7RNTA

Crystal structure of the tyr45trp mutant of ribonuclease t1 in a complex with 2'-adenylic acid
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNWEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Crystal structure of the Tyr45Trp mutant of ribonuclease T1 in a complex with 2'-adenylic acid.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 7rntA00
1UCIA 2HOHA 3DGYA 1X1YA 4J5KA 1RGFA 1BNGA 1A2PA 1B20A 1BU4A 1RGHA 1RNBA 1DETA 1SARA 1GMQA 1FZUA 1BNRA 1X1UA 2KF6A 4HAAA 6RNTA 1JBSA 5HOHA 3WR2A 1LOVA 5BU4A 3DH2A 1BIRA 3AGNA 1BAOA 1I2FA 1PY3A 1RNTA 2BIRA 1T2IA 1B2UA 1BRJA 1AQZA 1B21A 1BRSA 1AY7A 1UCJA 1RGGA 1GMRA 1I3IA 1BNSA 1I8VA 1RN1A 1UCKA 1RGAA 1FW7A 3SYUA 1HZ1A 1BSBA 3KCHA 1B2MA 1C54A 7RNTA 1FUTA 2KAAA 1BRGA 1GOVA 1BSCA 1TRPA 2GSPA 1BNFA 2KF5A 1I2GA 1LRAA 1RCLA 1JBRA 1MGRA 1BRNL 1G02A 1I0XA 1BOXA 1RCKA 3D4AA 1B2XA 6GSPA 1FYSA 1B3SA 1TRQA 1BSEA 3Q3FA 1BSAA 1GOYA 5RNTA 1I0VA 1T2HA 1RGEA 1TTOA 1RMSA 5GSPA 1RGLA 1BNIA 3AGOA 1GMPA 1RGCA 2F4YA 2F5WA 4BIRA 1RN4A 3AHWA 2C4BA 1R4YA 2AAEA 4HOHA 1BANA 4RNTA 3HOHA 1RDSA 2RBIA 7GSPA 1BNEA 1IYYA 2KF3A 2AADA 4GHOA 1BUJA 2ZA4A 3BIRA 2F56A 2F5MA 3URPA 1GSPA 1RLSA 1LOYA 1CH0A 1B27A 4GSPA 1Q9EA 2RNTA 3D5IA 1BRIA 1YVSA 1BRKA 4J5GA 3WHOA 1X1WA 1DE3A 1BRHA 1LNIA 2SARA 5BIRA 1ZGXA 1BVIA 1MGWA 1I70A 1YGWA 1X1XA 1YNVX 1RGKA 1BGSA 1GOUA 1JBTA 3RNTA 1BNJA 1RHLA 4BU4A 1RTUA 1UCLA 1I3FA 8RNTA 1B2ZA 2BU4A 1LOWA 3AHSA 1PYLA 9RNTA 2KF4A 1I2EA 3BU4A 3D5GA 1BSDA 3GSPA 3A5EA 1RSNA 1HYFA 1FUSA 1B2SA
chains in the Genus database with same CATH superfamily
5CXOA 1UCIA 2Q07A 5IG4A 3WA3A 2XSOB 3OWSA 1FGTA 1VQM3 5LC7A 3ZG0A 1BU4A 1RGHA 5AYSC 1SARA 1N9EA 1T5YA 1TFOA 3KSED 2CIUA 2PNCA 5AIGA 1GMQA 3WODG 1FZUA 1O7NB 2KF6A 3T8NA 2WOHA 2D1WA 2QGUA 2B24B 1SJWA 1OF5A 3S67A 2STDA 4OK0A 3AGNA 4OUQA 1BAOA 1ZX2A 1PY3A 2Z77A 1IT8A 1RNTA 2BIRA 3B4OA 3EJVA 3PCRA 3HZPA 3K7CA 4WHAA 3GRDA 5M1AA 1E97A 4HKVB 1SIHA 4IIAA 3MG3A 1OPYA 1YJW3 1N8R4 3E99A 3QK9A 1AY7A 2XFTA 3KN4A 1GMRA 3S28A 1YJ93 1RGAA 4L8OA 3KKGA 5M19A 1FGQA 1BSBA 2KCDA 3Q90A 1OGXA 1JJ22 1C54A 1Y4KA 4N6MA 2BT3A 4OVMA 2F99A 1BRGA 2WOFA 1GYBA 1BSCA 1TRPA 3I553 3DGNA 3NV0A 1VQL3 2ZDJA 2OTJ3 1RCLA 5CF1A 2BMOB 1ROVA 1W2B2 1ASKA 1Q40A 2HMKB 3CC73 1G02A 5IW9A 2RCDA 2W56B 4HBRA 4K1VA 3D4AA 1JKGB 3EBTA 2IUJA 3DGMA 6GSPA 1FYSA 1VQ73 1B3SA 1CQSA 1ZS7A 3FF2A 2E2UA 1I0VA 1T2HA 1A2KA 3FZWA 3NM7A 2QA43 1BUQA 1BNIA 2RGQA 2OTL3 1EG9B 3AGOA 6STDA 2XGLA 3DZLA 3FLJA 3LTDA 3EB8A 4N6LA 3OV4A 4ILFA 1RN4A 4XBXA 1O7PB 5TGNA 2QIYA 1YI23 1BANA 4MEIA 1DMQA 2IUKA 1BNEA 2BO9B 2YFJB 1IYYA 2KF3A 2ZHXB 4FMDA 3OXAA 2CG1A 3LTCA 1BUJA 4LGQA 1TJDA 3BNCA 1RLSA 2RFRA 3WDGB 1VZZA 3NHXA 2XFSA 3CC23 3F9SA 4GSPA 4KZ1A 1JZDA 2CFKA 3G16A 3IMAB 3BNBA 3D3LA 3T0UA 1BRIA 1YVSA 3JUOA 4J5GA 5D83A 3DY5A 4BL2A 4TX4A 4XDVA 2I9WA 1UUGB 1BRHA 5CK6A 4H3UA 1PFPA 5JPUA 1JN5B 3MG2A 4WWUC 1CYVA 3PCSA 3VF1A 1I70A 3X40A 3BNDA 4O02B 1JNQA 1VQP3 3FG1A 1W7CA 4XBTA 1O7WB 3LMLA 3RNTA 1NO3A 1LVNA 1GY7A 1TFKA 9RNTA 3BU4A 1ROAA 1W5ZA 2CFLA 3CCM3 3CCU3 1HYFA 1WMPA 1B2SA 1TIJA 3MKIA 5AYRB 1KWIA 3T8UA 2WGOA 1FGOA 1RGFA 2MF7A 3GZYB 4J8TA 4H61A 1YVBI 4XDWA 3S27A 1E3RA 3UL5A 3FSDA 1B20A 2V1LA 2W0QA 1DETA 1HU9A 3CPOA 5IG0A 2E2TA 2H0IA 2ML6A 1TUHA 3CMA3 1VQ63 1X1UA 3WA2X 3GZBA 6RNTA 4EYCA 5AIHA 2GEYA 4K61A 3WR2A 5HOHA 1LNHA 2QEX3 1VQO3 1UDII 3DH2A 4XBYA 4FCZA 1DMNA 2XGNA 4K90B 1IU7A 2XEPA 4EW5A 4CPKA 1LOXA 5AIFA 5KP4A 2P05A 4RZMA 4LMIA 1YGEA 4O3VA 2F98A 2W56A 4LEHA 4WYKB 1UCJA 2B1XB 2D42A 1GY6A 1JKGA 2Z76A 3O8YA 1DVDA 1W02A 4X2HA 2H0HA 1I3IA 3ALAA 1BNSA 1I8VA 1RN1A 1UCKA 3CU3A 3IJEB 4WP5A 1MWUA 5BXQA 5IERA 4NPBA 2KRTA 1FW7A 1Q42A 1W4NA 3CNMA 1AR0A 3FH1A 3JVCA 1W00A 4CCVA 3GAXA 3K5TA 1GOVA 3KZTA 2Z6BA 1L5GB 3SVAA 2GSPA 1BNFA 3MWZA 1IQ8A 2CG0A 2KF5A 1I2GA 2C11A 5IEOA 3X3YA 5IG5A 1NWWA 1ULIB 2IMJA 1UUWB 1FUWA 3ER7A 1J2BA 4EXRA 3KFQC 1JB2A 1NDOB 1OGZA 1OHSA 3GZRA 1K41A 2GBWB 1BOXA 1E3VA 3EC9A 1RCKA 2K3DA 4IPBA 4STDA 3N8BA 3SX1A 3LT9A 5HGRA 1LXEA 3D9RA 3CME3 1V58A 1TRQA 1BSEA 1BSAA 3RDEA 4FMAA 1TTOA 2XRXB 3B8LA 1FA3A 1RRHA 1RMSA 2F86B 3NQZA 1VQK3 1RGCA 5BVBA 2HMJB 3FGYA 1KD14 1TU5A 5I97A 2F5WA 4O8SA 2FXTA 1QAKA 1US1A 2CW9A 4MMXB 2GU1A 1STDA 2CFGA 3AMOB 4L8PA 1TP6A 2P0XA 3F7SA 3G8ZA 1N5HA 5JPPA 4FCJA 2RBIA 1IT7A 7GSPA 1LQGC 1NU3A 1QMAA 4LYLB 3HK4A 1DMMA 1JN5A 3G6E3 1VQ93 2CK3H 1HKXA 1EEJA 2ZA4A 2F56A 3BIRA 2F5MA 1QVG2 3F7XA 3N54B 3URPA 1GSPA 3Q2PA 4HM7B 3STDA 1B27A 1CH0A 1LOYA 1D6UA 3K9MC 3M8CA 2CWUA 2CX0A 1M1XB 3D5IA 1A67A 4KFFA 2L1SA 1WMNA 4GB5A 2OQEC 3WHOA 3CCS3 3ECFA 1DE3A 1LNIA 2SARA 1IV9A 1U8CB 3HIGA 4N6UA 5ELJA 3MSOA 1ZGXA 3F14A 1MGWA 1YGWA 5AEUB 4NREA 1EA2A 1GS3A 3EQQB 1RGKA 2XF3A 2Y74A 1GOUA 2RSXA 3PYJA 1M904 2A15A 4N6NB 1JBTA 1RHLA 4AKZA 3DGLA 1RTUA 4N6TA 4BU4A 2BU4A 4R1KA 2R41A 1ZO2A 1PYLA 3NUVA 3V98A 2UX0A 3NBRA 3CXC2 1EKMA 5EVHA 1FUSA 3HIIA 4FCMA 3J7Yd 5M18A 1OH0A 2O9UX 3FCSB 4HM8B 5G2GA 3V92A 1BNGA 1VQ43 1NNVA 1QJGA 1A2PA 1N9JA 3SOYA 4RNYA 4KT3B 4WYKA 1W2ZA 1BNRA 1IQYA 1C7HA 4K1UA 5FGOA 3DXOA 3NX0A 1WNHA 4FMCA 2OQEA 4AEQA 3LT8A 2CWTA 2BMQB 5CF2A 3UNLA 1NB3I 1UGIA 2CH9A 1IQXA 3JUQA 2YFIB 3HI7A 4X2OA 3LTAA 1BIRA 3L0RA 1I2FA 1JZOA 4HM0B 1NJI4 1T2IA 3UJMA 2XH9A 1BRJA 1F8NA 1IDPA 2W9QA 2GBXB 3CNXA 3EBYA 2CKFB 5ELUA 4QWTA 3UB1A 1MOLA 5DRVA 1QAFA 4EV5A 3EHCA 1BRSA 3HX8A 3N9HA 3VSYA 5EEOA 1RGGA 4HM4B 4AKYA 4U13A 2WO0A 4HVNA 3F8HA 3SYUA 1M1K4 1HZ1A 4L7KA 3SLUA 1B2MA 2INXA 2P38A 1YJN3 1FUTA 2KAAA 3OX9A 3MHEA 4ZM8A 2HMMB 3X42A 4R4KA 4KVHA 3DGOA 4HYZA 3CD63 2H0GA 4HM5B 1JBRA 7STDA 1MGRA 1BRNL 3I563 1SPUA 2IYJA 1UI8A 5IENA 3NBBA 2FGTA 3AMOA 1CEWI 2L4VA 2LYXA 1UW1A 4IT7A 2FNQA 3CCQ3 3F8XA 2W9PA 4EBGA 4R9LA 5RNTA 2ML5A 3FF0A 3Q3FA 4N6V0 1GOYA 3G4S3 1KQS2 1MWRA 4EC6A 1JB5A 3B7CA 2R4IA 1M9GA 1WMOA 1W6CA 5GSPA 1RGLA 4BTYA 2KXGA 2K0MA 5DREA 1A90A 3CCE3 3NXJA 5CLKA 2F4YA 3X3XA 4BIRA 2XR8B 4RBNA 2W6JH 3AHWA 1OACA 2C4BA 4N6OB 2C10A 1R4YA 2AAEA 3K63A 3CCL3 4EV2A 2W04A 1CYUA 5IG3A 3GZXB 4KFEA 1RDSA 5KP3A 1OHPA 2PZVA 2W03A 2AADA 1WQLB 1IVXA 4GL6A 4RNZA 3D79A 2BHMA 4HJLB 3WMDA 3CPW2 1U5OA 3GWRA 1DVCA 3PXMA 1V57A 1K8A4 1RN7A 1IK3A 1EQKA 5G1LA 1AV4A 3LH4A 3H51A 3X41A 1YIT3 3KIIA 3LOYA 1AVLA 5BIRA 3FG4A 4XB5A 1Q7Y4 2CC3A 3CCJ3 1BVIA 1QALA 2LQVA 2P0MA 1D6YA 3DM8A 3OWUA 1YNVX 4FMBA 4I5QA 2IY2A 2IA7A 2OOVC 1T3BA 1KSIA 1RJOA 1JB4A 3BB9A 4HM2B 2P09A 1GD4A 1LQMB 3S5CA 3KE7A 3G713 4LSOA 1I3FA 8RNTA 1LOWA 3EE1A 1N8QA 2CWVA 2KF4A 1I2EA 3BNEA 1UGHI 2UGIA 3WOEB 3A5EA 1RSNA 1GD3A 3DUKA 3I0YA 2ZL8A 4JRFA 1RNBA 2HOHA 3DGYA 1Q824 1X1YA 3MG1A 4J5KA 3U97A 1D6ZA 1UUVB 4R9KA 5AI1A 3ROBA 2Z7AA 1KC84 4PEJA 1VQN3 1W6GA 3SEDA 4HAAA 1IV7A 1NB5I 1JV2B 1O7HB 1O7GB 3FKAA 1JBSA 5LC6A 1EUIC 2GU3A 1MWSA 3ZG5A 1AVKA 1STFI 1LOVA 2GXFA 5BU4A 1G96A 4R80A 4BTXA 1YIJ3 3OWYA 5KP1A 2OOVA 1RRLA 2HMNB 1B2UA 4BTWA 1GY5A 1AQZA 3LYGA 1VQ53 1UI7A 1QVF2 1MWTA 4HZBB 1B21A 3DMCA 1Z1SA 1MNLA 2SBLA 3K0ZA 2O3OA 3OW22 2YFLB 1R4CA 4CDLA 4O2HA 2WGQA 3KCHA 3LXUX 1OF5B 3LZAA 4HM3B 7RNTA 5D81A 1IVUA 3BLZA 4MJDA 2HMLB 1LRAA 2YX9A 3ZFZA 1K28A 5G1KA 1IVVA 1W6YA 2K54A 4J9AA 5IEPA 3CCV3 2MC8A 1I0XA 3A76A 4FR9A 4MMYB 1Q814 2OWPA 3PZWA 3RGAA 3EF8A 2J8XB 1B2XA 5A0OB 2OCTA 4N3VA 1FGMA 2W2CA 4DKIA 1RGEA 1W01A 5STDA 1IVWA 4CJNA 4BL3A 3F40A 1GMPA 3NV0B 1ISKA 3NQYA 1VQ83 3U1WA 1N5PA 1YHQ3 2GEXA 4KFDA 3MPHA 1Q40B 4LZIA 1DYUA 1FGRA 5IF6A 1Q7HA 3B4PA 4HOHA 3EN8A 3IPTA 3JUNA 4RNTA 3HOHA 2BMRB 3JUMA 5JBSA 2E2VA 1OHOA 2UUGC 3EN1B 3CCR3 3X3ZA 3G0KA 1PU4A 4JF8A 4GHOA 4NHFA 3PGBA 1WTHA 2CX1A 5AIIA 3TDGA 3RGRA 4I4KA 2CFWA 1SIIA 2JQ5A 4WFOA 3SXXA 1JRQA 1O7MB 3WOFB 3SOAA 5D82A 3MYTA 1VQQA 1A2VA 1Q9EA 1OCVA 3EX9A 3QRDA 2XSHB 2RNTA 3V99A 1K9M4 5AEWB 1BRKA 2M7OA 3LTBA 3S29A 3PS8A 4HM1B 1X1WA 2BNGA 3NM2A 3CC43 4XM4A 1ULJB 3KSPA 1S723 4MMZB 1X1XA 4G1MB 4HM6B 3Q1CA 1OUNA 1RKYA 1Q864 2CFDA 3FG3A 3H3HA 2CHCA 1K734 1BGSA 4HZ9B 1V74A 1S5AA 4ORLA 4Q53A 5FW5A 1BNJA 2HMOB 3UL6A 2JDIH 2Y73A 5EQLA 1G0TA 1UCLA 3VGNA 1B2ZA 8CHOA 3AHSA 3NBJA 1SQWA 3D5GA 1BSDA 3GSPA 3JUPA
chains in the Genus database with same CATH topology
1UCIA 2HOHA 3DGYA 1X1YA 4J5KA 1RGFA 1BNGA 1A2PA 1B20A 1BU4A 1RGHA 1RNBA 1DETA 1SARA 1GMQA 1FZUA 1BNRA 1X1UA 2KF6A 4HAAA 6RNTA 1JBSA 5HOHA 3WR2A 1LOVA 5BU4A 3DH2A 1BIRA 3AGNA 1BAOA 1I2FA 1PY3A 1RNTA 2BIRA 1T2IA 1B2UA 1BRJA 1AQZA 1B21A 1BRSA 1AY7A 1UCJA 1RGGA 1GMRA 1I3IA 1BNSA 1I8VA 1RN1A 1UCKA 1RGAA 1FW7A 3SYUA 1HZ1A 1BSBA 3KCHA 1B2MA 1C54A 7RNTA 1FUTA 2KAAA 1BRGA 1GOVA 1BSCA 1TRPA 2GSPA 1BNFA 2KF5A 1I2GA 1LRAA 1RCLA 1JBRA 1MGRA 1BRNL 1G02A 1I0XA 1BOXA 1RCKA 3D4AA 1B2XA 6GSPA 1FYSA 1B3SA 1TRQA 1BSEA 3Q3FA 1BSAA 1GOYA 5RNTA 1I0VA 1T2HA 1RGEA 1TTOA 1RMSA 5GSPA 1RGLA 1BNIA 3AGOA 1GMPA 1RGCA 2F4YA 2F5WA 4BIRA 1RN4A 3AHWA 2C4BA 1R4YA 2AAEA 4HOHA 1BANA 4RNTA 3HOHA 1RDSA 2RBIA 7GSPA 1BNEA 1IYYA 2KF3A 2AADA 4GHOA 1BUJA 2ZA4A 3BIRA 2F56A 2F5MA 3URPA 1GSPA 1RLSA 1LOYA 1CH0A 1B27A 4GSPA 1Q9EA 2RNTA 3D5IA 1BRIA 1YVSA 1BRKA 4J5GA 3WHOA 1X1WA 1DE3A 1BRHA 1LNIA 2SARA 5BIRA 1ZGXA 1BVIA 1MGWA 1I70A 1YGWA 1X1XA 1YNVX 1RGKA 1BGSA 1GOUA 1JBTA 3RNTA 1BNJA 1RHLA 4BU4A 1RTUA 1UCLA 1I3FA 8RNTA 1B2ZA 2BU4A 1LOWA 3AHSA 1PYLA 9RNTA 2KF4A 1I2EA 3BU4A 3D5GA 1BSDA 3GSPA 3A5EA 1RSNA 1HYFA 1FUSA 1B2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCI A;  2HOH A;  3DGY A;  1X1Y A;  4J5K A;  1RGF A;  1BNG A;  1A2P A;  1B20 A;  1BU4 A;  1RGH A;  1RNB A;  1DET A;  1SAR A;  1GMQ A;  1FZU A;  1BNR A;  1X1U A;  2KF6 A;  4HAA A;  6RNT A;  1JBS A;  5HOH A;  3WR2 A;  1LOV A;  5BU4 A;  3DH2 A;  1BIR A;  3AGN A;  1BAO A;  1I2F A;  1PY3 A;  1RNT A;  2BIR A;  1T2I A;  1B2U A;  1BRJ A;  1AQZ A;  1B21 A;  1BRS A;  1AY7 A;  1UCJ A;  1RGG A;  1GMR A;  1I3I A;  1BNS A;  1I8V A;  1RN1 A;  1UCK A;  1RGA A;  1FW7 A;  3SYU A;  1HZ1 A;  1BSB A;  3KCH A;  1B2M A;  1C54 A;  7RNT A;  1FUT A;  2KAA A;  1BRG A;  1GOV A;  1BSC A;  1TRP A;  2GSP A;  1BNF A;  2KF5 A;  1I2G A;  1LRA A;  1RCL A;  1JBR A;  1MGR A;  1BRN L;  1G02 A;  1I0X A;  1BOX A;  1RCK A;  3D4A A;  1B2X A;  6GSP A;  1FYS A;  1B3S A;  1TRQ A;  1BSE A;  3Q3F A;  1BSA A;  1GOY A;  5RNT A;  1I0V A;  1T2H A;  1RGE A;  1TTO A;  1RMS A;  5GSP A;  1RGL A;  1BNI A;  3AGO A;  1GMP A;  1RGC A;  2F4Y A;  2F5W A;  4BIR A;  1RN4 A;  3AHW A;  2C4B A;  1R4Y A;  2AAE A;  4HOH A;  1BAN A;  4RNT A;  3HOH A;  1RDS A;  2RBI A;  7GSP A;  1BNE A;  1IYY A;  2KF3 A;  2AAD A;  4GHO A;  1BUJ A;  2ZA4 A;  3BIR A;  2F56 A;  2F5M A;  3URP A;  1GSP A;  1RLS A;  1LOY A;  1CH0 A;  1B27 A;  4GSP A;  1Q9E A;  2RNT A;  3D5I A;  1BRI A;  1YVS A;  1BRK A;  4J5G A;  3WHO A;  1X1W A;  1DE3 A;  1BRH A;  1LNI A;  2SAR A;  5BIR A;  1ZGX A;  1BVI A;  1MGW A;  1I70 A;  1YGW A;  1X1X A;  1YNV X;  1RGK A;  1BGS A;  1GOU A;  1JBT A;  3RNT A;  1BNJ A;  1RHL A;  4BU4 A;  1RTU A;  1UCL A;  1I3F A;  8RNT A;  1B2Z A;  2BU4 A;  1LOW A;  3AHS A;  1PYL A;  9RNT A;  2KF4 A;  1I2E A;  3BU4 A;  3D5G A;  1BSD A;  3GSP A;  3A5E A;  1RSN A;  1HYF A;  1FUS A;  1B2S A; 
#chains in the Genus database with same CATH topology
 5CXO A;  1UCI A;  2Q07 A;  5IG4 A;  3WA3 A;  2XSO B;  3OWS A;  1FGT A;  1VQM 3;  5LC7 A;  3ZG0 A;  1BU4 A;  1RGH A;  5AYS C;  1SAR A;  1N9E A;  1T5Y A;  1TFO A;  3KSE D;  2CIU A;  2PNC A;  5AIG A;  1GMQ A;  3WOD G;  1FZU A;  1O7N B;  2KF6 A;  3T8N A;  2WOH A;  2D1W A;  2QGU A;  2B24 B;  1SJW A;  1OF5 A;  3S67 A;  2STD A;  4OK0 A;  3AGN A;  4OUQ A;  1BAO A;  1ZX2 A;  1PY3 A;  2Z77 A;  1IT8 A;  1RNT A;  2BIR A;  3B4O A;  3EJV A;  3PCR A;  3HZP A;  3K7C A;  4WHA A;  3GRD A;  5M1A A;  1E97 A;  4HKV B;  1SIH A;  4IIA A;  3MG3 A;  1OPY A;  1YJW 3;  1N8R 4;  3E99 A;  3QK9 A;  1AY7 A;  2XFT A;  3KN4 A;  1GMR A;  3S28 A;  1YJ9 3;  1RGA A;  4L8O A;  3KKG A;  5M19 A;  1FGQ A;  1BSB A;  2KCD A;  3Q90 A;  1OGX A;  1JJ2 2;  1C54 A;  1Y4K A;  4N6M A;  2BT3 A;  4OVM A;  2F99 A;  1BRG A;  2WOF A;  1GYB A;  1BSC A;  1TRP A;  3I55 3;  3DGN A;  3NV0 A;  1VQL 3;  2ZDJ A;  2OTJ 3;  1RCL A;  5CF1 A;  2BMO B;  1ROV A;  1W2B 2;  1ASK A;  1Q40 A;  2HMK B;  3CC7 3;  1G02 A;  5IW9 A;  2RCD A;  2W56 B;  4HBR A;  4K1V A;  3D4A A;  1JKG B;  3EBT A;  2IUJ A;  3DGM A;  6GSP A;  1FYS A;  1VQ7 3;  1B3S A;  1CQS A;  1ZS7 A;  3FF2 A;  2E2U A;  1I0V A;  1T2H A;  1A2K A;  3FZW A;  3NM7 A;  2QA4 3;  1BUQ A;  1BNI A;  2RGQ A;  2OTL 3;  1EG9 B;  3AGO A;  6STD A;  2XGL A;  3DZL A;  3FLJ A;  3LTD A;  3EB8 A;  4N6L A;  3OV4 A;  4ILF A;  1RN4 A;  4XBX A;  1O7P B;  5TGN A;  2QIY A;  1YI2 3;  1BAN A;  4MEI A;  1DMQ A;  2IUK A;  1BNE A;  2BO9 B;  2YFJ B;  1IYY A;  2KF3 A;  2ZHX B;  4FMD A;  3OXA A;  2CG1 A;  3LTC A;  1BUJ A;  4LGQ A;  1TJD A;  3BNC A;  1RLS A;  2RFR A;  3WDG B;  1VZZ A;  3NHX A;  2XFS A;  3CC2 3;  3F9S A;  4GSP A;  4KZ1 A;  1JZD A;  2CFK A;  3G16 A;  3IMA B;  3BNB A;  3D3L A;  3T0U A;  1BRI A;  1YVS A;  3JUO A;  4J5G A;  5D83 A;  3DY5 A;  4BL2 A;  4TX4 A;  4XDV A;  2I9W A;  1UUG B;  1BRH A;  5CK6 A;  4H3U A;  1PFP A;  5JPU A;  1JN5 B;  3MG2 A;  4WWU C;  1CYV A;  3PCS A;  3VF1 A;  1I70 A;  3X40 A;  3BND A;  4O02 B;  1JNQ A;  1VQP 3;  3FG1 A;  1W7C A;  4XBT A;  1O7W B;  3LML A;  3RNT A;  1NO3 A;  1LVN A;  1GY7 A;  1TFK A;  9RNT A;  3BU4 A;  1ROA A;  1W5Z A;  2CFL A;  3CCM 3;  3CCU 3;  1HYF A;  1WMP A;  1B2S A;  1TIJ A;  3MKI A;  5AYR B;  1KWI A;  3T8U A;  2WGO A;  1FGO A;  1RGF A;  2MF7 A;  3GZY B;  4J8T A;  4H61 A;  1YVB I;  4XDW A;  3S27 A;  1E3R A;  3UL5 A;  3FSD A;  1B20 A;  2V1L A;  2W0Q A;  1DET A;  1HU9 A;  3CPO A;  5IG0 A;  2E2T A;  2H0I A;  2ML6 A;  1TUH A;  3CMA 3;  1VQ6 3;  1X1U A;  3WA2 X;  3GZB A;  6RNT A;  4EYC A;  5AIH A;  2GEY A;  4K61 A;  3WR2 A;  5HOH A;  1LNH A;  2QEX 3;  1VQO 3;  1UDI I;  3DH2 A;  4XBY A;  4FCZ A;  1DMN A;  2XGN A;  4K90 B;  1IU7 A;  2XEP A;  4EW5 A;  4CPK A;  1LOX A;  5AIF A;  5KP4 A;  2P05 A;  4RZM A;  4LMI A;  1YGE A;  4O3V A;  2F98 A;  2W56 A;  4LEH A;  4WYK B;  1UCJ A;  2B1X B;  2D42 A;  1GY6 A;  1JKG A;  2Z76 A;  3O8Y A;  1DVD A;  1W02 A;  4X2H A;  2H0H A;  1I3I A;  3ALA A;  1BNS A;  1I8V A;  1RN1 A;  1UCK A;  3CU3 A;  3IJE B;  4WP5 A;  1MWU A;  5BXQ A;  5IER A;  4NPB A;  2KRT A;  1FW7 A;  1Q42 A;  1W4N A;  3CNM A;  1AR0 A;  3FH1 A;  3JVC A;  1W00 A;  4CCV A;  3GAX A;  3K5T A;  1GOV A;  3KZT A;  2Z6B A;  1L5G B;  3SVA A;  2GSP A;  1BNF A;  3MWZ A;  1IQ8 A;  2CG0 A;  2KF5 A;  1I2G A;  2C11 A;  5IEO A;  3X3Y A;  5IG5 A;  1NWW A;  1ULI B;  2IMJ A;  1UUW B;  1FUW A;  3ER7 A;  1J2B A;  4EXR A;  3KFQ C;  1JB2 A;  1NDO B;  1OGZ A;  1OHS A;  3GZR A;  1K41 A;  2GBW B;  1BOX A;  1E3V A;  3EC9 A;  1RCK A;  2K3D A;  4IPB A;  4STD A;  3N8B A;  3SX1 A;  3LT9 A;  5HGR A;  1LXE A;  3D9R A;  3CME 3;  1V58 A;  1TRQ A;  1BSE A;  1BSA A;  3RDE A;  4FMA A;  1TTO A;  2XRX B;  3B8L A;  1FA3 A;  1RRH A;  1RMS A;  2F86 B;  3NQZ A;  1VQK 3;  1RGC A;  5BVB A;  2HMJ B;  3FGY A;  1KD1 4;  1TU5 A;  5I97 A;  2F5W A;  4O8S A;  2FXT A;  1QAK A;  1US1 A;  2CW9 A;  4MMX B;  2GU1 A;  1STD A;  2CFG A;  3AMO B;  4L8P A;  1TP6 A;  2P0X A;  3F7S A;  3G8Z A;  1N5H A;  5JPP A;  4FCJ A;  2RBI A;  1IT7 A;  7GSP A;  1LQG C;  1NU3 A;  1QMA A;  4LYL B;  3HK4 A;  1DMM A;  1JN5 A;  3G6E 3;  1VQ9 3;  2CK3 H;  1HKX A;  1EEJ A;  2ZA4 A;  2F56 A;  3BIR A;  2F5M A;  1QVG 2;  3F7X A;  3N54 B;  3URP A;  1GSP A;  3Q2P A;  4HM7 B;  3STD A;  1B27 A;  1CH0 A;  1LOY A;  1D6U A;  3K9M C;  3M8C A;  2CWU A;  2CX0 A;  1M1X B;  3D5I A;  1A67 A;  4KFF A;  2L1S A;  1WMN A;  4GB5 A;  2OQE C;  3WHO A;  3CCS 3;  3ECF A;  1DE3 A;  1LNI A;  2SAR A;  1IV9 A;  1U8C B;  3HIG A;  4N6U A;  5ELJ A;  3MSO A;  1ZGX A;  3F14 A;  1MGW A;  1YGW A;  5AEU B;  4NRE A;  1EA2 A;  1GS3 A;  3EQQ B;  1RGK A;  2XF3 A;  2Y74 A;  1GOU A;  2RSX A;  3PYJ A;  1M90 4;  2A15 A;  4N6N B;  1JBT A;  1RHL A;  4AKZ A;  3DGL A;  1RTU A;  4N6T A;  4BU4 A;  2BU4 A;  4R1K A;  2R41 A;  1ZO2 A;  1PYL A;  3NUV A;  3V98 A;  2UX0 A;  3NBR A;  3CXC 2;  1EKM A;  5EVH A;  1FUS A;  3HII A;  4FCM A;  3J7Y d;  5M18 A;  1OH0 A;  2O9U X;  3FCS B;  4HM8 B;  5G2G A;  3V92 A;  1BNG A;  1VQ4 3;  1NNV A;  1QJG A;  1A2P A;  1N9J A;  3SOY A;  4RNY A;  4KT3 B;  4WYK A;  1W2Z A;  1BNR A;  1IQY A;  1C7H A;  4K1U A;  5FGO A;  3DXO A;  3NX0 A;  1WNH A;  4FMC A;  2OQE A;  4AEQ A;  3LT8 A;  2CWT A;  2BMQ B;  5CF2 A;  3UNL A;  1NB3 I;  1UGI A;  2CH9 A;  1IQX A;  3JUQ A;  2YFI B;  3HI7 A;  4X2O A;  3LTA A;  1BIR A;  3L0R A;  1I2F A;  1JZO A;  4HM0 B;  1NJI 4;  1T2I A;  3UJM A;  2XH9 A;  1BRJ A;  1F8N A;  1IDP A;  2W9Q A;  2GBX B;  3CNX A;  3EBY A;  2CKF B;  5ELU A;  4QWT A;  3UB1 A;  1MOL A;  5DRV A;  1QAF A;  4EV5 A;  3EHC A;  1BRS A;  3HX8 A;  3N9H A;  3VSY A;  5EEO A;  1RGG A;  4HM4 B;  4AKY A;  4U13 A;  2WO0 A;  4HVN A;  3F8H A;  3SYU A;  1M1K 4;  1HZ1 A;  4L7K A;  3SLU A;  1B2M A;  2INX A;  2P38 A;  1YJN 3;  1FUT A;  2KAA A;  3OX9 A;  3MHE A;  4ZM8 A;  2HMM B;  3X42 A;  4R4K A;  4KVH A;  3DGO A;  4HYZ A;  3CD6 3;  2H0G A;  4HM5 B;  1JBR A;  7STD A;  1MGR A;  1BRN L;  3I56 3;  1SPU A;  2IYJ A;  1UI8 A;  5IEN A;  3NBB A;  2FGT A;  3AMO A;  1CEW I;  2L4V A;  2LYX A;  1UW1 A;  4IT7 A;  2FNQ A;  3CCQ 3;  3F8X A;  2W9P A;  4EBG A;  4R9L A;  5RNT A;  2ML5 A;  3FF0 A;  3Q3F A;  4N6V 0;  1GOY A;  3G4S 3;  1KQS 2;  1MWR A;  4EC6 A;  1JB5 A;  3B7C A;  2R4I A;  1M9G A;  1WMO A;  1W6C A;  5GSP A;  1RGL A;  4BTY A;  2KXG A;  2K0M A;  5DRE A;  1A90 A;  3CCE 3;  3NXJ A;  5CLK A;  2F4Y A;  3X3X A;  4BIR A;  2XR8 B;  4RBN A;  2W6J H;  3AHW A;  1OAC A;  2C4B A;  4N6O B;  2C10 A;  1R4Y A;  2AAE A;  3K63 A;  3CCL 3;  4EV2 A;  2W04 A;  1CYU A;  5IG3 A;  3GZX B;  4KFE A;  1RDS A;  5KP3 A;  1OHP A;  2PZV A;  2W03 A;  2AAD A;  1WQL B;  1IVX A;  4GL6 A;  4RNZ A;  3D79 A;  2BHM A;  4HJL B;  3WMD A;  3CPW 2;  1U5O A;  3GWR A;  1DVC A;  3PXM A;  1V57 A;  1K8A 4;  1RN7 A;  1IK3 A;  1EQK A;  5G1L A;  1AV4 A;  3LH4 A;  3H51 A;  3X41 A;  1YIT 3;  3KII A;  3LOY A;  1AVL A;  5BIR A;  3FG4 A;  4XB5 A;  1Q7Y 4;  2CC3 A;  3CCJ 3;  1BVI A;  1QAL A;  2LQV A;  2P0M A;  1D6Y A;  3DM8 A;  3OWU A;  1YNV X;  4FMB A;  4I5Q A;  2IY2 A;  2IA7 A;  2OOV C;  1T3B A;  1KSI A;  1RJO A;  1JB4 A;  3BB9 A;  4HM2 B;  2P09 A;  1GD4 A;  1LQM B;  3S5C A;  3KE7 A;  3G71 3;  4LSO A;  1I3F A;  8RNT A;  1LOW A;  3EE1 A;  1N8Q A;  2CWV A;  2KF4 A;  1I2E A;  3BNE A;  1UGH I;  2UGI A;  3WOE B;  3A5E A;  1RSN A;  1GD3 A;  3DUK A;  3I0Y A;  2ZL8 A;  4JRF A;  1RNB A;  2HOH A;  3DGY A;  1Q82 4;  1X1Y A;  3MG1 A;  4J5K A;  3U97 A;  1D6Z A;  1UUV B;  4R9K A;  5AI1 A;  3ROB A;  2Z7A A;  1KC8 4;  4PEJ A;  1VQN 3;  1W6G A;  3SED A;  4HAA A;  1IV7 A;  1NB5 I;  1JV2 B;  1O7H B;  1O7G B;  3FKA A;  1JBS A;  5LC6 A;  1EUI C;  2GU3 A;  1MWS A;  3ZG5 A;  1AVK A;  1STF I;  1LOV A;  2GXF A;  5BU4 A;  1G96 A;  4R80 A;  4BTX A;  1YIJ 3;  3OWY A;  5KP1 A;  2OOV A;  1RRL A;  2HMN B;  1B2U A;  4BTW A;  1GY5 A;  1AQZ A;  3LYG A;  1VQ5 3;  1UI7 A;  1QVF 2;  1MWT A;  4HZB B;  1B21 A;  3DMC A;  1Z1S A;  1MNL A;  2SBL A;  3K0Z A;  2O3O A;  3OW2 2;  2YFL B;  1R4C A;  4CDL A;  4O2H A;  2WGQ A;  3KCH A;  3LXU X;  1OF5 B;  3LZA A;  4HM3 B;  7RNT A;  5D81 A;  1IVU A;  3BLZ A;  4MJD A;  2HML B;  1LRA A;  2YX9 A;  3ZFZ A;  1K28 A;  5G1K A;  1IVV A;  1W6Y A;  2K54 A;  4J9A A;  5IEP A;  3CCV 3;  2MC8 A;  1I0X A;  3A76 A;  4FR9 A;  4MMY B;  1Q81 4;  2OWP A;  3PZW A;  3RGA A;  3EF8 A;  2J8X B;  1B2X A;  5A0O B;  2OCT A;  4N3V A;  1FGM A;  2W2C A;  4DKI A;  1RGE A;  1W01 A;  5STD A;  1IVW A;  4CJN A;  4BL3 A;  3F40 A;  1GMP A;  3NV0 B;  1ISK A;  3NQY A;  1VQ8 3;  3U1W A;  1N5P A;  1YHQ 3;  2GEX A;  4KFD A;  3MPH A;  1Q40 B;  4LZI A;  1DYU A;  1FGR A;  5IF6 A;  1Q7H A;  3B4P A;  4HOH A;  3EN8 A;  3IPT A;  3JUN A;  4RNT A;  3HOH A;  2BMR B;  3JUM A;  5JBS A;  2E2V A;  1OHO A;  2UUG C;  3EN1 B;  3CCR 3;  3X3Z A;  3G0K A;  1PU4 A;  4JF8 A;  4GHO A;  4NHF A;  3PGB A;  1WTH A;  2CX1 A;  5AII A;  3TDG A;  3RGR A;  4I4K A;  2CFW A;  1SII A;  2JQ5 A;  4WFO A;  3SXX A;  1JRQ A;  1O7M B;  3WOF B;  3SOA A;  5D82 A;  3MYT A;  1VQQ A;  1A2V A;  1Q9E A;  1OCV A;  3EX9 A;  3QRD A;  2XSH B;  2RNT A;  3V99 A;  1K9M 4;  5AEW B;  1BRK A;  2M7O A;  3LTB A;  3S29 A;  3PS8 A;  4HM1 B;  1X1W A;  2BNG A;  3NM2 A;  3CC4 3;  4XM4 A;  1ULJ B;  3KSP A;  1S72 3;  4MMZ B;  1X1X A;  4G1M B;  4HM6 B;  3Q1C A;  1OUN A;  1RKY A;  1Q86 4;  2CFD A;  3FG3 A;  3H3H A;  2CHC A;  1K73 4;  1BGS A;  4HZ9 B;  1V74 A;  1S5A A;  4ORL A;  4Q53 A;  5FW5 A;  1BNJ A;  2HMO B;  3UL6 A;  2JDI H;  2Y73 A;  5EQL A;  1G0T A;  1UCL A;  3VGN A;  1B2Z A;  8CHO A;  3AHS A;  3NBJ A;  1SQW A;  3D5G A;  1BSD A;  3GSP A;  3JUP A; 
#chains in the Genus database with same CATH homology
 1UCI A;  2HOH A;  3DGY A;  1X1Y A;  4J5K A;  1RGF A;  1BNG A;  1A2P A;  1B20 A;  1BU4 A;  1RGH A;  1RNB A;  1DET A;  1SAR A;  1GMQ A;  1FZU A;  1BNR A;  1X1U A;  2KF6 A;  4HAA A;  6RNT A;  1JBS A;  5HOH A;  3WR2 A;  1LOV A;  5BU4 A;  3DH2 A;  1BIR A;  3AGN A;  1BAO A;  1I2F A;  1PY3 A;  1RNT A;  2BIR A;  1T2I A;  1B2U A;  1BRJ A;  1AQZ A;  1B21 A;  1BRS A;  1AY7 A;  1UCJ A;  1RGG A;  1GMR A;  1I3I A;  1BNS A;  1I8V A;  1RN1 A;  1UCK A;  1RGA A;  1FW7 A;  3SYU A;  1HZ1 A;  1BSB A;  3KCH A;  1B2M A;  1C54 A;  7RNT A;  1FUT A;  2KAA A;  1BRG A;  1GOV A;  1BSC A;  1TRP A;  2GSP A;  1BNF A;  2KF5 A;  1I2G A;  1LRA A;  1RCL A;  1JBR A;  1MGR A;  1BRN L;  1G02 A;  1I0X A;  1BOX A;  1RCK A;  3D4A A;  1B2X A;  6GSP A;  1FYS A;  1B3S A;  1TRQ A;  1BSE A;  3Q3F A;  1BSA A;  1GOY A;  5RNT A;  1I0V A;  1T2H A;  1RGE A;  1TTO A;  1RMS A;  5GSP A;  1RGL A;  1BNI A;  3AGO A;  1GMP A;  1RGC A;  2F4Y A;  2F5W A;  4BIR A;  1RN4 A;  3AHW A;  2C4B A;  1R4Y A;  2AAE A;  4HOH A;  1BAN A;  4RNT A;  3HOH A;  1RDS A;  2RBI A;  7GSP A;  1BNE A;  1IYY A;  2KF3 A;  2AAD A;  4GHO A;  1BUJ A;  2ZA4 A;  3BIR A;  2F56 A;  2F5M A;  3URP A;  1GSP A;  1RLS A;  1LOY A;  1CH0 A;  1B27 A;  4GSP A;  1Q9E A;  2RNT A;  3D5I A;  1BRI A;  1YVS A;  1BRK A;  4J5G A;  3WHO A;  1X1W A;  1DE3 A;  1BRH A;  1LNI A;  2SAR A;  5BIR A;  1ZGX A;  1BVI A;  1MGW A;  1I70 A;  1YGW A;  1X1X A;  1YNV X;  1RGK A;  1BGS A;  1GOU A;  1JBT A;  3RNT A;  1BNJ A;  1RHL A;  4BU4 A;  1RTU A;  1UCL A;  1I3F A;  8RNT A;  1B2Z A;  2BU4 A;  1LOW A;  3AHS A;  1PYL A;  9RNT A;  2KF4 A;  1I2E A;  3BU4 A;  3D5G A;  1BSD A;  3GSP A;  3A5E A;  1RSN A;  1HYF A;  1FUS A;  1B2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...