1RGKA

Rnase t1 mutant glu46gln binds the inhibitors 2'gmp and 2'amp at the 3' subsite
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYQGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title RNase T1 mutant Glu46Gln binds the inhibitors 2'GMP and 2'AMP at the 3' subsite.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgkA00
5GSPA 1AQZA 1UCJA 1R4YA 1G02A 1GOUA 1B2MA 1GMRA 1I8VA 1B20A 3DH2A 4HAAA 2BU4A 4J5KA 1MGRA 1X1UA 1BNGA 4J5GA 1BSBA 1BRKA 1UCKA 1BVIA 1BSAA 3AHSA 4BU4A 1RDSA 1BGSA 3BU4A 3HOHA 1B2SA 3WHOA 2F4YA 1JBSA 1RGHA 1RNTA 1FYSA 1BOXA 1I70A 1SARA 3AGOA 1FUTA 1BNFA 1BU4A 1PY3A 1LNIA 5BU4A 1ZGXA 2RBIA 3RNTA 1I3IA 4RNTA 2GSPA 3D5IA 7GSPA 8RNTA 1Q9EA 1RN4A 2KF4A 5RNTA 1RHLA 1CH0A 1I2FA 1I3FA 1RTUA 1T2IA 2F56A 1LOWA 1B3SA 1BNEA 1X1YA 1BRIA 1AY7A 1BNRA 1PYLA 1FZUA 1BIRA 3KCHA 1RN1A 3AHWA 1LOVA 1JBRA 1BANA 1BRNL 1C54A 1RGCA 1TRQA 1YVSA 2F5WA 6GSPA 1GOVA 1RGGA 1GOYA 2KF5A 3DGYA 2KF3A 2HOHA 1BSCA 1BUJA 1BRSA 2KF6A 1A2PA 3Q3FA 4GHOA 1GMPA 1T2HA 1B2UA 1JBTA 2AADA 4GSPA 1I0XA 1BRGA 1DETA 1RGAA 1I0VA 5BIRA 1IYYA 1MGWA 1RNBA 1BAOA 1LOYA 2BIRA 1GMQA 1HYFA 1RLSA 3GSPA 4BIRA 6RNTA 1BRHA 3D4AA 3SYUA 7RNTA 1BNIA 3D5GA 1B2ZA 1X1WA 4HOHA 3URPA 1I2GA 1RCKA 1TTOA 1UCLA 1BRJA 1RMSA 2SARA 1FW7A 3AGNA 1B21A 1RGFA 1RGKA 1RGLA 1HZ1A 1RCLA 5HOHA 1RSNA 3BIRA 2RNTA 1TRPA 1I2EA 1BSDA 1YGWA 1X1XA 3WR2A 1B2XA 1LRAA 1BSEA 1RGEA 1BNJA 1YNVX 1B27A 1DE3A 3A5EA 1BNSA 2C4BA 1FUSA 1UCIA 2AAEA 9RNTA 2KAAA 1GSPA 2F5MA 2ZA4A
chains in the Genus database with same CATH superfamily
1YVBI 1AQZA 3X3ZA 3FG1A 1NB3I 1Q7Y4 2CFWA 3FCSB 1W01A 2PZVA 4KVHA 5DREA 1I8VA 3QK9A 1B20A 2ML6A 4I4KA 4HAAA 3SLUA 3G4S3 4J5KA 2XF3A 4CCVA 4CDLA 1MGRA 4R4KA 3DUKA 3CPW2 1MWRA 3B7CA 4K1VA 3S28A 3CCV3 1W02A 4FCMA 1SJWA 5FGOA 3AHSA 4BU4A 1BSAA 1EUIC 3FH1A 4IT7A 1J2BA 5IENA 2CKFB 3NUVA 1CYUA 1EKMA 3BU4A 4OUQA 3WA2X 2Y73A 2GBWB 2F4YA 4GB5A 5DRVA 3RDEA 3UL6A 1BOXA 1I70A 2H0IA 1IVUA 4NHFA 1LNIA 1YI23 5TGNA 1ZGXA 2RBIA 1M904 4RNTA 5G1KA 1A2VA 3CCQ3 1JB2A 2OWPA 7GSPA 8RNTA 2KF4A 2P0MA 1RHLA 3CNMA 1CH0A 2Z7AA 1M1K4 1Y4KA 4HM5B 3ECFA 3IMAB 1LOWA 4Q53A 1QJGA 1RRHA 4STDA 2MF7A 5AIFA 4JF8A 5KP3A 5IERA 1PYLA 2XR8B 1T3BA 3QRDA 2P38A 3NQZA 2XH9A 5D83A 2CWTA 5HGRA 5CK6A 3G0KA 2XFSA 1GOVA 4XDWA 1LQGC 1TFKA 3FZWA 4R1KA 3TDGA 2YFLB 3GZBA 2HOHA 1GD4A 2LYXA 2CW9A 3EE1A 3PXMA 2XEPA 1MWSA 3NQYA 1IVXA 3E99A 4KT3B 5JPPA 3KIIA 1RN7A 3V98A 2R41A 2XRXB 3KZTA 1B2UA 1JBTA 1ULIB 1DMMA 2AADA 4GSPA 2FNQA 4ILFA 4LMIA 2IYJA 5CF2A 2STDA 1OF5B 1DETA 3MPHA 4KZ1A 2O3OA 1Q40A 3FG4A 3H51A 2HMLB 3NV0A 1UDII 2P0XA 3JUNA 1DVCA 1T5YA 2SBLA 3CCU3 3HZPA 3G713 2GEYA 1LOYA 1IU7A 1M9GA 1IDPA 4FMBA 2BIRA 3I553 3LT8A 6RNTA 2RSXA 2HMOB 3SYUA 3PCRA 3S27A 1V74A 3A76A 1NU3A 4HZ9B 1VQ63 5G2GA 1X1WA 2GXFA 2P05A 2RFRA 2W0QA 4HM7B 1TUHA 1VQN3 1JV2B 1FUWA 3AMOB 4WFOA 1JKGB 3OX9A 1HZ1A 1TIJA 2R4IA 1WTHA 4TX4A 3L0RA 3JUQA 3SOAA 2RCDA 1N5PA 1YGWA 4RZMA 3EC9A 3MKIA 3LMLA 1KC84 2CWUA 3B8LA 5STDA 1DE3A 3CC23 3F7SA 2F99A 1C7HA 1UCIA 2ZDJA 1YJW3 1KWIA 3Q90A 3WOEB 4HM1B 3HIIA 4RBNA 1EQKA 2E2UA 1GSPA 2C4BA 2KRTA 2CFKA 2LQVA 2GEXA 1JZOA 3GZXB 1GD3A 2W56B 5IEPA 3CCS3 1A67A 2CX1A 2GU1A 1UCJA 1JN5B 2RGQA 3PCSA 1KSIA 1YIT3 3EBYA 2FGTA 1QAFA 1G02A 3RGRA 3O8YA 2J8XB 3KE7A 3CCM3 3MSOA 1N9EA 2OOVC 6STDA 2H0HA 1Q42A 2BMQB 1X1UA 5IG0A 1BSBA 4AKYA 1MNLA 1UCKA 1AVKA 4CPKA 1QVG2 2CX0A 2B1XB 4LGQA 5IF6A 1OPYA 1IQXA 4KFDA 1B2SA 3LTBA 3KSED 5JBSA 1UGHI 1ZS7A 1JBSA 1RGHA 5AIGA 1IK3A 3AGOA 1UI7A 4N6LA 1BNFA 1E3VA 1MWTA 2W6JH 5LC7A 2H0GA 1I3IA 1VZZA 3CD63 2GSPA 1O7PB 5RNTA 1RN4A 1W6CA 1DMNA 3LYGA 4WP5A 3CCL3 2V1LA 1UUGB 4RNZA 1OUNA 5M19A 3JUPA 2W03A 1AR0A 3D3LA 4XB5A 1B3SA 1BNEA 4BL3A 3BNBA 3UJMA 1K734 1JJ22 3EF8A 3OWSA 1W7CA 1AY7A 2IUKA 3HIGA 1LXEA 3KCHA 3G16A 3UL5A 3ROBA 1W6YA 1LVNA 3OWUA 1BANA 3NBRA 2KXGA 2IA7A 1VQ83 5BVBA 1C54A 1TRQA 4XM4A 3NHXA 1E97A 3DGNA 1YHQ3 2FXTA 4HM0B 1D6UA 3BLZA 1VQ73 4WYKA 2W9QA 3BNCA 4BL2A 3H3HA 3DGOA 1BUJA 2Z6BA 2BMOB 3IJEB 4N6MA 4OK0A 3I563 4N6V0 3DMCA 3OW22 3NXJA 2OCTA 4O3VA 1VQ93 2BT3A 1SPUA 1BRGA 3FF0A 3UB1A 1RGAA 5IG4A 3LTAA 5EQLA 5BIRA 2GBXB 1IYYA 3JUMA 1EG9B 2XFTA 3LT9A 3NBBA 1IT8A 3KN4A 1GMQA 1RLSA 3GSPA 4BIRA 1JNQA 1US1A 1BRHA 1D6YA 1MOLA 4PEJA 1QALA 3LTDA 2BNGA 5I97A 1YJ93 2W04A 7RNTA 1W2B2 1JB4A 5IG3A 4G1MB 3DM8A 4L7KA 1I2GA 1RCKA 3URPA 3X41A 7STDA 1BRJA 1RMSA 3ZG5A 1DMQA 2M7OA 3CC73 1FW7A 4R9LA 3N9HA 4HJLB 4XDVA 5HOHA 4NREA 3EQQB 2RNTA 1TRPA 1SQWA 3DGLA 1TP6A 3S5CA 3T0UA 4FMCA 1Q824 1DVDA 1IV9A 2OTL3 2Q07A 2ML5A 4GL6A 1U5OA 1WNHA 1LRAA 4NPBA 3LZAA 2W9PA 4HKVB 2IUJA 1OHSA 2BMRB 2OQEA 2KCDA 1BNJA 1VQK3 1JRQA 3HI7A 2MC8A 5M1AA 3CCR3 1KD14 1STFI 2OOVA 2HMJB 1M1XB 1K28A 3WMDA 1HKXA 3JVCA 1BUQA 2F5MA 2KF6A 2ZA4A 4MEIA 3LXUX 4H3UA 1Q7HA 4K1UA 3U1WA 2QGUA 4X2OA 5G1LA 1OF5A 1VQQA 1E3RA 3PGBA 1B2MA 3JUOA 1GMRA 1EEJA 1LNHA 3U97A 1QAKA 4XBTA 1G96A 5EEOA 2BU4A 2PNCA 4LZIA 1TJDA 3CCJ3 5IG5A 3X3YA 2E2TA 3PYJA 1K9M4 1LQMB 3Q1CA 1BGSA 3HOHA 5AYRB 3CC43 4FMDA 2CH9A 3K0ZA 4J8TA 5AEUB 1GY7A 1FYSA 1NWWA 1UW1A 3ALAA 3DGMA 3FGYA 4LEHA 4MMXB 3WDGB 5D82A 1BU4A 4EYCA 2D42A 5BU4A 3V92A 2CIUA 1K41A 2F86B 4FCJA 5AEWB 2QA43 1N8R4 2Z77A 3VSYA 2CC3A 5KP1A 1WMOA 3EN1B 3T8NA 5KP4A 4EV5A 1I2FA 1I3FA 4KFEA 2K0MA 3EHCA 1X1YA 3CU3A 3KSPA 3DY5A 1A2KA 1ULJB 2W2CA 1IQ8A 1BRIA 1QMAA 4CJNA 4FMAA 1BNRA 8CHOA 3F8HA 1FZUA 1BIRA 1S723 1G0TA 3N54B 2HMKB 5AYSC 1O7WB 3AHWA 3DXOA 4R9KA 2B24B 2XGLA 4OVMA 1BRNL 1N9JA 2CG0A 1CQSA 2F5WA 3MG3A 6GSPA 3ER7A 1RGGA 2W56A 2F98A 4K61A 5IEOA 5IW9A 1ISKA 4N6OB 1ROVA 5CXOA 3WOFB 2GU3A 3MWZA 2UX0A 2UGIA 1BSCA 2INXA 3MG1A 3GZRA 4HZBB 1VQM3 4WWUC 4EW5A 1BRSA 1NDOB 3DZLA 3LOYA 5A0OB 4O8SA 2YFJB 3Q3FA 4L8OA 2CWVA 4EC6A 4XBXA 1T2HA 1FGQA 1WMPA 2CFGA 5CF1A 3NM7A 1MWUA 2BO9B 3BNDA 1HU9A 3X3XA 3B4PA 3CPOA 2Y74A 3KKGA 1JZDA 1IT7A 1MGWA 1DYUA 1ZX2A 5FW5A 3NM2A 5AIHA 1HYFA 4WHAA 1GY5A 3G8ZA 4N6TA 4QWTA 1AVLA 1N5HA 3VGNA 3D4AA 3G6E3 2IMJA 1U8CB 1O7GB 1BNIA 1W4NA 1S5AA 3BB9A 3D5GA 3IPTA 4IPBA 1IVWA 3EN8A 1TTOA 2JQ5A 1TFOA 4K90B 3S67A 2CK3H 1JB5A 2SARA 5EVHA 1GYBA 1FGMA 1OHPA 4I5QA 4WYKB 1RGKA 4N6UA 2Z76A 1RGLA 3MYTA 1RCLA 3F8XA 1QVF2 1R4CA 1EA2A 5D81A 1O7MB 1I2EA 2HMMB 3ZG0A 1BSDA 3F40A 1X1XA 3FKAA 1B2XA 3WODG 1YIJ3 1YNVX 1SIIA 2L4VA 1B27A 4FCZA 4H61A 2BHMA 5ELJA 1NNVA 2E2VA 3X42A 2C11A 3WA3A 1VQO3 1ROAA 1FUSA 2YX9A 2ZHXB 1IV7A 2AAEA 4AEQA 2P09A 1Q864 2KAAA 3UNLA 4RNYA 1W6GA 2QIYA 1UUWB 5GSPA 5CLKA 2I9WA 3K5TA 1R4YA 4O02B 1VQ43 3K63A 3D79A 4BTWA 2O9UX 3SOYA 1IQYA 4HBRA 4LSOA 4EXRA 1GOUA 2L1SA 1RJOA 3KFQC 4HM3B 1GS3A 3DH2A 3F14A 3T8UA 3RGAA 1FGOA 4N6NB 2WOFA 2WGOA 4LYLB 1O7HB 1IVVA 3I0YA 4BTXA 1W5ZA 1LOXA 5LC6A 1L5GB 1BNGA 1W2ZA 4BTYA 4J5GA 3GZYB 1NO3A 1BRKA 5AIIA 1BVIA 1Q40B 3K9MC 1F8NA 1RDSA 2XSHB 3NV0B 3N8BA 4U13A 3CCE3 3PS8A 1K8A4 4XBYA 3WHOA 1TU5A 1OGZA 1RNTA 2XSOB 1SARA 3F9SA 1FUTA 1OGXA 4DKIA 4MMZB 1PY3A 4JRFA 3RNTA 3NBJA 1N8QA 1OACA 3D5IA 4O2HA 1Q9EA 4HYZA 4ZM8A 1V58A 1ZO2A 1STDA 2C10A 1RTUA 3HK4A 1T2IA 2IY2A 4ORLA 2F56A 3CMA3 4HM6B 3LH4A 3GRDA 4HM2B 3FG3A 1UGIA 2YFIB 2CG1A 2HMNB 1PU4A 1RRLA 1RN1A 3SEDA 3LTCA 3MG2A 2A15A 4HM8B 1LOVA 4FR9A 3V99A 1YJN3 1JBRA 5M18A 3FLJA 1RGCA 1YVSA 2K54A 1CYVA 1CEWI 3EX9A 1GOYA 1YGEA 1UUVB 2KF5A 3DGYA 3GAXA 2KF3A 4EV2A 2XGNA 1V57A 3AMOA 1JKGA 1VQP3 4KFFA 3OWYA 1FGRA 3NX0A 3S29A 1A2PA 4GHOA 1GMPA 1A90A 1FA3A 1D6ZA 3FSDA 2QEX3 1OHOA 1I0XA 4X2HA 1OCVA 2CFDA 2D1WA 3ZFZA 1I0VA 3CME3 2ZL8A 2K3DA 3EB8A 1FGTA 1NB5I 1RKYA 1RNBA 2WOHA 1O7NB 1BAOA 3EJVA 4EBGA 4R80A 1Z1SA 1ASKA 2JDIH 3OV4A 3SVAA 2WO0A 3BNEA 4MMYB 1JN5A 3OXAA 4HM4B 4L8PA 1KQS2 4HVNA 3K7CA 1B2ZA 4HOHA 2WGQA 4IIAA 3D9RA 1UCLA 3GWRA 3X40A 1WQLB 1SIHA 2OQEC 3AGNA 3CNXA 1AV4A 1B21A 1RGFA 1UI8A 1PFPA 3F7XA 1RSNA 3BIRA 3EBTA 3MHEA 4MJDA 3PZWA 3SX1A 1VQ53 3M8CA 5BXQA 3STDA 2OTJ3 2UUGC 3HX8A 1WMNA 4J9AA 3B4OA 5ELUA 3WR2A 5AI1A 1Q814 1BSEA 1W00A 1GY6A 1RGEA 5JPUA 4N3VA 3J7Yd 3A5EA 3VF1A 3CXC2 1BNSA 2CFLA 3SXXA 9RNTA 1VQL3 1NJI4 2CHCA 3FF2A 3Q2PA 1OH0A 4AKZA
chains in the Genus database with same CATH topology
5GSPA 1AQZA 1UCJA 1R4YA 1G02A 1GOUA 1B2MA 1GMRA 1I8VA 1B20A 3DH2A 4HAAA 2BU4A 4J5KA 1MGRA 1X1UA 1BNGA 4J5GA 1BSBA 1BRKA 1UCKA 1BVIA 1BSAA 3AHSA 4BU4A 1RDSA 1BGSA 3BU4A 3HOHA 1B2SA 3WHOA 2F4YA 1JBSA 1RGHA 1RNTA 1FYSA 1BOXA 1I70A 1SARA 3AGOA 1FUTA 1BNFA 1BU4A 1PY3A 1LNIA 5BU4A 1ZGXA 2RBIA 3RNTA 1I3IA 4RNTA 2GSPA 3D5IA 7GSPA 8RNTA 1Q9EA 1RN4A 2KF4A 5RNTA 1RHLA 1CH0A 1I2FA 1I3FA 1RTUA 1T2IA 2F56A 1LOWA 1B3SA 1BNEA 1X1YA 1BRIA 1AY7A 1BNRA 1PYLA 1FZUA 1BIRA 3KCHA 1RN1A 3AHWA 1LOVA 1JBRA 1BANA 1BRNL 1C54A 1RGCA 1TRQA 1YVSA 2F5WA 6GSPA 1GOVA 1RGGA 1GOYA 2KF5A 3DGYA 2KF3A 2HOHA 1BSCA 1BUJA 1BRSA 2KF6A 1A2PA 3Q3FA 4GHOA 1GMPA 1T2HA 1B2UA 1JBTA 2AADA 4GSPA 1I0XA 1BRGA 1DETA 1RGAA 1I0VA 5BIRA 1IYYA 1MGWA 1RNBA 1BAOA 1LOYA 2BIRA 1GMQA 1HYFA 1RLSA 3GSPA 4BIRA 6RNTA 1BRHA 3D4AA 3SYUA 7RNTA 1BNIA 3D5GA 1B2ZA 1X1WA 4HOHA 3URPA 1I2GA 1RCKA 1TTOA 1UCLA 1BRJA 1RMSA 2SARA 1FW7A 3AGNA 1B21A 1RGFA 1RGKA 1RGLA 1HZ1A 1RCLA 5HOHA 1RSNA 3BIRA 2RNTA 1TRPA 1I2EA 1BSDA 1YGWA 1X1XA 3WR2A 1B2XA 1LRAA 1BSEA 1RGEA 1BNJA 1YNVX 1B27A 1DE3A 3A5EA 1BNSA 2C4BA 1FUSA 1UCIA 2AAEA 9RNTA 2KAAA 1GSPA 2F5MA 2ZA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSP A;  1AQZ A;  1UCJ A;  1R4Y A;  1G02 A;  1GOU A;  1B2M A;  1GMR A;  1I8V A;  1B20 A;  3DH2 A;  4HAA A;  2BU4 A;  4J5K A;  1MGR A;  1X1U A;  1BNG A;  4J5G A;  1BSB A;  1BRK A;  1UCK A;  1BVI A;  1BSA A;  3AHS A;  4BU4 A;  1RDS A;  1BGS A;  3BU4 A;  3HOH A;  1B2S A;  3WHO A;  2F4Y A;  1JBS A;  1RGH A;  1RNT A;  1FYS A;  1BOX A;  1I70 A;  1SAR A;  3AGO A;  1FUT A;  1BNF A;  1BU4 A;  1PY3 A;  1LNI A;  5BU4 A;  1ZGX A;  2RBI A;  3RNT A;  1I3I A;  4RNT A;  2GSP A;  3D5I A;  7GSP A;  8RNT A;  1Q9E A;  1RN4 A;  2KF4 A;  5RNT A;  1RHL A;  1CH0 A;  1I2F A;  1I3F A;  1RTU A;  1T2I A;  2F56 A;  1LOW A;  1B3S A;  1BNE A;  1X1Y A;  1BRI A;  1AY7 A;  1BNR A;  1PYL A;  1FZU A;  1BIR A;  3KCH A;  1RN1 A;  3AHW A;  1LOV A;  1JBR A;  1BAN A;  1BRN L;  1C54 A;  1RGC A;  1TRQ A;  1YVS A;  2F5W A;  6GSP A;  1GOV A;  1RGG A;  1GOY A;  2KF5 A;  3DGY A;  2KF3 A;  2HOH A;  1BSC A;  1BUJ A;  1BRS A;  2KF6 A;  1A2P A;  3Q3F A;  4GHO A;  1GMP A;  1T2H A;  1B2U A;  1JBT A;  2AAD A;  4GSP A;  1I0X A;  1BRG A;  1DET A;  1RGA A;  1I0V A;  5BIR A;  1IYY A;  1MGW A;  1RNB A;  1BAO A;  1LOY A;  2BIR A;  1GMQ A;  1HYF A;  1RLS A;  3GSP A;  4BIR A;  6RNT A;  1BRH A;  3D4A A;  3SYU A;  7RNT A;  1BNI A;  3D5G A;  1B2Z A;  1X1W A;  4HOH A;  3URP A;  1I2G A;  1RCK A;  1TTO A;  1UCL A;  1BRJ A;  1RMS A;  2SAR A;  1FW7 A;  3AGN A;  1B21 A;  1RGF A;  1RGK A;  1RGL A;  1HZ1 A;  1RCL A;  5HOH A;  1RSN A;  3BIR A;  2RNT A;  1TRP A;  1I2E A;  1BSD A;  1YGW A;  1X1X A;  3WR2 A;  1B2X A;  1LRA A;  1BSE A;  1RGE A;  1BNJ A;  1YNV X;  1B27 A;  1DE3 A;  3A5E A;  1BNS A;  2C4B A;  1FUS A;  1UCI A;  2AAE A;  9RNT A;  2KAA A;  1GSP A;  2F5M A;  2ZA4 A; 
#chains in the Genus database with same CATH topology
 1YVB I;  1AQZ A;  3X3Z A;  3FG1 A;  1NB3 I;  1Q7Y 4;  2CFW A;  3FCS B;  1W01 A;  2PZV A;  4KVH A;  5DRE A;  1I8V A;  3QK9 A;  1B20 A;  2ML6 A;  4I4K A;  4HAA A;  3SLU A;  3G4S 3;  4J5K A;  2XF3 A;  4CCV A;  4CDL A;  1MGR A;  4R4K A;  3DUK A;  3CPW 2;  1MWR A;  3B7C A;  4K1V A;  3S28 A;  3CCV 3;  1W02 A;  4FCM A;  1SJW A;  5FGO A;  3AHS A;  4BU4 A;  1BSA A;  1EUI C;  3FH1 A;  4IT7 A;  1J2B A;  5IEN A;  2CKF B;  3NUV A;  1CYU A;  1EKM A;  3BU4 A;  4OUQ A;  3WA2 X;  2Y73 A;  2GBW B;  2F4Y A;  4GB5 A;  5DRV A;  3RDE A;  3UL6 A;  1BOX A;  1I70 A;  2H0I A;  1IVU A;  4NHF A;  1LNI A;  1YI2 3;  5TGN A;  1ZGX A;  2RBI A;  1M90 4;  4RNT A;  5G1K A;  1A2V A;  3CCQ 3;  1JB2 A;  2OWP A;  7GSP A;  8RNT A;  2KF4 A;  2P0M A;  1RHL A;  3CNM A;  1CH0 A;  2Z7A A;  1M1K 4;  1Y4K A;  4HM5 B;  3ECF A;  3IMA B;  1LOW A;  4Q53 A;  1QJG A;  1RRH A;  4STD A;  2MF7 A;  5AIF A;  4JF8 A;  5KP3 A;  5IER A;  1PYL A;  2XR8 B;  1T3B A;  3QRD A;  2P38 A;  3NQZ A;  2XH9 A;  5D83 A;  2CWT A;  5HGR A;  5CK6 A;  3G0K A;  2XFS A;  1GOV A;  4XDW A;  1LQG C;  1TFK A;  3FZW A;  4R1K A;  3TDG A;  2YFL B;  3GZB A;  2HOH A;  1GD4 A;  2LYX A;  2CW9 A;  3EE1 A;  3PXM A;  2XEP A;  1MWS A;  3NQY A;  1IVX A;  3E99 A;  4KT3 B;  5JPP A;  3KII A;  1RN7 A;  3V98 A;  2R41 A;  2XRX B;  3KZT A;  1B2U A;  1JBT A;  1ULI B;  1DMM A;  2AAD A;  4GSP A;  2FNQ A;  4ILF A;  4LMI A;  2IYJ A;  5CF2 A;  2STD A;  1OF5 B;  1DET A;  3MPH A;  4KZ1 A;  2O3O A;  1Q40 A;  3FG4 A;  3H51 A;  2HML B;  3NV0 A;  1UDI I;  2P0X A;  3JUN A;  1DVC A;  1T5Y A;  2SBL A;  3CCU 3;  3HZP A;  3G71 3;  2GEY A;  1LOY A;  1IU7 A;  1M9G A;  1IDP A;  4FMB A;  2BIR A;  3I55 3;  3LT8 A;  6RNT A;  2RSX A;  2HMO B;  3SYU A;  3PCR A;  3S27 A;  1V74 A;  3A76 A;  1NU3 A;  4HZ9 B;  1VQ6 3;  5G2G A;  1X1W A;  2GXF A;  2P05 A;  2RFR A;  2W0Q A;  4HM7 B;  1TUH A;  1VQN 3;  1JV2 B;  1FUW A;  3AMO B;  4WFO A;  1JKG B;  3OX9 A;  1HZ1 A;  1TIJ A;  2R4I A;  1WTH A;  4TX4 A;  3L0R A;  3JUQ A;  3SOA A;  2RCD A;  1N5P A;  1YGW A;  4RZM A;  3EC9 A;  3MKI A;  3LML A;  1KC8 4;  2CWU A;  3B8L A;  5STD A;  1DE3 A;  3CC2 3;  3F7S A;  2F99 A;  1C7H A;  1UCI A;  2ZDJ A;  1YJW 3;  1KWI A;  3Q90 A;  3WOE B;  4HM1 B;  3HII A;  4RBN A;  1EQK A;  2E2U A;  1GSP A;  2C4B A;  2KRT A;  2CFK A;  2LQV A;  2GEX A;  1JZO A;  3GZX B;  1GD3 A;  2W56 B;  5IEP A;  3CCS 3;  1A67 A;  2CX1 A;  2GU1 A;  1UCJ A;  1JN5 B;  2RGQ A;  3PCS A;  1KSI A;  1YIT 3;  3EBY A;  2FGT A;  1QAF A;  1G02 A;  3RGR A;  3O8Y A;  2J8X B;  3KE7 A;  3CCM 3;  3MSO A;  1N9E A;  2OOV C;  6STD A;  2H0H A;  1Q42 A;  2BMQ B;  1X1U A;  5IG0 A;  1BSB A;  4AKY A;  1MNL A;  1UCK A;  1AVK A;  4CPK A;  1QVG 2;  2CX0 A;  2B1X B;  4LGQ A;  5IF6 A;  1OPY A;  1IQX A;  4KFD A;  1B2S A;  3LTB A;  3KSE D;  5JBS A;  1UGH I;  1ZS7 A;  1JBS A;  1RGH A;  5AIG A;  1IK3 A;  3AGO A;  1UI7 A;  4N6L A;  1BNF A;  1E3V A;  1MWT A;  2W6J H;  5LC7 A;  2H0G A;  1I3I A;  1VZZ A;  3CD6 3;  2GSP A;  1O7P B;  5RNT A;  1RN4 A;  1W6C A;  1DMN A;  3LYG A;  4WP5 A;  3CCL 3;  2V1L A;  1UUG B;  4RNZ A;  1OUN A;  5M19 A;  3JUP A;  2W03 A;  1AR0 A;  3D3L A;  4XB5 A;  1B3S A;  1BNE A;  4BL3 A;  3BNB A;  3UJM A;  1K73 4;  1JJ2 2;  3EF8 A;  3OWS A;  1W7C A;  1AY7 A;  2IUK A;  3HIG A;  1LXE A;  3KCH A;  3G16 A;  3UL5 A;  3ROB A;  1W6Y A;  1LVN A;  3OWU A;  1BAN A;  3NBR A;  2KXG A;  2IA7 A;  1VQ8 3;  5BVB A;  1C54 A;  1TRQ A;  4XM4 A;  3NHX A;  1E97 A;  3DGN A;  1YHQ 3;  2FXT A;  4HM0 B;  1D6U A;  3BLZ A;  1VQ7 3;  4WYK A;  2W9Q A;  3BNC A;  4BL2 A;  3H3H A;  3DGO A;  1BUJ A;  2Z6B A;  2BMO B;  3IJE B;  4N6M A;  4OK0 A;  3I56 3;  4N6V 0;  3DMC A;  3OW2 2;  3NXJ A;  2OCT A;  4O3V A;  1VQ9 3;  2BT3 A;  1SPU A;  1BRG A;  3FF0 A;  3UB1 A;  1RGA A;  5IG4 A;  3LTA A;  5EQL A;  5BIR A;  2GBX B;  1IYY A;  3JUM A;  1EG9 B;  2XFT A;  3LT9 A;  3NBB A;  1IT8 A;  3KN4 A;  1GMQ A;  1RLS A;  3GSP A;  4BIR A;  1JNQ A;  1US1 A;  1BRH A;  1D6Y A;  1MOL A;  4PEJ A;  1QAL A;  3LTD A;  2BNG A;  5I97 A;  1YJ9 3;  2W04 A;  7RNT A;  1W2B 2;  1JB4 A;  5IG3 A;  4G1M B;  3DM8 A;  4L7K A;  1I2G A;  1RCK A;  3URP A;  3X41 A;  7STD A;  1BRJ A;  1RMS A;  3ZG5 A;  1DMQ A;  2M7O A;  3CC7 3;  1FW7 A;  4R9L A;  3N9H A;  4HJL B;  4XDV A;  5HOH A;  4NRE A;  3EQQ B;  2RNT A;  1TRP A;  1SQW A;  3DGL A;  1TP6 A;  3S5C A;  3T0U A;  4FMC A;  1Q82 4;  1DVD A;  1IV9 A;  2OTL 3;  2Q07 A;  2ML5 A;  4GL6 A;  1U5O A;  1WNH A;  1LRA A;  4NPB A;  3LZA A;  2W9P A;  4HKV B;  2IUJ A;  1OHS A;  2BMR B;  2OQE A;  2KCD A;  1BNJ A;  1VQK 3;  1JRQ A;  3HI7 A;  2MC8 A;  5M1A A;  3CCR 3;  1KD1 4;  1STF I;  2OOV A;  2HMJ B;  1M1X B;  1K28 A;  3WMD A;  1HKX A;  3JVC A;  1BUQ A;  2F5M A;  2KF6 A;  2ZA4 A;  4MEI A;  3LXU X;  4H3U A;  1Q7H A;  4K1U A;  3U1W A;  2QGU A;  4X2O A;  5G1L A;  1OF5 A;  1VQQ A;  1E3R A;  3PGB A;  1B2M A;  3JUO A;  1GMR A;  1EEJ A;  1LNH A;  3U97 A;  1QAK A;  4XBT A;  1G96 A;  5EEO A;  2BU4 A;  2PNC A;  4LZI A;  1TJD A;  3CCJ 3;  5IG5 A;  3X3Y A;  2E2T A;  3PYJ A;  1K9M 4;  1LQM B;  3Q1C A;  1BGS A;  3HOH A;  5AYR B;  3CC4 3;  4FMD A;  2CH9 A;  3K0Z A;  4J8T A;  5AEU B;  1GY7 A;  1FYS A;  1NWW A;  1UW1 A;  3ALA A;  3DGM A;  3FGY A;  4LEH A;  4MMX B;  3WDG B;  5D82 A;  1BU4 A;  4EYC A;  2D42 A;  5BU4 A;  3V92 A;  2CIU A;  1K41 A;  2F86 B;  4FCJ A;  5AEW B;  2QA4 3;  1N8R 4;  2Z77 A;  3VSY A;  2CC3 A;  5KP1 A;  1WMO A;  3EN1 B;  3T8N A;  5KP4 A;  4EV5 A;  1I2F A;  1I3F A;  4KFE A;  2K0M A;  3EHC A;  1X1Y A;  3CU3 A;  3KSP A;  3DY5 A;  1A2K A;  1ULJ B;  2W2C A;  1IQ8 A;  1BRI A;  1QMA A;  4CJN A;  4FMA A;  1BNR A;  8CHO A;  3F8H A;  1FZU A;  1BIR A;  1S72 3;  1G0T A;  3N54 B;  2HMK B;  5AYS C;  1O7W B;  3AHW A;  3DXO A;  4R9K A;  2B24 B;  2XGL A;  4OVM A;  1BRN L;  1N9J A;  2CG0 A;  1CQS A;  2F5W A;  3MG3 A;  6GSP A;  3ER7 A;  1RGG A;  2W56 A;  2F98 A;  4K61 A;  5IEO A;  5IW9 A;  1ISK A;  4N6O B;  1ROV A;  5CXO A;  3WOF B;  2GU3 A;  3MWZ A;  2UX0 A;  2UGI A;  1BSC A;  2INX A;  3MG1 A;  3GZR A;  4HZB B;  1VQM 3;  4WWU C;  4EW5 A;  1BRS A;  1NDO B;  3DZL A;  3LOY A;  5A0O B;  4O8S A;  2YFJ B;  3Q3F A;  4L8O A;  2CWV A;  4EC6 A;  4XBX A;  1T2H A;  1FGQ A;  1WMP A;  2CFG A;  5CF1 A;  3NM7 A;  1MWU A;  2BO9 B;  3BND A;  1HU9 A;  3X3X A;  3B4P A;  3CPO A;  2Y74 A;  3KKG A;  1JZD A;  1IT7 A;  1MGW A;  1DYU A;  1ZX2 A;  5FW5 A;  3NM2 A;  5AIH A;  1HYF A;  4WHA A;  1GY5 A;  3G8Z A;  4N6T A;  4QWT A;  1AVL A;  1N5H A;  3VGN A;  3D4A A;  3G6E 3;  2IMJ A;  1U8C B;  1O7G B;  1BNI A;  1W4N A;  1S5A A;  3BB9 A;  3D5G A;  3IPT A;  4IPB A;  1IVW A;  3EN8 A;  1TTO A;  2JQ5 A;  1TFO A;  4K90 B;  3S67 A;  2CK3 H;  1JB5 A;  2SAR A;  5EVH A;  1GYB A;  1FGM A;  1OHP A;  4I5Q A;  4WYK B;  1RGK A;  4N6U A;  2Z76 A;  1RGL A;  3MYT A;  1RCL A;  3F8X A;  1QVF 2;  1R4C A;  1EA2 A;  5D81 A;  1O7M B;  1I2E A;  2HMM B;  3ZG0 A;  1BSD A;  3F40 A;  1X1X A;  3FKA A;  1B2X A;  3WOD G;  1YIJ 3;  1YNV X;  1SII A;  2L4V A;  1B27 A;  4FCZ A;  4H61 A;  2BHM A;  5ELJ A;  1NNV A;  2E2V A;  3X42 A;  2C11 A;  3WA3 A;  1VQO 3;  1ROA A;  1FUS A;  2YX9 A;  2ZHX B;  1IV7 A;  2AAE A;  4AEQ A;  2P09 A;  1Q86 4;  2KAA A;  3UNL A;  4RNY A;  1W6G A;  2QIY A;  1UUW B;  5GSP A;  5CLK A;  2I9W A;  3K5T A;  1R4Y A;  4O02 B;  1VQ4 3;  3K63 A;  3D79 A;  4BTW A;  2O9U X;  3SOY A;  1IQY A;  4HBR A;  4LSO A;  4EXR A;  1GOU A;  2L1S A;  1RJO A;  3KFQ C;  4HM3 B;  1GS3 A;  3DH2 A;  3F14 A;  3T8U A;  3RGA A;  1FGO A;  4N6N B;  2WOF A;  2WGO A;  4LYL B;  1O7H B;  1IVV A;  3I0Y A;  4BTX A;  1W5Z A;  1LOX A;  5LC6 A;  1L5G B;  1BNG A;  1W2Z A;  4BTY A;  4J5G A;  3GZY B;  1NO3 A;  1BRK A;  5AII A;  1BVI A;  1Q40 B;  3K9M C;  1F8N A;  1RDS A;  2XSH B;  3NV0 B;  3N8B A;  4U13 A;  3CCE 3;  3PS8 A;  1K8A 4;  4XBY A;  3WHO A;  1TU5 A;  1OGZ A;  1RNT A;  2XSO B;  1SAR A;  3F9S A;  1FUT A;  1OGX A;  4DKI A;  4MMZ B;  1PY3 A;  4JRF A;  3RNT A;  3NBJ A;  1N8Q A;  1OAC A;  3D5I A;  4O2H A;  1Q9E A;  4HYZ A;  4ZM8 A;  1V58 A;  1ZO2 A;  1STD A;  2C10 A;  1RTU A;  3HK4 A;  1T2I A;  2IY2 A;  4ORL A;  2F56 A;  3CMA 3;  4HM6 B;  3LH4 A;  3GRD A;  4HM2 B;  3FG3 A;  1UGI A;  2YFI B;  2CG1 A;  2HMN B;  1PU4 A;  1RRL A;  1RN1 A;  3SED A;  3LTC A;  3MG2 A;  2A15 A;  4HM8 B;  1LOV A;  4FR9 A;  3V99 A;  1YJN 3;  1JBR A;  5M18 A;  3FLJ A;  1RGC A;  1YVS A;  2K54 A;  1CYV A;  1CEW I;  3EX9 A;  1GOY A;  1YGE A;  1UUV B;  2KF5 A;  3DGY A;  3GAX A;  2KF3 A;  4EV2 A;  2XGN A;  1V57 A;  3AMO A;  1JKG A;  1VQP 3;  4KFF A;  3OWY A;  1FGR A;  3NX0 A;  3S29 A;  1A2P A;  4GHO A;  1GMP A;  1A90 A;  1FA3 A;  1D6Z A;  3FSD A;  2QEX 3;  1OHO A;  1I0X A;  4X2H A;  1OCV A;  2CFD A;  2D1W A;  3ZFZ A;  1I0V A;  3CME 3;  2ZL8 A;  2K3D A;  3EB8 A;  1FGT A;  1NB5 I;  1RKY A;  1RNB A;  2WOH A;  1O7N B;  1BAO A;  3EJV A;  4EBG A;  4R80 A;  1Z1S A;  1ASK A;  2JDI H;  3OV4 A;  3SVA A;  2WO0 A;  3BNE A;  4MMY B;  1JN5 A;  3OXA A;  4HM4 B;  4L8P A;  1KQS 2;  4HVN A;  3K7C A;  1B2Z A;  4HOH A;  2WGQ A;  4IIA A;  3D9R A;  1UCL A;  3GWR A;  3X40 A;  1WQL B;  1SIH A;  2OQE C;  3AGN A;  3CNX A;  1AV4 A;  1B21 A;  1RGF A;  1UI8 A;  1PFP A;  3F7X A;  1RSN A;  3BIR A;  3EBT A;  3MHE A;  4MJD A;  3PZW A;  3SX1 A;  1VQ5 3;  3M8C A;  5BXQ A;  3STD A;  2OTJ 3;  2UUG C;  3HX8 A;  1WMN A;  4J9A A;  3B4O A;  5ELU A;  3WR2 A;  5AI1 A;  1Q81 4;  1BSE A;  1W00 A;  1GY6 A;  1RGE A;  5JPU A;  4N3V A;  3J7Y d;  3A5E A;  3VF1 A;  3CXC 2;  1BNS A;  2CFL A;  3SXX A;  9RNT A;  1VQL 3;  1NJI 4;  2CHC A;  3FF2 A;  3Q2P A;  1OH0 A;  4AKZ A; 
#chains in the Genus database with same CATH homology
 5GSP A;  1AQZ A;  1UCJ A;  1R4Y A;  1G02 A;  1GOU A;  1B2M A;  1GMR A;  1I8V A;  1B20 A;  3DH2 A;  4HAA A;  2BU4 A;  4J5K A;  1MGR A;  1X1U A;  1BNG A;  4J5G A;  1BSB A;  1BRK A;  1UCK A;  1BVI A;  1BSA A;  3AHS A;  4BU4 A;  1RDS A;  1BGS A;  3BU4 A;  3HOH A;  1B2S A;  3WHO A;  2F4Y A;  1JBS A;  1RGH A;  1RNT A;  1FYS A;  1BOX A;  1I70 A;  1SAR A;  3AGO A;  1FUT A;  1BNF A;  1BU4 A;  1PY3 A;  1LNI A;  5BU4 A;  1ZGX A;  2RBI A;  3RNT A;  1I3I A;  4RNT A;  2GSP A;  3D5I A;  7GSP A;  8RNT A;  1Q9E A;  1RN4 A;  2KF4 A;  5RNT A;  1RHL A;  1CH0 A;  1I2F A;  1I3F A;  1RTU A;  1T2I A;  2F56 A;  1LOW A;  1B3S A;  1BNE A;  1X1Y A;  1BRI A;  1AY7 A;  1BNR A;  1PYL A;  1FZU A;  1BIR A;  3KCH A;  1RN1 A;  3AHW A;  1LOV A;  1JBR A;  1BAN A;  1BRN L;  1C54 A;  1RGC A;  1TRQ A;  1YVS A;  2F5W A;  6GSP A;  1GOV A;  1RGG A;  1GOY A;  2KF5 A;  3DGY A;  2KF3 A;  2HOH A;  1BSC A;  1BUJ A;  1BRS A;  2KF6 A;  1A2P A;  3Q3F A;  4GHO A;  1GMP A;  1T2H A;  1B2U A;  1JBT A;  2AAD A;  4GSP A;  1I0X A;  1BRG A;  1DET A;  1RGA A;  1I0V A;  5BIR A;  1IYY A;  1MGW A;  1RNB A;  1BAO A;  1LOY A;  2BIR A;  1GMQ A;  1HYF A;  1RLS A;  3GSP A;  4BIR A;  6RNT A;  1BRH A;  3D4A A;  3SYU A;  7RNT A;  1BNI A;  3D5G A;  1B2Z A;  1X1W A;  4HOH A;  3URP A;  1I2G A;  1RCK A;  1TTO A;  1UCL A;  1BRJ A;  1RMS A;  2SAR A;  1FW7 A;  3AGN A;  1B21 A;  1RGF A;  1RGK A;  1RGL A;  1HZ1 A;  1RCL A;  5HOH A;  1RSN A;  3BIR A;  2RNT A;  1TRP A;  1I2E A;  1BSD A;  1YGW A;  1X1X A;  3WR2 A;  1B2X A;  1LRA A;  1BSE A;  1RGE A;  1BNJ A;  1YNV X;  1B27 A;  1DE3 A;  3A5E A;  1BNS A;  2C4B A;  1FUS A;  1UCI A;  2AAE A;  9RNT A;  2KAA A;  1GSP A;  2F5M A;  2ZA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...