2E2V A;  1W02 A;  2C10 A;  3CCS 3;  3KKG A;  3CME 3;  5M1A A;  3WA3 A;  3BNB A;  4FMA A;  4XB5 A;  2OCT A;  1K8A 4;  2QGU A;  1RGC A;  2LYX A;  4N3V A;  5EQL A;  1JB2 A;  1OGZ A;  2KAA A;  1SAR A;  1NDO B;  3LTC A;  5AYR B;  3FH1 A;  1FGT A;  3NM7 A;  3JUQ A;  3CCE 3;  1RSN A;  1O7M B;  1B2Z A;  1FA3 A;  4H61 A;  1B21 A;  1OPY A;  1TJD A;  4O02 B;  3CNX A;  3ROB A;  3K7C A;  1FZU A;  1RN7 A;  1JBS A;  3NHX A;  1RGH A;  1GMP A;  1IDP A;  1ASK A;  1BVI A;  1A67 A;  1MGW A;  1MNL A;  3U1W A;  1RNT A;  4BTY A;  1IYY A;  1WQL B;  4KT3 B;  1A2K A;  1B27 A;  3GSP A;  1NO3 A;  1JNQ A;  1VQ7 3;  1O7G B;  3GZR A;  1JBT A;  4N6L A;  1K41 A;  1ZO2 A;  5IG0 A;  4HM2 B;  4CCV A;  3PZW A;  1RGL A;  1RGG A;  1B3S A;  2HMM B;  3F14 A;  3LZA A;  1GS3 A;  4BIR A;  7GSP A;  4ILF A;  1M90 4;  1RRL A;  2CIU A;  3T8N A;  1O7N B;  2IY2 A;  1YJN 3;  4NHF A;  1VQ5 3;  3ZG5 A;  1EUI C;  3RGA A;  3CCJ 3;  2BHM A;  3CC7 3;  2RNT A;  4KFF A;  3HK4 A;  1M9G A;  2WGO A;  1VQO 3;  1US1 A;  1BU4 A;  1OUN A;  2XEP A;  1ISK A;  5IEN A;  5JPU A;  1R4Y A;  1AY7 A;  1YNV X;  1GSP A;  2GBW B;  3FZW A;  4AEQ A;  5CF2 A;  1O7H B;  1LXE A;  2C4B A;  3Q2P A;  5AI1 A;  2XH9 A;  4EYC A;  3G71 3;  3JUN A;  1W2B 2;  4LZI A;  1N5H A;  1IQY A;  2B1X B;  1OCV A;  4N6T A;  1RRH A;  2Q07 A;  3H51 A;  5AIF A;  3URP A;  1GY7 A;  3MYT A;  1UUW B;  2R4I A;  4MEI A;  4JF8 A;  4HZ9 B;  3PS8 A;  1VQ4 3;  3CMA 3;  1BAO A;  1D6Y A;  1DMM A;  3AGN A;  3CNM A;  1ULJ B;  4X2H A;  2RFR A;  5BIR A;  4H3U A;  3RDE A;  4DKI A;  1WMP A;  2XRX B;  1DYU A;  4GHO A;  3OW2 2;  1LOY A;  2CX0 A;  2F99 A;  3B7C A;  4OK0 A;  2Z76 A;  1JBR A;  4BL3 A;  3IJE B;  2KF3 A;  3LML A;  4GB5 A; 
#chains in the Genus database with same CATH homology
 1I3F A;  4GSP A;  4J5K A;  1RCL A;  1B20 A;  9RNT A;  1GOU A;  4J5G A;  1YVS A;  1B2X A;  1RGA A;  1BUJ A;  1GOV A;  2F5W A;  1PYL A;  1DET A;  3SYU A;  1BRJ A;  1BGS A;  1BRN L;  5RNT A;  1TRQ A;  1X1W A;  3AHW A;  1BSD A;  1FYS A;  1FUS A;  3DGY A;  5HOH A;  1RN1 A;  1T2H A;  1RHL A;  1MGR A;  1I2F A;  1LOV A;  4HAA A;  1I0V A;  1A2P A;  1I3I A;  1I70 A;  1BNI A;  1ZGX A;  2RBI A;  3D4A A;  1RLS A;  1RGC A;  1HZ1 A;  1I0X A;  1LOW A;  3WR2 A;  1B2U A;  2KAA A;  1C54 A;  1SAR A;  1RCK A;  1LRA A;  3D5I A;  1BNR A;  1X1Y A;  1Q9E A;  1RSN A;  3HOH A;  1RMS A;  1B2Z A;  1RN4 A;  1I2G A;  1B21 A;  1BNE A;  2SAR A;  1FZU A;  1JBS A;  1RGH A;  1GMP A;  1I8V A;  4BU4 A;  1BVI A;  2KF6 A;  1MGW A;  1BSE A;  1IYY A;  1RNT A;  1RNB A;  1BAN A;  1FUT A;  2F5M A;  1X1X A;  1B27 A;  3GSP A;  1BSB A;  1DE3 A;  2F56 A;  1BRG A;  1GMQ A;  2F4Y A;  1UCJ A;  1JBT A;  1RTU A;  5GSP A;  1G02 A;  1RGL A;  2AAD A;  1T2I A;  1RGE A;  1RGG A;  1B3S A;  1UCK A;  1YGW A;  4RNT A;  7GSP A;  4BIR A;  1FW7 A;  2GSP A;  6GSP A;  1LNI A;  1UCL A;  1B2M A;  3AHS A;  1RGF A;  2BU4 A;  1BRS A;  3DH2 A;  2RNT A;  1BIR A;  1TRP A;  3KCH A;  1BNJ A;  1PY3 A;  1GOY A;  1BU4 A;  1BSA A;  1B2S A;  4HOH A;  1AQZ A;  1R4Y A;  2KF5 A;  7RNT A;  1AY7 A;  1YNV X;  2AAE A;  3AGO A;  1BNG A;  1BRI A;  1GSP A;  1GMR A;  2C4B A;  1BOX A;  1BRH A;  1UCI A;  1BRK A;  3Q3F A;  2HOH A;  3URP A;  5BU4 A;  1CH0 A;  2ZA4 A;  3RNT A;  2BIR A;  2KF4 A;  1BAO A;  3BIR A;  8RNT A;  3AGN A;  3WHO A;  3D5G A;  5BIR A;  1BNS A;  3BU4 A;  4GHO A;  1LOY A;  1BSC A;  1RGK A;  3A5E A;  1HYF A;  1JBR A;  1I2E A;  1RDS A;  1TTO A;  2KF3 A;  1X1U A;  6RNT A;  1BNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...