1BOXA

N39s mutant of rnase sa from streptomyces aureofaciens
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
b'VSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQSRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE SA
publication title Contribution of a conserved asparagine to the conformational stability of ribonucleases Sa, Ba, and T1.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 23
structure length 95
sequence length 95
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1boxA00
1BRHA 5BU4A 1AQZA 1A2PA 1I2FA 3URPA 2KAAA 1I2EA 2C4BA 3DH2A 1UCJA 1RCKA 1BNSA 1X1XA 1I8VA 4GHOA 1JBSA 1BIRA 3BIRA 2BU4A 1RGGA 1RGHA 1RMSA 1B20A 3GSPA 1BSAA 1BNFA 1BU4A 1BRJA 1GMQA 1B2XA 1Q9EA 1B2SA 1BSBA 4HAAA 3AGNA 1C54A 1R4YA 1ZGXA 1FZUA 1RGLA 1B2ZA 1GOYA 2KF5A 1RHLA 1X1YA 1BNJA 3D5IA 1GOUA 1TTOA 1I0XA 1RLSA 1RGKA 1UCKA 3D4AA 1BNGA 4J5GA 1X1WA 4HOHA 1GOVA 1HZ1A 1PYLA 1RCLA 1RGEA 2RNTA 1YVSA 3KCHA 1UCLA 1TRQA 4GSPA 1MGRA 2F56A 1YGWA 3WR2A 2KF6A 7RNTA 2AAEA 1UCIA 7GSPA 1X1UA 1RDSA 3DGYA 1BRGA 9RNTA 2GSPA 4BIRA 3D5GA 6RNTA 1RTUA 1LOWA 2SARA 3AGOA 1FYSA 3AHWA 1RGCA 1BNIA 1I70A 1AY7A 1BRSA 3AHSA 1I2GA 1G02A 1BGSA 1RN1A 6GSPA 1RGFA 1B21A 1GSPA 1LNIA 1RSNA 1BSDA 5BIRA 1YNVX 1BNEA 1CH0A 1T2IA 2KF3A 5HOHA 1BRNL 2F4YA 1JBTA 3WHOA 1BANA 2KF4A 1FUTA 1GMRA 2RBIA 3HOHA 1BNRA 1T2HA 1RGAA 1B27A 2HOHA 1BSCA 1JBRA 1IYYA 2F5WA 1BRKA 1RNBA 1FW7A 1FUSA 2F5MA 2ZA4A 1BSEA 1BOXA 1RNTA 1TRPA 5GSPA 1B3SA 1GMPA 1BAOA 1DETA 1RN4A 3SYUA 2BIRA 1B2MA 1LRAA 1LOYA 1MGWA 2AADA 3A5EA 5RNTA 1PY3A 4J5KA 1HYFA 8RNTA 1DE3A 4RNTA 1I3IA 3BU4A 1BUJA 4BU4A 1BRIA 3Q3FA 1B2UA 1LOVA 1I0VA 1I3FA 1BVIA 1SARA 3RNTA
chains in the Genus database with same CATH superfamily
1JB5A 5BU4A 4WHAA 5D83A 2OQEC 3CNMA 3JUOA 3URPA 5IG3A 1TU5A 1I2EA 2YFJB 3DH2A 5AYRB 4CPKA 2CC3A 4HM0B 1IVXA 1IVVA 3LOYA 3KKGA 1BIRA 1ZS7A 3CNXA 3ER7A 2BU4A 4CCVA 1RMSA 3KFQC 1T3BA 1BSAA 2R4IA 3N54B 4R1KA 4DKIA 3G6E3 1CEWI 2HMLB 1B2XA 3X3XA 3CCS3 4HAAA 3FF2A 3GZBA 4FMDA 1FZUA 1RGLA 1A67A 1B2ZA 1YGEA 5DREA 2WO0A 3OV4A 1E3RA 3D5IA 1TTOA 3F40A 5BXQA 3WA3A 4N6OB 1YIT3 1QJGA 3EBYA 2IA7A 4J5GA 1Y4KA 2STDA 3NV0B 1LQMB 1RN7A 2XF3A 2UGIA 3CU3A 4N6MA 5ELUA 1QVG2 2LYXA 2OOVA 4R9LA 1VZZA 3CCU3 1OGZA 1RGEA 2QGUA 1FGMA 1N5HA 1VQM3 3KCHA 5CF2A 4HM7B 1UGHI 1UW1A 2KF6A 3FGYA 7GSPA 2YFLB 3B7CA 4X2OA 1A2KA 3AMOB 3NM7A 1EEJA 4XBTA 4XM4A 2SARA 3F9SA 5ELJA 3EQQB 3DXOA 2P38A 1K41A 1MWRA 1Z1SA 3DGLA 4FMCA 5AIIA 3U97A 3FZWA 3VF1A 2Z77A 3AMOA 1RGCA 3I553 4R9KA 1QAFA 1GY7A 4TX4A 3HX8A 2O3OA 2YFIB 4BL2A 5HGRA 3PCSA 6GSPA 1RGFA 1B21A 1GSPA 1LNIA 2CIUA 1OF5B 2XFTA 4AKYA 5KP4A 1V58A 4N3VA 3EJVA 1TP6A 1VQP3 1D6UA 4NREA 1Q864 1CH0A 1N9JA 2W04A 2W2CA 2BMOB 4K90B 4EXRA 1J2BA 2HMOB 2B24B 1UUWB 2B1XB 1STDA 1OF5A 4FMBA 2F4YA 1JBTA 4I4KA 1D6YA 2OTL3 1BANA 1FUTA 1GMRA 5CK6A 3HOHA 1BNRA 1N5PA 3BLZA 1RGAA 2UUGC 3EC9A 1WMOA 1VQ93 3CXC2 2HOHA 1BSCA 3NUVA 4K61A 3MPHA 1N8R4 1RNBA 3WODG 4HM5B 2LQVA 1WMPA 1RNTA 3DGMA 4LYLB 1B3SA 4LSOA 3ECFA 1KSIA 2IY2A 1QALA 2BIRA 3NX0A 3QRDA 4XB5A 4Q53A 1SIHA 2Y74A 2AADA 1UDII 3A5EA 4GL6A 3G8ZA 1JB2A 1HYFA 2C10A 1O7HB 4RNTA 3BU4A 3HZPA 2QEX3 4BU4A 3DGNA 5EVHA 3G4S3 1BRIA 1TUHA 1Q814 4L8PA 1I0VA 1BVIA 4RNYA 3LMLA 1E3VA 1SARA 3KZTA 3RNTA 2HMKB 1AQZA 2XEPA 2ML6A 1A2PA 1I2FA 1OACA 3EBTA 3JUQA 1SJWA 2KAAA 1TJDA 1NB3I 3GZYB 1VQ53 2P0MA 3ZG5A 1RCKA 4X2HA 2WOFA 1I8VA 1JKGB 4MJDA 4CDLA 4CJNA 1UGIA 2L4VA 3D3LA 3Q1CA 2IUJA 5CF1A 1YIJ3 5TGNA 3BIRA 3MYTA 3NQYA 1RGGA 5AIGA 5AI1A 5M18A 3GSPA 4BTXA 1AVLA 3QK9A 1BNFA 1G0TA 1ULIB 1BSBA 3AGNA 3LTAA 4K1VA 1FGQA 3K7CA 3HK4A 1GOYA 2KF5A 2I9WA 3EB8A 3GAXA 5FW5A 1BNJA 1C7HA 1RRLA 4EV2A 1GOUA 1PU4A 1RLSA 1G96A 3D4AA 1STFI 3Q90A 4BL3A 3EN8A 3MG2A 4HM8B 1DMNA 3L0RA 3RGAA 2CX1A 2XGLA 2W9PA 1GOVA 3GRDA 3CCE3 2KRTA 3RDEA 2CW9A 4EW5A 3A76A 3CCJ3 1OCVA 1TFOA 3V99A 1YVSA 3NXJA 5EQLA 3F7XA 1DYUA 4KFEA 3OXAA 4N6TA 1N8QA 1EKMA 1VQ73 2XSOB 1CQSA 2CG1A 1KC84 4R4KA 1OHPA 9RNTA 3F14A 1M9GA 1M904 4OK0A 1W5ZA 3D5GA 1K9M4 1RTUA 1O7NB 3AGOA 1ZO2A 2HMMB 3GWRA 3NHXA 4HBRA 1FYSA 3IJEB 5AIFA 3N9HA 2CG0A 2F99A 1DVCA 2Y73A 1BNIA 4G1MB 1O7WB 3PZWA 1AY7A 1BRSA 5G2GA 3X42A 1G02A 5IERA 1W6CA 1RSNA 4JRFA 1Q7HA 5BIRA 1YNVX 1VQ43 1RJOA 2P05A 1NNVA 2W03A 1BNEA 1GD3A 1LNHA 2W0QA 3NV0A 4PEJA 2OWPA 3JUMA 3BB9A 4KVHA 2GU1A 3G0KA 1BRNL 3FG3A 4ZM8A 2P0XA 2CK3H 3WHOA 3NBRA 1LQGC 3S67A 1EUIC 1FA3A 4ILFA 4IIAA 1JZDA 3ALAA 3UB1A 2L1SA 5LC6A 2RCDA 4HVNA 8CHOA 3D79A 3F8XA 1YJN3 1BRKA 1FW7A 2XSHB 2F5MA 3FH1A 5CXOA 3CC43 1GYBA 3SOAA 1YVBI 4RZMA 1W7CA 1M1K4 1TRPA 2H0GA 1JZOA 1R4CA 1GMPA 3CC23 2IMJA 2OCTA 1DETA 2K54A 4O3VA 3KSPA 2H0HA 4FCJA 2OQEA 1S723 1LOXA 2RGQA 3NBJA 4R80A 3ZG0A 1VQK3 3CMA3 2CFDA 3PGBA 4WWUC 1L5GB 5AYSC 1ULJB 3GZXB 3EF8A 3ZFZA 1DE3A 2H0IA 3U1WA 1K734 2SBLA 5IENA 4AKZA 1B2UA 1LOVA 1JN5B 4KFDA 1I3FA 2W6JH 2QIYA 1IQXA 5BVBA 2BNGA 3BNBA 3OX9A 1ZX2A 3K63A 1W2B2 3T8NA 1JN5A 3B4OA 1WTHA 1W02A 2C4BA 1OUNA 1UCJA 3MG3A 3MG1A 4N6NB 3S28A 1BNSA 3IMAB 4GHOA 4STDA 1EA2A 1A2VA 1AVKA 5D81A 1MWSA 1UUGB 1JJ22 2HMJB 2ML5A 3VSYA 4N6LA 1RGHA 1UI7A 4EC6A 1B20A 3NM2A 5LC7A 2ZL8A 1HKXA 3JUPA 1SQWA 1BU4A 3JUNA 3LTCA 1RKYA 1BRJA 4HZ9B 3CCR3 2Z76A 1ASKA 1JRQA 1R4YA 1W6GA 2W56B 4FCZA 5IEOA 1W00A 2W9QA 1X1YA 3FSDA 3F8HA 1ROVA 4KT3B 3I0YA 1I0XA 3EX9A 4EBGA 1US1A 3MKIA 3UL5A 3CCM3 1YJW3 3PCRA 1IV9A 1FGOA 5G1KA 2FGTA 3LT9A 2W56A 3B8LA 5A0OB 1OH0A 4LGQA 1NB5I 1JV2B 2F86B 3OWYA 1IVUA 3BNCA 1O7MB 2BO9B 1NO3A 4HM6B 1PYLA 1BUQA 4OVMA 2RNTA 3X40A 1W4NA 6STDA 1Q824 4H61A 1UCLA 4HZBB 3DMCA 1TIJA 3STDA 4IT7A 4GSPA 3WR2A 1RDSA 3DGYA 1BRGA 2CFGA 4HYZA 4BTWA 5IEPA 5IF6A 1JKGA 1SIIA 4BIRA 6RNTA 1LOWA 2OTJ3 3DGOA 2OOVC 3AHWA 3VGNA 2CFWA 1WQLB 4U13A 1NU3A 2KXGA 1I70A 3CCQ3 2CKFB 3I563 2F98A 2GBXB 2GXFA 4GB5A 1IT7A 1BGSA 3MWZA 3E99A 1WNHA 4NHFA 2BMQB 5I97A 3WMDA 5JPPA 3O8YA 1BSDA 2FNQA 4XBXA 3HIIA 1YHQ3 2HMNB 2XFSA 2K3DA 1UUVB 3FG4A 4IPBA 1GD4A 1M1XB 5HOHA 4H3UA 5JBSA 3G713 3T8UA 4HM3B 1V57A 1GY5A 3OW22 4K1UA 1W6YA 2Q07A 3MHEA 1V74A 2KF4A 3S5CA 4EYCA 1U5OA 2CWUA 4RNZA 4O2HA 2UX0A 3NQZA 4I5QA 1T2HA 2RSXA 4FCMA 3F7SA 1OHSA 3V98A 3IPTA 1B27A 3DUKA 2CHCA 2FXTA 3KIIA 1IYYA 1K8A4 2F5WA 3TDGA 2BHMA 4J9AA 4MEIA 4QWTA 1BSEA 2GU3A 3FF0A 4MMYB 3WOFB 5IW9A 5JPUA 5STDA 1DVDA 1BOXA 1WMNA 5IG4A 2C11A 2KCDA 2E2VA 3GZRA 2D1WA 5D82A 5KP1A 3EE1A 4HJLB 2INXA 1RN4A 5DRVA 1B2MA 4J8TA 3DY5A 1DMMA 1LOYA 4LEHA 4L8OA 1LXEA 4J5KA 4BTYA 1FGTA 3BNDA 1I3IA 3K5TA 8RNTA 3X3ZA 1TFKA 1BUJA 3ROBA 5IG5A 3SX1A 1PFPA 4MMZB 3M8CA 3B4PA 1YI23 1CYVA 2WOHA 4XBYA 2JQ5A 3LZAA 3H51A 1BRHA 2PNCA 2D42A 2Z6BA 1JB4A 3V92A 2PZVA 1Q42A 3N8BA 1OHOA 4HM1B 1IT8A 1MWUA 1X1XA 2CH9A 1JBSA 1U8CB 3PXMA 2Z7AA 1T5YA 2WGOA 5IG0A 2IYJA 1AV4A 2E2TA 4NPBA 5KP3A 1IVWA 3CCV3 4KFFA 4EV5A 2P09A 1AR0A 1GMQA 3LT8A 1Q9EA 4L7KA 1B2SA 2R41A 3SOYA 3WOEB 5M19A 3PS8A 1C54A 3KN4A 1ZGXA 1EQKA 2GEXA 4LZIA 2GBWB 1RHLA 5AEUB 3D9RA 2M7OA 2MF7A 3CPW2 1GS3A 1NWWA 1UCKA 3LYGA 1IDPA 1RGKA 2WGQA 2XGNA 3SEDA 1BNGA 3T0UA 3X3YA 3HI7A 1OPYA 1X1WA 1W2ZA 3FG1A 3LH4A 3LTDA 1ROAA 4FMAA 1MWTA 4HOHA 4O02B 3WDGB 1ISKA 1Q7Y4 3X41A 1HZ1A 3G16A 5M1AA 1DMQA 1RCLA 1VQQA 3K9MC 5AEWB 1FGRA 1IQYA 1YJ93 2V1LA 1TRQA 5EEOA 4KZ1A 3S27A 1MGRA 2F56A 1YGWA 2J8XB 3JVCA 3UJMA 7RNTA 1IK3A 2AAEA 1JNQA 1UCIA 1X1UA 3BNEA 4OUQA 2E2UA 2GSPA 1LVNA 1D6ZA 4WFOA 2MC8A 1NJI4 4MMXB 2XRXB 1IQ8A 1SPUA 3MSOA 4WYKA 2RFRA 2CWVA 3OWSA 1OGXA 4HM2B 1FUWA 3WA2X 3KE7A 3LXUX 2A15A 2JDIH 4N6V0 4WP5A 3SLUA 2XH9A 3EHCA 3AHSA 1I2GA 4XDWA 1IU7A 1MNLA 1RN1A 4O8SA 4WYKB 3KSED 3CCL3 1E97A 3SXXA 2CFKA 2ZHXB 1VQ63 3NBBA 5AIHA 4JF8A 5G1LA 4LMIA 3UNLA 3HIGA 1MOLA 1HU9A 1T2IA 2KF3A 4HKVB 1EG9B 1KWIA 4N6UA 1Q40B 4ORLA 2QA43 2ZDJA 3DM8A 3Q2PA 7STDA 1QMAA 3FCSB 4HM4B 2CWTA 3FLJA 3PYJA 2RBIA 3LTBA 1CYUA 3CPOA 3J7Yd 1KD14 3CD63 1Q40A 1NDOB 1RRHA 2BT3A 3OWUA 3H3HA 1UI8A 2CX0A 1VQL3 2GEYA 1JBRA 5FGOA 4RBNA 1K28A 1FUSA 2ZA4A 3EN1B 4XDVA 5GSPA 1O7GB 1O7PB 1GY6A 2IUKA 3CC73 1BAOA 3DZLA 2BMRB 3SVAA 3SYUA 3S29A 1LRAA 1MGWA 3K0ZA 2XR8B 3UL6A 5RNTA 1VQ83 1PY3A 3FKAA 1QVF2 1A90A 3RGRA 2YX9A 5CLKA 1N9EA 2K0MA 1IV7A 3CME3 2CFLA 3Q3FA 1VQO3 1VQN3 4AEQA 2O9UX 1KQS2 1W01A 4FR9A 1F8NA 1QAKA 1S5AA
chains in the Genus database with same CATH topology
1BRHA 5BU4A 1AQZA 1A2PA 1I2FA 3URPA 2KAAA 1I2EA 2C4BA 3DH2A 1UCJA 1RCKA 1BNSA 1X1XA 1I8VA 4GHOA 1JBSA 1BIRA 3BIRA 2BU4A 1RGGA 1RGHA 1RMSA 1B20A 3GSPA 1BSAA 1BNFA 1BU4A 1BRJA 1GMQA 1B2XA 1Q9EA 1B2SA 1BSBA 4HAAA 3AGNA 1C54A 1R4YA 1ZGXA 1FZUA 1RGLA 1B2ZA 1GOYA 2KF5A 1RHLA 1X1YA 1BNJA 3D5IA 1GOUA 1TTOA 1I0XA 1RLSA 1RGKA 1UCKA 3D4AA 1BNGA 4J5GA 1X1WA 4HOHA 1GOVA 1HZ1A 1PYLA 1RCLA 1RGEA 2RNTA 1YVSA 3KCHA 1UCLA 1TRQA 4GSPA 1MGRA 2F56A 1YGWA 3WR2A 2KF6A 7RNTA 2AAEA 1UCIA 7GSPA 1X1UA 1RDSA 3DGYA 1BRGA 9RNTA 2GSPA 4BIRA 3D5GA 6RNTA 1RTUA 1LOWA 2SARA 3AGOA 1FYSA 3AHWA 1RGCA 1BNIA 1I70A 1AY7A 1BRSA 3AHSA 1I2GA 1G02A 1BGSA 1RN1A 6GSPA 1RGFA 1B21A 1GSPA 1LNIA 1RSNA 1BSDA 5BIRA 1YNVX 1BNEA 1CH0A 1T2IA 2KF3A 5HOHA 1BRNL 2F4YA 1JBTA 3WHOA 1BANA 2KF4A 1FUTA 1GMRA 2RBIA 3HOHA 1BNRA 1T2HA 1RGAA 1B27A 2HOHA 1BSCA 1JBRA 1IYYA 2F5WA 1BRKA 1RNBA 1FW7A 1FUSA 2F5MA 2ZA4A 1BSEA 1BOXA 1RNTA 1TRPA 5GSPA 1B3SA 1GMPA 1BAOA 1DETA 1RN4A 3SYUA 2BIRA 1B2MA 1LRAA 1LOYA 1MGWA 2AADA 3A5EA 5RNTA 1PY3A 4J5KA 1HYFA 8RNTA 1DE3A 4RNTA 1I3IA 3BU4A 1BUJA 4BU4A 1BRIA 3Q3FA 1B2UA 1LOVA 1I0VA 1I3FA 1BVIA 1SARA 3RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRH A;  5BU4 A;  1AQZ A;  1A2P A;  1I2F A;  3URP A;  2KAA A;  1I2E A;  2C4B A;  3DH2 A;  1UCJ A;  1RCK A;  1BNS A;  1X1X A;  1I8V A;  4GHO A;  1JBS A;  1BIR A;  3BIR A;  2BU4 A;  1RGG A;  1RGH A;  1RMS A;  1B20 A;  3GSP A;  1BSA A;  1BNF A;  1BU4 A;  1BRJ A;  1GMQ A;  1B2X A;  1Q9E A;  1B2S A;  1BSB A;  4HAA A;  3AGN A;  1C54 A;  1R4Y A;  1ZGX A;  1FZU A;  1RGL A;  1B2Z A;  1GOY A;  2KF5 A;  1RHL A;  1X1Y A;  1BNJ A;  3D5I A;  1GOU A;  1TTO A;  1I0X A;  1RLS A;  1RGK A;  1UCK A;  3D4A A;  1BNG A;  4J5G A;  1X1W A;  4HOH A;  1GOV A;  1HZ1 A;  1PYL A;  1RCL A;  1RGE A;  2RNT A;  1YVS A;  3KCH A;  1UCL A;  1TRQ A;  4GSP A;  1MGR A;  2F56 A;  1YGW A;  3WR2 A;  2KF6 A;  7RNT A;  2AAE A;  1UCI A;  7GSP A;  1X1U A;  1RDS A;  3DGY A;  1BRG A;  9RNT A;  2GSP A;  4BIR A;  3D5G A;  6RNT A;  1RTU A;  1LOW A;  2SAR A;  3AGO A;  1FYS A;  3AHW A;  1RGC A;  1BNI A;  1I70 A;  1AY7 A;  1BRS A;  3AHS A;  1I2G A;  1G02 A;  1BGS A;  1RN1 A;  6GSP A;  1RGF A;  1B21 A;  1GSP A;  1LNI A;  1RSN A;  1BSD A;  5BIR A;  1YNV X;  1BNE A;  1CH0 A;  1T2I A;  2KF3 A;  5HOH A;  1BRN L;  2F4Y A;  1JBT A;  3WHO A;  1BAN A;  2KF4 A;  1FUT A;  1GMR A;  2RBI A;  3HOH A;  1BNR A;  1T2H A;  1RGA A;  1B27 A;  2HOH A;  1BSC A;  1JBR A;  1IYY A;  2F5W A;  1BRK A;  1RNB A;  1FW7 A;  1FUS A;  2F5M A;  2ZA4 A;  1BSE A;  1BOX A;  1RNT A;  1TRP A;  5GSP A;  1B3S A;  1GMP A;  1BAO A;  1DET A;  1RN4 A;  3SYU A;  2BIR A;  1B2M A;  1LRA A;  1LOY A;  1MGW A;  2AAD A;  3A5E A;  5RNT A;  1PY3 A;  4J5K A;  1HYF A;  8RNT A;  1DE3 A;  4RNT A;  1I3I A;  3BU4 A;  1BUJ A;  4BU4 A;  1BRI A;  3Q3F A;  1B2U A;  1LOV A;  1I0V A;  1I3F A;  1BVI A;  1SAR A;  3RNT A; 
#chains in the Genus database with same CATH topology
 1JB5 A;  5BU4 A;  4WHA A;  5D83 A;  2OQE C;  3CNM A;  3JUO A;  3URP A;  5IG3 A;  1TU5 A;  1I2E A;  2YFJ B;  3DH2 A;  5AYR B;  4CPK A;  2CC3 A;  4HM0 B;  1IVX A;  1IVV A;  3LOY A;  3KKG A;  1BIR A;  1ZS7 A;  3CNX A;  3ER7 A;  2BU4 A;  4CCV A;  1RMS A;  3KFQ C;  1T3B A;  1BSA A;  2R4I A;  3N54 B;  4R1K A;  4DKI A;  3G6E 3;  1CEW I;  2HML B;  1B2X A;  3X3X A;  3CCS 3;  4HAA A;  3FF2 A;  3GZB A;  4FMD A;  1FZU A;  1RGL A;  1A67 A;  1B2Z A;  1YGE A;  5DRE A;  2WO0 A;  3OV4 A;  1E3R A;  3D5I A;  1TTO A;  3F40 A;  5BXQ A;  3WA3 A;  4N6O B;  1YIT 3;  1QJG A;  3EBY A;  2IA7 A;  4J5G A;  1Y4K A;  2STD A;  3NV0 B;  1LQM B;  1RN7 A;  2XF3 A;  2UGI A;  3CU3 A;  4N6M A;  5ELU A;  1QVG 2;  2LYX A;  2OOV A;  4R9L A;  1VZZ A;  3CCU 3;  1OGZ A;  1RGE A;  2QGU A;  1FGM A;  1N5H A;  1VQM 3;  3KCH A;  5CF2 A;  4HM7 B;  1UGH I;  1UW1 A;  2KF6 A;  3FGY A;  7GSP A;  2YFL B;  3B7C A;  4X2O A;  1A2K A;  3AMO B;  3NM7 A;  1EEJ A;  4XBT A;  4XM4 A;  2SAR A;  3F9S A;  5ELJ A;  3EQQ B;  3DXO A;  2P38 A;  1K41 A;  1MWR A;  1Z1S A;  3DGL A;  4FMC A;  5AII A;  3U97 A;  3FZW A;  3VF1 A;  2Z77 A;  3AMO A;  1RGC A;  3I55 3;  4R9K A;  1QAF A;  1GY7 A;  4TX4 A;  3HX8 A;  2O3O A;  2YFI B;  4BL2 A;  5HGR A;  3PCS A;  6GSP A;  1RGF A;  1B21 A;  1GSP A;  1LNI A;  2CIU A;  1OF5 B;  2XFT A;  4AKY A;  5KP4 A;  1V58 A;  4N3V A;  3EJV A;  1TP6 A;  1VQP 3;  1D6U A;  4NRE A;  1Q86 4;  1CH0 A;  1N9J A;  2W04 A;  2W2C A;  2BMO B;  4K90 B;  4EXR A;  1J2B A;  2HMO B;  2B24 B;  1UUW B;  2B1X B;  1STD A;  1OF5 A;  4FMB A;  2F4Y A;  1JBT A;  4I4K A;  1D6Y A;  2OTL 3;  1BAN A;  1FUT A;  1GMR A;  5CK6 A;  3HOH A;  1BNR A;  1N5P A;  3BLZ A;  1RGA A;  2UUG C;  3EC9 A;  1WMO A;  1VQ9 3;  3CXC 2;  2HOH A;  1BSC A;  3NUV A;  4K61 A;  3MPH A;  1N8R 4;  1RNB A;  3WOD G;  4HM5 B;  2LQV A;  1WMP A;  1RNT A;  3DGM A;  4LYL B;  1B3S A;  4LSO A;  3ECF A;  1KSI A;  2IY2 A;  1QAL A;  2BIR A;  3NX0 A;  3QRD A;  4XB5 A;  4Q53 A;  1SIH A;  2Y74 A;  2AAD A;  1UDI I;  3A5E A;  4GL6 A;  3G8Z A;  1JB2 A;  1HYF A;  2C10 A;  1O7H B;  4RNT A;  3BU4 A;  3HZP A;  2QEX 3;  4BU4 A;  3DGN A;  5EVH A;  3G4S 3;  1BRI A;  1TUH A;  1Q81 4;  4L8P A;  1I0V A;  1BVI A;  4RNY A;  3LML A;  1E3V A;  1SAR A;  3KZT A;  3RNT A;  2HMK B;  1AQZ A;  2XEP A;  2ML6 A;  1A2P A;  1I2F A;  1OAC A;  3EBT A;  3JUQ A;  1SJW A;  2KAA A;  1TJD A;  1NB3 I;  3GZY B;  1VQ5 3;  2P0M A;  3ZG5 A;  1RCK A;  4X2H A;  2WOF A;  1I8V A;  1JKG B;  4MJD A;  4CDL A;  4CJN A;  1UGI A;  2L4V A;  3D3L A;  3Q1C A;  2IUJ A;  5CF1 A;  1YIJ 3;  5TGN A;  3BIR A;  3MYT A;  3NQY A;  1RGG A;  5AIG A;  5AI1 A;  5M18 A;  3GSP A;  4BTX A;  1AVL A;  3QK9 A;  1BNF A;  1G0T A;  1ULI B;  1BSB A;  3AGN A;  3LTA A;  4K1V A;  1FGQ A;  3K7C A;  3HK4 A;  1GOY A;  2KF5 A;  2I9W A;  3EB8 A;  3GAX A;  5FW5 A;  1BNJ A;  1C7H A;  1RRL A;  4EV2 A;  1GOU A;  1PU4 A;  1RLS A;  1G96 A;  3D4A A;  1STF I;  3Q90 A;  4BL3 A;  3EN8 A;  3MG2 A;  4HM8 B;  1DMN A;  3L0R A;  3RGA A;  2CX1 A;  2XGL A;  2W9P A;  1GOV A;  3GRD A;  3CCE 3;  2KRT A;  3RDE A;  2CW9 A;  4EW5 A;  3A76 A;  3CCJ 3;  1OCV A;  1TFO A;  3V99 A;  1YVS A;  3NXJ A;  5EQL A;  3F7X A;  1DYU A;  4KFE A;  3OXA A;  4N6T A;  1N8Q A;  1EKM A;  1VQ7 3;  2XSO B;  1CQS A;  2CG1 A;  1KC8 4;  4R4K A;  1OHP A;  9RNT A;  3F14 A;  1M9G A;  1M90 4;  4OK0 A;  1W5Z A;  3D5G A;  1K9M 4;  1RTU A;  1O7N B;  3AGO A;  1ZO2 A;  2HMM B;  3GWR A;  3NHX A;  4HBR A;  1FYS A;  3IJE B;  5AIF A;  3N9H A;  2CG0 A;  2F99 A;  1DVC A;  2Y73 A;  1BNI A;  4G1M B;  1O7W B;  3PZW A;  1AY7 A;  1BRS A;  5G2G A;  3X42 A;  1G02 A;  5IER A;  1W6C A;  1RSN A;  4JRF A;  1Q7H A;  5BIR A;  1YNV X;  1VQ4 3;  1RJO A;  2P05 A;  1NNV A;  2W03 A;  1BNE A;  1GD3 A;  1LNH A;  2W0Q A;  3NV0 A;  4PEJ A;  2OWP A;  3JUM A;  3BB9 A;  4KVH A;  2GU1 A;  3G0K A;  1BRN L;  3FG3 A;  4ZM8 A;  2P0X A;  2CK3 H;  3WHO A;  3NBR A;  1LQG C;  3S67 A;  1EUI C;  1FA3 A;  4ILF A;  4IIA A;  1JZD A;  3ALA A;  3UB1 A;  2L1S A;  5LC6 A;  2RCD A;  4HVN A;  8CHO A;  3D79 A;  3F8X A;  1YJN 3;  1BRK A;  1FW7 A;  2XSH B;  2F5M A;  3FH1 A;  5CXO A;  3CC4 3;  1GYB A;  3SOA A;  1YVB I;  4RZM A;  1W7C A;  1M1K 4;  1TRP A;  2H0G A;  1JZO A;  1R4C A;  1GMP A;  3CC2 3;  2IMJ A;  2OCT A;  1DET A;  2K54 A;  4O3V A;  3KSP A;  2H0H A;  4FCJ A;  2OQE A;  1S72 3;  1LOX A;  2RGQ A;  3NBJ A;  4R80 A;  3ZG0 A;  1VQK 3;  3CMA 3;  2CFD A;  3PGB A;  4WWU C;  1L5G B;  5AYS C;  1ULJ B;  3GZX B;  3EF8 A;  3ZFZ A;  1DE3 A;  2H0I A;  3U1W A;  1K73 4;  2SBL A;  5IEN A;  4AKZ A;  1B2U A;  1LOV A;  1JN5 B;  4KFD A;  1I3F A;  2W6J H;  2QIY A;  1IQX A;  5BVB A;  2BNG A;  3BNB A;  3OX9 A;  1ZX2 A;  3K63 A;  1W2B 2;  3T8N A;  1JN5 A;  3B4O A;  1WTH A;  1W02 A;  2C4B A;  1OUN A;  1UCJ A;  3MG3 A;  3MG1 A;  4N6N B;  3S28 A;  1BNS A;  3IMA B;  4GHO A;  4STD A;  1EA2 A;  1A2V A;  1AVK A;  5D81 A;  1MWS A;  1UUG B;  1JJ2 2;  2HMJ B;  2ML5 A;  3VSY A;  4N6L A;  1RGH A;  1UI7 A;  4EC6 A;  1B20 A;  3NM2 A;  5LC7 A;  2ZL8 A;  1HKX A;  3JUP A;  1SQW A;  1BU4 A;  3JUN A;  3LTC A;  1RKY A;  1BRJ A;  4HZ9 B;  3CCR 3;  2Z76 A;  1ASK A;  1JRQ A;  1R4Y A;  1W6G A;  2W56 B;  4FCZ A;  5IEO A;  1W00 A;  2W9Q A;  1X1Y A;  3FSD A;  3F8H A;  1ROV A;  4KT3 B;  3I0Y A;  1I0X A;  3EX9 A;  4EBG A;  1US1 A;  3MKI A;  3UL5 A;  3CCM 3;  1YJW 3;  3PCR A;  1IV9 A;  1FGO A;  5G1K A;  2FGT A;  3LT9 A;  2W56 A;  3B8L A;  5A0O B;  1OH0 A;  4LGQ A;  1NB5 I;  1JV2 B;  2F86 B;  3OWY A;  1IVU A;  3BNC A;  1O7M B;  2BO9 B;  1NO3 A;  4HM6 B;  1PYL A;  1BUQ A;  4OVM A;  2RNT A;  3X40 A;  1W4N A;  6STD A;  1Q82 4;  4H61 A;  1UCL A;  4HZB B;  3DMC A;  1TIJ A;  3STD A;  4IT7 A;  4GSP A;  3WR2 A;  1RDS A;  3DGY A;  1BRG A;  2CFG A;  4HYZ A;  4BTW A;  5IEP A;  5IF6 A;  1JKG A;  1SII A;  4BIR A;  6RNT A;  1LOW A;  2OTJ 3;  3DGO A;  2OOV C;  3AHW A;  3VGN A;  2CFW A;  1WQL B;  4U13 A;  1NU3 A;  2KXG A;  1I70 A;  3CCQ 3;  2CKF B;  3I56 3;  2F98 A;  2GBX B;  2GXF A;  4GB5 A;  1IT7 A;  1BGS A;  3MWZ A;  3E99 A;  1WNH A;  4NHF A;  2BMQ B;  5I97 A;  3WMD A;  5JPP A;  3O8Y A;  1BSD A;  2FNQ A;  4XBX A;  3HII A;  1YHQ 3;  2HMN B;  2XFS A;  2K3D A;  1UUV B;  3FG4 A;  4IPB A;  1GD4 A;  1M1X B;  5HOH A;  4H3U A;  5JBS A;  3G71 3;  3T8U A;  4HM3 B;  1V57 A;  1GY5 A;  3OW2 2;  4K1U A;  1W6Y A;  2Q07 A;  3MHE A;  1V74 A;  2KF4 A;  3S5C A;  4EYC A;  1U5O A;  2CWU A;  4RNZ A;  4O2H A;  2UX0 A;  3NQZ A;  4I5Q A;  1T2H A;  2RSX A;  4FCM A;  3F7S A;  1OHS A;  3V98 A;  3IPT A;  1B27 A;  3DUK A;  2CHC A;  2FXT A;  3KII A;  1IYY A;  1K8A 4;  2F5W A;  3TDG A;  2BHM A;  4J9A A;  4MEI A;  4QWT A;  1BSE A;  2GU3 A;  3FF0 A;  4MMY B;  3WOF B;  5IW9 A;  5JPU A;  5STD A;  1DVD A;  1BOX A;  1WMN A;  5IG4 A;  2C11 A;  2KCD A;  2E2V A;  3GZR A;  2D1W A;  5D82 A;  5KP1 A;  3EE1 A;  4HJL B;  2INX A;  1RN4 A;  5DRV A;  1B2M A;  4J8T A;  3DY5 A;  1DMM A;  1LOY A;  4LEH A;  4L8O A;  1LXE A;  4J5K A;  4BTY A;  1FGT A;  3BND A;  1I3I A;  3K5T A;  8RNT A;  3X3Z A;  1TFK A;  1BUJ A;  3ROB A;  5IG5 A;  3SX1 A;  1PFP A;  4MMZ B;  3M8C A;  3B4P A;  1YI2 3;  1CYV A;  2WOH A;  4XBY A;  2JQ5 A;  3LZA A;  3H51 A;  1BRH A;  2PNC A;  2D42 A;  2Z6B A;  1JB4 A;  3V92 A;  2PZV A;  1Q42 A;  3N8B A;  1OHO A;  4HM1 B;  1IT8 A;  1MWU A;  1X1X A;  2CH9 A;  1JBS A;  1U8C B;  3PXM A;  2Z7A A;  1T5Y A;  2WGO A;  5IG0 A;  2IYJ A;  1AV4 A;  2E2T A;  4NPB A;  5KP3 A;  1IVW A;  3CCV 3;  4KFF A;  4EV5 A;  2P09 A;  1AR0 A;  1GMQ A;  3LT8 A;  1Q9E A;  4L7K A;  1B2S A;  2R41 A;  3SOY A;  3WOE B;  5M19 A;  3PS8 A;  1C54 A;  3KN4 A;  1ZGX A;  1EQK A;  2GEX A;  4LZI A;  2GBW B;  1RHL A;  5AEU B;  3D9R A;  2M7O A;  2MF7 A;  3CPW 2;  1GS3 A;  1NWW A;  1UCK A;  3LYG A;  1IDP A;  1RGK A;  2WGQ A;  2XGN A;  3SED A;  1BNG A;  3T0U A;  3X3Y A;  3HI7 A;  1OPY A;  1X1W A;  1W2Z A;  3FG1 A;  3LH4 A;  3LTD A;  1ROA A;  4FMA A;  1MWT A;  4HOH A;  4O02 B;  3WDG B;  1ISK A;  1Q7Y 4;  3X41 A;  1HZ1 A;  3G16 A;  5M1A A;  1DMQ A;  1RCL A;  1VQQ A;  3K9M C;  5AEW B;  1FGR A;  1IQY A;  1YJ9 3;  2V1L A;  1TRQ A;  5EEO A;  4KZ1 A;  3S27 A;  1MGR A;  2F56 A;  1YGW A;  2J8X B;  3JVC A;  3UJM A;  7RNT A;  1IK3 A;  2AAE A;  1JNQ A;  1UCI A;  1X1U A;  3BNE A;  4OUQ A;  2E2U A;  2GSP A;  1LVN A;  1D6Z A;  4WFO A;  2MC8 A;  1NJI 4;  4MMX B;  2XRX B;  1IQ8 A;  1SPU A;  3MSO A;  4WYK A;  2RFR A;  2CWV A;  3OWS A;  1OGX A;  4HM2 B;  1FUW A;  3WA2 X;  3KE7 A;  3LXU X;  2A15 A;  2JDI H;  4N6V 0;  4WP5 A;  3SLU A;  2XH9 A;  3EHC A;  3AHS A;  1I2G A;  4XDW A;  1IU7 A;  1MNL A;  1RN1 A;  4O8S A;  4WYK B;  3KSE D;  3CCL 3;  1E97 A;  3SXX A;  2CFK A;  2ZHX B;  1VQ6 3;  3NBB A;  5AIH A;  4JF8 A;  5G1L A;  4LMI A;  3UNL A;  3HIG A;  1MOL A;  1HU9 A;  1T2I A;  2KF3 A;  4HKV B;  1EG9 B;  1KWI A;  4N6U A;  1Q40 B;  4ORL A;  2QA4 3;  2ZDJ A;  3DM8 A;  3Q2P A;  7STD A;  1QMA A;  3FCS B;  4HM4 B;  2CWT A;  3FLJ A;  3PYJ A;  2RBI A;  3LTB A;  1CYU A;  3CPO A;  3J7Y d;  1KD1 4;  3CD6 3;  1Q40 A;  1NDO B;  1RRH A;  2BT3 A;  3OWU A;  3H3H A;  1UI8 A;  2CX0 A;  1VQL 3;  2GEY A;  1JBR A;  5FGO A;  4RBN A;  1K28 A;  1FUS A;  2ZA4 A;  3EN1 B;  4XDV A;  5GSP A;  1O7G B;  1O7P B;  1GY6 A;  2IUK A;  3CC7 3;  1BAO A;  3DZL A;  2BMR B;  3SVA A;  3SYU A;  3S29 A;  1LRA A;  1MGW A;  3K0Z A;  2XR8 B;  3UL6 A;  5RNT A;  1VQ8 3;  1PY3 A;  3FKA A;  1QVF 2;  1A90 A;  3RGR A;  2YX9 A;  5CLK A;  1N9E A;  2K0M A;  1IV7 A;  3CME 3;  2CFL A;  3Q3F A;  1VQO 3;  1VQN 3;  4AEQ A;  2O9U X;  1KQS 2;  1W01 A;  4FR9 A;  1F8N A;  1QAK A;  1S5A A; 
#chains in the Genus database with same CATH homology
 1BRH A;  5BU4 A;  1AQZ A;  1A2P A;  1I2F A;  3URP A;  2KAA A;  1I2E A;  2C4B A;  3DH2 A;  1UCJ A;  1RCK A;  1BNS A;  1X1X A;  1I8V A;  4GHO A;  1JBS A;  1BIR A;  3BIR A;  2BU4 A;  1RGG A;  1RGH A;  1RMS A;  1B20 A;  3GSP A;  1BSA A;  1BNF A;  1BU4 A;  1BRJ A;  1GMQ A;  1B2X A;  1Q9E A;  1B2S A;  1BSB A;  4HAA A;  3AGN A;  1C54 A;  1R4Y A;  1ZGX A;  1FZU A;  1RGL A;  1B2Z A;  1GOY A;  2KF5 A;  1RHL A;  1X1Y A;  1BNJ A;  3D5I A;  1GOU A;  1TTO A;  1I0X A;  1RLS A;  1RGK A;  1UCK A;  3D4A A;  1BNG A;  4J5G A;  1X1W A;  4HOH A;  1GOV A;  1HZ1 A;  1PYL A;  1RCL A;  1RGE A;  2RNT A;  1YVS A;  3KCH A;  1UCL A;  1TRQ A;  4GSP A;  1MGR A;  2F56 A;  1YGW A;  3WR2 A;  2KF6 A;  7RNT A;  2AAE A;  1UCI A;  7GSP A;  1X1U A;  1RDS A;  3DGY A;  1BRG A;  9RNT A;  2GSP A;  4BIR A;  3D5G A;  6RNT A;  1RTU A;  1LOW A;  2SAR A;  3AGO A;  1FYS A;  3AHW A;  1RGC A;  1BNI A;  1I70 A;  1AY7 A;  1BRS A;  3AHS A;  1I2G A;  1G02 A;  1BGS A;  1RN1 A;  6GSP A;  1RGF A;  1B21 A;  1GSP A;  1LNI A;  1RSN A;  1BSD A;  5BIR A;  1YNV X;  1BNE A;  1CH0 A;  1T2I A;  2KF3 A;  5HOH A;  1BRN L;  2F4Y A;  1JBT A;  3WHO A;  1BAN A;  2KF4 A;  1FUT A;  1GMR A;  2RBI A;  3HOH A;  1BNR A;  1T2H A;  1RGA A;  1B27 A;  2HOH A;  1BSC A;  1JBR A;  1IYY A;  2F5W A;  1BRK A;  1RNB A;  1FW7 A;  1FUS A;  2F5M A;  2ZA4 A;  1BSE A;  1BOX A;  1RNT A;  1TRP A;  5GSP A;  1B3S A;  1GMP A;  1BAO A;  1DET A;  1RN4 A;  3SYU A;  2BIR A;  1B2M A;  1LRA A;  1LOY A;  1MGW A;  2AAD A;  3A5E A;  5RNT A;  1PY3 A;  4J5K A;  1HYF A;  8RNT A;  1DE3 A;  4RNT A;  1I3I A;  3BU4 A;  1BUJ A;  4BU4 A;  1BRI A;  3Q3F A;  1B2U A;  1LOV A;  1I0V A;  1I3F A;  1BVI A;  1SAR A;  3RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...