1K9M4

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k9m400
1Q864 1KC84 3CXC2 3CCE3 1VQ53 1K9M4 1K8A4 3CC43 3G4S3 3G713 2OTL3 1Q814 1VQN3 3CCJ3 1KQS2 1M904 1N8R4 3CCL3 3CD63 3G6E3 1VQ63 1VQL3 3CC73 1YHQ3 1JJ22 1KD14 3OW22 3CCS3 3CCR3 1W2B2 1VQ83 1QVF2 1VQK3 1VQO3 1S723 3CC23 1VQP3 3CPW2 1YIJ3 1NJI4 1VQ73 1VQ43 3CCU3 3CCV3 1YJN3 1QVG2 1M1K4 3CCM3 3I563 1K734 1Q7Y4 1VQ93 1YJW3 1Q824 2QEX3 3I553 3CME3 2OTJ3 3CCQ3 2QA43 1YIT3 1YI23 3CMA3 1YJ93 1VQM3
chains in the Genus database with same CATH superfamily
1LOWA 1LQGC 1Q864 3CCE3 3KN4A 3LOYA 3NX0A 4HM3B 3EQQB 5IEPA 2HMOB 3I0YA 2K3DA 2B24B 3F7SA 1C54A 4H3UA 1IVXA 3D5GA 4KFEA 2KAAA 1VQL3 1RN4A 4BTWA 1W2B2 1BSBA 1VQ83 2CWTA 1STFI 2ZL8A 3FGYA 1JB4A 1ROAA 1DMQA 2WGQA 3CPW2 2RCDA 4X2HA 3FF2A 1G02A 4HM4B 1RN1A 4XDVA 4L8PA 3UL6A 3A5EA 1OPYA 2XGNA 3PZWA 4HJLB 3J7Yd 3CME3 4AEQA 2P0MA 4BTXA 3JUPA 1UGHI 3CMA3 2YFIB 2YFLB 2HOHA 1BNIA 3ECFA 4FMCA 2RBIA 3FZWA 4HZ9B 1Q814 2O9UX 1GMPA 1C7HA 1I2GA 1RRLA 3DGYA 3ER7A 3CCL3 4LYLB 1VQ63 4WYKA 4JF8A 1QJGA 1YHQ3 3K7CA 1FUTA 1IK3A 3OW22 1KD14 2Y74A 4X2OA 1JKGB 3SEDA 3RNTA 3NV0B 4EBGA 1FW7A 3CU3A 3KFQC 1KWIA 1RNBA 2F99A 2STDA 1OGXA 4IPBA 1W5ZA 4NREA 1QVG2 3RGRA 3CCM3 1T3BA 1IVUA 3QRDA 2RNTA 4KT3B 1W6GA 1M1XB 1A2VA 1B2SA 5HGRA 1GD3A 3IMAB 1ROVA 4EV2A 4N6UA 1V74A 1RGGA 3WHOA 1JKGA 2H0GA 3BNCA 3OWSA 1IQYA 1VQ53 1MNLA 1I3FA 1MOLA 1GMRA 1SIIA 1E3VA 4RNZA 3BNDA 5BXQA 5KP1A 3ALAA 4U13A 2MC8A 6GSPA 1OACA 3F40A 1KSIA 1AR0A 1JNQA 4I4KA 4RNYA 1W7CA 1JBTA 3WMDA 1LXEA 2OCTA 1YGEA 1TFOA 1AV4A 3V99A 3K9MC 3JUOA 1RGFA 3E99A 3VF1A 3CC23 3X40A 1W2ZA 1VZZA 3LTAA 3T8UA 3HX8A 1QAKA 3FG1A 1OF5B 5HOHA 1TRPA 1G96A 4L7KA 3ZFZA 2P09A 1OHOA 1OGZA 1O7MB 2IUKA 4N3VA 1JZDA 2BHMA 2GU3A 2CH9A 2SBLA 1O7HB 1B2ZA 1CQSA 1N5PA 3BNBA 1RLSA 1SARA 1L5GB 2C4BA 2CWUA 3MG1A 1GOVA 2AADA 2KRTA 5EEOA 1LVNA 3NHXA 1OF5A 1RHLA 1W6CA 1M904 3GAXA 3SX1A 3X3XA 1BRNL 3BIRA 5CXOA 2GEYA 1UCLA 3G8ZA 1I0XA 4FCJA 4JRFA 2OWPA 1VQO3 4BTYA 3BNEA 1NJI4 2CKFB 2K54A 5ELUA 3FCSB 3PCSA 4WHAA 3N9HA 1IT7A 1BSDA 1O7PB 4STDA 1NWWA 1BNGA 5AIHA 5AEUB 3KSED 2KF5A 4HVNA 3I563 2J8XB 1JB2A 3MG3A 3FF0A 5CF1A 5AI1A 3FH1A 2OQEC 1UGIA 1RGLA 3D9RA 3CCQ3 1Q7HA 1BGSA 1IVWA 1D6UA 1OUNA 5EQLA 1YJ93 4N6LA 4RZMA 4O02B 2C10A 1UCIA 3AMOB 1K9M4 3CC43 3SVAA 1UUWB 1IYYA 1IT8A 1CYUA 1BIRA 1RJOA 4CJNA 3CC73 2KF6A 1DETA 1RGKA 2BMRB 5G1LA 2CG0A 1IV7A 2ML6A 4AKYA 1QVF2 1TIJA 4R9KA 5BIRA 1V58A 4QWTA 4KZ1A 4N6V0 1FGOA 1VQP3 3SYUA 4NHFA 2O3OA 3PGBA 3KE7A 2RSXA 2XF3A 3IPTA 4LSOA 4MEIA 1BRKA 1B20A 2MF7A 3OXAA 4LGQA 3GWRA 5IG5A 4HYZA 1Q7Y4 3KSPA 1EQKA 4HZBB 2PZVA 2OTJ3 1I70A 3DGLA 3U1WA 1EUIC 3X3ZA 3CNXA 6STDA 1FYSA 1RN7A 1MWTA 1RGHA 2YFJB 4G1MB 1A67A 3MKIA 2IY2A 4Q53A 1RNTA 2RFRA 2JQ5A 2Y73A 4OUQA 4O3VA 3DY5A 2XFSA 3HI7A 3MYTA 3NXJA 2W9PA 1O7GB 5KP3A 3U97A 5KP4A 2C11A 1JN5A 1MWRA 1RGEA 1ZGXA 2FGTA 2LYXA 2BNGA 3LZAA 1EA2A 4XDWA 3VGNA 1RCLA 4CPKA 1LOXA 2IYJA 2L4VA 3URPA 3X41A 4GSPA 1IU7A 1IQXA 1N9JA 2D1WA 4IIAA 1T2HA 1LNIA 2M7OA 1YVBI 3WA3A 1B2MA 3WOEB 1HZ1A 3CNMA 8RNTA 1TP6A 4CDLA 2F5MA 3OWYA 1AQZA 4KFFA 1LRAA 5IEOA 5IENA 3WA2X 1TJDA 1RRHA 1UCJA 3F14A 4EW5A 1GOYA 4XBYA 1U8CB 2KCDA 2WGOA 1RGAA 3A76A 1JRQA 3Q1CA 3V92A 3CCJ3 5M19A 1K41A 1A90A 1BU4A 2ZHXB 1B21A 4XB5A 1SIHA 1RMSA 1BNEA 1VQQA 1RKYA 1JBSA 2IUJA 4N6TA 4CCVA 2W56A 2AAEA 1Q42A 1IVVA 2I9WA 3LXUX 3MPHA 5ELJA 1UUVB 5BU4A 3AMOA 2HMMB 1RTUA 3DH2A 3EJVA 3CCU3 1HYFA 2CFDA 3N54B 3AGNA 3VSYA 1UUGB 1E3RA 4ILFA 4WP5A 3BB9A 1YIT3 1BSEA 3Q3FA 2E2TA 2IA7A 1CYVA 5JPUA 1PYLA 3UL5A 2Q07A 1YVSA 2CHCA 3LTBA 1ASKA 5IW9A 1PU4A 3N8BA 3QK9A 3NBJA 3G4S3 3SXXA 2OTL3 1VQN3 1FGQA 3JUQA 2XSOB 4ORLA 1I0VA 4H61A 1SQWA 1BVIA 3FG4A 1A2KA 3CCR3 1Y4KA 5G1KA 3IJEB 1S723 4HM1B 1YIJ3 5AYRB 5EVHA 3F8XA 4BL2A 2F4YA 2HMJB 3OWUA 2H0HA 1BRGA 2SARA 1BSAA 1WMPA 2CX1A 3PYJA 1VQ93 4FCMA 3K5TA 1Q9EA 2E2UA 3DZLA 1BNJA 3STDA 1FZUA 2Z77A 4K61A 9RNTA 3SLUA 1KC84 3H3HA 3F9SA 1W00A 1CH0A 3EN1B 1TFKA 1Q40A 3X3YA 4K90B 1JJ22 3NM7A 1GD4A 3JUMA 2CFKA 1LQMB 3LH4A 4OVMA 5A0OB 1OHPA 1GS3A 1QALA 2BU4A 2W0QA 3FSDA 1M9GA 5AIIA 1OH0A 3F7XA 4AKZA 1NO3A 1AVLA 1V57A 2ZDJA 3O8YA 5D83A 1ZX2A 1WQLB 2CW9A 1BUQA 2R4IA 2LQVA 1TUHA 1JV2B 3NBBA 4FCZA 1YI23 4EC6A 1I8VA 1BRHA 2XRXB 4FMDA 2HMLB 2Z6BA 1RGCA 4KFDA 3FG3A 2W56B 1I2EA 1BOXA 4GHOA 3NV0A 3UNLA 1B2XA 1CEWI 1D6YA 1QMAA 2PNCA 3B7CA 3EBTA 5G2GA 7STDA 1DMNA 1BNRA 1BSCA 1O7WB 3LMLA 1BRSA 1FGTA 1RSNA 5STDA 2WOHA 3AHWA 3OX9A 3WR2A 3LT8A 1DMMA 1BANA 3K0ZA 2CFLA 1FGRA 1GY7A 1T2IA 4OK0A 4BIRA 1FUWA 1M1K4 4R80A 3LT9A 5IG4A 2K0MA 5I97A 1ZO2A 1NNVA 3S29A 3EX9A 2GSPA 2ML5A 1YJW3 5CF2A 2F5WA 4HM0B 7RNTA 1BUJA 4BU4A 3KCHA 5JPPA 3X42A 2A15A 1B3SA 1BRIA 1NU3A 3S28A 1MWUA 4LMIA 2HMKB 1GMQA 4O8SA 1RDSA 3G713 3WOFB 1JN5B 1W01A 3DM8A 3KIIA 5RNTA 4HOHA 2OQEA 4L8OA 1WNHA 3NQZA 2D42A 1R4CA 2W6JH 4FMAA 3MG2A 4LZIA 4MMZB 3FKAA 1ULIB 1X1WA 3GRDA 3DGOA 3DGMA 1G0TA 4XM4A 1TRQA 4N6OB 1VQ73 4HKVB 5TGNA 1S5AA 3GZXB 1SPUA 5D81A 4HM8B 1NDOB 4R9LA 3D79A 3D3LA 1K734 5IERA 3EC9A 3GZBA 3I553 5BVBA 3NQYA 2QA43 1E97A 1U5OA 3NUVA 1ISKA 3LTDA 1RCKA 4J5KA 3M8CA 3EB8A 2XGLA 3T8NA 2KF4A 3PS8A 5AYSC 1W6YA 2UX0A 1GYBA 1TU5A 1Q40B 1LOVA 3GSPA 2W2CA 3LTCA 1EG9B 1ZS7A 1D6ZA 1UI7A 2BO9B 4LEHA 4HM5B 5D82A 3FLJA 3CD63 1DE3A 1IV9A 1UI8A 2UGIA 4MMYB 5LC7A 2E2VA 3NBRA 2P38A 1VQK3 1I2FA 5M1AA 1PY3A 1F8NA 1MGRA 4N6NB 3CCV3 3SOYA 5CK6A 3MSOA 2L1SA 4J9AA 3Q2PA 3EN8A 1DYUA 1HU9A 3HIIA 1Q824 1IDPA 2BMQB 3K63A 5LC6A 1QAFA 1NB3I 4HM6B 2BMOB 4XBXA 5GSPA 3CXC2 5M18A 5IG3A 1BNSA 3DMCA 1B2UA 2CX0A 2B1XB 2CFGA 4WWUC 1KQS2 3EF8A 3G16A 1W4NA 1N8R4 7GSPA 2FNQA 1WMOA 4DKIA 3MHEA 3BLZA 3MWZA 4EXRA 1BNFA 3DGNA 1LOYA 1FUSA 5DREA 1TTOA 2F86B 1IQ8A 2V1LA 1R4YA 1FA3A 1JZOA 2CK3H 2H0IA 4HM2B 1STDA 3AGOA 3HIGA 1A2PA 3T0UA 1GSPA 4HAAA 4BL3A 4HM7B 8CHOA 4J5GA 1UCKA 3HZPA 4KVHA 2WO0A 2INXA 1JBRA 1AY7A 4MJDA 1PFPA 4R1KA 2GBWB 3EHCA 5AIFA 2Z76A 5JBSA 4NPBA 3ZG0A 5IG0A 3F8HA 2BIRA 2P05A 2UUGC 3HK4A 3TDGA 2KXGA 4N6MA 1WMNA 4HBRA 4ZM8A 3CCS3 1UW1A 1YNVX 1EKMA 4FR9A 1NB5I 1EEJA 2W04A 5AEWB 3AHSA 3RGAA 1X1YA 2W03A 2CIUA 3S5CA 2GXFA 3D5IA 1VQ43 2GBXB 4R4KA 2QIYA 2Z7AA 1BAOA 1B27A 2YX9A 4FMBA 1N9EA 1X1XA 3ROBA 3Q90A 3S67A 1LNHA 5FGOA 3KZTA 2XSHB 2R41A 3WDGB 1ULJB 5IF6A 1K8A4 1MWSA 2ZA4A 1OCVA 3V98A 3HOHA 3L0RA 2BT3A 3KKGA 3PCRA 1HKXA 2CWVA 3NM2A 4WYKB 1I3IA 2CFWA 4GB5A 1J2BA 2F98A 3RDEA 2CC3A 1N5HA 1SJWA 1W02A 3WODG 4O2HA 1YGWA 6RNTA 3OV4A 1MGWA 4EYCA 5AIGA 3D4AA 1US1A 3H51A 1GOUA 1AVKA 5FW5A 4K1VA 3UB1A 1T5YA 2XEPA 4GL6A 3ZG5A 1N8QA 2QEX3 2OOVA 2GEXA 3BU4A 2XFTA 4RBNA 3S27A 1FGMA 3LYGA 1GY5A 2KF3A 3DXOA 1BRJA 2WOFA 1DVCA 3GZYB 2RGQA 4K1UA 2CG1A 1GY6A 2W9QA 4RNTA 2GU1A 2OOVC 2P0XA 3JVCA 2XR8B 3PXMA 4WFOA 3G6E3 1JB5A 2QGUA 4TX4A 5DRVA 1UDII 1DVDA 1Z1SA 3GZRA 2F56A 2HMNB 3UJMA 5CLKA 3JUNA 2JDIH 3DUKA 1OHSA 3EBYA 3G0KA 3EE1A 3B8LA 1YJN3 2IMJA 2FXTA 4I5QA 4J8TA 4EV5A 2XH9A 4XBTA 3SOAA 1WTHA 1X1UA 3B4PA 4MMXB 3B4OA 1K28A 1O7NB 1VQM3 3CPOA 4PEJA 4IT7A
chains in the Genus database with same CATH topology
1Q864 3CCE3 3KN4A 3LOYA 3NX0A 4HM3B 3EQQB 5IEPA 2HMOB 3I0YA 3F7SA 2B24B 4H3UA 1IVXA 4KFEA 1VQL3 4BTWA 1W2B2 1VQ83 2CWTA 1STFI 2ZL8A 3FGYA 1JB4A 1ROAA 1DMQA 2WGQA 3CPW2 2RCDA 4X2HA 3FF2A 4HM4B 4XDVA 4L8PA 3UL6A 1OPYA 2XGNA 3PZWA 4HJLB 3J7Yd 3CME3 4AEQA 2P0MA 4BTXA 3JUPA 3CMA3 2YFIB 2YFLB 3ECFA 4FMCA 3FZWA 4HZ9B 1Q814 2O9UX 1C7HA 1RRLA 3CCL3 3ER7A 1VQ63 4WYKA 4JF8A 1QJGA 1YHQ3 3K7CA 1IK3A 3OW22 1KD14 2Y74A 4X2OA 1JKGB 3SEDA 3NV0B 4EBGA 3CU3A 3KFQC 1KWIA 2F99A 2STDA 1OGXA 4IPBA 1W5ZA 4NREA 1QVG2 3RGRA 3CCM3 3QRDA 1IVUA 1W6GA 1M1XB 1A2VA 5HGRA 1GD3A 3IMAB 1ROVA 4EV2A 4N6UA 1V74A 1JKGA 3BNCA 3OWSA 1IQYA 1VQ53 1MNLA 1MOLA 1SIIA 1E3VA 4RNZA 3BNDA 5BXQA 5KP1A 3ALAA 4U13A 2MC8A 1OACA 3F40A 1KSIA 1AR0A 1JNQA 4I4KA 4RNYA 1W7CA 3WMDA 1LXEA 2OCTA 1YGEA 1TFOA 1AV4A 3V99A 3K9MC 3JUOA 3E99A 3VF1A 3CC23 3X40A 1W2ZA 1VZZA 3LTAA 3T8UA 3HX8A 1QAKA 3FG1A 1OF5B 1G96A 4L7KA 2P09A 1OHOA 1OGZA 1O7MB 2IUKA 4N3VA 2BHMA 2GU3A 2CH9A 2SBLA 1O7HB 3BNBA 1CQSA 1N5PA 1L5GB 2CWUA 3MG1A 5EEOA 2KRTA 1LVNA 3NHXA 1OF5A 1W6CA 1M904 3GAXA 3SX1A 3X3XA 5CXOA 2GEYA 3G8ZA 4FCJA 4JRFA 2OWPA 1VQO3 4BTYA 3BNEA 1NJI4 2CKFB 2K54A 5ELUA 3FCSB 3PCSA 4WHAA 3N9HA 1IT7A 4STDA 1O7PB 5AEUB 1NWWA 5AIHA 3I563 3KSED 4HVNA 3MG3A 1JB2A 3FF0A 5CF1A 5AI1A 3FH1A 2OQEC 3D9RA 3CCQ3 1IVWA 1D6UA 1OUNA 5EQLA 1YJ93 4N6LA 4RZMA 4O02B 2C10A 3AMOB 1K9M4 3CC43 3SVAA 1UUWB 1CYUA 1IT8A 1RJOA 3CC73 2BMRB 2CG0A 1IV7A 2ML6A 4AKYA 1QVF2 1TIJA 4R9KA 4QWTA 4KZ1A 4N6V0 1FGOA 1VQP3 4NHFA 2O3OA 3PGBA 3KE7A 2RSXA 2XF3A 3IPTA 4LSOA 4MEIA 2MF7A 3OXAA 4LGQA 3GWRA 5IG5A 4HYZA 1Q7Y4 3KSPA 1EQKA 4HZBB 2PZVA 2OTJ3 3DGLA 3U1WA 3X3ZA 3CNXA 6STDA 1RN7A 2YFJB 4G1MB 1A67A 3MKIA 4Q53A 2Y73A 2RFRA 2JQ5A 4OUQA 4O3VA 3DY5A 2XFSA 3HI7A 3MYTA 3NXJA 2W9PA 1O7GB 5KP3A 3U97A 5KP4A 1JN5A 2C11A 2FGTA 3LZAA 2LYXA 2BNGA 1EA2A 4XDWA 3VGNA 1LOXA 2L4VA 3X41A 1IU7A 1IQXA 1N9JA 2D1WA 4IIAA 2M7OA 1YVBI 3WA3A 3WOEB 3CNMA 1TP6A 4CDLA 3OWYA 4KFFA 5IEOA 5IENA 3WA2X 3F14A 1RRHA 4XBYA 1U8CB 2KCDA 2WGOA 3A76A 1JRQA 3Q1CA 3V92A 3CCJ3 1K41A 1A90A 4XB5A 1SIHA 1RKYA 2IUJA 4N6TA 4CCVA 2W56A 1Q42A 1IVVA 2I9WA 3LXUX 3MPHA 5ELJA 1UUVB 3AMOA 2HMMB 3CCU3 3EJVA 2CFDA 3N54B 3VSYA 1E3RA 4WP5A 3BB9A 1YIT3 2E2TA 2IA7A 1CYVA 5JPUA 3UL5A 2Q07A 2CHCA 3LTBA 1ASKA 5IW9A 1PU4A 3N8BA 3QK9A 3NBJA 3G4S3 3SXXA 2OTL3 1VQN3 1FGQA 3JUQA 2XSOB 4ORLA 4H61A 1SQWA 3FG4A 1A2KA 3CCR3 1Y4KA 3IJEB 1S723 4HM1B 1YIJ3 5AYRB 5EVHA 3F8XA 2HMJB 3OWUA 1WMPA 3PYJA 1VQ93 4FCMA 3K5TA 2E2UA 3DZLA 3STDA 4K61A 2Z77A 3SLUA 1KC84 3H3HA 3F9SA 1W00A 3EN1B 1TFKA 1Q40A 3X3YA 4K90B 1JJ22 3NM7A 1GD4A 3JUMA 2CFKA 3LH4A 4OVMA 5A0OB 1OHPA 1GS3A 1QALA 2W0QA 3FSDA 1M9GA 5AIIA 1OH0A 3F7XA 4AKZA 1NO3A 1AVLA 2ZDJA 5D83A 3O8YA 1ZX2A 1WQLB 2CW9A 1BUQA 2R4IA 2LQVA 1TUHA 1JV2B 3NBBA 4FCZA 1YI23 4EC6A 2XRXB 4FMDA 2HMLB 2Z6BA 4KFDA 3FG3A 2W56B 3NV0A 3UNLA 1CEWI 1D6YA 1QMAA 2PNCA 3B7CA 3EBTA 5G2GA 7STDA 1DMNA 1O7WB 3LMLA 1FGTA 5STDA 2WOHA 3OX9A 3LT8A 1DMMA 3K0ZA 4OK0A 2CFLA 1FGRA 1GY7A 1FUWA 1M1K4 4R80A 3LT9A 5IG4A 2K0MA 5I97A 1ZO2A 3S29A 3EX9A 2ML5A 1YJW3 5CF2A 4HM0B 5JPPA 3X42A 2A15A 1NU3A 3S28A 4LMIA 2HMKB 4O8SA 3G713 3WOFB 1JN5B 1W01A 3DM8A 3KIIA 2OQEA 4L8OA 1WNHA 3NQZA 2D42A 1R4CA 2W6JH 4FMAA 3MG2A 4LZIA 4MMZB 3FKAA 1ULIB 3GRDA 3DGOA 3DGMA 4XM4A 4N6OB 1VQ73 4HKVB 5TGNA 1S5AA 3GZXB 1SPUA 5D81A 4HM8B 1NDOB 4R9LA 3D3LA 1K734 5IERA 3EC9A 3GZBA 3I553 5BVBA 3NQYA 2QA43 1E97A 1U5OA 3NUVA 1ISKA 3LTDA 3M8CA 3EB8A 2XGLA 3T8NA 3PS8A 5AYSC 1W6YA 2UX0A 1GYBA 1TU5A 1Q40B 3LTCA 2W2CA 1EG9B 1D6ZA 1UI7A 2BO9B 4LEHA 4HM5B 5D82A 3FLJA 3CD63 1IV9A 1UI8A 4MMYB 5LC7A 2E2VA 3NBRA 2P38A 1VQK3 1F8NA 3CCV3 4N6NB 3SOYA 5CK6A 3MSOA 4J9AA 3Q2PA 3EN8A 1DYUA 1HU9A 3HIIA 1Q824 1IDPA 2BMQB 3K63A 5LC6A 1QAFA 1NB3I 4HM6B 2BMOB 4XBXA 3CXC2 5IG3A 3DMCA 2B1XB 2CFGA 4WWUC 1KQS2 3EF8A 3G16A 1W4NA 1N8R4 2FNQA 1WMOA 3MHEA 3BLZA 3MWZA 4EXRA 3DGNA 5DREA 2F86B 1IQ8A 2V1LA 1FA3A 2CK3H 4HM2B 1STDA 3HIGA 3T0UA 4HM7B 8CHOA 3HZPA 4KVHA 2WO0A 2INXA 4MJDA 1PFPA 4R1KA 2GBWB 3EHCA 5AIFA 2Z76A 5JBSA 5IG0A 3F8HA 3HK4A 2P05A 3TDGA 2KXGA 4N6MA 1WMNA 4HBRA 4ZM8A 3CCS3 1UW1A 1EKMA 4FR9A 1NB5I 2W04A 5AEWB 3RGAA 2W03A 2CIUA 3S5CA 2GXFA 1VQ43 2GBXB 4R4KA 2QIYA 2Z7AA 2YX9A 4FMBA 1N9EA 3ROBA 3Q90A 3S67A 1LNHA 5FGOA 3KZTA 2XSHB 3WDGB 1ULJB 5IF6A 1K8A4 1OCVA 3V98A 3L0RA 2BT3A 3KKGA 3PCRA 1HKXA 2CWVA 3NM2A 4WYKB 2CFWA 4GB5A 1J2BA 2F98A 3RDEA 2CC3A 1N5HA 1SJWA 1W02A 3WODG 4O2HA 3OV4A 4EYCA 5AIGA 1US1A 3H51A 1AVKA 5FW5A 4K1VA 3UB1A 1T5YA 2XEPA 4GL6A 1N8QA 2QEX3 2OOVA 2GEXA 2XFTA 4RBNA 3S27A 1FGMA 3LYGA 1GY5A 3DXOA 2WOFA 1DVCA 3GZYB 2RGQA 4K1UA 2CG1A 1GY6A 2W9QA 2GU1A 2OOVC 2P0XA 3JVCA 2XR8B 3PXMA 4WFOA 3G6E3 1JB5A 2QGUA 4TX4A 5DRVA 1DVDA 1Z1SA 3GZRA 3UJMA 2HMNB 5CLKA 3JUNA 2JDIH 3DUKA 1OHSA 3EBYA 3G0KA 3EE1A 3B8LA 1YJN3 2IMJA 2FXTA 4J8TA 4EV5A 2XH9A 4XBTA 3SOAA 1WTHA 3B4PA 4MMXB 3B4OA 1K28A 1O7NB 1VQM3 3CPOA 4PEJA 4IT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 4;  1KC8 4;  3CXC 2;  3CCE 3;  1VQ5 3;  1K9M 4;  1K8A 4;  3CC4 3;  3G4S 3;  3G71 3;  2OTL 3;  1Q81 4;  1VQN 3;  3CCJ 3;  1KQS 2;  1M90 4;  1N8R 4;  3CCL 3;  3CD6 3;  3G6E 3;  1VQ6 3;  1VQL 3;  3CC7 3;  1YHQ 3;  1JJ2 2;  1KD1 4;  3OW2 2;  3CCS 3;  3CCR 3;  1W2B 2;  1VQ8 3;  1QVF 2;  1VQK 3;  1VQO 3;  1S72 3;  3CC2 3;  1VQP 3;  3CPW 2;  1YIJ 3;  1NJI 4;  1VQ7 3;  1VQ4 3;  3CCU 3;  3CCV 3;  1YJN 3;  1QVG 2;  1M1K 4;  3CCM 3;  3I56 3;  1K73 4;  1Q7Y 4;  1VQ9 3;  1YJW 3;  1Q82 4;  2QEX 3;  3I55 3;  3CME 3;  2OTJ 3;  3CCQ 3;  2QA4 3;  1YIT 3;  1YI2 3;  3CMA 3;  1YJ9 3;  1VQM 3; 
#chains in the Genus database with same CATH topology
 1LOW A;  1LQG C;  1Q86 4;  3CCE 3;  3KN4 A;  3LOY A;  3NX0 A;  4HM3 B;  3EQQ B;  5IEP A;  2HMO B;  3I0Y A;  2K3D A;  2B24 B;  3F7S A;  1C54 A;  4H3U A;  1IVX A;  3D5G A;  4KFE A;  2KAA A;  1VQL 3;  1RN4 A;  4BTW A;  1W2B 2;  1BSB A;  1VQ8 3;  2CWT A;  1STF I;  2ZL8 A;  3FGY A;  1JB4 A;  1ROA A;  1DMQ A;  2WGQ A;  3CPW 2;  2RCD A;  4X2H A;  3FF2 A;  1G02 A;  4HM4 B;  1RN1 A;  4XDV A;  4L8P A;  3UL6 A;  3A5E A;  1OPY A;  2XGN A;  3PZW A;  4HJL B;  3J7Y d;  3CME 3;  4AEQ A;  2P0M A;  4BTX A;  3JUP A;  1UGH I;  3CMA 3;  2YFI B;  2YFL B;  2HOH A;  1BNI A;  3ECF A;  4FMC A;  2RBI A;  3FZW A;  4HZ9 B;  1Q81 4;  2O9U X;  1GMP A;  1C7H A;  1I2G A;  1RRL A;  3DGY A;  3ER7 A;  3CCL 3;  4LYL B;  1VQ6 3;  4WYK A;  4JF8 A;  1QJG A;  1YHQ 3;  3K7C A;  1FUT A;  1IK3 A;  3OW2 2;  1KD1 4;  2Y74 A;  4X2O A;  1JKG B;  3SED A;  3RNT A;  3NV0 B;  4EBG A;  1FW7 A;  3CU3 A;  3KFQ C;  1KWI A;  1RNB A;  2F99 A;  2STD A;  1OGX A;  4IPB A;  1W5Z A;  4NRE A;  1QVG 2;  3RGR A;  3CCM 3;  1T3B A;  1IVU A;  3QRD A;  2RNT A;  4KT3 B;  1W6G A;  1M1X B;  1A2V A;  1B2S A;  5HGR A;  1GD3 A;  3IMA B;  1ROV A;  4EV2 A;  4N6U A;  1V74 A;  1RGG A;  3WHO A;  1JKG A;  2H0G A;  3BNC A;  3OWS A;  1IQY A;  1VQ5 3;  1MNL A;  1I3F A;  1MOL A;  1GMR A;  1SII A;  1E3V A;  4RNZ A;  3BND A;  5BXQ A;  5KP1 A;  3ALA A;  4U13 A;  2MC8 A;  6GSP A;  1OAC A;  3F40 A;  1KSI A;  1AR0 A;  1JNQ A;  4I4K A;  4RNY A;  1W7C A;  1JBT A;  3WMD A;  1LXE A;  2OCT A;  1YGE A;  1TFO A;  1AV4 A;  3V99 A;  3K9M C;  3JUO A;  1RGF A;  3E99 A;  3VF1 A;  3CC2 3;  3X40 A;  1W2Z A;  1VZZ A;  3LTA A;  3T8U A;  3HX8 A;  1QAK A;  3FG1 A;  1OF5 B;  5HOH A;  1TRP A;  1G96 A;  4L7K A;  3ZFZ A;  2P09 A;  1OHO A;  1OGZ A;  1O7M B;  2IUK A;  4N3V A;  1JZD A;  2BHM A;  2GU3 A;  2CH9 A;  2SBL A;  1O7H B;  1B2Z A;  1CQS A;  1N5P A;  3BNB A;  1RLS A;  1SAR A;  1L5G B;  2C4B A;  2CWU A;  3MG1 A;  1GOV A;  2AAD A;  2KRT A;  5EEO A;  1LVN A;  3NHX A;  1OF5 A;  1RHL A;  1W6C A;  1M90 4;  3GAX A;  3SX1 A;  3X3X A;  1BRN L;  3BIR A;  5CXO A;  2GEY A;  1UCL A;  3G8Z A;  1I0X A;  4FCJ A;  4JRF A;  2OWP A;  1VQO 3;  4BTY A;  3BNE A;  1NJI 4;  2CKF B;  2K54 A;  5ELU A;  3FCS B;  3PCS A;  4WHA A;  3N9H A;  1IT7 A;  1BSD A;  1O7P B;  4STD A;  1NWW A;  1BNG A;  5AIH A;  5AEU B;  3KSE D;  2KF5 A;  4HVN A;  3I56 3;  2J8X B;  1JB2 A;  3MG3 A;  3FF0 A;  5CF1 A;  5AI1 A;  3FH1 A;  2OQE C;  1UGI A;  1RGL A;  3D9R A;  3CCQ 3;  1Q7H A;  1BGS A;  1IVW A;  1D6U A;  1OUN A;  5EQL A;  1YJ9 3;  4N6L A;  4RZM A;  4O02 B;  2C10 A;  1UCI A;  3AMO B;  1K9M 4;  3CC4 3;  3SVA A;  1UUW B;  1IYY A;  1IT8 A;  1CYU A;  1BIR A;  1RJO A;  4CJN A;  3CC7 3;  2KF6 A;  1DET A;  1RGK A;  2BMR B;  5G1L A;  2CG0 A;  1IV7 A;  2ML6 A;  4AKY A;  1QVF 2;  1TIJ A;  4R9K A;  5BIR A;  1V58 A;  4QWT A;  4KZ1 A;  4N6V 0;  1FGO A;  1VQP 3;  3SYU A;  4NHF A;  2O3O A;  3PGB A;  3KE7 A;  2RSX A;  2XF3 A;  3IPT A;  4LSO A;  4MEI A;  1BRK A;  1B20 A;  2MF7 A;  3OXA A;  4LGQ A;  3GWR A;  5IG5 A;  4HYZ A;  1Q7Y 4;  3KSP A;  1EQK A;  4HZB B;  2PZV A;  2OTJ 3;  1I70 A;  3DGL A;  3U1W A;  1EUI C;  3X3Z A;  3CNX A;  6STD A;  1FYS A;  1RN7 A;  1MWT A;  1RGH A;  2YFJ B;  4G1M B;  1A67 A;  3MKI A;  2IY2 A;  4Q53 A;  1RNT A;  2RFR A;  2JQ5 A;  2Y73 A;  4OUQ A;  4O3V A;  3DY5 A;  2XFS A;  3HI7 A;  3MYT A;  3NXJ A;  2W9P A;  1O7G B;  5KP3 A;  3U97 A;  5KP4 A;  2C11 A;  1JN5 A;  1MWR A;  1RGE A;  1ZGX A;  2FGT A;  2LYX A;  2BNG A;  3LZA A;  1EA2 A;  4XDW A;  3VGN A;  1RCL A;  4CPK A;  1LOX A;  2IYJ A;  2L4V A;  3URP A;  3X41 A;  4GSP A;  1IU7 A;  1IQX A;  1N9J A;  2D1W A;  4IIA A;  1T2H A;  1LNI A;  2M7O A;  1YVB I;  3WA3 A;  1B2M A;  3WOE B;  1HZ1 A;  3CNM A;  8RNT A;  1TP6 A;  4CDL A;  2F5M A;  3OWY A;  1AQZ A;  4KFF A;  1LRA A;  5IEO A;  5IEN A;  3WA2 X;  1TJD A;  1RRH A;  1UCJ A;  3F14 A;  4EW5 A;  1GOY A;  4XBY A;  1U8C B;  2KCD A;  2WGO A;  1RGA A;  3A76 A;  1JRQ A;  3Q1C A;  3V92 A;  3CCJ 3;  5M19 A;  1K41 A;  1A90 A;  1BU4 A;  2ZHX B;  1B21 A;  4XB5 A;  1SIH A;  1RMS A;  1BNE A;  1VQQ A;  1RKY A;  1JBS A;  2IUJ A;  4N6T A;  4CCV A;  2W56 A;  2AAE A;  1Q42 A;  1IVV A;  2I9W A;  3LXU X;  3MPH A;  5ELJ A;  1UUV B;  5BU4 A;  3AMO A;  2HMM B;  1RTU A;  3DH2 A;  3EJV A;  3CCU 3;  1HYF A;  2CFD A;  3N54 B;  3AGN A;  3VSY A;  1UUG B;  1E3R A;  4ILF A;  4WP5 A;  3BB9 A;  1YIT 3;  1BSE A;  3Q3F A;  2E2T A;  2IA7 A;  1CYV A;  5JPU A;  1PYL A;  3UL5 A;  2Q07 A;  1YVS A;  2CHC A;  3LTB A;  1ASK A;  5IW9 A;  1PU4 A;  3N8B A;  3QK9 A;  3NBJ A;  3G4S 3;  3SXX A;  2OTL 3;  1VQN 3;  1FGQ A;  3JUQ A;  2XSO B;  4ORL A;  1I0V A;  4H61 A;  1SQW A;  1BVI A;  3FG4 A;  1A2K A;  3CCR 3;  1Y4K A;  5G1K A;  3IJE B;  1S72 3;  4HM1 B;  1YIJ 3;  5AYR B;  5EVH A;  3F8X A;  4BL2 A;  2F4Y A;  2HMJ B;  3OWU A;  2H0H A;  1BRG A;  2SAR A;  1BSA A;  1WMP A;  2CX1 A;  3PYJ A;  1VQ9 3;  4FCM A;  3K5T A;  1Q9E A;  2E2U A;  3DZL A;  1BNJ A;  3STD A;  1FZU A;  2Z77 A;  4K61 A;  9RNT A;  3SLU A;  1KC8 4;  3H3H A;  3F9S A;  1W00 A;  1CH0 A;  3EN1 B;  1TFK A;  1Q40 A;  3X3Y A;  4K90 B;  1JJ2 2;  3NM7 A;  1GD4 A;  3JUM A;  2CFK A;  1LQM B;  3LH4 A;  4OVM A;  5A0O B;  1OHP A;  1GS3 A;  1QAL A;  2BU4 A;  2W0Q A;  3FSD A;  1M9G A;  5AII A;  1OH0 A;  3F7X A;  4AKZ A;  1NO3 A;  1AVL A;  1V57 A;  2ZDJ A;  3O8Y A;  5D83 A;  1ZX2 A;  1WQL B;  2CW9 A;  1BUQ A;  2R4I A;  2LQV A;  1TUH A;  1JV2 B;  3NBB A;  4FCZ A;  1YI2 3;  4EC6 A;  1I8V A;  1BRH A;  2XRX B;  4FMD A;  2HML B;  2Z6B A;  1RGC A;  4KFD A;  3FG3 A;  2W56 B;  1I2E A;  1BOX A;  4GHO A;  3NV0 A;  3UNL A;  1B2X A;  1CEW I;  1D6Y A;  1QMA A;  2PNC A;  3B7C A;  3EBT A;  5G2G A;  7STD A;  1DMN A;  1BNR A;  1BSC A;  1O7W B;  3LML A;  1BRS A;  1FGT A;  1RSN A;  5STD A;  2WOH A;  3AHW A;  3OX9 A;  3WR2 A;  3LT8 A;  1DMM A;  1BAN A;  3K0Z A;  2CFL A;  1FGR A;  1GY7 A;  1T2I A;  4OK0 A;  4BIR A;  1FUW A;  1M1K 4;  4R80 A;  3LT9 A;  5IG4 A;  2K0M A;  5I97 A;  1ZO2 A;  1NNV A;  3S29 A;  3EX9 A;  2GSP A;  2ML5 A;  1YJW 3;  5CF2 A;  2F5W A;  4HM0 B;  7RNT A;  1BUJ A;  4BU4 A;  3KCH A;  5JPP A;  3X42 A;  2A15 A;  1B3S A;  1BRI A;  1NU3 A;  3S28 A;  1MWU A;  4LMI A;  2HMK B;  1GMQ A;  4O8S A;  1RDS A;  3G71 3;  3WOF B;  1JN5 B;  1W01 A;  3DM8 A;  3KII A;  5RNT A;  4HOH A;  2OQE A;  4L8O A;  1WNH A;  3NQZ A;  2D42 A;  1R4C A;  2W6J H;  4FMA A;  3MG2 A;  4LZI A;  4MMZ B;  3FKA A;  1ULI B;  1X1W A;  3GRD A;  3DGO A;  3DGM A;  1G0T A;  4XM4 A;  1TRQ A;  4N6O B;  1VQ7 3;  4HKV B;  5TGN A;  1S5A A;  3GZX B;  1SPU A;  5D81 A;  4HM8 B;  1NDO B;  4R9L A;  3D79 A;  3D3L A;  1K73 4;  5IER A;  3EC9 A;  3GZB A;  3I55 3;  5BVB A;  3NQY A;  2QA4 3;  1E97 A;  1U5O A;  3NUV A;  1ISK A;  3LTD A;  1RCK A;  4J5K A;  3M8C A;  3EB8 A;  2XGL A;  3T8N A;  2KF4 A;  3PS8 A;  5AYS C;  1W6Y A;  2UX0 A;  1GYB A;  1TU5 A;  1Q40 B;  1LOV A;  3GSP A;  2W2C A;  3LTC A;  1EG9 B;  1ZS7 A;  1D6Z A;  1UI7 A;  2BO9 B;  4LEH A;  4HM5 B;  5D82 A;  3FLJ A;  3CD6 3;  1DE3 A;  1IV9 A;  1UI8 A;  2UGI A;  4MMY B;  5LC7 A;  2E2V A;  3NBR A;  2P38 A;  1VQK 3;  1I2F A;  5M1A A;  1PY3 A;  1F8N A;  1MGR A;  4N6N B;  3CCV 3;  3SOY A;  5CK6 A;  3MSO A;  2L1S A;  4J9A A;  3Q2P A;  3EN8 A;  1DYU A;  1HU9 A;  3HII A;  1Q82 4;  1IDP A;  2BMQ B;  3K63 A;  5LC6 A;  1QAF A;  1NB3 I;  4HM6 B;  2BMO B;  4XBX A;  5GSP A;  3CXC 2;  5M18 A;  5IG3 A;  1BNS A;  3DMC A;  1B2U A;  2CX0 A;  2B1X B;  2CFG A;  4WWU C;  1KQS 2;  3EF8 A;  3G16 A;  1W4N A;  1N8R 4;  7GSP A;  2FNQ A;  1WMO A;  4DKI A;  3MHE A;  3BLZ A;  3MWZ A;  4EXR A;  1BNF A;  3DGN A;  1LOY A;  1FUS A;  5DRE A;  1TTO A;  2F86 B;  1IQ8 A;  2V1L A;  1R4Y A;  1FA3 A;  1JZO A;  2CK3 H;  2H0I A;  4HM2 B;  1STD A;  3AGO A;  3HIG A;  1A2P A;  3T0U A;  1GSP A;  4HAA A;  4BL3 A;  4HM7 B;  8CHO A;  4J5G A;  1UCK A;  3HZP A;  4KVH A;  2WO0 A;  2INX A;  1JBR A;  1AY7 A;  4MJD A;  1PFP A;  4R1K A;  2GBW B;  3EHC A;  5AIF A;  2Z76 A;  5JBS A;  4NPB A;  3ZG0 A;  5IG0 A;  3F8H A;  2BIR A;  2P05 A;  2UUG C;  3HK4 A;  3TDG A;  2KXG A;  4N6M A;  1WMN A;  4HBR A;  4ZM8 A;  3CCS 3;  1UW1 A;  1YNV X;  1EKM A;  4FR9 A;  1NB5 I;  1EEJ A;  2W04 A;  5AEW B;  3AHS A;  3RGA A;  1X1Y A;  2W03 A;  2CIU A;  3S5C A;  2GXF A;  3D5I A;  1VQ4 3;  2GBX B;  4R4K A;  2QIY A;  2Z7A A;  1BAO A;  1B27 A;  2YX9 A;  4FMB A;  1N9E A;  1X1X A;  3ROB A;  3Q90 A;  3S67 A;  1LNH A;  5FGO A;  3KZT A;  2XSH B;  2R41 A;  3WDG B;  1ULJ B;  5IF6 A;  1K8A 4;  1MWS A;  2ZA4 A;  1OCV A;  3V98 A;  3HOH A;  3L0R A;  2BT3 A;  3KKG A;  3PCR A;  1HKX A;  2CWV A;  3NM2 A;  4WYK B;  1I3I A;  2CFW A;  4GB5 A;  1J2B A;  2F98 A;  3RDE A;  2CC3 A;  1N5H A;  1SJW A;  1W02 A;  3WOD G;  4O2H A;  1YGW A;  6RNT A;  3OV4 A;  1MGW A;  4EYC A;  5AIG A;  3D4A A;  1US1 A;  3H51 A;  1GOU A;  1AVK A;  5FW5 A;  4K1V A;  3UB1 A;  1T5Y A;  2XEP A;  4GL6 A;  3ZG5 A;  1N8Q A;  2QEX 3;  2OOV A;  2GEX A;  3BU4 A;  2XFT A;  4RBN A;  3S27 A;  1FGM A;  3LYG A;  1GY5 A;  2KF3 A;  3DXO A;  1BRJ A;  2WOF A;  1DVC A;  3GZY B;  2RGQ A;  4K1U A;  2CG1 A;  1GY6 A;  2W9Q A;  4RNT A;  2GU1 A;  2OOV C;  2P0X A;  3JVC A;  2XR8 B;  3PXM A;  4WFO A;  3G6E 3;  1JB5 A;  2QGU A;  4TX4 A;  5DRV A;  1UDI I;  1DVD A;  1Z1S A;  3GZR A;  2F56 A;  2HMN B;  3UJM A;  5CLK A;  3JUN A;  2JDI H;  3DUK A;  1OHS A;  3EBY A;  3G0K A;  3EE1 A;  3B8L A;  1YJN 3;  2IMJ A;  2FXT A;  4I5Q A;  4J8T A;  4EV5 A;  2XH9 A;  4XBT A;  3SOA A;  1WTH A;  1X1U A;  3B4P A;  4MMX B;  3B4O A;  1K28 A;  1O7N B;  1VQM 3;  3CPO A;  4PEJ A;  4IT7 A; 
#chains in the Genus database with same CATH homology
 1Q86 4;  3CCE 3;  3KN4 A;  3LOY A;  3NX0 A;  4HM3 B;  3EQQ B;  5IEP A;  2HMO B;  3I0Y A;  3F7S A;  2B24 B;  4H3U A;  1IVX A;  4KFE A;  1VQL 3;  4BTW A;  1W2B 2;  1VQ8 3;  2CWT A;  1STF I;  2ZL8 A;  3FGY A;  1JB4 A;  1ROA A;  1DMQ A;  2WGQ A;  3CPW 2;  2RCD A;  4X2H A;  3FF2 A;  4HM4 B;  4XDV A;  4L8P A;  3UL6 A;  1OPY A;  2XGN A;  3PZW A;  4HJL B;  3J7Y d;  3CME 3;  4AEQ A;  2P0M A;  4BTX A;  3JUP A;  3CMA 3;  2YFI B;  2YFL B;  3ECF A;  4FMC A;  3FZW A;  4HZ9 B;  1Q81 4;  2O9U X;  1C7H A;  1RRL A;  3CCL 3;  3ER7 A;  1VQ6 3;  4WYK A;  4JF8 A;  1QJG A;  1YHQ 3;  3K7C A;  1IK3 A;  3OW2 2;  1KD1 4;  2Y74 A;  4X2O A;  1JKG B;  3SED A;  3NV0 B;  4EBG A;  3CU3 A;  3KFQ C;  1KWI A;  2F99 A;  2STD A;  1OGX A;  4IPB A;  1W5Z A;  4NRE A;  1QVG 2;  3RGR A;  3CCM 3;  3QRD A;  1IVU A;  1W6G A;  1M1X B;  1A2V A;  5HGR A;  1GD3 A;  3IMA B;  1ROV A;  4EV2 A;  4N6U A;  1V74 A;  1JKG A;  3BNC A;  3OWS A;  1IQY A;  1VQ5 3;  1MNL A;  1MOL A;  1SII A;  1E3V A;  4RNZ A;  3BND A;  5BXQ A;  5KP1 A;  3ALA A;  4U13 A;  2MC8 A;  1OAC A;  3F40 A;  1KSI A;  1AR0 A;  1JNQ A;  4I4K A;  4RNY A;  1W7C A;  3WMD A;  1LXE A;  2OCT A;  1YGE A;  1TFO A;  1AV4 A;  3V99 A;  3K9M C;  3JUO A;  3E99 A;  3VF1 A;  3CC2 3;  3X40 A;  1W2Z A;  1VZZ A;  3LTA A;  3T8U A;  3HX8 A;  1QAK A;  3FG1 A;  1OF5 B;  1G96 A;  4L7K A;  2P09 A;  1OHO A;  1OGZ A;  1O7M B;  2IUK A;  4N3V A;  2BHM A;  2GU3 A;  2CH9 A;  2SBL A;  1O7H B;  3BNB A;  1CQS A;  1N5P A;  1L5G B;  2CWU A;  3MG1 A;  5EEO A;  2KRT A;  1LVN A;  3NHX A;  1OF5 A;  1W6C A;  1M90 4;  3GAX A;  3SX1 A;  3X3X A;  5CXO A;  2GEY A;  3G8Z A;  4FCJ A;  4JRF A;  2OWP A;  1VQO 3;  4BTY A;  3BNE A;  1NJI 4;  2CKF B;  2K54 A;  5ELU A;  3FCS B;  3PCS A;  4WHA A;  3N9H A;  1IT7 A;  4STD A;  1O7P B;  5AEU B;  1NWW A;  5AIH A;  3I56 3;  3KSE D;  4HVN A;  3MG3 A;  1JB2 A;  3FF0 A;  5CF1 A;  5AI1 A;  3FH1 A;  2OQE C;  3D9R A;  3CCQ 3;  1IVW A;  1D6U A;  1OUN A;  5EQL A;  1YJ9 3;  4N6L A;  4RZM A;  4O02 B;  2C10 A;  3AMO B;  1K9M 4;  3CC4 3;  3SVA A;  1UUW B;  1CYU A;  1IT8 A;  1RJO A;  3CC7 3;  2BMR B;  2CG0 A;  1IV7 A;  2ML6 A;  4AKY A;  1QVF 2;  1TIJ A;  4R9K A;  4QWT A;  4KZ1 A;  4N6V 0;  1FGO A;  1VQP 3;  4NHF A;  2O3O A;  3PGB A;  3KE7 A;  2RSX A;  2XF3 A;  3IPT A;  4LSO A;  4MEI A;  2MF7 A;  3OXA A;  4LGQ A;  3GWR A;  5IG5 A;  4HYZ A;  1Q7Y 4;  3KSP A;  1EQK A;  4HZB B;  2PZV A;  2OTJ 3;  3DGL A;  3U1W A;  3X3Z A;  3CNX A;  6STD A;  1RN7 A;  2YFJ B;  4G1M B;  1A67 A;  3MKI A;  4Q53 A;  2Y73 A;  2RFR A;  2JQ5 A;  4OUQ A;  4O3V A;  3DY5 A;  2XFS A;  3HI7 A;  3MYT A;  3NXJ A;  2W9P A;  1O7G B;  5KP3 A;  3U97 A;  5KP4 A;  1JN5 A;  2C11 A;  2FGT A;  3LZA A;  2LYX A;  2BNG A;  1EA2 A;  4XDW A;  3VGN A;  1LOX A;  2L4V A;  3X41 A;  1IU7 A;  1IQX A;  1N9J A;  2D1W A;  4IIA A;  2M7O A;  1YVB I;  3WA3 A;  3WOE B;  3CNM A;  1TP6 A;  4CDL A;  3OWY A;  4KFF A;  5IEO A;  5IEN A;  3WA2 X;  3F14 A;  1RRH A;  4XBY A;  1U8C B;  2KCD A;  2WGO A;  3A76 A;  1JRQ A;  3Q1C A;  3V92 A;  3CCJ 3;  1K41 A;  1A90 A;  4XB5 A;  1SIH A;  1RKY A;  2IUJ A;  4N6T A;  4CCV A;  2W56 A;  1Q42 A;  1IVV A;  2I9W A;  3LXU X;  3MPH A;  5ELJ A;  1UUV B;  3AMO A;  2HMM B;  3CCU 3;  3EJV A;  2CFD A;  3N54 B;  3VSY A;  1E3R A;  4WP5 A;  3BB9 A;  1YIT 3;  2E2T A;  2IA7 A;  1CYV A;  5JPU A;  3UL5 A;  2Q07 A;  2CHC A;  3LTB A;  1ASK A;  5IW9 A;  1PU4 A;  3N8B A;  3QK9 A;  3NBJ A;  3G4S 3;  3SXX A;  2OTL 3;  1VQN 3;  1FGQ A;  3JUQ A;  2XSO B;  4ORL A;  4H61 A;  1SQW A;  3FG4 A;  1A2K A;  3CCR 3;  1Y4K A;  3IJE B;  1S72 3;  4HM1 B;  1YIJ 3;  5AYR B;  5EVH A;  3F8X A;  2HMJ B;  3OWU A;  1WMP A;  3PYJ A;  1VQ9 3;  4FCM A;  3K5T A;  2E2U A;  3DZL A;  3STD A;  4K61 A;  2Z77 A;  3SLU A;  1KC8 4;  3H3H A;  3F9S A;  1W00 A;  3EN1 B;  1TFK A;  1Q40 A;  3X3Y A;  4K90 B;  1JJ2 2;  3NM7 A;  1GD4 A;  3JUM A;  2CFK A;  3LH4 A;  4OVM A;  5A0O B;  1OHP A;  1GS3 A;  1QAL A;  2W0Q A;  3FSD A;  1M9G A;  5AII A;  1OH0 A;  3F7X A;  4AKZ A;  1NO3 A;  1AVL A;  2ZDJ A;  5D83 A;  3O8Y A;  1ZX2 A;  1WQL B;  2CW9 A;  1BUQ A;  2R4I A;  2LQV A;  1TUH A;  1JV2 B;  3NBB A;  4FCZ A;  1YI2 3;  4EC6 A;  2XRX B;  4FMD A;  2HML B;  2Z6B A;  4KFD A;  3FG3 A;  2W56 B;  3NV0 A;  3UNL A;  1CEW I;  1D6Y A;  1QMA A;  2PNC A;  3B7C A;  3EBT A;  5G2G A;  7STD A;  1DMN A;  1O7W B;  3LML A;  1FGT A;  5STD A;  2WOH A;  3OX9 A;  3LT8 A;  1DMM A;  3K0Z A;  4OK0 A;  2CFL A;  1FGR A;  1GY7 A;  1FUW A;  1M1K 4;  4R80 A;  3LT9 A;  5IG4 A;  2K0M A;  5I97 A;  1ZO2 A;  3S29 A;  3EX9 A;  2ML5 A;  1YJW 3;  5CF2 A;  4HM0 B;  5JPP A;  3X42 A;  2A15 A;  1NU3 A;  3S28 A;  4LMI A;  2HMK B;  4O8S A;  3G71 3;  3WOF B;  1JN5 B;  1W01 A;  3DM8 A;  3KII A;  2OQE A;  4L8O A;  1WNH A;  3NQZ A;  2D42 A;  1R4C A;  2W6J H;  4FMA A;  3MG2 A;  4LZI A;  4MMZ B;  3FKA A;  1ULI B;  3GRD A;  3DGO A;  3DGM A;  4XM4 A;  4N6O B;  1VQ7 3;  4HKV B;  5TGN A;  1S5A A;  3GZX B;  1SPU A;  5D81 A;  4HM8 B;  1NDO B;  4R9L A;  3D3L A;  1K73 4;  5IER A;  3EC9 A;  3GZB A;  3I55 3;  5BVB A;  3NQY A;  2QA4 3;  1E97 A;  1U5O A;  3NUV A;  1ISK A;  3LTD A;  3M8C A;  3EB8 A;  2XGL A;  3T8N A;  3PS8 A;  5AYS C;  1W6Y A;  2UX0 A;  1GYB A;  1TU5 A;  1Q40 B;  3LTC A;  2W2C A;  1EG9 B;  1D6Z A;  1UI7 A;  2BO9 B;  4LEH A;  4HM5 B;  5D82 A;  3FLJ A;  3CD6 3;  1IV9 A;  1UI8 A;  4MMY B;  5LC7 A;  2E2V A;  3NBR A;  2P38 A;  1VQK 3;  1F8N A;  3CCV 3;  4N6N B;  3SOY A;  5CK6 A;  3MSO A;  4J9A A;  3Q2P A;  3EN8 A;  1DYU A;  1HU9 A;  3HII A;  1Q82 4;  1IDP A;  2BMQ B;  3K63 A;  5LC6 A;  1QAF A;  1NB3 I;  4HM6 B;  2BMO B;  4XBX A;  3CXC 2;  5IG3 A;  3DMC A;  2B1X B;  2CFG A;  4WWU C;  1KQS 2;  3EF8 A;  3G16 A;  1W4N A;  1N8R 4;  2FNQ A;  1WMO A;  3MHE A;  3BLZ A;  3MWZ A;  4EXR A;  3DGN A;  5DRE A;  2F86 B;  1IQ8 A;  2V1L A;  1FA3 A;  2CK3 H;  4HM2 B;  1STD A;  3HIG A;  3T0U A;  4HM7 B;  8CHO A;  3HZP A;  4KVH A;  2WO0 A;  2INX A;  4MJD A;  1PFP A;  4R1K A;  2GBW B;  3EHC A;  5AIF A;  2Z76 A;  5JBS A;  5IG0 A;  3F8H A;  3HK4 A;  2P05 A;  3TDG A;  2KXG A;  4N6M A;  1WMN A;  4HBR A;  4ZM8 A;  3CCS 3;  1UW1 A;  1EKM A;  4FR9 A;  1NB5 I;  2W04 A;  5AEW B;  3RGA A;  2W03 A;  2CIU A;  3S5C A;  2GXF A;  1VQ4 3;  2GBX B;  4R4K A;  2QIY A;  2Z7A A;  2YX9 A;  4FMB A;  1N9E A;  3ROB A;  3Q90 A;  3S67 A;  1LNH A;  5FGO A;  3KZT A;  2XSH B;  3WDG B;  1ULJ B;  5IF6 A;  1K8A 4;  1OCV A;  3V98 A;  3L0R A;  2BT3 A;  3KKG A;  3PCR A;  1HKX A;  2CWV A;  3NM2 A;  4WYK B;  2CFW A;  4GB5 A;  1J2B A;  2F98 A;  3RDE A;  2CC3 A;  1N5H A;  1SJW A;  1W02 A;  3WOD G;  4O2H A;  3OV4 A;  4EYC A;  5AIG A;  1US1 A;  3H51 A;  1AVK A;  5FW5 A;  4K1V A;  3UB1 A;  1T5Y A;  2XEP A;  4GL6 A;  1N8Q A;  2QEX 3;  2OOV A;  2GEX A;  2XFT A;  4RBN A;  3S27 A;  1FGM A;  3LYG A;  1GY5 A;  3DXO A;  2WOF A;  1DVC A;  3GZY B;  2RGQ A;  4K1U A;  2CG1 A;  1GY6 A;  2W9Q A;  2GU1 A;  2OOV C;  2P0X A;  3JVC A;  2XR8 B;  3PXM A;  4WFO A;  3G6E 3;  1JB5 A;  2QGU A;  4TX4 A;  5DRV A;  1DVD A;  1Z1S A;  3GZR A;  3UJM A;  2HMN B;  5CLK A;  3JUN A;  2JDI H;  3DUK A;  1OHS A;  3EBY A;  3G0K A;  3EE1 A;  3B8L A;  1YJN 3;  2IMJ A;  2FXT A;  4J8T A;  4EV5 A;  2XH9 A;  4XBT A;  3SOA A;  1WTH A;  3B4P A;  4MMX B;  3B4O A;  1K28 A;  1O7N B;  1VQM 3;  3CPO A;  4PEJ A;  4IT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...