7RNTA

Crystal structure of the tyr45trp mutant of ribonuclease t1 in a complex with 2'-adenylic acid
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNWEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title Crystal structure of the Tyr45Trp mutant of ribonuclease T1 in a complex with 2'-adenylic acid.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 7rntA00
1RGLA 2F4YA 1I3IA 1I2EA 1TRPA 1GMRA 1RMSA 1Q9EA 1CH0A 4HAAA 1C54A 1BU4A 1A2PA 1GOUA 1RGAA 2GSPA 1BUJA 2RBIA 1B2UA 6GSPA 3URPA 3D4AA 1I70A 1MGRA 9RNTA 1RTUA 2SARA 1BNRA 2KAAA 1HZ1A 1BSDA 1BRKA 4BIRA 1BSCA 1YNVX 1B27A 3AHSA 1BAOA 1LRAA 1SARA 5BU4A 2RNTA 1BOXA 1X1WA 1RSNA 5HOHA 1X1XA 1LOYA 3SYUA 1BNIA 4J5KA 1BNJA 2BU4A 2F5MA 1BSAA 7RNTA 3AHWA 1BANA 3A5EA 1JBTA 1X1UA 1BNSA 3Q3FA 1RGGA 1B3SA 1I3FA 1FZUA 1G02A 3DH2A 1GMPA 1B2ZA 1BRNL 2KF5A 1GOYA 1UCLA 1B2XA 1YVSA 5GSPA 5RNTA 1PY3A 1RN1A 1BVIA 7GSPA 8RNTA 2HOHA 2BIRA 1GMQA 1I0XA 1RHLA 1RN4A 1TRQA 3D5IA 1DETA 3AGNA 5BIRA 1BNGA 1JBRA 1GOVA 1BNEA 1BRGA 3D5GA 1MGWA 1BRHA 1X1YA 1B2MA 1UCJA 1HYFA 3GSPA 1RGFA 3AGOA 3WHOA 1YGWA 1RGHA 1TTOA 1I2FA 4J5GA 1FW7A 2F5WA 1FYSA 2AAEA 2AADA 2KF4A 4BU4A 1T2IA 1LNIA 1T2HA 1BGSA 1BIRA 1B21A 1I2GA 1R4YA 1RGEA 1AY7A 1RGKA 2KF3A 4HOHA 1BNFA 1RDSA 3BIRA 1I8VA 1RNTA 3DGYA 3WR2A 2ZA4A 1BRJA 4RNTA 1I0VA 1LOWA 1FUSA 3KCHA 4GHOA 3HOHA 1PYLA 1BSEA 1RLSA 1ZGXA 1BSBA 1B20A 3RNTA 1BRSA 1RGCA 1FUTA 1RCKA 2C4BA 1DE3A 1JBSA 1LOVA 1RNBA 1UCIA 1B2SA 4GSPA 2F56A 3BU4A 1GSPA 6RNTA 1IYYA 2KF6A 1BRIA 1UCKA 1RCLA 1AQZA
chains in the Genus database with same CATH superfamily
3BNCA 1RGLA 2F4YA 1I3IA 1IQYA 1I2EA 1TRPA 4N6TA 4LSOA 1GMRA 2W2CA 2BMRB 4BL2A 2CFWA 5DRVA 1CH0A 2SBLA 2M7OA 1MWTA 3FSDA 3SEDA 2GSPA 2BNGA 3X42A 4LEHA 5DREA 1KSIA 2WOFA 1BUJA 2Q07A 4BTXA 3CMA3 3EN8A 1AVLA 3D4AA 3FF0A 1UGIA 1YGEA 2CFKA 1JB4A 2W6JH 5IG0A 1PFPA 3BNBA 3NV0A 4GL6A 1E3RA 1BRKA 3QK9A 4HM3B 4U13A 1Q7Y4 3DGMA 1GD4A 1EG9B 5BXQA 1VQP3 3LYGA 2IY2A 1SARA 1NNVA 2GEYA 2H0IA 1FUWA 5JPUA 2F86B 4CDLA 3PGBA 1X1XA 1LOYA 3ALAA 5KP3A 1BNIA 1TP6A 5A0OB 2XFTA 3I553 1ZS7A 3LMLA 3NM7A 4BTWA 1RRLA 7RNTA 1MWRA 3G4S3 1OGXA 1BANA 3CCJ3 1ZX2A 1X1UA 3FG4A 2CW9A 3LTCA 4K1UA 1D6UA 2OCTA 1FZUA 4HZ9B 1EUIC 3GZRA 4WWUC 1JB5A 2KF5A 1GOYA 1UCLA 1B2XA 1W2B2 5ELUA 1N5HA 1RN1A 1BVIA 2JQ5A 3F8HA 3VF1A 4CJNA 1F8NA 3LTDA 7GSPA 1US1A 8RNTA 4L7KA 1KD14 1W6GA 2XGNA 3D79A 3EHCA 4HM4B 4RZMA 1Y4KA 3OX9A 3D5IA 1DETA 4O2HA 3SXXA 4K61A 1DYUA 1U5OA 4WFOA 2P0MA 2CFLA 4WP5A 1BRGA 2CH9A 3PCRA 2W9PA 1YIJ3 1X1YA 1GY5A 1O7PB 1UCJA 3D3LA 4R80A 3V99A 1B2MA 1VQN3 5IEOA 1TJDA 1I2FA 4N6UA 2FNQA 2AAEA 3LT8A 4H61A 3EN1B 1RJOA 4HOHA 1Q42A 1RGKA 4CCVA 3WDGB 5D83A 2P09A 3EJVA 3GZYB 3CC43 1RDSA 3DGYA 3WR2A 3AMOA 3N9HA 1LVNA 3HIGA 2GU3A 1LOWA 1IT8A 3WA3A 1UDII 3KCHA 4GHOA 4RNZA 1JJ22 3OWYA 4N3VA 4WYKB 3M8CA 1LQGC 3DGOA 3KSED 3VGNA 3FF2A 3PS8A 4J9AA 1OHOA 2K54A 2E2UA 3BB9A 1Q814 2CG0A 4HYZA 5AYSC 4I5QA 1NO3A 2B1XB 2UGIA 2QEX3 1VQ43 2OTL3 2BMOB 4EXRA 3Q1CA 4AEQA 5AEWB 3V98A 2K0MA 2MC8A 1FUTA 4EV2A 1YJN3 3DUKA 2C4BA 3GZBA 1D6ZA 3NQYA 1LOVA 5I97A 1RNBA 1SIHA 3S5CA 1SPUA 1YIT3 1VQL3 2STDA 2QGUA 4QWTA 2L1SA 3ZG0A 1UUWB 3Q90A 1BRIA 3KZTA 5TGNA 3JUPA 4FR9A 1NWWA 1SIIA 4IIAA 3B4OA 3F7SA 1RN7A 2CWUA 2WGQA 4HAAA 2ZL8A 4N6V0 5M18A 2WO0A 1A2PA 1GOUA 4GB5A 1TIJA 4KVHA 3GAXA 3CCE3 3CCU3 5ELJA 3F9SA 3K63A 1TFOA 1TU5A 3CC23 1Q7HA 2BT3A 2K3DA 4FCZA 3URPA 3I563 2HMLB 1ROAA 1I70A 2O9UX 4N6OB 1RTUA 2CHCA 2SARA 3MG1A 4HZBB 1A67A 2YX9A 3JUNA 1OF5A 1KC84 3S27A 2C11A 1T3BA 3K9MC 1YNVX 4FMCA 2MF7A 1B27A 2GU1A 4K1VA 2F99A 1BAOA 1LRAA 5IERA 3K5TA 5EEOA 1X1WA 3RDEA 1GS3A 1DVCA 2P0XA 2E2TA 2V1LA 2CIUA 4XM4A 2OOVA 3S28A 4J5KA 1BNJA 2BU4A 2F5MA 2P38A 2PNCA 3MYTA 4X2OA 3CXC2 4LMIA 2BMQB 5AIHA 2CG1A 2QA43 3B8LA 1Q864 4HVNA 4H3UA 4XDVA 4TX4A 1RGGA 1B3SA 3JUQA 4BTYA 1STDA 3NBRA 1B2ZA 1A2VA 1Q40B 2D1WA 2HMNB 1YVSA 3MG3A 5RNTA 1PY3A 3NX0A 1WMNA 2GXFA 2R4IA 1JRQA 5CLKA 5IF6A 3BNEA 2D42A 4O8SA 1O7WB 1I0XA 2W56B 4EV5A 1FGRA 1RN4A 1TRQA 4FMBA 4J8TA 2KCDA 3AGNA 1ISKA 2XR8B 1OPYA 3S67A 5BIRA 2CKFB 1JN5A 2IUJA 1GOVA 3OXAA 4OVMA 3F8XA 3E99A 3WODG 3D5GA 1UW1A 1AV4A 1KWIA 3H3HA 1QAFA 1VQ53 1BRHA 2XFSA 1V58A 2CK3H 3T8NA 1Z1SA 3WHOA 3X40A 2ML6A 2XRXB 3ER7A 3FKAA 3GSPA 5AIIA 6STDA 3F40A 1VQK3 4KFDA 1N9EA 1IVVA 1N9JA 4J5GA 3WOFB 1FW7A 1ULJB 1EQKA 2KF4A 4BU4A 1NU3A 3DXOA 4STDA 1O7GB 2INXA 2KF3A 1CEWI 3DGLA 1JKGB 5HGRA 3F7XA 1STFI 1OUNA 1BNFA 3BIRA 3Q2PA 1RNTA 5D82A 4HM6B 3U1WA 2ZA4A 1BRJA 5CK6A 3ZFZA 3J7Yd 4RNTA 1I0VA 2FXTA 3MKIA 3JUMA 3PZWA 5STDA 1VQ73 1R4CA 1A2KA 3QRDA 2HMOB 4ILFA 1GD3A 3HOHA 3X41A 3CME3 1PYLA 2IMJA 1KQS2 3SVAA 1W2ZA 1GY7A 4KZ1A 3NV0B 1WNHA 3LOYA 5KP4A 3NBBA 1NB5I 3KFQC 4HM2B 4MEIA 8CHOA 1B20A 3RNTA 1WQLB 3TDGA 3MWZA 1IT7A 1MOLA 1QMAA 4AKZA 2OWPA 4X2HA 1RCKA 1QVF2 2L4VA 4Q53A 4MMXB 2GBXB 2PZVA 1HKXA 4LZIA 2J8XB 1B2SA 3UJMA 3I0YA 5JPPA 1IQ8A 4HBRA 5BVBA 1UCKA 1W7CA 2H0HA 3X3YA 3S29A 1RMSA 1Q9EA 3CPOA 1QJGA 3A76A 2IA7A 3MG2A 3NUVA 2P05A 1EKMA 1RGAA 3LTAA 2Y74A 5CXOA 2ZHXB 2WOHA 4HM0B 4KFFA 1B2UA 1V74A 1FGMA 1W5ZA 1GY6A 1W02A 3CNXA 3EX9A 3G16A 3CPW2 1MWUA 3LH4A 1MGRA 3SX1A 7STDA 2ML5A 2XF3A 2HMKB 3HZPA 2KAAA 3CCS3 3EC9A 3F14A 2Y73A 5G1LA 1T5YA 4BIRA 1YHQ3 1BSCA 1W4NA 3N54B 3LXUX 3AHSA 1W6CA 1IVWA 3OW22 3DY5A 2RNTA 1IVXA 1BOXA 3ECFA 2CC3A 4HM8B 5FGOA 5G2GA 3SYUA 4AKYA 5HOHA 4OUQA 1FGTA 2W03A 1W01A 1BSAA 1O7HB 3STDA 4NPBA 1K8A4 2KXGA 3B7CA 3A5EA 2CWVA 1VQO3 3CCL3 3BLZA 3Q3FA 3CCQ3 1V57A 5CF2A 4OK0A 2O3OA 1IVUA 1N8R4 3DH2A 1GMPA 4KT3B 4FCJA 2Z76A 3G0KA 2ZDJA 4HJLB 1OGZA 4JRFA 3AMOB 1J2BA 3ZG5A 1M1XB 2CX0A 1IDPA 1S5AA 2BIRA 1GMQA 2IUKA 3EF8A 3JVCA 5M19A 1K28A 1UUVB 3PXMA 1U8CB 1ASKA 1TFKA 3KIIA 4FCMA 4NREA 3T8UA 5AYRB 2W56A 4DKIA 4N6NB 2UUGC 2RCDA 4FMDA 1K41A 1LQMB 1ZO2A 2IYJA 1OHSA 1SJWA 2KRTA 5JBSA 1OHPA 1K734 3MHEA 1QVG2 1RKYA 4PEJA 1VZZA 1HYFA 3AGOA 5IG5A 1IQXA 3DMCA 2OQEC 4LYLB 2F5WA 2A15A 4BL3A 1NB3I 1E3VA 2AADA 1N5PA 1T2IA 1E97A 2UX0A 1LNIA 5IW9A 4O3VA 1BGSA 1B21A 1R4YA 5AIFA 1VQQA 2BHMA 1W00A 2WGOA 3EQQB 2GEXA 1JKGA 3IMAB 4MMZB 1FUSA 2FGTA 1MNLA 1WMOA 4N6MA 4R9LA 2F98A 1EEJA 1TUHA 1BSEA 3JUOA 1VQM3 2R41A 1RLSA 2RGQA 3BNDA 3L0RA 3LZAA 1CYUA 1C7HA 4JF8A 1OF5B 2W04A 3GRDA 4G1MB 4N6LA 3GWRA 2YFJB 4XBYA 4R1KA 4EYCA 1YJ93 1RGCA 1SQWA 3X3XA 4R9KA 1NJI4 4NHFA 1DMNA 4ZM8A 1UCIA 2Z7AA 3CCV3 2CWTA 3OWUA 3UL5A 4EBGA 5IG4A 2F56A 3BU4A 2XGLA 3X3ZA 1IK3A 1FA3A 2CX1A 1QALA 3NBJA 1JZDA 1N8QA 4IT7A 1DMMA 3FG3A 3IJEB 1GYBA 3FLJA 5EQLA 3OV4A 2QIYA 5LC7A 3FGYA 3CD63 1CQSA 1OH0A 1QAKA 1BU4A 1WMPA 1C54A 3RGRA 3V92A 1EA2A 2RBIA 1ROVA 4FMAA 1VQ63 3WA2X 3FCSB 3SOYA 6GSPA 3FH1A 3NXJA 1BUQA 3EE1A 1MWSA 4WYKA 9RNTA 1O7MB 3CCR3 1BNRA 2LYXA 3LT9A 3SOAA 1M9GA 5AI1A 1HZ1A 4HKVB 1BSDA 5FW5A 4EC6A 1AVKA 3HX8A 2RFRA 1JN5B 3EB8A 3GZXB 1FGQA 3CNMA 2I9WA 3CC73 4CPKA 5BU4A 1RSNA 2Z6BA 3HIIA 3NHXA 4MMYB 1LOXA 1O7NB 5AIGA 4RNYA 3AHWA 3FG1A 4LGQA 2CFGA 2XSOB 1S723 1DVDA 1JBTA 4HM7B 1K9M4 1IV9A 4HM1B 1BNSA 4I4KA 4XBTA 3UB1A 3G713 5IG3A 3WMDA 2H0GA 5IENA 1I3FA 3HI7A 1G02A 1LNHA 3OWSA 1JZOA 1IV7A 4K90B 1BRNL 5GSPA 1G96A 3RGAA 1FGOA 5AEUB 2HMMB 2E2VA 2HOHA 4O02B 5KP1A 3MSOA 3K7CA 2CFDA 3PYJA 3DM8A 5D81A 1DMQA 1AR0A 1JV2B 1RHLA 3SLUA 1NDOB 3NM2A 4XBXA 5EVHA 4HM5B 3EBYA 4L8OA 3HK4A 5IEPA 1BNGA 1JBRA 3D9RA 3ROBA 1A90A 3UNLA 1RRHA 1BNEA 3CCM3 1W6YA 2W0QA 1MGWA 4RBNA 4WHAA 3N8BA 1JB2A 1OACA 1JNQA 3KE7A 1M904 1VQ83 1RGFA 3KSPA 3NQZA 1D6YA 1UI7A 1YGWA 1RGHA 1TTOA 2GBWB 3CU3A 3DZLA 3LTBA 3PCSA 4KFEA 5CF1A 1FYSA 3T0UA 4IPBA 3FZWA 1T2HA 1BIRA 3KKGA 1Q40A 1I2GA 1RGEA 3IPTA 1AY7A 1HU9A 3KN4A 4EW5A 2Z77A 1I8VA 1UI8A 3VSYA 2W9QA 2B24B 3DGNA 5M1AA 1YVBI 1OCVA 1WTHA 1YJW3 1UGHI 4XB5A 3WOEB 3G6E3 1IU7A 2LQVA 2XH9A 2YFIB 1ZGXA 4L8PA 1VQ93 3K0ZA 5LC6A 3H51A 1BSBA 2C10A 3MPHA 4XDWA 1PU4A 2RSXA 2HMJB 4ORLA 1M1K4 2YFLB 3EBTA 1L5GB 1BRSA 2OOVC 3B4PA 4MJDA 1G0TA 2XSHB 3G8ZA 2BO9B 4R4KA 1ULIB 3UL6A 1DE3A 5G1KA 1JBSA 1UUGB 3O8YA 1LXEA 2OTJ3 1CYVA 4GSPA 6RNTA 1GSPA 2JDIH 1IYYA 2KF6A 2XEPA 2OQEA 3U97A 1YI23 1Q824 1RCLA 1AQZA
chains in the Genus database with same CATH topology
1RGLA 2F4YA 1I3IA 1I2EA 1TRPA 1GMRA 1RMSA 1Q9EA 1CH0A 4HAAA 1C54A 1BU4A 1A2PA 1GOUA 1RGAA 2GSPA 1BUJA 2RBIA 1B2UA 6GSPA 3URPA 3D4AA 1I70A 1MGRA 9RNTA 1RTUA 2SARA 1BNRA 2KAAA 1HZ1A 1BSDA 1BRKA 4BIRA 1BSCA 1YNVX 1B27A 3AHSA 1BAOA 1LRAA 1SARA 5BU4A 2RNTA 1BOXA 1X1WA 1RSNA 5HOHA 1X1XA 1LOYA 3SYUA 1BNIA 4J5KA 1BNJA 2BU4A 2F5MA 1BSAA 7RNTA 3AHWA 1BANA 3A5EA 1JBTA 1X1UA 1BNSA 3Q3FA 1RGGA 1B3SA 1I3FA 1FZUA 1G02A 3DH2A 1GMPA 1B2ZA 1BRNL 2KF5A 1GOYA 1UCLA 1B2XA 1YVSA 5GSPA 5RNTA 1PY3A 1RN1A 1BVIA 7GSPA 8RNTA 2HOHA 2BIRA 1GMQA 1I0XA 1RHLA 1RN4A 1TRQA 3D5IA 1DETA 3AGNA 5BIRA 1BNGA 1JBRA 1GOVA 1BNEA 1BRGA 3D5GA 1MGWA 1BRHA 1X1YA 1B2MA 1UCJA 1HYFA 3GSPA 1RGFA 3AGOA 3WHOA 1YGWA 1RGHA 1TTOA 1I2FA 4J5GA 1FW7A 2F5WA 1FYSA 2AAEA 2AADA 2KF4A 4BU4A 1T2IA 1LNIA 1T2HA 1BGSA 1BIRA 1B21A 1I2GA 1R4YA 1RGEA 1AY7A 1RGKA 2KF3A 4HOHA 1BNFA 1RDSA 3BIRA 1I8VA 1RNTA 3DGYA 3WR2A 2ZA4A 1BRJA 4RNTA 1I0VA 1LOWA 1FUSA 3KCHA 4GHOA 3HOHA 1PYLA 1BSEA 1RLSA 1ZGXA 1BSBA 1B20A 3RNTA 1BRSA 1RGCA 1FUTA 1RCKA 2C4BA 1DE3A 1JBSA 1LOVA 1RNBA 1UCIA 1B2SA 4GSPA 2F56A 3BU4A 1GSPA 6RNTA 1IYYA 2KF6A 1BRIA 1UCKA 1RCLA 1AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGL A;  2F4Y A;  1I3I A;  1I2E A;  1TRP A;  1GMR A;  1RMS A;  1Q9E A;  1CH0 A;  4HAA A;  1C54 A;  1BU4 A;  1A2P A;  1GOU A;  1RGA A;  2GSP A;  1BUJ A;  2RBI A;  1B2U A;  6GSP A;  3URP A;  3D4A A;  1I70 A;  1MGR A;  9RNT A;  1RTU A;  2SAR A;  1BNR A;  2KAA A;  1HZ1 A;  1BSD A;  1BRK A;  4BIR A;  1BSC A;  1YNV X;  1B27 A;  3AHS A;  1BAO A;  1LRA A;  1SAR A;  5BU4 A;  2RNT A;  1BOX A;  1X1W A;  1RSN A;  5HOH A;  1X1X A;  1LOY A;  3SYU A;  1BNI A;  4J5K A;  1BNJ A;  2BU4 A;  2F5M A;  1BSA A;  7RNT A;  3AHW A;  1BAN A;  3A5E A;  1JBT A;  1X1U A;  1BNS A;  3Q3F A;  1RGG A;  1B3S A;  1I3F A;  1FZU A;  1G02 A;  3DH2 A;  1GMP A;  1B2Z A;  1BRN L;  2KF5 A;  1GOY A;  1UCL A;  1B2X A;  1YVS A;  5GSP A;  5RNT A;  1PY3 A;  1RN1 A;  1BVI A;  7GSP A;  8RNT A;  2HOH A;  2BIR A;  1GMQ A;  1I0X A;  1RHL A;  1RN4 A;  1TRQ A;  3D5I A;  1DET A;  3AGN A;  5BIR A;  1BNG A;  1JBR A;  1GOV A;  1BNE A;  1BRG A;  3D5G A;  1MGW A;  1BRH A;  1X1Y A;  1B2M A;  1UCJ A;  1HYF A;  3GSP A;  1RGF A;  3AGO A;  3WHO A;  1YGW A;  1RGH A;  1TTO A;  1I2F A;  4J5G A;  1FW7 A;  2F5W A;  1FYS A;  2AAE A;  2AAD A;  2KF4 A;  4BU4 A;  1T2I A;  1LNI A;  1T2H A;  1BGS A;  1BIR A;  1B21 A;  1I2G A;  1R4Y A;  1RGE A;  1AY7 A;  1RGK A;  2KF3 A;  4HOH A;  1BNF A;  1RDS A;  3BIR A;  1I8V A;  1RNT A;  3DGY A;  3WR2 A;  2ZA4 A;  1BRJ A;  4RNT A;  1I0V A;  1LOW A;  1FUS A;  3KCH A;  4GHO A;  3HOH A;  1PYL A;  1BSE A;  1RLS A;  1ZGX A;  1BSB A;  1B20 A;  3RNT A;  1BRS A;  1RGC A;  1FUT A;  1RCK A;  2C4B A;  1DE3 A;  1JBS A;  1LOV A;  1RNB A;  1UCI A;  1B2S A;  4GSP A;  2F56 A;  3BU4 A;  1GSP A;  6RNT A;  1IYY A;  2KF6 A;  1BRI A;  1UCK A;  1RCL A;  1AQZ A; 
#chains in the Genus database with same CATH topology
 3BNC A;  1RGL A;  2F4Y A;  1I3I A;  1IQY A;  1I2E A;  1TRP A;  4N6T A;  4LSO A;  1GMR A;  2W2C A;  2BMR B;  4BL2 A;  2CFW A;  5DRV A;  1CH0 A;  2SBL A;  2M7O A;  1MWT A;  3FSD A;  3SED A;  2GSP A;  2BNG A;  3X42 A;  4LEH A;  5DRE A;  1KSI A;  2WOF A;  1BUJ A;  2Q07 A;  4BTX A;  3CMA 3;  3EN8 A;  1AVL A;  3D4A A;  3FF0 A;  1UGI A;  1YGE A;  2CFK A;  1JB4 A;  2W6J H;  5IG0 A;  1PFP A;  3BNB A;  3NV0 A;  4GL6 A;  1E3R A;  1BRK A;  3QK9 A;  4HM3 B;  4U13 A;  1Q7Y 4;  3DGM A;  1GD4 A;  1EG9 B;  5BXQ A;  1VQP 3;  3LYG A;  2IY2 A;  1SAR A;  1NNV A;  2GEY A;  2H0I A;  1FUW A;  5JPU A;  2F86 B;  4CDL A;  3PGB A;  1X1X A;  1LOY A;  3ALA A;  5KP3 A;  1BNI A;  1TP6 A;  5A0O B;  2XFT A;  3I55 3;  1ZS7 A;  3LML A;  3NM7 A;  4BTW A;  1RRL A;  7RNT A;  1MWR A;  3G4S 3;  1OGX A;  1BAN A;  3CCJ 3;  1ZX2 A;  1X1U A;  3FG4 A;  2CW9 A;  3LTC A;  4K1U A;  1D6U A;  2OCT A;  1FZU A;  4HZ9 B;  1EUI C;  3GZR A;  4WWU C;  1JB5 A;  2KF5 A;  1GOY A;  1UCL A;  1B2X A;  1W2B 2;  5ELU A;  1N5H A;  1RN1 A;  1BVI A;  2JQ5 A;  3F8H A;  3VF1 A;  4CJN A;  1F8N A;  3LTD A;  7GSP A;  1US1 A;  8RNT A;  4L7K A;  1KD1 4;  1W6G A;  2XGN A;  3D79 A;  3EHC A;  4HM4 B;  4RZM A;  1Y4K A;  3OX9 A;  3D5I A;  1DET A;  4O2H A;  3SXX A;  4K61 A;  1DYU A;  1U5O A;  4WFO A;  2P0M A;  2CFL A;  4WP5 A;  1BRG A;  2CH9 A;  3PCR A;  2W9P A;  1YIJ 3;  1X1Y A;  1GY5 A;  1O7P B;  1UCJ A;  3D3L A;  4R80 A;  3V99 A;  1B2M A;  1VQN 3;  5IEO A;  1TJD A;  1I2F A;  4N6U A;  2FNQ A;  2AAE A;  3LT8 A;  4H61 A;  3EN1 B;  1RJO A;  4HOH A;  1Q42 A;  1RGK A;  4CCV A;  3WDG B;  5D83 A;  2P09 A;  3EJV A;  3GZY B;  3CC4 3;  1RDS A;  3DGY A;  3WR2 A;  3AMO A;  3N9H A;  1LVN A;  3HIG A;  2GU3 A;  1LOW A;  1IT8 A;  3WA3 A;  1UDI I;  3KCH A;  4GHO A;  4RNZ A;  1JJ2 2;  3OWY A;  4N3V A;  4WYK B;  3M8C A;  1LQG C;  3DGO A;  3KSE D;  3VGN A;  3FF2 A;  3PS8 A;  4J9A A;  1OHO A;  2K54 A;  2E2U A;  3BB9 A;  1Q81 4;  2CG0 A;  4HYZ A;  5AYS C;  4I5Q A;  1NO3 A;  2B1X B;  2UGI A;  2QEX 3;  1VQ4 3;  2OTL 3;  2BMO B;  4EXR A;  3Q1C A;  4AEQ A;  5AEW B;  3V98 A;  2K0M A;  2MC8 A;  1FUT A;  4EV2 A;  1YJN 3;  3DUK A;  2C4B A;  3GZB A;  1D6Z A;  3NQY A;  1LOV A;  5I97 A;  1RNB A;  1SIH A;  3S5C A;  1SPU A;  1YIT 3;  1VQL 3;  2STD A;  2QGU A;  4QWT A;  2L1S A;  3ZG0 A;  1UUW B;  3Q90 A;  1BRI A;  3KZT A;  5TGN A;  3JUP A;  4FR9 A;  1NWW A;  1SII A;  4IIA A;  3B4O A;  3F7S A;  1RN7 A;  2CWU A;  2WGQ A;  4HAA A;  2ZL8 A;  4N6V 0;  5M18 A;  2WO0 A;  1A2P A;  1GOU A;  4GB5 A;  1TIJ A;  4KVH A;  3GAX A;  3CCE 3;  3CCU 3;  5ELJ A;  3F9S A;  3K63 A;  1TFO A;  1TU5 A;  3CC2 3;  1Q7H A;  2BT3 A;  2K3D A;  4FCZ A;  3URP A;  3I56 3;  2HML B;  1ROA A;  1I70 A;  2O9U X;  4N6O B;  1RTU A;  2CHC A;  2SAR A;  3MG1 A;  4HZB B;  1A67 A;  2YX9 A;  3JUN A;  1OF5 A;  1KC8 4;  3S27 A;  2C11 A;  1T3B A;  3K9M C;  1YNV X;  4FMC A;  2MF7 A;  1B27 A;  2GU1 A;  4K1V A;  2F99 A;  1BAO A;  1LRA A;  5IER A;  3K5T A;  5EEO A;  1X1W A;  3RDE A;  1GS3 A;  1DVC A;  2P0X A;  2E2T A;  2V1L A;  2CIU A;  4XM4 A;  2OOV A;  3S28 A;  4J5K A;  1BNJ A;  2BU4 A;  2F5M A;  2P38 A;  2PNC A;  3MYT A;  4X2O A;  3CXC 2;  4LMI A;  2BMQ B;  5AIH A;  2CG1 A;  2QA4 3;  3B8L A;  1Q86 4;  4HVN A;  4H3U A;  4XDV A;  4TX4 A;  1RGG A;  1B3S A;  3JUQ A;  4BTY A;  1STD A;  3NBR A;  1B2Z A;  1A2V A;  1Q40 B;  2D1W A;  2HMN B;  1YVS A;  3MG3 A;  5RNT A;  1PY3 A;  3NX0 A;  1WMN A;  2GXF A;  2R4I A;  1JRQ A;  5CLK A;  5IF6 A;  3BNE A;  2D42 A;  4O8S A;  1O7W B;  1I0X A;  2W56 B;  4EV5 A;  1FGR A;  1RN4 A;  1TRQ A;  4FMB A;  4J8T A;  2KCD A;  3AGN A;  1ISK A;  2XR8 B;  1OPY A;  3S67 A;  5BIR A;  2CKF B;  1JN5 A;  2IUJ A;  1GOV A;  3OXA A;  4OVM A;  3F8X A;  3E99 A;  3WOD G;  3D5G A;  1UW1 A;  1AV4 A;  1KWI A;  3H3H A;  1QAF A;  1VQ5 3;  1BRH A;  2XFS A;  1V58 A;  2CK3 H;  3T8N A;  1Z1S A;  3WHO A;  3X40 A;  2ML6 A;  2XRX B;  3ER7 A;  3FKA A;  3GSP A;  5AII A;  6STD A;  3F40 A;  1VQK 3;  4KFD A;  1N9E A;  1IVV A;  1N9J A;  4J5G A;  3WOF B;  1FW7 A;  1ULJ B;  1EQK A;  2KF4 A;  4BU4 A;  1NU3 A;  3DXO A;  4STD A;  1O7G B;  2INX A;  2KF3 A;  1CEW I;  3DGL A;  1JKG B;  5HGR A;  3F7X A;  1STF I;  1OUN A;  1BNF A;  3BIR A;  3Q2P A;  1RNT A;  5D82 A;  4HM6 B;  3U1W A;  2ZA4 A;  1BRJ A;  5CK6 A;  3ZFZ A;  3J7Y d;  4RNT A;  1I0V A;  2FXT A;  3MKI A;  3JUM A;  3PZW A;  5STD A;  1VQ7 3;  1R4C A;  1A2K A;  3QRD A;  2HMO B;  4ILF A;  1GD3 A;  3HOH A;  3X41 A;  3CME 3;  1PYL A;  2IMJ A;  1KQS 2;  3SVA A;  1W2Z A;  1GY7 A;  4KZ1 A;  3NV0 B;  1WNH A;  3LOY A;  5KP4 A;  3NBB A;  1NB5 I;  3KFQ C;  4HM2 B;  4MEI A;  8CHO A;  1B20 A;  3RNT A;  1WQL B;  3TDG A;  3MWZ A;  1IT7 A;  1MOL A;  1QMA A;  4AKZ A;  2OWP A;  4X2H A;  1RCK A;  1QVF 2;  2L4V A;  4Q53 A;  4MMX B;  2GBX B;  2PZV A;  1HKX A;  4LZI A;  2J8X B;  1B2S A;  3UJM A;  3I0Y A;  5JPP A;  1IQ8 A;  4HBR A;  5BVB A;  1UCK A;  1W7C A;  2H0H A;  3X3Y A;  3S29 A;  1RMS A;  1Q9E A;  3CPO A;  1QJG A;  3A76 A;  2IA7 A;  3MG2 A;  3NUV A;  2P05 A;  1EKM A;  1RGA A;  3LTA A;  2Y74 A;  5CXO A;  2ZHX B;  2WOH A;  4HM0 B;  4KFF A;  1B2U A;  1V74 A;  1FGM A;  1W5Z A;  1GY6 A;  1W02 A;  3CNX A;  3EX9 A;  3G16 A;  3CPW 2;  1MWU A;  3LH4 A;  1MGR A;  3SX1 A;  7STD A;  2ML5 A;  2XF3 A;  2HMK B;  3HZP A;  2KAA A;  3CCS 3;  3EC9 A;  3F14 A;  2Y73 A;  5G1L A;  1T5Y A;  4BIR A;  1YHQ 3;  1BSC A;  1W4N A;  3N54 B;  3LXU X;  3AHS A;  1W6C A;  1IVW A;  3OW2 2;  3DY5 A;  2RNT A;  1IVX A;  1BOX A;  3ECF A;  2CC3 A;  4HM8 B;  5FGO A;  5G2G A;  3SYU A;  4AKY A;  5HOH A;  4OUQ A;  1FGT A;  2W03 A;  1W01 A;  1BSA A;  1O7H B;  3STD A;  4NPB A;  1K8A 4;  2KXG A;  3B7C A;  3A5E A;  2CWV A;  1VQO 3;  3CCL 3;  3BLZ A;  3Q3F A;  3CCQ 3;  1V57 A;  5CF2 A;  4OK0 A;  2O3O A;  1IVU A;  1N8R 4;  3DH2 A;  1GMP A;  4KT3 B;  4FCJ A;  2Z76 A;  3G0K A;  2ZDJ A;  4HJL B;  1OGZ A;  4JRF A;  3AMO B;  1J2B A;  3ZG5 A;  1M1X B;  2CX0 A;  1IDP A;  1S5A A;  2BIR A;  1GMQ A;  2IUK A;  3EF8 A;  3JVC A;  5M19 A;  1K28 A;  1UUV B;  3PXM A;  1U8C B;  1ASK A;  1TFK A;  3KII A;  4FCM A;  4NRE A;  3T8U A;  5AYR B;  2W56 A;  4DKI A;  4N6N B;  2UUG C;  2RCD A;  4FMD A;  1K41 A;  1LQM B;  1ZO2 A;  2IYJ A;  1OHS A;  1SJW A;  2KRT A;  5JBS A;  1OHP A;  1K73 4;  3MHE A;  1QVG 2;  1RKY A;  4PEJ A;  1VZZ A;  1HYF A;  3AGO A;  5IG5 A;  1IQX A;  3DMC A;  2OQE C;  4LYL B;  2F5W A;  2A15 A;  4BL3 A;  1NB3 I;  1E3V A;  2AAD A;  1N5P A;  1T2I A;  1E97 A;  2UX0 A;  1LNI A;  5IW9 A;  4O3V A;  1BGS A;  1B21 A;  1R4Y A;  5AIF A;  1VQQ A;  2BHM A;  1W00 A;  2WGO A;  3EQQ B;  2GEX A;  1JKG A;  3IMA B;  4MMZ B;  1FUS A;  2FGT A;  1MNL A;  1WMO A;  4N6M A;  4R9L A;  2F98 A;  1EEJ A;  1TUH A;  1BSE A;  3JUO A;  1VQM 3;  2R41 A;  1RLS A;  2RGQ A;  3BND A;  3L0R A;  3LZA A;  1CYU A;  1C7H A;  4JF8 A;  1OF5 B;  2W04 A;  3GRD A;  4G1M B;  4N6L A;  3GWR A;  2YFJ B;  4XBY A;  4R1K A;  4EYC A;  1YJ9 3;  1RGC A;  1SQW A;  3X3X A;  4R9K A;  1NJI 4;  4NHF A;  1DMN A;  4ZM8 A;  1UCI A;  2Z7A A;  3CCV 3;  2CWT A;  3OWU A;  3UL5 A;  4EBG A;  5IG4 A;  2F56 A;  3BU4 A;  2XGL A;  3X3Z A;  1IK3 A;  1FA3 A;  2CX1 A;  1QAL A;  3NBJ A;  1JZD A;  1N8Q A;  4IT7 A;  1DMM A;  3FG3 A;  3IJE B;  1GYB A;  3FLJ A;  5EQL A;  3OV4 A;  2QIY A;  5LC7 A;  3FGY A;  3CD6 3;  1CQS A;  1OH0 A;  1QAK A;  1BU4 A;  1WMP A;  1C54 A;  3RGR A;  3V92 A;  1EA2 A;  2RBI A;  1ROV A;  4FMA A;  1VQ6 3;  3WA2 X;  3FCS B;  3SOY A;  6GSP A;  3FH1 A;  3NXJ A;  1BUQ A;  3EE1 A;  1MWS A;  4WYK A;  9RNT A;  1O7M B;  3CCR 3;  1BNR A;  2LYX A;  3LT9 A;  3SOA A;  1M9G A;  5AI1 A;  1HZ1 A;  4HKV B;  1BSD A;  5FW5 A;  4EC6 A;  1AVK A;  3HX8 A;  2RFR A;  1JN5 B;  3EB8 A;  3GZX B;  1FGQ A;  3CNM A;  2I9W A;  3CC7 3;  4CPK A;  5BU4 A;  1RSN A;  2Z6B A;  3HII A;  3NHX A;  4MMY B;  1LOX A;  1O7N B;  5AIG A;  4RNY A;  3AHW A;  3FG1 A;  4LGQ A;  2CFG A;  2XSO B;  1S72 3;  1DVD A;  1JBT A;  4HM7 B;  1K9M 4;  1IV9 A;  4HM1 B;  1BNS A;  4I4K A;  4XBT A;  3UB1 A;  3G71 3;  5IG3 A;  3WMD A;  2H0G A;  5IEN A;  1I3F A;  3HI7 A;  1G02 A;  1LNH A;  3OWS A;  1JZO A;  1IV7 A;  4K90 B;  1BRN L;  5GSP A;  1G96 A;  3RGA A;  1FGO A;  5AEU B;  2HMM B;  2E2V A;  2HOH A;  4O02 B;  5KP1 A;  3MSO A;  3K7C A;  2CFD A;  3PYJ A;  3DM8 A;  5D81 A;  1DMQ A;  1AR0 A;  1JV2 B;  1RHL A;  3SLU A;  1NDO B;  3NM2 A;  4XBX A;  5EVH A;  4HM5 B;  3EBY A;  4L8O A;  3HK4 A;  5IEP A;  1BNG A;  1JBR A;  3D9R A;  3ROB A;  1A90 A;  3UNL A;  1RRH A;  1BNE A;  3CCM 3;  1W6Y A;  2W0Q A;  1MGW A;  4RBN A;  4WHA A;  3N8B A;  1JB2 A;  1OAC A;  1JNQ A;  3KE7 A;  1M90 4;  1VQ8 3;  1RGF A;  3KSP A;  3NQZ A;  1D6Y A;  1UI7 A;  1YGW A;  1RGH A;  1TTO A;  2GBW B;  3CU3 A;  3DZL A;  3LTB A;  3PCS A;  4KFE A;  5CF1 A;  1FYS A;  3T0U A;  4IPB A;  3FZW A;  1T2H A;  1BIR A;  3KKG A;  1Q40 A;  1I2G A;  1RGE A;  3IPT A;  1AY7 A;  1HU9 A;  3KN4 A;  4EW5 A;  2Z77 A;  1I8V A;  1UI8 A;  3VSY A;  2W9Q A;  2B24 B;  3DGN A;  5M1A A;  1YVB I;  1OCV A;  1WTH A;  1YJW 3;  1UGH I;  4XB5 A;  3WOE B;  3G6E 3;  1IU7 A;  2LQV A;  2XH9 A;  2YFI B;  1ZGX A;  4L8P A;  1VQ9 3;  3K0Z A;  5LC6 A;  3H51 A;  1BSB A;  2C10 A;  3MPH A;  4XDW A;  1PU4 A;  2RSX A;  2HMJ B;  4ORL A;  1M1K 4;  2YFL B;  3EBT A;  1L5G B;  1BRS A;  2OOV C;  3B4P A;  4MJD A;  1G0T A;  2XSH B;  3G8Z A;  2BO9 B;  4R4K A;  1ULI B;  3UL6 A;  1DE3 A;  5G1K A;  1JBS A;  1UUG B;  3O8Y A;  1LXE A;  2OTJ 3;  1CYV A;  4GSP A;  6RNT A;  1GSP A;  2JDI H;  1IYY A;  2KF6 A;  2XEP A;  2OQE A;  3U97 A;  1YI2 3;  1Q82 4;  1RCL A;  1AQZ A; 
#chains in the Genus database with same CATH homology
 1RGL A;  2F4Y A;  1I3I A;  1I2E A;  1TRP A;  1GMR A;  1RMS A;  1Q9E A;  1CH0 A;  4HAA A;  1C54 A;  1BU4 A;  1A2P A;  1GOU A;  1RGA A;  2GSP A;  1BUJ A;  2RBI A;  1B2U A;  6GSP A;  3URP A;  3D4A A;  1I70 A;  1MGR A;  9RNT A;  1RTU A;  2SAR A;  1BNR A;  2KAA A;  1HZ1 A;  1BSD A;  1BRK A;  4BIR A;  1BSC A;  1YNV X;  1B27 A;  3AHS A;  1BAO A;  1LRA A;  1SAR A;  5BU4 A;  2RNT A;  1BOX A;  1X1W A;  1RSN A;  5HOH A;  1X1X A;  1LOY A;  3SYU A;  1BNI A;  4J5K A;  1BNJ A;  2BU4 A;  2F5M A;  1BSA A;  7RNT A;  3AHW A;  1BAN A;  3A5E A;  1JBT A;  1X1U A;  1BNS A;  3Q3F A;  1RGG A;  1B3S A;  1I3F A;  1FZU A;  1G02 A;  3DH2 A;  1GMP A;  1B2Z A;  1BRN L;  2KF5 A;  1GOY A;  1UCL A;  1B2X A;  1YVS A;  5GSP A;  5RNT A;  1PY3 A;  1RN1 A;  1BVI A;  7GSP A;  8RNT A;  2HOH A;  2BIR A;  1GMQ A;  1I0X A;  1RHL A;  1RN4 A;  1TRQ A;  3D5I A;  1DET A;  3AGN A;  5BIR A;  1BNG A;  1JBR A;  1GOV A;  1BNE A;  1BRG A;  3D5G A;  1MGW A;  1BRH A;  1X1Y A;  1B2M A;  1UCJ A;  1HYF A;  3GSP A;  1RGF A;  3AGO A;  3WHO A;  1YGW A;  1RGH A;  1TTO A;  1I2F A;  4J5G A;  1FW7 A;  2F5W A;  1FYS A;  2AAE A;  2AAD A;  2KF4 A;  4BU4 A;  1T2I A;  1LNI A;  1T2H A;  1BGS A;  1BIR A;  1B21 A;  1I2G A;  1R4Y A;  1RGE A;  1AY7 A;  1RGK A;  2KF3 A;  4HOH A;  1BNF A;  1RDS A;  3BIR A;  1I8V A;  1RNT A;  3DGY A;  3WR2 A;  2ZA4 A;  1BRJ A;  4RNT A;  1I0V A;  1LOW A;  1FUS A;  3KCH A;  4GHO A;  3HOH A;  1PYL A;  1BSE A;  1RLS A;  1ZGX A;  1BSB A;  1B20 A;  3RNT A;  1BRS A;  1RGC A;  1FUT A;  1RCK A;  2C4B A;  1DE3 A;  1JBS A;  1LOV A;  1RNB A;  1UCI A;  1B2S A;  4GSP A;  2F56 A;  3BU4 A;  1GSP A;  6RNT A;  1IYY A;  2KF6 A;  1BRI A;  1UCK A;  1RCL A;  1AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...