1BOXA

N39s mutant of rnase sa from streptomyces aureofaciens
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
VSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQSRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Contribution of a conserved asparagine to the conformational stability of ribonucleases Sa, Ba, and T1.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 23
structure length 95
sequence length 95
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1boxA00
3WHOA 1B2MA 5HOHA 1BRSA 1AQZA 5GSPA 3AGOA 1GMQA 3Q3FA 1B21A 8RNTA 2ZA4A 1I0VA 2AAEA 1RGLA 1FUSA 2F4YA 1RGHA 1I70A 3BU4A 2C4BA 3HOHA 1Q9EA 3DH2A 1YGWA 1YVSA 1A2PA 1BRHA 1TTOA 1LOYA 3KCHA 1X1UA 6GSPA 1FZUA 1LNIA 3AGNA 3AHSA 1RGEA 1RNBA 1C54A 1RNTA 4HOHA 1BAOA 1LRAA 1RGAA 1RGFA 1BRJA 1B3SA 1RGGA 5BU4A 1SARA 4GSPA 1B2ZA 1RGCA 1FW7A 1MGWA 1HZ1A 1UCLA 4BIRA 1I2GA 1B2SA 2RNTA 1X1YA 1BNJA 1MGRA 3GSPA 1JBTA 1BNEA 9RNTA 1G02A 1I2FA 1BSEA 2BIRA 1BU4A 5RNTA 1DE3A 1RGKA 1R4YA 2F5MA 2KF6A 4HAAA 3SYUA 3AHWA 1UCJA 1GOUA 1ZGXA 5BIRA 1RCLA 1BNRA 1AY7A 1BANA 2RBIA 1RSNA 1BSBA 2HOHA 1PY3A 4GHOA 3WR2A 1JBSA 1I2EA 2KAAA 1UCIA 3BIRA 3D5GA 1B2UA 1GMPA 1TRPA 2BU4A 1GMRA 3D5IA 1FYSA 1HYFA 1I3FA 1RN4A 4J5KA 1TRQA 1T2IA 3DGYA 1BRNL 1RCKA 1UCKA 1B27A 1BNSA 1BNGA 1BSCA 1RTUA 2KF3A 1BNIA 1I3IA 4RNTA 1BRKA 1YNVX 1BGSA 1GSPA 1IYYA 2F56A 7RNTA 1GOYA 1BSAA 2KF5A 1RLSA 1BIRA 1RDSA 2F5WA 6RNTA 7GSPA 1BOXA 1I8VA 1LOVA 1T2HA 2KF4A 1BVIA 3A5EA 1RHLA 1GOVA 1X1XA 2SARA 1BSDA 1FUTA 3URPA 1RMSA 1DETA 1LOWA 4BU4A 1BRIA 3RNTA 1BRGA 1I0XA 3D4AA 1BUJA 1B20A 2GSPA 1X1WA 4J5GA 1B2XA 2AADA 1PYLA 1JBRA 1BNFA 1RN1A 1CH0A
chains in the Genus database with same CATH superfamily
1OH0A 1B2MA 5HOHA 4OK0A 3RGRA 1DMNA 5STDA 1VQP3 1D6YA 1YGEA 3HI7A 3CC73 3U97A 3QK9A 2STDA 3ECFA 2ZA4A 1I0VA 2LYXA 3F40A 1MWSA 5EQLA 1O7GB 4HM7B 3S28A 3WA2X 1Y4KA 3NQYA 4N6TA 1VQL3 1OGXA 3DH2A 3FH1A 4N6MA 1YGWA 1OF5A 4HZ9B 1VQ73 1BRHA 3L0RA 3AMOB 3X3ZA 1X1UA 4RNZA 1ZO2A 4AEQA 1Q864 1FZUA 2CWVA 3AGNA 3ALAA 3OV4A 1MWUA 1RNBA 1C54A 1RNTA 1BAOA 4MEIA 5AIFA 1OHPA 1LRAA 3EBTA 1WMPA 1W00A 1DMQA 1RGAA 5KP3A 3BNDA 1RGGA 4RBNA 4N6LA 5JPPA 3FGYA 1JB5A 3GZYB 1SARA 4FCMA 1LXEA 1FW7A 4HZBB 4BTWA 5IF6A 4HM5B 2JQ5A 2QIYA 1MGWA 2YFJB 1O7HB 1M9GA 1I2GA 2RNTA 1MOLA 3T0UA 1X1YA 1N8QA 1BNJA 3G8ZA 2H0IA 3GSPA 1LQGC 3LTBA 5G2GA 3K5TA 1MWRA 1OF5B 5RNTA 1DE3A 1UUVB 4BL2A 3BLZA 5IG4A 4FMAA 2F5MA 5KP1A 1EA2A 4FCJA 4EYCA 1YJ93 2LQVA 2L4VA 2BMRB 1RCLA 1LOXA 1N8R4 3CD63 3UL5A 2RBIA 3V92A 3CCE3 1BSBA 2HOHA 2CIUA 4GHOA 2XFSA 3CXC2 2I9WA 4J5GA 1DVDA 3RDEA 2BU4A 3MHEA 3U1WA 1Q814 1VQ93 4XM4A 1G96A 3OWUA 2F98A 3D5IA 1ROAA 4LZIA 3CC43 4HM8B 1A2VA 2FNQA 4WYKB 2QEX3 1A90A 4J5KA 1Q7HA 2HMKB 2BHMA 2XH9A 3K0ZA 2R4IA 2K3DA 1TP6A 1NJI4 1UCKA 3JUNA 3D3LA 2KCDA 3LTCA 3CPW2 1B27A 1BNGA 2KF3A 2Z7AA 2Y74A 3GZXB 1R4CA 2V1LA 3OX9A 1IQYA 4MJDA 5LC6A 3DGMA 1OUNA 2ML5A 5IERA 1BUQA 3BNCA 1BSAA 1TUHA 3MG1A 5AYSC 1NWWA 7GSPA 2F5WA 2XGNA 3CCM3 1LOVA 3CCV3 1Q40B 3CCU3 2KF4A 3MWZA 1K734 1N9EA 2SARA 1TIJA 5D81A 3JUPA 1Q7Y4 1RMSA 3IMAB 1EKMA 4K61A 5DRVA 3SX1A 1D6UA 2CFWA 1LOWA 4BU4A 3NBJA 2RCDA 1I0XA 1SJWA 3D4AA 2W04A 4I4KA 1KD14 4L8OA 2CX0A 1CYUA 1YJN3 5EEOA 1J2BA 5HGRA 1BNFA 3FF2A 2Y73A 4JF8A 1QMAA 4L7KA 1CH0A 1W2ZA 3CCS3 3F14A 2E2TA 1BRSA 1QJGA 3PCSA 3G713 3JVCA 3S67A 4KVHA 5GSPA 3AGOA 1CQSA 4OUQA 2YFIB 1GYBA 3SLUA 3IPTA 4K90B 1GD4A 5CK6A 1OACA 2AAEA 2GXFA 3G16A 4HJLB 1JRQA 1RGLA 2F4YA 2YFLB 1W02A 1RGHA 3GWRA 3HOHA 4LGQA 1S5AA 3PXMA 2W56B 3NV0A 3ZG0A 3LTAA 2BMOB 3F9SA 3VGNA 5IG5A 4PEJA 1GY7A 4EV5A 1YJW3 1YHQ3 1TTOA 5IEPA 1MNLA 1QAFA 3WOEB 3PGBA 3S27A 1GY5A 3PYJA 3UB1A 2OCTA 3VSYA 1LNHA 1N5HA 2CX1A 4JRFA 5JPUA 4IT7A 3DXOA 1ASKA 3CU3A 3HIGA 1EEJA 3SVAA 1NNVA 4XDWA 2CFDA 3B7CA 2CG1A 5AIHA 1A67A 3CCR3 5BU4A 1YI23 2R41A 2CW9A 1RGCA 4AKZA 4XBYA 3G6E3 1FGTA 2WGOA 3F8XA 1VQ63 2WOHA 3DM8A 3FZWA 1E97A 1UCLA 1HZ1A 4K1UA 1GS3A 1OPYA 4BIRA 2H0HA 2B1XB 5M1AA 1B2SA 3WODG 2QGUA 4AKYA 1Q42A 1EQKA 3WDGB 3GAXA 1JKGB 3KKGA 1AVLA 1U5OA 1JNQA 2HMOB 1IU7A 1RGKA 1NO3A 4CPKA 1Q824 2W9PA 4EW5A 3DGNA 1RRLA 1O7NB 2XR8B 3NXJA 4HAAA 1SIHA 1JB4A 3AHWA 1NDOB 5D82A 2OQEA 3X40A 5M19A 3MKIA 5IEOA 1FGRA 1KQS2 1KWIA 1BANA 3KIIA 3X3XA 1QALA 2CKFB 1M1XB 1JB2A 1JBSA 3B4OA 1UCIA 1GMPA 1G0TA 1TRPA 3EC9A 1GMRA 1OCVA 3HK4A 2GEYA 3JUOA 4MMZB 3KZTA 1FYSA 1RN4A 1UUWB 5IENA 3FSDA 3NX0A 2Q07A 1RCKA 4L8PA 4N3VA 4CDLA 2PNCA 3A76A 1TFKA 4NREA 1HU9A 4ZM8A 5KP4A 4EV2A 4RNTA 1BRKA 4X2OA 3BNBA 4HM1B 4R80A 3EE1A 1IT8A 1IV9A 7RNTA 3X42A 3K7CA 2ZHXB 1JN5A 4FMBA 4HKVB 1M1K4 3DUKA 1BOXA 1NB3I 3N8BA 2K0MA 4NPBA 1IT7A 1SQWA 2CFLA 3ZG5A 1DYUA 1FGQA 1BSDA 1FUTA 1JV2B 1X1XA 1VQN3 1PU4A 4KFDA 2ZL8A 1DETA 3NHXA 3STDA 1US1A 1F8NA 1JJ22 2XFTA 1VZZA 1BRIA 3DGOA 4OVMA 1UUGB 2W03A 1O7MB 5ELUA 1X1WA 2GBXB 4BL3A 4N6OB 1B2XA 1IK3A 2L1SA 1T3BA 4IIAA 1PYLA 2E2VA 4O2HA 1D6ZA 2Z77A 1IQXA 1K41A 3LXUX 3FCSB 3LH4A 3N54B 3WHOA 4RNYA 3DZLA 1ZS7A 1AQZA 3B8LA 1KSIA 1IVWA 1ZX2A 3X41A 1AR0A 5CXOA 5A0OB 1FGMA 1STFI 3NM7A 4GL6A 4DKIA 3G0KA 2MC8A 6STDA 1M904 3Q3FA 5CF2A 2D1WA 5I97A 3EQQB 4O3VA 2OTJ3 5IG3A 3LYGA 2A15A 2KRTA 3HX8A 3SEDA 3EX9A 1I70A 2CWUA 4MMXB 1Q9EA 3CCQ3 1IQ8A 3H3HA 2UX0A 2W9QA 1SPUA 1A2PA 3KCHA 1LOYA 1Z1SA 4X2HA 2J8XB 6GSPA 3LOYA 1FGOA 3NM2A 1LNIA 3O8YA 1VQM3 2CFKA 4BTYA 4HOHA 1UI7A 4N6V0 1VQO3 3MYTA 2RGQA 3S29A 3GRDA 2QA43 1QAKA 2OOVA 4U13A 4EXRA 1PFPA 1W6YA 2IA7A 3SOAA 1VQK3 4FR9A 1VQ83 1B2ZA 1S723 1W2B2 2MF7A 1AV4A 3MG3A 3E99A 3UL6A 3GZRA 2RSXA 3M8CA 4N6NB 4XBXA 2M7OA 2E2UA 3KSED 3MPHA 1MWTA 2K54A 9RNTA 1I2FA 2BIRA 1BSEA 2BO9B 1BU4A 2P0XA 4ILFA 1VQ43 3BB9A 4KFFA 1R4YA 2CWTA 4LYLB 4EC6A 1W01A 3EF8A 3EBYA 4R4KA 1L5GB 1UCJA 2B24B 2C10A 3WOFB 3Q1CA 1T5YA 3FKAA 3EJVA 3KSPA 1ZGXA 4WHAA 2OTL3 4HM6B 5M18A 3V99A 1BNRA 2XSHB 3H51A 3BNEA 3EHCA 3WR2A 2KAAA 2W6JH 1K8A4 2XEPA 1B2UA 1W7CA 2CC3A 5G1LA 3CC23 3TDGA 3LTDA 5EVHA 1UI8A 3UJMA 1I3FA 3NQZA 3AMOA 3FG4A 3QRDA 1SIIA 3X3YA 2HMJB 2ML6A 8CHOA 1T2IA 2YX9A 1JZDA 5IG0A 1UDII 3DGLA 5LC7A 3SOYA 1RKYA 2XRXB 1BRNL 3NV0B 1BNSA 1BSCA 3J7Yd 1I3IA 2W0QA 4O8SA 3OW22 1W6CA 5AIGA 1GSPA 3OWSA 2W2CA 1GOYA 4HM0B 1BIRA 1E3RA 3MSOA 4WP5A 6RNTA 1I8VA 1ULJB 2P0MA 4ORLA 1GD3A 2INXA 1CEWI 2P05A 1BVIA 3CNXA 5G1KA 1ULIB 4HM4B 2UGIA 1RHLA 1GOVA 3PZWA 1U8CB 5IW9A 3URPA 3DMCA 1V57A 2GU1A 5AYRB 3JUQA 1DVCA 3HIIA 1FA3A 3RNTA 1RJOA 3CPOA 1O7WB 1BRGA 1C7HA 4RZMA 3NUVA 3ZFZA 1A2KA 2F86B 2Z6BA 1K9M4 2XGLA 1JBRA 1W5ZA 1YVBI 2OWPA 2Z76A 4TX4A 5AIIA 5AEWB 3OXAA 1AVKA 3MG2A 1TFOA 1W4NA 4J8TA 5AEUB 2CFGA 3EN8A 3LZAA 3Q90A 1UGHI 4HM3B 1EUIC 1GMQA 1JBTA 1IVVA 2HMLB 1B21A 2XSOB 8RNTA 3RGAA 4LSOA 4WYKA 3IJEB 3PCRA 1YIJ3 2P09A 4H3UA 1V74A 1FUSA 3WMDA 4J9AA 1LVNA 3BU4A 2C4BA 2JDIH 3DY5A 3F7SA 3JUMA 5AI1A 3KE7A 3Q2PA 1YVSA 2HMMB 3CNMA 4KT3B 2UUGC 3GZBA 1IVXA 3LT9A 3PS8A 2FXTA 1O7PB 2PZVA 3UNLA 1WNHA 2OOVC 4R1KA 3AHSA 1RGEA 3S5CA 2F99A 3V98A 4BTXA 3NBBA 1KC84 2GEXA 2IUKA 2C11A 1Q40A 2CG0A 2WOFA 2KXGA 3K63A 1RGFA 1BRJA 2IY2A 1B3SA 4XB5A 1W6GA 5CF1A 1HKXA 5JBSA 1FUWA 4FMCA 1IDPA 1JN5B 1EG9B 4GSPA 2WGQA 5FW5A 1WMOA 4HYZA 1QVF2 3F8HA 4EBGA 2GU3A 4CCVA 1YIT3 1UW1A 4LMIA 1VQ53 3LT8A 1CYVA 1MGRA 3FG1A 3N9HA 1BNEA 3T8NA 5D83A 1G02A 2CHCA 3K9MC 1N5PA 5TGNA 5DREA 1RRHA 1NU3A 4Q53A 3NBRA 2KF6A 3SYUA 3CME3 3G4S3 3I0YA 1IVUA 2O9UX 1GOUA 4FMDA 1N9JA 4G1MB 4KZ1A 4CJNA 5BIRA 2XF3A 1GY6A 1DMMA 1AY7A 1WTHA 1RSNA 4KFEA 4HM2B 1PY3A 4XDVA 1I2EA 3BIRA 3F7XA 3OWYA 1TJDA 2IMJA 3D5GA 2W56A 4XBTA 3LMLA 1V58A 1VQQA 2BNGA 3I563 2CK3H 1HYFA 4K1VA 5FGOA 1WMNA 4MMYB 2SBLA 1TU5A 1NB5I 5BXQA 1TRQA 1ROVA 3CMA3 2BT3A 3WA3A 7STDA 2BMQB 2OQEC 3DGYA 3EB8A 2ZDJA 3FF0A 2IYJA 1RTUA 3D9RA 3KN4A 1BNIA 3KFQC 1ISKA 3D79A 4FCZA 2HMNB 1RN7A 1YNVX 1BGSA 1JZOA 1OGZA 4R9LA 1E3VA 2F56A 4O02B 4QWTA 1IYYA 2D42A 2GBWB 2KF5A 3I553 1RLSA 1RDSA 1OHSA 2RFRA 4STDA 3SXXA 1IV7A 1T2HA 1WQLB 4LEHA 1LQMB 1QVG2 3A5EA 2O3OA 4IPBA 4HBRA 4HVNA 1STDA 2IUJA 3FG3A 3T8UA 4WFOA 1JKGA 1OHOA 2H0GA 3EN1B 3B4PA 4N6UA 4GB5A 2CH9A 2WO0A 1BUJA 1B20A 2GSPA 4NHFA 3VF1A 5ELJA 2FGTA 2AADA 5CLKA 3HZPA 1UGIA 3ROBA 3ER7A 3CCL3 1RN1A 4WWUC 4R9KA 5BVBA 4I5QA 3CCJ3 4H61A 1K28A 3FLJA 2P38A
chains in the Genus database with same CATH topology
3WHOA 1B2MA 5HOHA 1BRSA 1AQZA 5GSPA 3AGOA 1GMQA 3Q3FA 1B21A 8RNTA 2ZA4A 1I0VA 2AAEA 1RGLA 1FUSA 2F4YA 1RGHA 1I70A 3BU4A 2C4BA 3HOHA 1Q9EA 3DH2A 1YGWA 1YVSA 1A2PA 1BRHA 1TTOA 1LOYA 3KCHA 1X1UA 6GSPA 1FZUA 1LNIA 3AGNA 3AHSA 1RGEA 1RNBA 1C54A 1RNTA 4HOHA 1BAOA 1LRAA 1RGAA 1RGFA 1BRJA 1B3SA 1RGGA 5BU4A 1SARA 4GSPA 1B2ZA 1RGCA 1FW7A 1MGWA 1HZ1A 1UCLA 4BIRA 1I2GA 1B2SA 2RNTA 1X1YA 1BNJA 1MGRA 3GSPA 1JBTA 1BNEA 9RNTA 1G02A 1I2FA 1BSEA 2BIRA 1BU4A 5RNTA 1DE3A 1RGKA 1R4YA 2F5MA 2KF6A 4HAAA 3SYUA 3AHWA 1UCJA 1GOUA 1ZGXA 5BIRA 1RCLA 1BNRA 1AY7A 1BANA 2RBIA 1RSNA 1BSBA 2HOHA 1PY3A 4GHOA 3WR2A 1JBSA 1I2EA 2KAAA 1UCIA 3BIRA 3D5GA 1B2UA 1GMPA 1TRPA 2BU4A 1GMRA 3D5IA 1FYSA 1HYFA 1I3FA 1RN4A 4J5KA 1TRQA 1T2IA 3DGYA 1BRNL 1RCKA 1UCKA 1B27A 1BNSA 1BNGA 1BSCA 1RTUA 2KF3A 1BNIA 1I3IA 4RNTA 1BRKA 1YNVX 1BGSA 1GSPA 1IYYA 2F56A 7RNTA 1GOYA 1BSAA 2KF5A 1RLSA 1BIRA 1RDSA 2F5WA 6RNTA 7GSPA 1BOXA 1I8VA 1LOVA 1T2HA 2KF4A 1BVIA 3A5EA 1RHLA 1GOVA 1X1XA 2SARA 1BSDA 1FUTA 3URPA 1RMSA 1DETA 1LOWA 4BU4A 1BRIA 3RNTA 1BRGA 1I0XA 3D4AA 1BUJA 1B20A 2GSPA 1X1WA 4J5GA 1B2XA 2AADA 1PYLA 1JBRA 1BNFA 1RN1A 1CH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHO A;  1B2M A;  5HOH A;  1BRS A;  1AQZ A;  5GSP A;  3AGO A;  1GMQ A;  3Q3F A;  1B21 A;  8RNT A;  2ZA4 A;  1I0V A;  2AAE A;  1RGL A;  1FUS A;  2F4Y A;  1RGH A;  1I70 A;  3BU4 A;  2C4B A;  3HOH A;  1Q9E A;  3DH2 A;  1YGW A;  1YVS A;  1A2P A;  1BRH A;  1TTO A;  1LOY A;  3KCH A;  1X1U A;  6GSP A;  1FZU A;  1LNI A;  3AGN A;  3AHS A;  1RGE A;  1RNB A;  1C54 A;  1RNT A;  4HOH A;  1BAO A;  1LRA A;  1RGA A;  1RGF A;  1BRJ A;  1B3S A;  1RGG A;  5BU4 A;  1SAR A;  4GSP A;  1B2Z A;  1RGC A;  1FW7 A;  1MGW A;  1HZ1 A;  1UCL A;  4BIR A;  1I2G A;  1B2S A;  2RNT A;  1X1Y A;  1BNJ A;  1MGR A;  3GSP A;  1JBT A;  1BNE A;  9RNT A;  1G02 A;  1I2F A;  1BSE A;  2BIR A;  1BU4 A;  5RNT A;  1DE3 A;  1RGK A;  1R4Y A;  2F5M A;  2KF6 A;  4HAA A;  3SYU A;  3AHW A;  1UCJ A;  1GOU A;  1ZGX A;  5BIR A;  1RCL A;  1BNR A;  1AY7 A;  1BAN A;  2RBI A;  1RSN A;  1BSB A;  2HOH A;  1PY3 A;  4GHO A;  3WR2 A;  1JBS A;  1I2E A;  2KAA A;  1UCI A;  3BIR A;  3D5G A;  1B2U A;  1GMP A;  1TRP A;  2BU4 A;  1GMR A;  3D5I A;  1FYS A;  1HYF A;  1I3F A;  1RN4 A;  4J5K A;  1TRQ A;  1T2I A;  3DGY A;  1BRN L;  1RCK A;  1UCK A;  1B27 A;  1BNS A;  1BNG A;  1BSC A;  1RTU A;  2KF3 A;  1BNI A;  1I3I A;  4RNT A;  1BRK A;  1YNV X;  1BGS A;  1GSP A;  1IYY A;  2F56 A;  7RNT A;  1GOY A;  1BSA A;  2KF5 A;  1RLS A;  1BIR A;  1RDS A;  2F5W A;  6RNT A;  7GSP A;  1BOX A;  1I8V A;  1LOV A;  1T2H A;  2KF4 A;  1BVI A;  3A5E A;  1RHL A;  1GOV A;  1X1X A;  2SAR A;  1BSD A;  1FUT A;  3URP A;  1RMS A;  1DET A;  1LOW A;  4BU4 A;  1BRI A;  3RNT A;  1BRG A;  1I0X A;  3D4A A;  1BUJ A;  1B20 A;  2GSP A;  1X1W A;  4J5G A;  1B2X A;  2AAD A;  1PYL A;  1JBR A;  1BNF A;  1RN1 A;  1CH0 A; 
#chains in the Genus database with same CATH topology
 1OH0 A;  1B2M A;  5HOH A;  4OK0 A;  3RGR A;  1DMN A;  5STD A;  1VQP 3;  1D6Y A;  1YGE A;  3HI7 A;  3CC7 3;  3U97 A;  3QK9 A;  2STD A;  3ECF A;  2ZA4 A;  1I0V A;  2LYX A;  3F40 A;  1MWS A;  5EQL A;  1O7G B;  4HM7 B;  3S28 A;  3WA2 X;  1Y4K A;  3NQY A;  4N6T A;  1VQL 3;  1OGX A;  3DH2 A;  3FH1 A;  4N6M A;  1YGW A;  1OF5 A;  4HZ9 B;  1VQ7 3;  1BRH A;  3L0R A;  3AMO B;  3X3Z A;  1X1U A;  4RNZ A;  1ZO2 A;  4AEQ A;  1Q86 4;  1FZU A;  2CWV A;  3AGN A;  3ALA A;  3OV4 A;  1MWU A;  1RNB A;  1C54 A;  1RNT A;  1BAO A;  4MEI A;  5AIF A;  1OHP A;  1LRA A;  3EBT A;  1WMP A;  1W00 A;  1DMQ A;  1RGA A;  5KP3 A;  3BND A;  1RGG A;  4RBN A;  4N6L A;  5JPP A;  3FGY A;  1JB5 A;  3GZY B;  1SAR A;  4FCM A;  1LXE A;  1FW7 A;  4HZB B;  4BTW A;  5IF6 A;  4HM5 B;  2JQ5 A;  2QIY A;  1MGW A;  2YFJ B;  1O7H B;  1M9G A;  1I2G A;  2RNT A;  1MOL A;  3T0U A;  1X1Y A;  1N8Q A;  1BNJ A;  3G8Z A;  2H0I A;  3GSP A;  1LQG C;  3LTB A;  5G2G A;  3K5T A;  1MWR A;  1OF5 B;  5RNT A;  1DE3 A;  1UUV B;  4BL2 A;  3BLZ A;  5IG4 A;  4FMA A;  2F5M A;  5KP1 A;  1EA2 A;  4FCJ A;  4EYC A;  1YJ9 3;  2LQV A;  2L4V A;  2BMR B;  1RCL A;  1LOX A;  1N8R 4;  3CD6 3;  3UL5 A;  2RBI A;  3V92 A;  3CCE 3;  1BSB A;  2HOH A;  2CIU A;  4GHO A;  2XFS A;  3CXC 2;  2I9W A;  4J5G A;  1DVD A;  3RDE A;  2BU4 A;  3MHE A;  3U1W A;  1Q81 4;  1VQ9 3;  4XM4 A;  1G96 A;  3OWU A;  2F98 A;  3D5I A;  1ROA A;  4LZI A;  3CC4 3;  4HM8 B;  1A2V A;  2FNQ A;  4WYK B;  2QEX 3;  1A90 A;  4J5K A;  1Q7H A;  2HMK B;  2BHM A;  2XH9 A;  3K0Z A;  2R4I A;  2K3D A;  1TP6 A;  1NJI 4;  1UCK A;  3JUN A;  3D3L A;  2KCD A;  3LTC A;  3CPW 2;  1B27 A;  1BNG A;  2KF3 A;  2Z7A A;  2Y74 A;  3GZX B;  1R4C A;  2V1L A;  3OX9 A;  1IQY A;  4MJD A;  5LC6 A;  3DGM A;  1OUN A;  2ML5 A;  5IER A;  1BUQ A;  3BNC A;  1BSA A;  1TUH A;  3MG1 A;  5AYS C;  1NWW A;  7GSP A;  2F5W A;  2XGN A;  3CCM 3;  1LOV A;  3CCV 3;  1Q40 B;  3CCU 3;  2KF4 A;  3MWZ A;  1K73 4;  1N9E A;  2SAR A;  1TIJ A;  5D81 A;  3JUP A;  1Q7Y 4;  1RMS A;  3IMA B;  1EKM A;  4K61 A;  5DRV A;  3SX1 A;  1D6U A;  2CFW A;  1LOW A;  4BU4 A;  3NBJ A;  2RCD A;  1I0X A;  1SJW A;  3D4A A;  2W04 A;  4I4K A;  1KD1 4;  4L8O A;  2CX0 A;  1CYU A;  1YJN 3;  5EEO A;  1J2B A;  5HGR A;  1BNF A;  3FF2 A;  2Y73 A;  4JF8 A;  1QMA A;  4L7K A;  1CH0 A;  1W2Z A;  3CCS 3;  3F14 A;  2E2T A;  1BRS A;  1QJG A;  3PCS A;  3G71 3;  3JVC A;  3S67 A;  4KVH A;  5GSP A;  3AGO A;  1CQS A;  4OUQ A;  2YFI B;  1GYB A;  3SLU A;  3IPT A;  4K90 B;  1GD4 A;  5CK6 A;  1OAC A;  2AAE A;  2GXF A;  3G16 A;  4HJL B;  1JRQ A;  1RGL A;  2F4Y A;  2YFL B;  1W02 A;  1RGH A;  3GWR A;  3HOH A;  4LGQ A;  1S5A A;  3PXM A;  2W56 B;  3NV0 A;  3ZG0 A;  3LTA A;  2BMO B;  3F9S A;  3VGN A;  5IG5 A;  4PEJ A;  1GY7 A;  4EV5 A;  1YJW 3;  1YHQ 3;  1TTO A;  5IEP A;  1MNL A;  1QAF A;  3WOE B;  3PGB A;  3S27 A;  1GY5 A;  3PYJ A;  3UB1 A;  2OCT A;  3VSY A;  1LNH A;  1N5H A;  2CX1 A;  4JRF A;  5JPU A;  4IT7 A;  3DXO A;  1ASK A;  3CU3 A;  3HIG A;  1EEJ A;  3SVA A;  1NNV A;  4XDW A;  2CFD A;  3B7C A;  2CG1 A;  5AIH A;  1A67 A;  3CCR 3;  5BU4 A;  1YI2 3;  2R41 A;  2CW9 A;  1RGC A;  4AKZ A;  4XBY A;  3G6E 3;  1FGT A;  2WGO A;  3F8X A;  1VQ6 3;  2WOH A;  3DM8 A;  3FZW A;  1E97 A;  1UCL A;  1HZ1 A;  4K1U A;  1GS3 A;  1OPY A;  4BIR A;  2H0H A;  2B1X B;  5M1A A;  1B2S A;  3WOD G;  2QGU A;  4AKY A;  1Q42 A;  1EQK A;  3WDG B;  3GAX A;  1JKG B;  3KKG A;  1AVL A;  1U5O A;  1JNQ A;  2HMO B;  1IU7 A;  1RGK A;  1NO3 A;  4CPK A;  1Q82 4;  2W9P A;  4EW5 A;  3DGN A;  1RRL A;  1O7N B;  2XR8 B;  3NXJ A;  4HAA A;  1SIH A;  1JB4 A;  3AHW A;  1NDO B;  5D82 A;  2OQE A;  3X40 A;  5M19 A;  3MKI A;  5IEO A;  1FGR A;  1KQS 2;  1KWI A;  1BAN A;  3KII A;  3X3X A;  1QAL A;  2CKF B;  1M1X B;  1JB2 A;  1JBS A;  3B4O A;  1UCI A;  1GMP A;  1G0T A;  1TRP A;  3EC9 A;  1GMR A;  1OCV A;  3HK4 A;  2GEY A;  3JUO A;  4MMZ B;  3KZT A;  1FYS A;  1RN4 A;  1UUW B;  5IEN A;  3FSD A;  3NX0 A;  2Q07 A;  1RCK A;  4L8P A;  4N3V A;  4CDL A;  2PNC A;  3A76 A;  1TFK A;  4NRE A;  1HU9 A;  4ZM8 A;  5KP4 A;  4EV2 A;  4RNT A;  1BRK A;  4X2O A;  3BNB A;  4HM1 B;  4R80 A;  3EE1 A;  1IT8 A;  1IV9 A;  7RNT A;  3X42 A;  3K7C A;  2ZHX B;  1JN5 A;  4FMB A;  4HKV B;  1M1K 4;  3DUK A;  1BOX A;  1NB3 I;  3N8B A;  2K0M A;  4NPB A;  1IT7 A;  1SQW A;  2CFL A;  3ZG5 A;  1DYU A;  1FGQ A;  1BSD A;  1FUT A;  1JV2 B;  1X1X A;  1VQN 3;  1PU4 A;  4KFD A;  2ZL8 A;  1DET A;  3NHX A;  3STD A;  1US1 A;  1F8N A;  1JJ2 2;  2XFT A;  1VZZ A;  1BRI A;  3DGO A;  4OVM A;  1UUG B;  2W03 A;  1O7M B;  5ELU A;  1X1W A;  2GBX B;  4BL3 A;  4N6O B;  1B2X A;  1IK3 A;  2L1S A;  1T3B A;  4IIA A;  1PYL A;  2E2V A;  4O2H A;  1D6Z A;  2Z77 A;  1IQX A;  1K41 A;  3LXU X;  3FCS B;  3LH4 A;  3N54 B;  3WHO A;  4RNY A;  3DZL A;  1ZS7 A;  1AQZ A;  3B8L A;  1KSI A;  1IVW A;  1ZX2 A;  3X41 A;  1AR0 A;  5CXO A;  5A0O B;  1FGM A;  1STF I;  3NM7 A;  4GL6 A;  4DKI A;  3G0K A;  2MC8 A;  6STD A;  1M90 4;  3Q3F A;  5CF2 A;  2D1W A;  5I97 A;  3EQQ B;  4O3V A;  2OTJ 3;  5IG3 A;  3LYG A;  2A15 A;  2KRT A;  3HX8 A;  3SED A;  3EX9 A;  1I70 A;  2CWU A;  4MMX B;  1Q9E A;  3CCQ 3;  1IQ8 A;  3H3H A;  2UX0 A;  2W9Q A;  1SPU A;  1A2P A;  3KCH A;  1LOY A;  1Z1S A;  4X2H A;  2J8X B;  6GSP A;  3LOY A;  1FGO A;  3NM2 A;  1LNI A;  3O8Y A;  1VQM 3;  2CFK A;  4BTY A;  4HOH A;  1UI7 A;  4N6V 0;  1VQO 3;  3MYT A;  2RGQ A;  3S29 A;  3GRD A;  2QA4 3;  1QAK A;  2OOV A;  4U13 A;  4EXR A;  1PFP A;  1W6Y A;  2IA7 A;  3SOA A;  1VQK 3;  4FR9 A;  1VQ8 3;  1B2Z A;  1S72 3;  1W2B 2;  2MF7 A;  1AV4 A;  3MG3 A;  3E99 A;  3UL6 A;  3GZR A;  2RSX A;  3M8C A;  4N6N B;  4XBX A;  2M7O A;  2E2U A;  3KSE D;  3MPH A;  1MWT A;  2K54 A;  9RNT A;  1I2F A;  2BIR A;  1BSE A;  2BO9 B;  1BU4 A;  2P0X A;  4ILF A;  1VQ4 3;  3BB9 A;  4KFF A;  1R4Y A;  2CWT A;  4LYL B;  4EC6 A;  1W01 A;  3EF8 A;  3EBY A;  4R4K A;  1L5G B;  1UCJ A;  2B24 B;  2C10 A;  3WOF B;  3Q1C A;  1T5Y A;  3FKA A;  3EJV A;  3KSP A;  1ZGX A;  4WHA A;  2OTL 3;  4HM6 B;  5M18 A;  3V99 A;  1BNR A;  2XSH B;  3H51 A;  3BNE A;  3EHC A;  3WR2 A;  2KAA A;  2W6J H;  1K8A 4;  2XEP A;  1B2U A;  1W7C A;  2CC3 A;  5G1L A;  3CC2 3;  3TDG A;  3LTD A;  5EVH A;  1UI8 A;  3UJM A;  1I3F A;  3NQZ A;  3AMO A;  3FG4 A;  3QRD A;  1SII A;  3X3Y A;  2HMJ B;  2ML6 A;  8CHO A;  1T2I A;  2YX9 A;  1JZD A;  5IG0 A;  1UDI I;  3DGL A;  5LC7 A;  3SOY A;  1RKY A;  2XRX B;  1BRN L;  3NV0 B;  1BNS A;  1BSC A;  3J7Y d;  1I3I A;  2W0Q A;  4O8S A;  3OW2 2;  1W6C A;  5AIG A;  1GSP A;  3OWS A;  2W2C A;  1GOY A;  4HM0 B;  1BIR A;  1E3R A;  3MSO A;  4WP5 A;  6RNT A;  1I8V A;  1ULJ B;  2P0M A;  4ORL A;  1GD3 A;  2INX A;  1CEW I;  2P05 A;  1BVI A;  3CNX A;  5G1K A;  1ULI B;  4HM4 B;  2UGI A;  1RHL A;  1GOV A;  3PZW A;  1U8C B;  5IW9 A;  3URP A;  3DMC A;  1V57 A;  2GU1 A;  5AYR B;  3JUQ A;  1DVC A;  3HII A;  1FA3 A;  3RNT A;  1RJO A;  3CPO A;  1O7W B;  1BRG A;  1C7H A;  4RZM A;  3NUV A;  3ZFZ A;  1A2K A;  2F86 B;  2Z6B A;  1K9M 4;  2XGL A;  1JBR A;  1W5Z A;  1YVB I;  2OWP A;  2Z76 A;  4TX4 A;  5AII A;  5AEW B;  3OXA A;  1AVK A;  3MG2 A;  1TFO A;  1W4N A;  4J8T A;  5AEU B;  2CFG A;  3EN8 A;  3LZA A;  3Q90 A;  1UGH I;  4HM3 B;  1EUI C;  1GMQ A;  1JBT A;  1IVV A;  2HML B;  1B21 A;  2XSO B;  8RNT A;  3RGA A;  4LSO A;  4WYK A;  3IJE B;  3PCR A;  1YIJ 3;  2P09 A;  4H3U A;  1V74 A;  1FUS A;  3WMD A;  4J9A A;  1LVN A;  3BU4 A;  2C4B A;  2JDI H;  3DY5 A;  3F7S A;  3JUM A;  5AI1 A;  3KE7 A;  3Q2P A;  1YVS A;  2HMM B;  3CNM A;  4KT3 B;  2UUG C;  3GZB A;  1IVX A;  3LT9 A;  3PS8 A;  2FXT A;  1O7P B;  2PZV A;  3UNL A;  1WNH A;  2OOV C;  4R1K A;  3AHS A;  1RGE A;  3S5C A;  2F99 A;  3V98 A;  4BTX A;  3NBB A;  1KC8 4;  2GEX A;  2IUK A;  2C11 A;  1Q40 A;  2CG0 A;  2WOF A;  2KXG A;  3K63 A;  1RGF A;  1BRJ A;  2IY2 A;  1B3S A;  4XB5 A;  1W6G A;  5CF1 A;  1HKX A;  5JBS A;  1FUW A;  4FMC A;  1IDP A;  1JN5 B;  1EG9 B;  4GSP A;  2WGQ A;  5FW5 A;  1WMO A;  4HYZ A;  1QVF 2;  3F8H A;  4EBG A;  2GU3 A;  4CCV A;  1YIT 3;  1UW1 A;  4LMI A;  1VQ5 3;  3LT8 A;  1CYV A;  1MGR A;  3FG1 A;  3N9H A;  1BNE A;  3T8N A;  5D83 A;  1G02 A;  2CHC A;  3K9M C;  1N5P A;  5TGN A;  5DRE A;  1RRH A;  1NU3 A;  4Q53 A;  3NBR A;  2KF6 A;  3SYU A;  3CME 3;  3G4S 3;  3I0Y A;  1IVU A;  2O9U X;  1GOU A;  4FMD A;  1N9J A;  4G1M B;  4KZ1 A;  4CJN A;  5BIR A;  2XF3 A;  1GY6 A;  1DMM A;  1AY7 A;  1WTH A;  1RSN A;  4KFE A;  4HM2 B;  1PY3 A;  4XDV A;  1I2E A;  3BIR A;  3F7X A;  3OWY A;  1TJD A;  2IMJ A;  3D5G A;  2W56 A;  4XBT A;  3LML A;  1V58 A;  1VQQ A;  2BNG A;  3I56 3;  2CK3 H;  1HYF A;  4K1V A;  5FGO A;  1WMN A;  4MMY B;  2SBL A;  1TU5 A;  1NB5 I;  5BXQ A;  1TRQ A;  1ROV A;  3CMA 3;  2BT3 A;  3WA3 A;  7STD A;  2BMQ B;  2OQE C;  3DGY A;  3EB8 A;  2ZDJ A;  3FF0 A;  2IYJ A;  1RTU A;  3D9R A;  3KN4 A;  1BNI A;  3KFQ C;  1ISK A;  3D79 A;  4FCZ A;  2HMN B;  1RN7 A;  1YNV X;  1BGS A;  1JZO A;  1OGZ A;  4R9L A;  1E3V A;  2F56 A;  4O02 B;  4QWT A;  1IYY A;  2D42 A;  2GBW B;  2KF5 A;  3I55 3;  1RLS A;  1RDS A;  1OHS A;  2RFR A;  4STD A;  3SXX A;  1IV7 A;  1T2H A;  1WQL B;  4LEH A;  1LQM B;  1QVG 2;  3A5E A;  2O3O A;  4IPB A;  4HBR A;  4HVN A;  1STD A;  2IUJ A;  3FG3 A;  3T8U A;  4WFO A;  1JKG A;  1OHO A;  2H0G A;  3EN1 B;  3B4P A;  4N6U A;  4GB5 A;  2CH9 A;  2WO0 A;  1BUJ A;  1B20 A;  2GSP A;  4NHF A;  3VF1 A;  5ELJ A;  2FGT A;  2AAD A;  5CLK A;  3HZP A;  1UGI A;  3ROB A;  3ER7 A;  3CCL 3;  1RN1 A;  4WWU C;  4R9K A;  5BVB A;  4I5Q A;  3CCJ 3;  4H61 A;  1K28 A;  3FLJ A;  2P38 A; 
#chains in the Genus database with same CATH homology
 3WHO A;  1B2M A;  5HOH A;  1BRS A;  1AQZ A;  5GSP A;  3AGO A;  1GMQ A;  3Q3F A;  1B21 A;  8RNT A;  2ZA4 A;  1I0V A;  2AAE A;  1RGL A;  1FUS A;  2F4Y A;  1RGH A;  1I70 A;  3BU4 A;  2C4B A;  3HOH A;  1Q9E A;  3DH2 A;  1YGW A;  1YVS A;  1A2P A;  1BRH A;  1TTO A;  1LOY A;  3KCH A;  1X1U A;  6GSP A;  1FZU A;  1LNI A;  3AGN A;  3AHS A;  1RGE A;  1RNB A;  1C54 A;  1RNT A;  4HOH A;  1BAO A;  1LRA A;  1RGA A;  1RGF A;  1BRJ A;  1B3S A;  1RGG A;  5BU4 A;  1SAR A;  4GSP A;  1B2Z A;  1RGC A;  1FW7 A;  1MGW A;  1HZ1 A;  1UCL A;  4BIR A;  1I2G A;  1B2S A;  2RNT A;  1X1Y A;  1BNJ A;  1MGR A;  3GSP A;  1JBT A;  1BNE A;  9RNT A;  1G02 A;  1I2F A;  1BSE A;  2BIR A;  1BU4 A;  5RNT A;  1DE3 A;  1RGK A;  1R4Y A;  2F5M A;  2KF6 A;  4HAA A;  3SYU A;  3AHW A;  1UCJ A;  1GOU A;  1ZGX A;  5BIR A;  1RCL A;  1BNR A;  1AY7 A;  1BAN A;  2RBI A;  1RSN A;  1BSB A;  2HOH A;  1PY3 A;  4GHO A;  3WR2 A;  1JBS A;  1I2E A;  2KAA A;  1UCI A;  3BIR A;  3D5G A;  1B2U A;  1GMP A;  1TRP A;  2BU4 A;  1GMR A;  3D5I A;  1FYS A;  1HYF A;  1I3F A;  1RN4 A;  4J5K A;  1TRQ A;  1T2I A;  3DGY A;  1BRN L;  1RCK A;  1UCK A;  1B27 A;  1BNS A;  1BNG A;  1BSC A;  1RTU A;  2KF3 A;  1BNI A;  1I3I A;  4RNT A;  1BRK A;  1YNV X;  1BGS A;  1GSP A;  1IYY A;  2F56 A;  7RNT A;  1GOY A;  1BSA A;  2KF5 A;  1RLS A;  1BIR A;  1RDS A;  2F5W A;  6RNT A;  7GSP A;  1BOX A;  1I8V A;  1LOV A;  1T2H A;  2KF4 A;  1BVI A;  3A5E A;  1RHL A;  1GOV A;  1X1X A;  2SAR A;  1BSD A;  1FUT A;  3URP A;  1RMS A;  1DET A;  1LOW A;  4BU4 A;  1BRI A;  3RNT A;  1BRG A;  1I0X A;  3D4A A;  1BUJ A;  1B20 A;  2GSP A;  1X1W A;  4J5G A;  1B2X A;  2AAD A;  1PYL A;  1JBR A;  1BNF A;  1RN1 A;  1CH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...