1RGKA

Rnase t1 mutant glu46gln binds the inhibitors 2'gmp and 2'amp at the 3' subsite
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYQGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase T1 mutant Glu46Gln binds the inhibitors 2'GMP and 2'AMP at the 3' subsite.
pubmed doi rcsb
molecule keywords RIBONUCLEASE T1
molecule tags Hydrolase(endoribonuclease)
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgkA00
1FYSA 1AY7A 2KF3A 1B2SA 1UCKA 1TRQA 2KAAA 1FUTA 1BNEA 1FZUA 1PYLA 1T2HA 4BIRA 1RN4A 1I0VA 1B2MA 1YNVX 4J5KA 1X1UA 1CH0A 1BNJA 4J5GA 1DE3A 1AQZA 1LOWA 1I70A 1RGLA 1LOYA 4BU4A 1YGWA 1FUSA 1RN1A 3AGOA 1RTUA 1RGKA 1X1WA 2C4BA 2F4YA 1BSEA 1RMSA 1BRKA 3AHWA 1YVSA 1TTOA 1SARA 3KCHA 3DH2A 1I3IA 9RNTA 1B2UA 1GSPA 3D5IA 3WHOA 8RNTA 1RDSA 1RNBA 3BU4A 3RNTA 2ZA4A 1B2XA 1RGAA 1BUJA 1HYFA 1LRAA 1BSDA 1DETA 1RHLA 1RGCA 1A2PA 2GSPA 1HZ1A 4HAAA 3SYUA 2AAEA 1LOVA 3D4AA 3HOHA 5BIRA 1BANA 1B21A 1RGEA 1I0XA 1RGFA 1BSBA 1BSCA 2F56A 1RCKA 2HOHA 1GOVA 5BU4A 3AGNA 1B3SA 1GOYA 1BNSA 1I2GA 6RNTA 1C54A 1BNGA 1T2IA 1FW7A 3D5GA 1R4YA 1JBSA 2KF6A 3BIRA 7RNTA 3AHSA 1BAOA 1BNRA 2RBIA 2BU4A 4RNTA 1X1XA 1BVIA 5GSPA 1I3FA 2F5WA 1BRNL 1ZGXA 4GSPA 5RNTA 1IYYA 1BSAA 1I8VA 1RNTA 1UCIA 1BRSA 2AADA 1RGGA 5HOHA 1Q9EA 1BNIA 1PY3A 1B2ZA 1BRGA 2KF4A 1BRJA 1GMQA 1BIRA 1LNIA 1GMRA 1B20A 1I2FA 1UCLA 4GHOA 1X1YA 2RNTA 4HOHA 1UCJA 3DGYA 1GOUA 3A5EA 1G02A 2F5MA 1BOXA 1BNFA 1RSNA 1I2EA 2KF5A 1MGWA 1BU4A 7GSPA 1B27A 2BIRA 6GSPA 3WR2A 3GSPA 1BRIA 1TRPA 1RCLA 1BGSA 2SARA 3Q3FA 1GMPA 1JBTA 1BRHA 3URPA 1RLSA 1JBRA 1MGRA 1RGHA
chains in the Genus database with same CATH superfamily
1EEJA 2BMOB 5FGOA 3CCL3 2W2CA 4KT3B 2KAAA 2CWUA 4L7KA 1BNEA 3K5TA 4X2HA 1PYLA 1ULIB 5CF2A 3MG2A 1X1UA 4FMBA 3KSED 4FMDA 4AKYA 1OCVA 3MG1A 2V1LA 3LTBA 1VQQA 1JB4A 1TFKA 2CWTA 4BU4A 1YGWA 3B4OA 4FCJA 1YJ93 3AGOA 1RTUA 1QJGA 1UUGB 1O7WB 4CCVA 1RGKA 4EV5A 3LOYA 1X1WA 1TIJA 2F4YA 1BUQA 3AHWA 1BRKA 4O02B 1WQLB 1KC84 1TTOA 3OV4A 4R80A 4WHAA 1M904 4GL6A 2SBLA 5D83A 2J8XB 3WMDA 3FCSB 4XDVA 1RNBA 1OPYA 2JQ5A 2UX0A 3RNTA 4NHFA 4HM4B 3IPTA 3KIIA 3EB8A 5CXOA 5BXQA 3QRDA 1DMQA 3B4PA 3SXXA 1UGHI 3NM2A 3SYUA 1DYUA 1V57A 3CD63 1E97A 1PU4A 3HOHA 2CFLA 1SJWA 2W6JH 1Q7HA 2KRTA 2W56A 2XF3A 1N8QA 4RZMA 3HI7A 1JKGB 1NB5I 2B1XB 3CC43 1STDA 2GBWB 2P0MA 1FGOA 1IT7A 4FMAA 1A2VA 1VQ73 4FR9A 5FW5A 1Q864 1HU9A 2CX0A 3ROBA 4XBTA 1GY7A 1OGXA 3WA2X 1JRQA 3KE7A 2CC3A 3CCR3 1FW7A 1R4YA 1JBSA 2ZL8A 1ULJB 1CYVA 1YHQ3 3DMCA 3TDGA 5EEOA 3JUPA 3GZRA 2XSOB 3G16A 1JB2A 3EX9A 2D1WA 1BNRA 3LT9A 1QVF2 1EG9B 1DVDA 1RRLA 2BU4A 1AVKA 1X1XA 5AIIA 2RFRA 5GSPA 3EE1A 4HM7B 1IQYA 1BRNL 1NWWA 5RNTA 1W7CA 1IYYA 3GWRA 2K54A 2CX1A 3GZYB 1BRSA 4L8PA 2GEYA 2CH9A 4GHOA 2IUKA 3FG3A 4HM2B 3F9SA 4R4KA 4J9AA 3DGYA 1IK3A 4MMYB 2ZHXB 2WOHA 3NUVA 4O2HA 3A5EA 3K63A 5CK6A 2QGUA 2OQEA 3T0UA 1BNFA 1TFOA 4IT7A 2KF5A 3MPHA 2GU3A 7GSPA 1GD3A 2P09A 4G1MB 1JKGA 3FF0A 4BL2A 5M19A 1BGSA 1L5GB 1MOLA 3F14A 1GMPA 4XBXA 3PGBA 3FF2A 1Z1SA 3MHEA 3MYTA 3K9MC 3G4S3 1J2BA 1GY5A 3EBTA 3NBJA 1D6UA 4EYCA 1AY7A 2KF3A 2XFTA 1QALA 3OW22 3GRDA 5LC7A 1TRQA 1N5PA 2ZDJA 1ISKA 1KWIA 1FZUA 1T2HA 4MEIA 3F40A 1RN4A 2F86B 3UJMA 3WDGB 4BIRA 1YNVX 4J5KA 5AIFA 1E3VA 4BTYA 4K1UA 1R4CA 1LXEA 3X3YA 5CLKA 1UUWB 3VSYA 3CNXA 1ZS7A 2BHMA 1LOWA 4OK0A 1I70A 2A15A 5IENA 2R41A 3LZAA 3B7CA 4STDA 3CU3A 5KP3A 1Q40B 1OGZA 4LYLB 4CDLA 1ASKA 3NHXA 3FH1A 3DGMA 2CKFB 2Y74A 3KCHA 4BTWA 3E99A 4TX4A 4J8TA 5IW9A 3D3LA 1PFPA 1W6CA 1V58A 2YFLB 3BU4A 2Q07A 4EXRA 1CYUA 2C10A 4I4KA 4L8OA 1UDII 4MMZB 1N8R4 5DREA 2Z76A 1U5OA 1C7HA 1HZ1A 3KN4A 3MG3A 3NX0A 1AR0A 2AAEA 1LOVA 5STDA 3FKAA 2L4VA 1BANA 2INXA 3NBBA 1B21A 3F7SA 1RGEA 1AVLA 1I0XA 3QK9A 4HVNA 1K9M4 2HMLB 1RGFA 1UGIA 5JBSA 1FGTA 1BSBA 3X40A 4ORLA 2F56A 4NREA 3NM7A 4LSOA 2IA7A 1KSIA 3AGNA 1SQWA 2Z6BA 3LYGA 3UL6A 3O8YA 1GOYA 1C54A 2W9PA 3HIGA 3DY5A 3MSOA 3EHCA 1Y4KA 2I9WA 1O7NB 1MWUA 3AMOB 3EN1B 4XDWA 1GD4A 2CHCA 2KF6A 3DGOA 3PCRA 3RGRA 3CCV3 3IMAB 1DMMA 2KCDA 1NJI4 1IVXA 4K1VA 2YFIB 1QVG2 4AEQA 3AHSA 3V92A 2UUGC 1Q40A 3U1WA 2FNQA 4LZIA 4N3VA 3SEDA 1GS3A 1JV2B 1CEWI 3MWZA 2CFGA 3NV0A 5LC6A 2MF7A 4KVHA 5KP4A 1WMPA 4RNTA 4WYKB 4IPBA 3A76A 2PNCA 1ZO2A 3D9RA 3N8BA 4KFFA 3GZXB 2UGIA 1MWTA 4HM6B 3D79A 4JRFA 2E2VA 3RGAA 3GZBA 3VF1A 2AADA 1IV9A 1O7GB 4X2OA 2IY2A 1BRGA 5ELJA 1BRJA 1LNIA 1IQXA 1I2FA 4RNYA 4HOHA 1UCJA 2BO9B 1AV4A 1QMAA 3H3HA 3B8LA 4PEJA 2W04A 1G02A 3S29A 1BOXA 1E3RA 4O3VA 1RSNA 4KFDA 2BNGA 5IF6A 2E2UA 4N6NB 2F98A 4HYZA 4HM3B 1EA2A 2PZVA 3PS8A 5AYSC 3CC23 2RSXA 3SX1A 5HGRA 1D6YA 1TRPA 4CPKA 3SOYA 1W6GA 2R4IA 3Q3FA 3UB1A 1Q814 3OXAA 1NNVA 1TUHA 2W03A 1W4NA 3OX9A 5CF1A 3NQYA 1YI23 1D6ZA 3AMOA 3F8HA 2BMQB 1HKXA 3UNLA 1S5AA 1B2SA 1WNHA 4QWTA 5AIHA 1GYBA 3Q2PA 3Q90A 4XB5A 2OOVC 3OWUA 3ER7A 4O8SA 1FUTA 3PXMA 1M9GA 1DMNA 2OTL3 1I0VA 1B2MA 1K734 1CH0A 1BNJA 1IVVA 3HK4A 1EKMA 4J5GA 1FA3A 1AQZA 1FGQA 1JN5B 1VQP3 1T5YA 1LOYA 2XEPA 3Q1CA 5IG5A 1TP6A 1UI7A 3BNCA 1KQS2 2CIUA 1IDPA 1O7MB 3CCQ3 1OH0A 2H0HA 3DM8A 2E2TA 1CQSA 4H61A 1OF5B 1YVSA 3IJEB 1SARA 4XBYA 3S5CA 3WHOA 3WODG 9RNTA 3X42A 3CCU3 1VQK3 2WO0A 5G1LA 1G96A 2GXFA 1GY6A 1RDSA 2K0MA 2STDA 2WGQA 3HIIA 3LTAA 1MNLA 1NB3I 5AI1A 3BNEA 2Y73A 1FGMA 3DXOA 2ZA4A 3LTCA 1BUJA 2W9QA 1LRAA 2CK3H 3CCS3 1KD14 1BSDA 1DETA 1RHLA 1O7HB 4N6OB 3G713 2H0GA 4OUQA 1RJOA 5JPUA 2YFJB 4HAAA 2F99A 4R9KA 4IIAA 2BT3A 3CPOA 3D4AA 4R1KA 2H0IA 1JB5A 5BIRA 3PZWA 4I5QA 3PCSA 5IEOA 2MC8A 1W02A 2P38A 2Z77A 1BSCA 2HMKB 1W6YA 4HJLB 2HOHA 2JDIH 1Q42A 1Q824 1RN7A 1B3SA 2L1SA 3ALAA 1LQMB 1I2GA 6RNTA 2CG0A 3I0YA 5KP1A 2K3DA 1QAFA 2P05A 1W00A 2HMNB 4HM8B 4EV2A 1A67A 5A0OB 3NXJA 5IG4A 2CG1A 3BIRA 2XFSA 2CW9A 4EBGA 2XR8B 7RNTA 4FCMA 3BNDA 3ZG0A 3WA3A 1UUVB 3FZWA 3G8ZA 3UL5A 5G1KA 5IG3A 5AEWB 2FXTA 4WP5A 2QA43 1ROAA 4LMIA 8CHOA 1LOXA 1BAOA 5IG0A 2RBIA 1T3BA 1US1A 3FSDA 2XGLA 3KFQC 2XSHB 1IU7A 3WOEB 2F5WA 2LYXA 3V99A 1W5ZA 2CWVA 5DRVA 1VQM3 1VQN3 1WTHA 2W0QA 3ZFZA 5HOHA 5ELUA 4HM5B 3S67A 5M18A 3CXC2 2M7OA 1LNHA 4AKZA 4K61A 1BIRA 1UCLA 1B20A 5EQLA 3U97A 2RNTA 1W2B2 1VQ83 1DVCA 4WFOA 4ZM8A 1GOUA 4RBNA 1YJN3 4HZBB 3BLZA 3OWSA 5G2GA 4GB5A 4MJDA 3JUMA 1VQ53 1MGWA 3CNMA 1BU4A 4NPBA 1QAKA 5I97A 1IQ8A 4BTXA 3RDEA 6GSPA 3WR2A 3OWYA 4FMCA 2XRXB 1WMOA 3LXUX 5EVHA 4EW5A 1RCLA 3FLJA 2QEX3 2HMOB 2SARA 1JZDA 1MWRA 3GAXA 1JZOA 1IV7A 4N6LA 2D42A 1IT8A 3F8XA 3ZG5A 1BRHA 1VQ63 2OQEC 3CCM3 1UI8A 2GU1A 3KSPA 1YJW3 1M1XB 1RLSA 2WGOA 3MKIA 3N54B 1MGRA 1RGHA 1VQL3 3FGYA 1FYSA 1JJ22 1W01A 2C11A 2RGQA 3DZLA 1UCKA 3CMA3 1YGEA 2GBXB 3PYJA 5AIGA 1JNQA 2KXGA 3DGNA 3EN8A 4DKIA 4HZ9B 3F7XA 3N9HA 1OHSA 3L0RA 3X3ZA 3I563 5D82A 5JPPA 1DE3A 1STFI 1K41A 1EUIC 1UW1A 2YX9A 5BVBA 1RGLA 1NDOB 1N9JA 3FG4A 1N5HA 3I553 4ILFA 1FUSA 1RN1A 3M8CA 2OWPA 1MWSA 1K8A4 2HMJB 2C4BA 1RRHA 1TJDA 1BSEA 3EF8A 2CFDA 1RMSA 3NBRA 1SIHA 1VQO3 3DH2A 1I3IA 1B2UA 1GSPA 3D5IA 8RNTA 4N6TA 1OHPA 3FG1A 4OVMA 1TU5A 2WOFA 1W2ZA 1B2XA 1LQGC 1RGAA 2IMJA 1HYFA 3HX8A 1RGCA 2RCDA 1Q7Y4 1WMNA 5IERA 1A2PA 2GSPA 1YIJ3 3EBYA 2IUJA 4HKVB 1SPUA 3G0KA 1VQ93 2CFWA 3LMLA 4U13A 3DGLA 1G0TA 4WYKA 1IVUA 1K28A 2QIYA 4JF8A 1A2KA 2LQVA 1ZX2A 1OACA 1ROVA 2XGNA 5M1AA 1A90A 3CCE3 1SIIA 1YVBI 3HZPA 3JUOA 3SOAA 3T8UA 1RCKA 4LGQA 1GOVA 5BU4A 1IVWA 3SVAA 3CCJ3 4RNZA 1BNSA 2ML5A 3JVCA 4HM0B 4BL3A 3STDA 1BNGA 2BMRB 1T2IA 3BNBA 5TGNA 3T8NA 3D5GA 3K7CA 3VGNA 1OHOA 1V74A 2HMMB 1VZZA 4N6UA 2OTJ3 4K90B 3EC9A 7STDA 4Q53A 2O3OA 2P0XA 1FGRA 3EQQB 5D81A 3BB9A 5IEPA 3LH4A 3X41A 3S27A 1O7PB 3LTDA 2B24B 4HBRA 3LT8A 1U8CB 4HM1B 3WOFB 1YIT3 1BVIA 3ECFA 1I3FA 1S723 4CJNA 1ZGXA 4GSPA 2IYJA 1BSAA 1I8VA 1RNTA 2CFKA 1UCIA 4N6V0 2Z7AA 3KKGA 1RGGA 1NU3A 6STDA 1Q9EA 1BNIA 4KFEA 1PY3A 1B2ZA 5AEUB 2KF4A 1VQ43 4XM4A 1F8NA 1GMQA 3SLUA 1GMRA 1RKYA 1M1K4 1X1YA 2OCTA 3KZTA 4N6MA 3JUNA 3CC73 4FCZA 2XH9A 3EJVA 2F5MA 1OUNA 3CPW2 4R9LA 1LVNA 1JN5A 1I2EA 5AYRB 3J7Yd 2FGTA 3K0ZA 3V98A 1B27A 2BIRA 3G6E3 2O9UX 4WWUC 2OOVA 3X3XA 3GSPA 3S28A 4EC6A 1BRIA 4LEHA 3DUKA 3NQZA 2GEXA 3H51A 1N9EA 3NV0B 1JBTA 2ML6A 1OF5A 2W56B 4KZ1A 1NO3A 4H3UA 1EQKA 3JUQA 3URPA 1FUWA 1JBRA 4MMXB 3CME3
chains in the Genus database with same CATH topology
1FYSA 1AY7A 2KF3A 1B2SA 1UCKA 1TRQA 2KAAA 1FUTA 1BNEA 1FZUA 1PYLA 1T2HA 4BIRA 1RN4A 1I0VA 1B2MA 1YNVX 4J5KA 1X1UA 1CH0A 1BNJA 4J5GA 1DE3A 1AQZA 1LOWA 1I70A 1RGLA 1LOYA 4BU4A 1YGWA 1FUSA 1RN1A 3AGOA 1RTUA 1RGKA 1X1WA 2C4BA 2F4YA 1BSEA 1RMSA 1BRKA 3AHWA 1YVSA 1TTOA 1SARA 3KCHA 3DH2A 1I3IA 9RNTA 1B2UA 1GSPA 3D5IA 3WHOA 8RNTA 1RDSA 1RNBA 3BU4A 3RNTA 2ZA4A 1B2XA 1RGAA 1BUJA 1HYFA 1LRAA 1BSDA 1DETA 1RHLA 1RGCA 1A2PA 2GSPA 1HZ1A 4HAAA 3SYUA 2AAEA 1LOVA 3D4AA 3HOHA 5BIRA 1BANA 1B21A 1RGEA 1I0XA 1RGFA 1BSBA 1BSCA 2F56A 1RCKA 2HOHA 1GOVA 5BU4A 3AGNA 1B3SA 1GOYA 1BNSA 1I2GA 6RNTA 1C54A 1BNGA 1T2IA 1FW7A 3D5GA 1R4YA 1JBSA 2KF6A 3BIRA 7RNTA 3AHSA 1BAOA 1BNRA 2RBIA 2BU4A 4RNTA 1X1XA 1BVIA 5GSPA 1I3FA 2F5WA 1BRNL 1ZGXA 4GSPA 5RNTA 1IYYA 1BSAA 1I8VA 1RNTA 1UCIA 1BRSA 2AADA 1RGGA 5HOHA 1Q9EA 1BNIA 1PY3A 1B2ZA 1BRGA 2KF4A 1BRJA 1GMQA 1BIRA 1LNIA 1GMRA 1B20A 1I2FA 1UCLA 4GHOA 1X1YA 2RNTA 4HOHA 1UCJA 3DGYA 1GOUA 3A5EA 1G02A 2F5MA 1BOXA 1BNFA 1RSNA 1I2EA 2KF5A 1MGWA 1BU4A 7GSPA 1B27A 2BIRA 6GSPA 3WR2A 3GSPA 1BRIA 1TRPA 1RCLA 1BGSA 2SARA 3Q3FA 1GMPA 1JBTA 1BRHA 3URPA 1RLSA 1JBRA 1MGRA 1RGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYS A;  1AY7 A;  2KF3 A;  1B2S A;  1UCK A;  1TRQ A;  2KAA A;  1FUT A;  1BNE A;  1FZU A;  1PYL A;  1T2H A;  4BIR A;  1RN4 A;  1I0V A;  1B2M A;  1YNV X;  4J5K A;  1X1U A;  1CH0 A;  1BNJ A;  4J5G A;  1DE3 A;  1AQZ A;  1LOW A;  1I70 A;  1RGL A;  1LOY A;  4BU4 A;  1YGW A;  1FUS A;  1RN1 A;  3AGO A;  1RTU A;  1RGK A;  1X1W A;  2C4B A;  2F4Y A;  1BSE A;  1RMS A;  1BRK A;  3AHW A;  1YVS A;  1TTO A;  1SAR A;  3KCH A;  3DH2 A;  1I3I A;  9RNT A;  1B2U A;  1GSP A;  3D5I A;  3WHO A;  8RNT A;  1RDS A;  1RNB A;  3BU4 A;  3RNT A;  2ZA4 A;  1B2X A;  1RGA A;  1BUJ A;  1HYF A;  1LRA A;  1BSD A;  1DET A;  1RHL A;  1RGC A;  1A2P A;  2GSP A;  1HZ1 A;  4HAA A;  3SYU A;  2AAE A;  1LOV A;  3D4A A;  3HOH A;  5BIR A;  1BAN A;  1B21 A;  1RGE A;  1I0X A;  1RGF A;  1BSB A;  1BSC A;  2F56 A;  1RCK A;  2HOH A;  1GOV A;  5BU4 A;  3AGN A;  1B3S A;  1GOY A;  1BNS A;  1I2G A;  6RNT A;  1C54 A;  1BNG A;  1T2I A;  1FW7 A;  3D5G A;  1R4Y A;  1JBS A;  2KF6 A;  3BIR A;  7RNT A;  3AHS A;  1BAO A;  1BNR A;  2RBI A;  2BU4 A;  4RNT A;  1X1X A;  1BVI A;  5GSP A;  1I3F A;  2F5W A;  1BRN L;  1ZGX A;  4GSP A;  5RNT A;  1IYY A;  1BSA A;  1I8V A;  1RNT A;  1UCI A;  1BRS A;  2AAD A;  1RGG A;  5HOH A;  1Q9E A;  1BNI A;  1PY3 A;  1B2Z A;  1BRG A;  2KF4 A;  1BRJ A;  1GMQ A;  1BIR A;  1LNI A;  1GMR A;  1B20 A;  1I2F A;  1UCL A;  4GHO A;  1X1Y A;  2RNT A;  4HOH A;  1UCJ A;  3DGY A;  1GOU A;  3A5E A;  1G02 A;  2F5M A;  1BOX A;  1BNF A;  1RSN A;  1I2E A;  2KF5 A;  1MGW A;  1BU4 A;  7GSP A;  1B27 A;  2BIR A;  6GSP A;  3WR2 A;  3GSP A;  1BRI A;  1TRP A;  1RCL A;  1BGS A;  2SAR A;  3Q3F A;  1GMP A;  1JBT A;  1BRH A;  3URP A;  1RLS A;  1JBR A;  1MGR A;  1RGH A; 
#chains in the Genus database with same CATH topology
 1EEJ A;  2BMO B;  5FGO A;  3CCL 3;  2W2C A;  4KT3 B;  2KAA A;  2CWU A;  4L7K A;  1BNE A;  3K5T A;  4X2H A;  1PYL A;  1ULI B;  5CF2 A;  3MG2 A;  1X1U A;  4FMB A;  3KSE D;  4FMD A;  4AKY A;  1OCV A;  3MG1 A;  2V1L A;  3LTB A;  1VQQ A;  1JB4 A;  1TFK A;  2CWT A;  4BU4 A;  1YGW A;  3B4O A;  4FCJ A;  1YJ9 3;  3AGO A;  1RTU A;  1QJG A;  1UUG B;  1O7W B;  4CCV A;  1RGK A;  4EV5 A;  3LOY A;  1X1W A;  1TIJ A;  2F4Y A;  1BUQ A;  3AHW A;  1BRK A;  4O02 B;  1WQL B;  1KC8 4;  1TTO A;  3OV4 A;  4R80 A;  4WHA A;  1M90 4;  4GL6 A;  2SBL A;  5D83 A;  2J8X B;  3WMD A;  3FCS B;  4XDV A;  1RNB A;  1OPY A;  2JQ5 A;  2UX0 A;  3RNT A;  4NHF A;  4HM4 B;  3IPT A;  3KII A;  3EB8 A;  5CXO A;  5BXQ A;  3QRD A;  1DMQ A;  3B4P A;  3SXX A;  1UGH I;  3NM2 A;  3SYU A;  1DYU A;  1V57 A;  3CD6 3;  1E97 A;  1PU4 A;  3HOH A;  2CFL A;  1SJW A;  2W6J H;  1Q7H A;  2KRT A;  2W56 A;  2XF3 A;  1N8Q A;  4RZM A;  3HI7 A;  1JKG B;  1NB5 I;  2B1X B;  3CC4 3;  1STD A;  2GBW B;  2P0M A;  1FGO A;  1IT7 A;  4FMA A;  1A2V A;  1VQ7 3;  4FR9 A;  5FW5 A;  1Q86 4;  1HU9 A;  2CX0 A;  3ROB A;  4XBT A;  1GY7 A;  1OGX A;  3WA2 X;  1JRQ A;  3KE7 A;  2CC3 A;  3CCR 3;  1FW7 A;  1R4Y A;  1JBS A;  2ZL8 A;  1ULJ B;  1CYV A;  1YHQ 3;  3DMC A;  3TDG A;  5EEO A;  3JUP A;  3GZR A;  2XSO B;  3G16 A;  1JB2 A;  3EX9 A;  2D1W A;  1BNR A;  3LT9 A;  1QVF 2;  1EG9 B;  1DVD A;  1RRL A;  2BU4 A;  1AVK A;  1X1X A;  5AII A;  2RFR A;  5GSP A;  3EE1 A;  4HM7 B;  1IQY A;  1BRN L;  1NWW A;  5RNT A;  1W7C A;  1IYY A;  3GWR A;  2K54 A;  2CX1 A;  3GZY B;  1BRS A;  4L8P A;  2GEY A;  2CH9 A;  4GHO A;  2IUK A;  3FG3 A;  4HM2 B;  3F9S A;  4R4K A;  4J9A A;  3DGY A;  1IK3 A;  4MMY B;  2ZHX B;  2WOH A;  3NUV A;  4O2H A;  3A5E A;  3K63 A;  5CK6 A;  2QGU A;  2OQE A;  3T0U A;  1BNF A;  1TFO A;  4IT7 A;  2KF5 A;  3MPH A;  2GU3 A;  7GSP A;  1GD3 A;  2P09 A;  4G1M B;  1JKG A;  3FF0 A;  4BL2 A;  5M19 A;  1BGS A;  1L5G B;  1MOL A;  3F14 A;  1GMP A;  4XBX A;  3PGB A;  3FF2 A;  1Z1S A;  3MHE A;  3MYT A;  3K9M C;  3G4S 3;  1J2B A;  1GY5 A;  3EBT A;  3NBJ A;  1D6U A;  4EYC A;  1AY7 A;  2KF3 A;  2XFT A;  1QAL A;  3OW2 2;  3GRD A;  5LC7 A;  1TRQ A;  1N5P A;  2ZDJ A;  1ISK A;  1KWI A;  1FZU A;  1T2H A;  4MEI A;  3F40 A;  1RN4 A;  2F86 B;  3UJM A;  3WDG B;  4BIR A;  1YNV X;  4J5K A;  5AIF A;  1E3V A;  4BTY A;  4K1U A;  1R4C A;  1LXE A;  3X3Y A;  5CLK A;  1UUW B;  3VSY A;  3CNX A;  1ZS7 A;  2BHM A;  1LOW A;  4OK0 A;  1I70 A;  2A15 A;  5IEN A;  2R41 A;  3LZA A;  3B7C A;  4STD A;  3CU3 A;  5KP3 A;  1Q40 B;  1OGZ A;  4LYL B;  4CDL A;  1ASK A;  3NHX A;  3FH1 A;  3DGM A;  2CKF B;  2Y74 A;  3KCH A;  4BTW A;  3E99 A;  4TX4 A;  4J8T A;  5IW9 A;  3D3L A;  1PFP A;  1W6C A;  1V58 A;  2YFL B;  3BU4 A;  2Q07 A;  4EXR A;  1CYU A;  2C10 A;  4I4K A;  4L8O A;  1UDI I;  4MMZ B;  1N8R 4;  5DRE A;  2Z76 A;  1U5O A;  1C7H A;  1HZ1 A;  3KN4 A;  3MG3 A;  3NX0 A;  1AR0 A;  2AAE A;  1LOV A;  5STD A;  3FKA A;  2L4V A;  1BAN A;  2INX A;  3NBB A;  1B21 A;  3F7S A;  1RGE A;  1AVL A;  1I0X A;  3QK9 A;  4HVN A;  1K9M 4;  2HML B;  1RGF A;  1UGI A;  5JBS A;  1FGT A;  1BSB A;  3X40 A;  4ORL A;  2F56 A;  4NRE A;  3NM7 A;  4LSO A;  2IA7 A;  1KSI A;  3AGN A;  1SQW A;  2Z6B A;  3LYG A;  3UL6 A;  3O8Y A;  1GOY A;  1C54 A;  2W9P A;  3HIG A;  3DY5 A;  3MSO A;  3EHC A;  1Y4K A;  2I9W A;  1O7N B;  1MWU A;  3AMO B;  3EN1 B;  4XDW A;  1GD4 A;  2CHC A;  2KF6 A;  3DGO A;  3PCR A;  3RGR A;  3CCV 3;  3IMA B;  1DMM A;  2KCD A;  1NJI 4;  1IVX A;  4K1V A;  2YFI B;  1QVG 2;  4AEQ A;  3AHS A;  3V92 A;  2UUG C;  1Q40 A;  3U1W A;  2FNQ A;  4LZI A;  4N3V A;  3SED A;  1GS3 A;  1JV2 B;  1CEW I;  3MWZ A;  2CFG A;  3NV0 A;  5LC6 A;  2MF7 A;  4KVH A;  5KP4 A;  1WMP A;  4RNT A;  4WYK B;  4IPB A;  3A76 A;  2PNC A;  1ZO2 A;  3D9R A;  3N8B A;  4KFF A;  3GZX B;  2UGI A;  1MWT A;  4HM6 B;  3D79 A;  4JRF A;  2E2V A;  3RGA A;  3GZB A;  3VF1 A;  2AAD A;  1IV9 A;  1O7G B;  4X2O A;  2IY2 A;  1BRG A;  5ELJ A;  1BRJ A;  1LNI A;  1IQX A;  1I2F A;  4RNY A;  4HOH A;  1UCJ A;  2BO9 B;  1AV4 A;  1QMA A;  3H3H A;  3B8L A;  4PEJ A;  2W04 A;  1G02 A;  3S29 A;  1BOX A;  1E3R A;  4O3V A;  1RSN A;  4KFD A;  2BNG A;  5IF6 A;  2E2U A;  4N6N B;  2F98 A;  4HYZ A;  4HM3 B;  1EA2 A;  2PZV A;  3PS8 A;  5AYS C;  3CC2 3;  2RSX A;  3SX1 A;  5HGR A;  1D6Y A;  1TRP A;  4CPK A;  3SOY A;  1W6G A;  2R4I A;  3Q3F A;  3UB1 A;  1Q81 4;  3OXA A;  1NNV A;  1TUH A;  2W03 A;  1W4N A;  3OX9 A;  5CF1 A;  3NQY A;  1YI2 3;  1D6Z A;  3AMO A;  3F8H A;  2BMQ B;  1HKX A;  3UNL A;  1S5A A;  1B2S A;  1WNH A;  4QWT A;  5AIH A;  1GYB A;  3Q2P A;  3Q90 A;  4XB5 A;  2OOV C;  3OWU A;  3ER7 A;  4O8S A;  1FUT A;  3PXM A;  1M9G A;  1DMN A;  2OTL 3;  1I0V A;  1B2M A;  1K73 4;  1CH0 A;  1BNJ A;  1IVV A;  3HK4 A;  1EKM A;  4J5G A;  1FA3 A;  1AQZ A;  1FGQ A;  1JN5 B;  1VQP 3;  1T5Y A;  1LOY A;  2XEP A;  3Q1C A;  5IG5 A;  1TP6 A;  1UI7 A;  3BNC A;  1KQS 2;  2CIU A;  1IDP A;  1O7M B;  3CCQ 3;  1OH0 A;  2H0H A;  3DM8 A;  2E2T A;  1CQS A;  4H61 A;  1OF5 B;  1YVS A;  3IJE B;  1SAR A;  4XBY A;  3S5C A;  3WHO A;  3WOD G;  9RNT A;  3X42 A;  3CCU 3;  1VQK 3;  2WO0 A;  5G1L A;  1G96 A;  2GXF A;  1GY6 A;  1RDS A;  2K0M A;  2STD A;  2WGQ A;  3HII A;  3LTA A;  1MNL A;  1NB3 I;  5AI1 A;  3BNE A;  2Y73 A;  1FGM A;  3DXO A;  2ZA4 A;  3LTC A;  1BUJ A;  2W9Q A;  1LRA A;  2CK3 H;  3CCS 3;  1KD1 4;  1BSD A;  1DET A;  1RHL A;  1O7H B;  4N6O B;  3G71 3;  2H0G A;  4OUQ A;  1RJO A;  5JPU A;  2YFJ B;  4HAA A;  2F99 A;  4R9K A;  4IIA A;  2BT3 A;  3CPO A;  3D4A A;  4R1K A;  2H0I A;  1JB5 A;  5BIR A;  3PZW A;  4I5Q A;  3PCS A;  5IEO A;  2MC8 A;  1W02 A;  2P38 A;  2Z77 A;  1BSC A;  2HMK B;  1W6Y A;  4HJL B;  2HOH A;  2JDI H;  1Q42 A;  1Q82 4;  1RN7 A;  1B3S A;  2L1S A;  3ALA A;  1LQM B;  1I2G A;  6RNT A;  2CG0 A;  3I0Y A;  5KP1 A;  2K3D A;  1QAF A;  2P05 A;  1W00 A;  2HMN B;  4HM8 B;  4EV2 A;  1A67 A;  5A0O B;  3NXJ A;  5IG4 A;  2CG1 A;  3BIR A;  2XFS A;  2CW9 A;  4EBG A;  2XR8 B;  7RNT A;  4FCM A;  3BND A;  3ZG0 A;  3WA3 A;  1UUV B;  3FZW A;  3G8Z A;  3UL5 A;  5G1K A;  5IG3 A;  5AEW B;  2FXT A;  4WP5 A;  2QA4 3;  1ROA A;  4LMI A;  8CHO A;  1LOX A;  1BAO A;  5IG0 A;  2RBI A;  1T3B A;  1US1 A;  3FSD A;  2XGL A;  3KFQ C;  2XSH B;  1IU7 A;  3WOE B;  2F5W A;  2LYX A;  3V99 A;  1W5Z A;  2CWV A;  5DRV A;  1VQM 3;  1VQN 3;  1WTH A;  2W0Q A;  3ZFZ A;  5HOH A;  5ELU A;  4HM5 B;  3S67 A;  5M18 A;  3CXC 2;  2M7O A;  1LNH A;  4AKZ A;  4K61 A;  1BIR A;  1UCL A;  1B20 A;  5EQL A;  3U97 A;  2RNT A;  1W2B 2;  1VQ8 3;  1DVC A;  4WFO A;  4ZM8 A;  1GOU A;  4RBN A;  1YJN 3;  4HZB B;  3BLZ A;  3OWS A;  5G2G A;  4GB5 A;  4MJD A;  3JUM A;  1VQ5 3;  1MGW A;  3CNM A;  1BU4 A;  4NPB A;  1QAK A;  5I97 A;  1IQ8 A;  4BTX A;  3RDE A;  6GSP A;  3WR2 A;  3OWY A;  4FMC A;  2XRX B;  1WMO A;  3LXU X;  5EVH A;  4EW5 A;  1RCL A;  3FLJ A;  2QEX 3;  2HMO B;  2SAR A;  1JZD A;  1MWR A;  3GAX A;  1JZO A;  1IV7 A;  4N6L A;  2D42 A;  1IT8 A;  3F8X A;  3ZG5 A;  1BRH A;  1VQ6 3;  2OQE C;  3CCM 3;  1UI8 A;  2GU1 A;  3KSP A;  1YJW 3;  1M1X B;  1RLS A;  2WGO A;  3MKI A;  3N54 B;  1MGR A;  1RGH A;  1VQL 3;  3FGY A;  1FYS A;  1JJ2 2;  1W01 A;  2C11 A;  2RGQ A;  3DZL A;  1UCK A;  3CMA 3;  1YGE A;  2GBX B;  3PYJ A;  5AIG A;  1JNQ A;  2KXG A;  3DGN A;  3EN8 A;  4DKI A;  4HZ9 B;  3F7X A;  3N9H A;  1OHS A;  3L0R A;  3X3Z A;  3I56 3;  5D82 A;  5JPP A;  1DE3 A;  1STF I;  1K41 A;  1EUI C;  1UW1 A;  2YX9 A;  5BVB A;  1RGL A;  1NDO B;  1N9J A;  3FG4 A;  1N5H A;  3I55 3;  4ILF A;  1FUS A;  1RN1 A;  3M8C A;  2OWP A;  1MWS A;  1K8A 4;  2HMJ B;  2C4B A;  1RRH A;  1TJD A;  1BSE A;  3EF8 A;  2CFD A;  1RMS A;  3NBR A;  1SIH A;  1VQO 3;  3DH2 A;  1I3I A;  1B2U A;  1GSP A;  3D5I A;  8RNT A;  4N6T A;  1OHP A;  3FG1 A;  4OVM A;  1TU5 A;  2WOF A;  1W2Z A;  1B2X A;  1LQG C;  1RGA A;  2IMJ A;  1HYF A;  3HX8 A;  1RGC A;  2RCD A;  1Q7Y 4;  1WMN A;  5IER A;  1A2P A;  2GSP A;  1YIJ 3;  3EBY A;  2IUJ A;  4HKV B;  1SPU A;  3G0K A;  1VQ9 3;  2CFW A;  3LML A;  4U13 A;  3DGL A;  1G0T A;  4WYK A;  1IVU A;  1K28 A;  2QIY A;  4JF8 A;  1A2K A;  2LQV A;  1ZX2 A;  1OAC A;  1ROV A;  2XGN A;  5M1A A;  1A90 A;  3CCE 3;  1SII A;  1YVB I;  3HZP A;  3JUO A;  3SOA A;  3T8U A;  1RCK A;  4LGQ A;  1GOV A;  5BU4 A;  1IVW A;  3SVA A;  3CCJ 3;  4RNZ A;  1BNS A;  2ML5 A;  3JVC A;  4HM0 B;  4BL3 A;  3STD A;  1BNG A;  2BMR B;  1T2I A;  3BNB A;  5TGN A;  3T8N A;  3D5G A;  3K7C A;  3VGN A;  1OHO A;  1V74 A;  2HMM B;  1VZZ A;  4N6U A;  2OTJ 3;  4K90 B;  3EC9 A;  7STD A;  4Q53 A;  2O3O A;  2P0X A;  1FGR A;  3EQQ B;  5D81 A;  3BB9 A;  5IEP A;  3LH4 A;  3X41 A;  3S27 A;  1O7P B;  3LTD A;  2B24 B;  4HBR A;  3LT8 A;  1U8C B;  4HM1 B;  3WOF B;  1YIT 3;  1BVI A;  3ECF A;  1I3F A;  1S72 3;  4CJN A;  1ZGX A;  4GSP A;  2IYJ A;  1BSA A;  1I8V A;  1RNT A;  2CFK A;  1UCI A;  4N6V 0;  2Z7A A;  3KKG A;  1RGG A;  1NU3 A;  6STD A;  1Q9E A;  1BNI A;  4KFE A;  1PY3 A;  1B2Z A;  5AEU B;  2KF4 A;  1VQ4 3;  4XM4 A;  1F8N A;  1GMQ A;  3SLU A;  1GMR A;  1RKY A;  1M1K 4;  1X1Y A;  2OCT A;  3KZT A;  4N6M A;  3JUN A;  3CC7 3;  4FCZ A;  2XH9 A;  3EJV A;  2F5M A;  1OUN A;  3CPW 2;  4R9L A;  1LVN A;  1JN5 A;  1I2E A;  5AYR B;  3J7Y d;  2FGT A;  3K0Z A;  3V98 A;  1B27 A;  2BIR A;  3G6E 3;  2O9U X;  4WWU C;  2OOV A;  3X3X A;  3GSP A;  3S28 A;  4EC6 A;  1BRI A;  4LEH A;  3DUK A;  3NQZ A;  2GEX A;  3H51 A;  1N9E A;  3NV0 B;  1JBT A;  2ML6 A;  1OF5 A;  2W56 B;  4KZ1 A;  1NO3 A;  4H3U A;  1EQK A;  3JUQ A;  3URP A;  1FUW A;  1JBR A;  4MMX B;  3CME 3; 
#chains in the Genus database with same CATH homology
 1FYS A;  1AY7 A;  2KF3 A;  1B2S A;  1UCK A;  1TRQ A;  2KAA A;  1FUT A;  1BNE A;  1FZU A;  1PYL A;  1T2H A;  4BIR A;  1RN4 A;  1I0V A;  1B2M A;  1YNV X;  4J5K A;  1X1U A;  1CH0 A;  1BNJ A;  4J5G A;  1DE3 A;  1AQZ A;  1LOW A;  1I70 A;  1RGL A;  1LOY A;  4BU4 A;  1YGW A;  1FUS A;  1RN1 A;  3AGO A;  1RTU A;  1RGK A;  1X1W A;  2C4B A;  2F4Y A;  1BSE A;  1RMS A;  1BRK A;  3AHW A;  1YVS A;  1TTO A;  1SAR A;  3KCH A;  3DH2 A;  1I3I A;  9RNT A;  1B2U A;  1GSP A;  3D5I A;  3WHO A;  8RNT A;  1RDS A;  1RNB A;  3BU4 A;  3RNT A;  2ZA4 A;  1B2X A;  1RGA A;  1BUJ A;  1HYF A;  1LRA A;  1BSD A;  1DET A;  1RHL A;  1RGC A;  1A2P A;  2GSP A;  1HZ1 A;  4HAA A;  3SYU A;  2AAE A;  1LOV A;  3D4A A;  3HOH A;  5BIR A;  1BAN A;  1B21 A;  1RGE A;  1I0X A;  1RGF A;  1BSB A;  1BSC A;  2F56 A;  1RCK A;  2HOH A;  1GOV A;  5BU4 A;  3AGN A;  1B3S A;  1GOY A;  1BNS A;  1I2G A;  6RNT A;  1C54 A;  1BNG A;  1T2I A;  1FW7 A;  3D5G A;  1R4Y A;  1JBS A;  2KF6 A;  3BIR A;  7RNT A;  3AHS A;  1BAO A;  1BNR A;  2RBI A;  2BU4 A;  4RNT A;  1X1X A;  1BVI A;  5GSP A;  1I3F A;  2F5W A;  1BRN L;  1ZGX A;  4GSP A;  5RNT A;  1IYY A;  1BSA A;  1I8V A;  1RNT A;  1UCI A;  1BRS A;  2AAD A;  1RGG A;  5HOH A;  1Q9E A;  1BNI A;  1PY3 A;  1B2Z A;  1BRG A;  2KF4 A;  1BRJ A;  1GMQ A;  1BIR A;  1LNI A;  1GMR A;  1B20 A;  1I2F A;  1UCL A;  4GHO A;  1X1Y A;  2RNT A;  4HOH A;  1UCJ A;  3DGY A;  1GOU A;  3A5E A;  1G02 A;  2F5M A;  1BOX A;  1BNF A;  1RSN A;  1I2E A;  2KF5 A;  1MGW A;  1BU4 A;  7GSP A;  1B27 A;  2BIR A;  6GSP A;  3WR2 A;  3GSP A;  1BRI A;  1TRP A;  1RCL A;  1BGS A;  2SAR A;  3Q3F A;  1GMP A;  1JBT A;  1BRH A;  3URP A;  1RLS A;  1JBR A;  1MGR A;  1RGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...