1K9M4

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k9m400
1VQP3 1YJW3 2QEX3 3CCU3 3CCE3 2QA43 3CCS3 1YIT3 1M1K4 3G4S3 3CCM3 1YIJ3 3CCJ3 3G713 1YJN3 3G6E3 1Q814 1K734 1VQ83 1VQ93 1VQN3 1KC84 3CC23 1QVG2 1K8A4 1Q824 1VQ53 3I563 2OTJ3 1VQM3 3CMA3 1N8R4 1YHQ3 1NJI4 3CC43 1M904 1YI23 3CME3 3CC73 1VQK3 1KQS2 1VQ63 1KD14 3CCQ3 1Q864 1JJ22 3I553 3OW22 1VQO3 1YJ93 1Q7Y4 1VQ43 1K9M4 1QVF2 1S723 3CCL3 2OTL3 3CPW2 3CCR3 3CD63 1VQ73 3CXC2 1W2B2 3CCV3 1VQL3
chains in the Genus database with same CATH superfamily
3FF2A 1EA2A 1JBSA 3F14A 7STDA 3ECFA 1PU4A 2Z76A 1OHSA 3LXUX 3OV4A 1B2SA 1BNRA 3BIRA 3VSYA 4WWUC 2H0IA 1A2KA 2AAEA 2BNGA 2O3OA 2CWTA 1QMAA 4AKZA 2BO9B 4GHOA 1RNTA 3F9SA 1LRAA 1M904 4J5GA 2RNTA 3DXOA 1GSPA 1OHOA 1K28A 1AV4A 1CYVA 1CH0A 4N6TA 3V92A 3MG3A 1S723 1F8NA 4WYKA 2F5MA 1B2XA 1GD4A 2CWVA 4N6UA 3DGYA 1C54A 3PZWA 3EC9A 3VGNA 1FA3A 1JN5B 1NWWA 3DGNA 1Q9EA 3K9MC 4EV2A 1JNQA 1TUHA 1JB5A 2GEXA 2ZDJA 5D82A 1J2BA 1WNHA 4R9KA 1BSBA 1MNLA 1MWUA 2CH9A 2KF5A 2F99A 2O9UX 5IG4A 1AR0A 3B4PA 4KFFA 5G1KA 3K0ZA 5JPUA 1TP6A 5M1AA 1JBRA 1MGRA 1FZUA 3CC43 2Z6BA 3KCHA 4GB5A 3T8UA 2ML6A 3SVAA 2XR8B 3F7SA 1JBTA 1N8QA 2RBIA 3Q1CA 3D9RA 3FF0A 3EB8A 1RLSA 1MOLA 2F86B 2BIRA 3DGMA 4HZ9B 2LQVA 4K61A 3G0KA 3S29A 1RGAA 4XBTA 3NBRA 4GSPA 3WR2A 3JUNA 1VQQA 3GSPA 3SOAA 2QA43 3LT8A 1ISKA 3PS8A 3S28A 1EKMA 1UGIA 3AMOA 1FGRA 4HZBB 3ALAA 2P0MA 4XM4A 1Q824 3Q90A 2SBLA 1VQM3 4R1KA 1PY3A 2CG1A 4CPKA 3FZWA 1N5PA 1FUTA 1SQWA 1I3IA 4BIRA 1N9EA 3HOHA 3NXJA 2GBWB 3FGYA 1PYLA 3U97A 1OH0A 1W5ZA 1X1UA 1W02A 4BTWA 3CCL3 2PNCA 4LEHA 1IQ8A 3NM7A 3CPW2 1GS3A 1RN7A 2WGOA 4J9AA 1T2IA 1ZX2A 1VQP3 4CDLA 3CCU3 2Y73A 3MSOA 1QAKA 3G16A 2YFLB 1BRSA 1M1K4 2GBXB 2RSXA 2W2CA 4HM8B 5EQLA 1VQ93 1IVWA 3HI7A 5G1LA 3V98A 5AYSC 4HM3B 1BVIA 4L8PA 2UGIA 2BT3A 4FCMA 4EC6A 1ULIB 1FW7A 3DM8A 2GU1A 5AIIA 4LSOA 1KSIA 1QAFA 2B1XB 4OVMA 5RNTA 1LOXA 4HM4B 1N5HA 1B20A 1EUIC 2XGNA 3CCQ3 2IA7A 3D5GA 1AVLA 3EE1A 1Q42A 2A15A 1I8VA 3FSDA 3PXMA 4O2HA 5M18A 1K9M4 3AHSA 1JN5A 3KFQC 1VZZA 1BSAA 4N6V0 4K1UA 2P09A 3EN1B 3LMLA 3DUKA 4FMDA 4N6OB 5AIFA 1IDPA 2JDIH 5M19A 4Q53A 5FW5A 1QJGA 1TJDA 2XFTA 3N8BA 5LC6A 5HOHA 2HMLB 1GY6A 3RDEA 4N6MA 4MMZB 1UCKA 4J8TA 1O7NB 4O3VA 3HZPA 2OOVA 1LOVA 3BNBA 3K63A 5AEWB 4KFEA 5IW9A 2OQEC 2CFLA 3UNLA 4GL6A 2KF6A 5IERA 3I563 1VQ53 1UGHI 3S5CA 1FUWA 1B2MA 1MGWA 3QRDA 1QALA 3FG4A 4H3UA 1JZOA 3X40A 3MG1A 3PGBA 2HMNB 3NHXA 1O7HB 1LQGC 5FGOA 1NU3A 1GOUA 3RGAA 3BNEA 3F8HA 5IG0A 3UJMA 2MF7A 1RJOA 4I4KA 1RRHA 3I553 3OW22 3BNCA 2HMKB 4EBGA 2INXA 1WTHA 5A0OB 1NB3I 1U5OA 2RGQA 3NX0A 4CCVA 1L5GB 4FMCA 4R4KA 3NM2A 4OK0A 1W2ZA 1TRPA 2JQ5A 3BLZA 1OCVA 4HM5B 3CCS3 2HMMB 1V74A 3SOYA 2KF3A 3CCM3 2HMOB 1BNSA 2F4YA 3MWZA 3OXAA 4LYLB 1UCLA 4XB5A 3X3YA 3AGOA 3CCJ3 1IV7A 1GYBA 1YGEA 9RNTA 3FCSB 3N9HA 4R80A 3LT9A 2C4BA 2P05A 1FGQA 5ELJA 5TGNA 1AVKA 2XH9A 7GSPA 1B2UA 3IMAB 2CFDA 3LTBA 1RGGA 4EYCA 4OUQA 5BVBA 1JB2A 4MMXB 5CF2A 1RCKA 2OWPA 3GZBA 2D42A 2IUJA 1TRQA 1Z1SA 3PCRA 3NBJA 1Q7Y4 3EBYA 1B3SA 1V57A 3EN8A 3JUMA 2SARA 1I3FA 3O8YA 3LH4A 2OTL3 1HZ1A 1NDOB 1B27A 2ML5A 2HOHA 4TX4A 1LOWA 1TFOA 1O7PB 2CKFB 3H51A 2R41A 3LTAA 1BRJA 4HBRA 3QK9A 4NPBA 6GSPA 1WQLB 2P38A 3OX9A 1BANA 2XSOB 3IPTA 1K734 1W6YA 4HAAA 4FCZA 3WOFB 1JZDA 1KC84 3D5IA 1IQYA 1RGEA 1W7CA 3X41A 1STDA 2XFSA 2KXGA 3CNMA 3WA2X 3EQQB 4R9LA 2M7OA 2RCDA 3BB9A 1SJWA 2XF3A 2IUKA 3B4OA 3WODG 5AI1A 5HGRA 4RZMA 1Y4KA 3CME3 4N3VA 3UB1A 1BAOA 5AEUB 1RRLA 1EEJA 5IG3A 1Q40B 2W56B 4L8OA 4XDWA 4NHFA 1RN1A 3HX8A 4BL2A 4N6LA 1GD3A 1LQMB 4QWTA 1AY7A 1BNFA 4RNZA 3CU3A 4FCJA 1IT8A 3BNDA 1WMPA 3JUOA 4EW5A 2UX0A 3G6E3 4O8SA 2F5WA 2XSHB 5D81A 1ASKA 1NNVA 3I0YA 2WOHA 4L7KA 1BUQA 3CPOA 3FG3A 5KP1A 5G2GA 3X42A 1W6GA 3DY5A 3WMDA 6RNTA 1E97A 3PYJA 1WMNA 2CFWA 3MHEA 4KT3B 3SEDA 3L0RA 3JUQA 1W01A 1KD14 3EX9A 3CC73 2K54A 1LVNA 2CFGA 3KSED 1JKGB 1C7HA 1IVUA 3JUPA 3V99A 3CXC2 1UUGB 1RMSA 4FMAA 1GMRA 1X1WA 2QEX3 5STDA 1BOXA 1O7MB 4LZIA 3ZG5A 1BRNL 4MEIA 3CNXA 2H0HA 1X1XA 1X1YA 4XDVA 3CC23 3WHOA 1UCIA 2IMJA 1I0XA 3GZRA 3KN4A 1UW1A 4EV5A 1PFPA 1W00A 1RTUA 3GZYB 3NV0B 1DMQA 2R4IA 3DZLA 1WMOA 4N6NB 2IYJA 2C10A 4ZM8A 5BIRA 1LXEA 1CYUA 1IYYA 3HK4A 4BU4A 5CXOA 1O7GB 1BU4A 1FGTA 1STFI 1BSDA 1D6UA 1RDSA 1UI8A 1T3BA 1A2PA 1YVSA 3E99A 4FR9A 1N9JA 2CFKA 4I5QA 1IT7A 3NQYA 4LGQA 5JPPA 3Q2PA 1MWSA 2F56A 3KIIA 2P0XA 3F8XA 4HM2B 1RKYA 2K0MA 4RBNA 1G96A 2CC3A 2OTJ3 1I70A 1Q7HA 4XBYA 2W9PA 1LOYA 3HIIA 5EVHA 3GZXB 1Q40A 1ROVA 2W56A 5IENA 1YNVX 1FGMA 1R4CA 3JVCA 1SPUA 2B24B 1AQZA 1IVXA 1NB5I 2V1LA 3GWRA 4KZ1A 2YX9A 3D3LA 1UUWB 3U1WA 1IVVA 1DYUA 1TTOA 5KP3A 1GMQA 3CCR3 5DREA 1BIRA 1M1XB 1ROAA 1TIJA 2CIUA 5BXQA 4MJDA 1DVCA 2XEPA 1DVDA 3KZTA 1OPYA 2H0GA 1EG9B 1ZS7A 3D4AA 2Z77A 3MG2A 4FMBA 4WP5A 1ZGXA 3ROBA 4CJNA 3F40A 2QIYA 3OWSA 1A90A 1JKGA 2XGLA 1UDII 3A76A 1E3RA 4IPBA 5AIHA 1VQK3 4HM7B 1BNEA 2WOFA 1Q864 4NREA 5EEOA 4WHAA 1GY5A 2CWUA 4ORLA 4DKIA 5IF6A 2LYXA 3T8NA 1OUNA 5D83A 3CD63 2I9WA 3RGRA 1BRIA 3CCV3 1UCJA 3DGOA 3SLUA 2ZHXB 1SIIA 3UL5A 2CW9A 3MYTA 1TU5A 3N54B 2QGUA 1BNJA 4KFDA 1DMMA 1YJN3 1Q814 2GU3A 3J7Yd 2OCTA 2UUGC 3LTCA 2W6JH 3NV0A 4G1MB 3STDA 1DE3A 4KVHA 1HKXA 3GAXA 1G02A 4H61A 4J5KA 1OF5B 3ZFZA 1RN4A 1JB4A 1U8CB 1N8R4 2CG0A 2CX1A 2J8XB 1RNBA 3RNTA 2BHMA 4HM1B 1I2GA 2E2TA 4X2HA 1BRGA 1RSNA 5CK6A 3TDGA 1VQ43 2L1SA 1QVF2 1UUVB 1RGHA 2C11A 6STDA 1OACA 2KF4A 8RNTA 1V58A 4BL3A 1YVBI 4ILFA 2PZVA 3MPHA 5LC7A 5JBSA 2OQEA 3X3ZA 2CK3H 1I2FA 3D79A 3EHCA 3CCE3 1GOVA 1W4NA 1RGLA 3UL6A 1VQN3 1B2ZA 1VQ83 2BMQB 3LOYA 1E3VA 3WOEB 4BTXA 1SARA 4XBXA 5AIGA 5KP4A 1A67A 3Q3FA 4HVNA 5IEOA 1HU9A 5DRVA 2FGTA 2OOVC 3BU4A 3K7CA 1NJI4 2W03A 1KQS2 3WDGB 1JJ22 2BMOB 3AGNA 1KWIA 4RNTA 2XRXB 3EF8A 1G0TA 5CLKA 3SYUA 1D6ZA 3NQZA 1IQXA 2L4VA 4U13A 1UI7A 3K5TA 2BMRB 1RGKA 2WGQA 1CQSA 1YJW3 4IT7A 3NBBA 8CHOA 1YIJ3 1BGSA 3X3XA 1BUJA 1JRQA 1GY7A 4X2OA 1JV2B 2YFJB 4JRFA 1MWRA 3PCSA 2D1WA 2YFIB 5IEPA 1I2EA 2E2VA 3FG1A 1FUSA 1K41A 1LNIA 1O7WB 2KAAA 2ZA4A 1I0VA 1T5YA 1DMNA 2Z7AA 1T2HA 2W0QA 2GEYA 3LZAA 3GRDA 4RNYA 4AKYA 1GOYA 3DGLA 3SX1A 3VF1A 1VQ73 3B8LA 2BU4A 2K3DA 3M8CA 3G8ZA 4WFOA 3FH1A 3KSPA 3LTDA 2ZL8A 2IY2A 1BNIA 4IIAA 4MMYB 4WYKB 3A5EA 1YIT3 5BU4A 3OWUA 1OF5A 3URPA 4AEQA 3G4S3 3G713 1NO3A 3IJEB 2Y74A 3HIGA 1QVG2 1BRHA 1K8A4 2CX0A 1BNGA 1TFKA 4HYZA 1IU7A 4HKVB 3SXXA 2KRTA 1R4YA 2STDA 3EBTA 1OHPA 1IK3A 1ZO2A 3DMCA 3KE7A 3S27A 1B21A 1OGZA 3S67A 3KKGA 1VQ63 5AYRB 1VQO3 2E2UA 1CEWI 4LMIA 3B7CA 1D6YA 1W6CA 2FXTA 1FGOA 3EJVA 3F7XA 4HJLB 4STDA 1RHLA 2AADA 2W04A 4PEJA 4JF8A 3ZG0A 1VQL3 3ER7A 1RCLA 1DETA 1LNHA 3NUVA 5GSPA 4BTYA 5IG5A 3OWYA 1SIHA 5I97A 2F98A 3T0UA 2GXFA 1US1A 1S5AA 3MKIA 3LYGA 3H3HA 1IV9A 1BSEA 1RGCA 1FYSA 1HYFA 3AHWA 3DH2A 4HM6B 4K90B 2KCDA 2MC8A 3CMA3 1ULJB 2W9QA 2WO0A 1BRKA 2Q07A 1YHQ3 4HOHA 3AMOB 2RFRA 3FKAA 7RNTA 1GMPA 2CHCA 4HM0B 5ELUA 1MWTA 1YI23 1OGXA 2FNQA 4O02B 3WA3A 1YJ93 1BSCA 1EQKA 1YGWA 4EXRA 1M9GA 3FLJA 2HMJB 1W2B2 1RGFA 2GSPA 4K1VA 5CF1A 1A2VA
chains in the Genus database with same CATH topology
3FF2A 1EA2A 3F14A 7STDA 3ECFA 1PU4A 2Z76A 1OHSA 3LXUX 3OV4A 3VSYA 4WWUC 1A2KA 2BNGA 2O3OA 2CWTA 1QMAA 4AKZA 2BO9B 3F9SA 1M904 3DXOA 1OHOA 1K28A 1AV4A 1CYVA 4N6TA 3V92A 3MG3A 1S723 1F8NA 4WYKA 4N6UA 1GD4A 2CWVA 3PZWA 3EC9A 3VGNA 1FA3A 1JN5B 1NWWA 3DGNA 3K9MC 4EV2A 1JNQA 1TUHA 1JB5A 2GEXA 2ZDJA 5D82A 1J2BA 1WNHA 4R9KA 1MNLA 2CH9A 2F99A 2O9UX 5IG4A 1AR0A 3B4PA 4KFFA 3K0ZA 5JPUA 1TP6A 3CC43 2Z6BA 4GB5A 3T8UA 2ML6A 3SVAA 2XR8B 3F7SA 1N8QA 3Q1CA 3D9RA 3FF0A 3EB8A 1MOLA 2F86B 3DGMA 4HZ9B 2LQVA 4K61A 3G0KA 3S29A 4XBTA 3NBRA 3JUNA 3SOAA 2QA43 3LT8A 1ISKA 3PS8A 1EKMA 3AMOA 1FGRA 4HZBB 3ALAA 2P0MA 4XM4A 1Q824 3Q90A 2SBLA 1VQM3 4R1KA 2CG1A 3FZWA 1N5PA 1SQWA 1N9EA 3NXJA 2GBWB 3FGYA 3U97A 1OH0A 1W5ZA 1W02A 3CCL3 2PNCA 4LEHA 1IQ8A 3NM7A 3CPW2 1GS3A 1RN7A 2WGOA 4J9AA 1VQP3 1ZX2A 4CDLA 3CCU3 2Y73A 3MSOA 1QAKA 3G16A 2YFLB 1M1K4 2GBXB 2RSXA 2W2CA 4HM8B 5EQLA 1VQ93 1IVWA 3HI7A 3V98A 5AYSC 4HM3B 4L8PA 4EC6A 2BT3A 4FCMA 1ULIB 3DM8A 2GU1A 5AIIA 4LSOA 1KSIA 1QAFA 2B1XB 4OVMA 1LOXA 4HM4B 1N5HA 2XGNA 3CCQ3 2IA7A 3EE1A 1AVLA 3PXMA 1Q42A 2A15A 3FSDA 4O2HA 1K9M4 1JN5A 3KFQC 1VZZA 4N6V0 4K1UA 2P09A 3EN1B 3LMLA 3DUKA 4FMDA 4N6OB 5AIFA 1IDPA 2JDIH 4Q53A 5FW5A 2XFTA 1QJGA 3N8BA 5LC6A 2HMLB 1GY6A 3RDEA 4N6MA 4MMZB 4J8TA 1O7NB 4O3VA 3HZPA 2OOVA 3K63A 3BNBA 5AEWB 4KFEA 5IW9A 2OQEC 2CFLA 3UNLA 4GL6A 1VQ53 5IERA 3I563 3S5CA 1FUWA 3QRDA 1QALA 3FG4A 4H3UA 3X40A 3MG1A 3PGBA 2HMNB 3NHXA 1O7HB 5FGOA 3S28A 1NU3A 3UJMA 3RGAA 3BNEA 3F8HA 5IG0A 4BTWA 2MF7A 1RJOA 4I4KA 1RRHA 3I553 3OW22 3BNCA 2HMKB 4EBGA 2INXA 1WTHA 5A0OB 1NB3I 1U5OA 2RGQA 3NX0A 4CCVA 1L5GB 4FMCA 4R4KA 3NM2A 4OK0A 1W2ZA 2JQ5A 3BLZA 1OCVA 4HM5B 3CCS3 2HMMB 1V74A 3SOYA 3CCM3 2HMOB 3CCJ3 4XB5A 3MWZA 3OXAA 3X3YA 1IV7A 1GYBA 1YGEA 3FCSB 3N9HA 4R80A 3LT9A 2P05A 5ELJA 1FGQA 5TGNA 1AVKA 2XH9A 3IMAB 3LTBA 2CFDA 4EYCA 4OUQA 5BVBA 1JB2A 4MMXB 5CF2A 2OWPA 3GZBA 2D42A 2IUJA 1Z1SA 3PCRA 3NBJA 1Q7Y4 3EBYA 3EN8A 3JUMA 3O8YA 3LH4A 2OTL3 1NDOB 2ML5A 4TX4A 1W2B2 1TFOA 3LTAA 1O7PB 2CKFB 3H51A 4HBRA 3QK9A 1WQLB 2P38A 3OX9A 2XSOB 3IPTA 1K734 1W6YA 4FCZA 3WOFB 1KC84 1IQYA 1W7CA 3X41A 1STDA 2XFSA 2KXGA 3CNMA 3WA2X 3EQQB 4R9LA 2M7OA 2RCDA 3BB9A 1SJWA 2XF3A 2IUKA 3B4OA 3WODG 5AI1A 5HGRA 4RZMA 1Y4KA 3CME3 4N3VA 3UB1A 5AEUB 1RRLA 5IG3A 1Q40B 2W56B 4L8OA 4XDWA 4NHFA 3HX8A 4N6LA 1GD3A 4QWTA 4RNZA 3CU3A 4FCJA 1IT8A 3BNDA 1WMPA 3JUOA 2UX0A 3G6E3 4O8SA 2XSHB 5D81A 1ASKA 3I0YA 4L7KA 2WOHA 1BUQA 3CPOA 3FG3A 5KP1A 5G2GA 3X42A 1W6GA 3DY5A 3WMDA 1E97A 3PYJA 1WMNA 2CFWA 3MHEA 3SEDA 3L0RA 3JUQA 1W01A 1KD14 3EX9A 3CC73 2K54A 1LVNA 2CFGA 3KSED 1JKGB 1C7HA 1IVUA 3JUPA 3V99A 3CXC2 4FMAA 2QEX3 5STDA 1O7MB 4LZIA 4MEIA 3CNXA 4XDVA 3CC23 2IMJA 3GZRA 3KN4A 1UW1A 4EV5A 1PFPA 1W00A 3GZYB 3NV0B 1DMQA 2R4IA 3DZLA 1WMOA 4N6NB 2C10A 4ZM8A 1LXEA 1CYUA 3HK4A 5CXOA 1O7GB 1FGTA 1STFI 1D6UA 1UI8A 3E99A 4FR9A 1N9JA 2CFKA 1IT7A 3NQYA 4LGQA 5JPPA 3Q2PA 3KIIA 4HM2B 2P0XA 3F8XA 1RKYA 2K0MA 4RBNA 1G96A 2CC3A 2OTJ3 4XBYA 2W9PA 5EVHA 3HIIA 3GZXB 1Q40A 1ROVA 2W56A 5IENA 3JVCA 1FGMA 1R4CA 1SPUA 2B24B 1NB5I 1IVXA 2V1LA 3GWRA 4KZ1A 2YX9A 3D3LA 1UUWB 3U1WA 1IVVA 1DYUA 5KP3A 3CCR3 5DREA 1M1XB 1ROAA 1TIJA 2CIUA 5BXQA 4MJDA 1DVCA 2XEPA 1DVDA 3KZTA 1OPYA 1EG9B 2Z77A 3MG2A 4FMBA 4WP5A 3ROBA 3F40A 2QIYA 3OWSA 1A90A 1JKGA 3A76A 2XGLA 1E3RA 4IPBA 5AIHA 1VQK3 4HM7B 2WOFA 1Q864 4NREA 5EEOA 4WHAA 1GY5A 2CWUA 4ORLA 5IF6A 2LYXA 3T8NA 1OUNA 5D83A 3CD63 2I9WA 3RGRA 3CCV3 3DGOA 3SLUA 3UL5A 1SIIA 2CW9A 3MYTA 1TU5A 3N54B 2QGUA 4KFDA 1DMMA 1YJN3 1Q814 2GU3A 3J7Yd 2OCTA 3LTCA 2W6JH 3NV0A 4G1MB 3STDA 4KVHA 1HKXA 3GAXA 4H61A 1OF5B 1JB4A 1U8CB 1N8R4 2CG0A 2BHMA 4HM1B 2E2TA 4X2HA 1VQ43 5CK6A 3TDGA 1QVF2 1UUVB 2C11A 6STDA 1OACA 1YVBI 2PZVA 3MPHA 5LC7A 5JBSA 2OQEA 3X3ZA 2CK3H 3EHCA 3CCE3 3UL6A 1W4NA 1VQN3 1VQ83 2BMQB 3LOYA 1E3VA 3WOEB 4BTXA 4XBXA 5AIGA 5KP4A 1A67A 4HVNA 5IEOA 1HU9A 5DRVA 2FGTA 2OOVC 1NJI4 3K7CA 2W03A 1KQS2 3WDGB 1JJ22 2BMOB 1KWIA 2XRXB 3EF8A 5CLKA 1D6ZA 3NQZA 1IQXA 2L4VA 4U13A 1UI7A 3K5TA 2BMRB 2WGQA 1CQSA 1YJW3 4IT7A 3NBBA 8CHOA 1YIJ3 3X3XA 1JRQA 1GY7A 4X2OA 1JV2B 2YFJB 4JRFA 3PCSA 2D1WA 2YFIB 5IEPA 2E2VA 3FG1A 1K41A 1O7WB 1T5YA 1DMNA 2Z7AA 2W0QA 2GEYA 3LZAA 3GRDA 4RNYA 4AKYA 3DGLA 3SX1A 3VF1A 1VQ73 3B8LA 3M8CA 4WFOA 3G8ZA 3FH1A 3KSPA 3LTDA 2ZL8A 4IIAA 4MMYB 4WYKB 1YIT3 3OWUA 1OF5A 4AEQA 3G4S3 3G713 1NO3A 3IJEB 2Y74A 3HIGA 1QVG2 1K8A4 1TFKA 4HYZA 1IU7A 4HKVB 3SXXA 2KRTA 2STDA 3EBTA 1OHPA 1IK3A 1ZO2A 3DMCA 3KE7A 3S27A 1OGZA 3S67A 3KKGA 1VQ63 5AYRB 1VQO3 2E2UA 1CEWI 4LMIA 3B7CA 1D6YA 1W6CA 2FXTA 1FGOA 3EJVA 3F7XA 4HJLB 4STDA 1VQL3 2W04A 4PEJA 4JF8A 3ER7A 1LNHA 3NUVA 5IG5A 4BTYA 3OWYA 1SIHA 5I97A 2F98A 3T0UA 2GXFA 1US1A 1S5AA 3MKIA 3LYGA 3H3HA 1IV9A 2MC8A 4HM6B 4K90B 2KCDA 3CMA3 2W9QA 1ULJB 2WO0A 2Q07A 1YHQ3 3AMOB 2RFRA 3FKAA 2CHCA 4HM0B 5ELUA 1YI23 1OGXA 2FNQA 4O02B 3WA3A 1YJ93 1EQKA 4EXRA 1M9GA 3FLJA 2HMJB 4K1VA 5CF1A 1A2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP 3;  1YJW 3;  2QEX 3;  3CCU 3;  3CCE 3;  2QA4 3;  3CCS 3;  1YIT 3;  1M1K 4;  3G4S 3;  3CCM 3;  1YIJ 3;  3CCJ 3;  3G71 3;  1YJN 3;  3G6E 3;  1Q81 4;  1K73 4;  1VQ8 3;  1VQ9 3;  1VQN 3;  1KC8 4;  3CC2 3;  1QVG 2;  1K8A 4;  1Q82 4;  1VQ5 3;  3I56 3;  2OTJ 3;  1VQM 3;  3CMA 3;  1N8R 4;  1YHQ 3;  1NJI 4;  3CC4 3;  1M90 4;  1YI2 3;  3CME 3;  3CC7 3;  1VQK 3;  1KQS 2;  1VQ6 3;  1KD1 4;  3CCQ 3;  1Q86 4;  1JJ2 2;  3I55 3;  3OW2 2;  1VQO 3;  1YJ9 3;  1Q7Y 4;  1VQ4 3;  1K9M 4;  1QVF 2;  1S72 3;  3CCL 3;  2OTL 3;  3CPW 2;  3CCR 3;  3CD6 3;  1VQ7 3;  3CXC 2;  1W2B 2;  3CCV 3;  1VQL 3; 
#chains in the Genus database with same CATH topology
 3FF2 A;  1EA2 A;  1JBS A;  3F14 A;  7STD A;  3ECF A;  1PU4 A;  2Z76 A;  1OHS A;  3LXU X;  3OV4 A;  1B2S A;  1BNR A;  3BIR A;  3VSY A;  4WWU C;  2H0I A;  1A2K A;  2AAE A;  2BNG A;  2O3O A;  2CWT A;  1QMA A;  4AKZ A;  2BO9 B;  4GHO A;  1RNT A;  3F9S A;  1LRA A;  1M90 4;  4J5G A;  2RNT A;  3DXO A;  1GSP A;  1OHO A;  1K28 A;  1AV4 A;  1CYV A;  1CH0 A;  4N6T A;  3V92 A;  3MG3 A;  1S72 3;  1F8N A;  4WYK A;  2F5M A;  1B2X A;  1GD4 A;  2CWV A;  4N6U A;  3DGY A;  1C54 A;  3PZW A;  3EC9 A;  3VGN A;  1FA3 A;  1JN5 B;  1NWW A;  3DGN A;  1Q9E A;  3K9M C;  4EV2 A;  1JNQ A;  1TUH A;  1JB5 A;  2GEX A;  2ZDJ A;  5D82 A;  1J2B A;  1WNH A;  4R9K A;  1BSB A;  1MNL A;  1MWU A;  2CH9 A;  2KF5 A;  2F99 A;  2O9U X;  5IG4 A;  1AR0 A;  3B4P A;  4KFF A;  5G1K A;  3K0Z A;  5JPU A;  1TP6 A;  5M1A A;  1JBR A;  1MGR A;  1FZU A;  3CC4 3;  2Z6B A;  3KCH A;  4GB5 A;  3T8U A;  2ML6 A;  3SVA A;  2XR8 B;  3F7S A;  1JBT A;  1N8Q A;  2RBI A;  3Q1C A;  3D9R A;  3FF0 A;  3EB8 A;  1RLS A;  1MOL A;  2F86 B;  2BIR A;  3DGM A;  4HZ9 B;  2LQV A;  4K61 A;  3G0K A;  3S29 A;  1RGA A;  4XBT A;  3NBR A;  4GSP A;  3WR2 A;  3JUN A;  1VQQ A;  3GSP A;  3SOA A;  2QA4 3;  3LT8 A;  1ISK A;  3PS8 A;  3S28 A;  1EKM A;  1UGI A;  3AMO A;  1FGR A;  4HZB B;  3ALA A;  2P0M A;  4XM4 A;  1Q82 4;  3Q90 A;  2SBL A;  1VQM 3;  4R1K A;  1PY3 A;  2CG1 A;  4CPK A;  3FZW A;  1N5P A;  1FUT A;  1SQW A;  1I3I A;  4BIR A;  1N9E A;  3HOH A;  3NXJ A;  2GBW B;  3FGY A;  1PYL A;  3U97 A;  1OH0 A;  1W5Z A;  1X1U A;  1W02 A;  4BTW A;  3CCL 3;  2PNC A;  4LEH A;  1IQ8 A;  3NM7 A;  3CPW 2;  1GS3 A;  1RN7 A;  2WGO A;  4J9A A;  1T2I A;  1ZX2 A;  1VQP 3;  4CDL A;  3CCU 3;  2Y73 A;  3MSO A;  1QAK A;  3G16 A;  2YFL B;  1BRS A;  1M1K 4;  2GBX B;  2RSX A;  2W2C A;  4HM8 B;  5EQL A;  1VQ9 3;  1IVW A;  3HI7 A;  5G1L A;  3V98 A;  5AYS C;  4HM3 B;  1BVI A;  4L8P A;  2UGI A;  2BT3 A;  4FCM A;  4EC6 A;  1ULI B;  1FW7 A;  3DM8 A;  2GU1 A;  5AII A;  4LSO A;  1KSI A;  1QAF A;  2B1X B;  4OVM A;  5RNT A;  1LOX A;  4HM4 B;  1N5H A;  1B20 A;  1EUI C;  2XGN A;  3CCQ 3;  2IA7 A;  3D5G A;  1AVL A;  3EE1 A;  1Q42 A;  2A15 A;  1I8V A;  3FSD A;  3PXM A;  4O2H A;  5M18 A;  1K9M 4;  3AHS A;  1JN5 A;  3KFQ C;  1VZZ A;  1BSA A;  4N6V 0;  4K1U A;  2P09 A;  3EN1 B;  3LML A;  3DUK A;  4FMD A;  4N6O B;  5AIF A;  1IDP A;  2JDI H;  5M19 A;  4Q53 A;  5FW5 A;  1QJG A;  1TJD A;  2XFT A;  3N8B A;  5LC6 A;  5HOH A;  2HML B;  1GY6 A;  3RDE A;  4N6M A;  4MMZ B;  1UCK A;  4J8T A;  1O7N B;  4O3V A;  3HZP A;  2OOV A;  1LOV A;  3BNB A;  3K63 A;  5AEW B;  4KFE A;  5IW9 A;  2OQE C;  2CFL A;  3UNL A;  4GL6 A;  2KF6 A;  5IER A;  3I56 3;  1VQ5 3;  1UGH I;  3S5C A;  1FUW A;  1B2M A;  1MGW A;  3QRD A;  1QAL A;  3FG4 A;  4H3U A;  1JZO A;  3X40 A;  3MG1 A;  3PGB A;  2HMN B;  3NHX A;  1O7H B;  1LQG C;  5FGO A;  1NU3 A;  1GOU A;  3RGA A;  3BNE A;  3F8H A;  5IG0 A;  3UJM A;  2MF7 A;  1RJO A;  4I4K A;  1RRH A;  3I55 3;  3OW2 2;  3BNC A;  2HMK B;  4EBG A;  2INX A;  1WTH A;  5A0O B;  1NB3 I;  1U5O A;  2RGQ A;  3NX0 A;  4CCV A;  1L5G B;  4FMC A;  4R4K A;  3NM2 A;  4OK0 A;  1W2Z A;  1TRP A;  2JQ5 A;  3BLZ A;  1OCV A;  4HM5 B;  3CCS 3;  2HMM B;  1V74 A;  3SOY A;  2KF3 A;  3CCM 3;  2HMO B;  1BNS A;  2F4Y A;  3MWZ A;  3OXA A;  4LYL B;  1UCL A;  4XB5 A;  3X3Y A;  3AGO A;  3CCJ 3;  1IV7 A;  1GYB A;  1YGE A;  9RNT A;  3FCS B;  3N9H A;  4R80 A;  3LT9 A;  2C4B A;  2P05 A;  1FGQ A;  5ELJ A;  5TGN A;  1AVK A;  2XH9 A;  7GSP A;  1B2U A;  3IMA B;  2CFD A;  3LTB A;  1RGG A;  4EYC A;  4OUQ A;  5BVB A;  1JB2 A;  4MMX B;  5CF2 A;  1RCK A;  2OWP A;  3GZB A;  2D42 A;  2IUJ A;  1TRQ A;  1Z1S A;  3PCR A;  3NBJ A;  1Q7Y 4;  3EBY A;  1B3S A;  1V57 A;  3EN8 A;  3JUM A;  2SAR A;  1I3F A;  3O8Y A;  3LH4 A;  2OTL 3;  1HZ1 A;  1NDO B;  1B27 A;  2ML5 A;  2HOH A;  4TX4 A;  1LOW A;  1TFO A;  1O7P B;  2CKF B;  3H51 A;  2R41 A;  3LTA A;  1BRJ A;  4HBR A;  3QK9 A;  4NPB A;  6GSP A;  1WQL B;  2P38 A;  3OX9 A;  1BAN A;  2XSO B;  3IPT A;  1K73 4;  1W6Y A;  4HAA A;  4FCZ A;  3WOF B;  1JZD A;  1KC8 4;  3D5I A;  1IQY A;  1RGE A;  1W7C A;  3X41 A;  1STD A;  2XFS A;  2KXG A;  3CNM A;  3WA2 X;  3EQQ B;  4R9L A;  2M7O A;  2RCD A;  3BB9 A;  1SJW A;  2XF3 A;  2IUK A;  3B4O A;  3WOD G;  5AI1 A;  5HGR A;  4RZM A;  1Y4K A;  3CME 3;  4N3V A;  3UB1 A;  1BAO A;  5AEU B;  1RRL A;  1EEJ A;  5IG3 A;  1Q40 B;  2W56 B;  4L8O A;  4XDW A;  4NHF A;  1RN1 A;  3HX8 A;  4BL2 A;  4N6L A;  1GD3 A;  1LQM B;  4QWT A;  1AY7 A;  1BNF A;  4RNZ A;  3CU3 A;  4FCJ A;  1IT8 A;  3BND A;  1WMP A;  3JUO A;  4EW5 A;  2UX0 A;  3G6E 3;  4O8S A;  2F5W A;  2XSH B;  5D81 A;  1ASK A;  1NNV A;  3I0Y A;  2WOH A;  4L7K A;  1BUQ A;  3CPO A;  3FG3 A;  5KP1 A;  5G2G A;  3X42 A;  1W6G A;  3DY5 A;  3WMD A;  6RNT A;  1E97 A;  3PYJ A;  1WMN A;  2CFW A;  3MHE A;  4KT3 B;  3SED A;  3L0R A;  3JUQ A;  1W01 A;  1KD1 4;  3EX9 A;  3CC7 3;  2K54 A;  1LVN A;  2CFG A;  3KSE D;  1JKG B;  1C7H A;  1IVU A;  3JUP A;  3V99 A;  3CXC 2;  1UUG B;  1RMS A;  4FMA A;  1GMR A;  1X1W A;  2QEX 3;  5STD A;  1BOX A;  1O7M B;  4LZI A;  3ZG5 A;  1BRN L;  4MEI A;  3CNX A;  2H0H A;  1X1X A;  1X1Y A;  4XDV A;  3CC2 3;  3WHO A;  1UCI A;  2IMJ A;  1I0X A;  3GZR A;  3KN4 A;  1UW1 A;  4EV5 A;  1PFP A;  1W00 A;  1RTU A;  3GZY B;  3NV0 B;  1DMQ A;  2R4I A;  3DZL A;  1WMO A;  4N6N B;  2IYJ A;  2C10 A;  4ZM8 A;  5BIR A;  1LXE A;  1CYU A;  1IYY A;  3HK4 A;  4BU4 A;  5CXO A;  1O7G B;  1BU4 A;  1FGT A;  1STF I;  1BSD A;  1D6U A;  1RDS A;  1UI8 A;  1T3B A;  1A2P A;  1YVS A;  3E99 A;  4FR9 A;  1N9J A;  2CFK A;  4I5Q A;  1IT7 A;  3NQY A;  4LGQ A;  5JPP A;  3Q2P A;  1MWS A;  2F56 A;  3KII A;  2P0X A;  3F8X A;  4HM2 B;  1RKY A;  2K0M A;  4RBN A;  1G96 A;  2CC3 A;  2OTJ 3;  1I70 A;  1Q7H A;  4XBY A;  2W9P A;  1LOY A;  3HII A;  5EVH A;  3GZX B;  1Q40 A;  1ROV A;  2W56 A;  5IEN A;  1YNV X;  1FGM A;  1R4C A;  3JVC A;  1SPU A;  2B24 B;  1AQZ A;  1IVX A;  1NB5 I;  2V1L A;  3GWR A;  4KZ1 A;  2YX9 A;  3D3L A;  1UUW B;  3U1W A;  1IVV A;  1DYU A;  1TTO A;  5KP3 A;  1GMQ A;  3CCR 3;  5DRE A;  1BIR A;  1M1X B;  1ROA A;  1TIJ A;  2CIU A;  5BXQ A;  4MJD A;  1DVC A;  2XEP A;  1DVD A;  3KZT A;  1OPY A;  2H0G A;  1EG9 B;  1ZS7 A;  3D4A A;  2Z77 A;  3MG2 A;  4FMB A;  4WP5 A;  1ZGX A;  3ROB A;  4CJN A;  3F40 A;  2QIY A;  3OWS A;  1A90 A;  1JKG A;  2XGL A;  1UDI I;  3A76 A;  1E3R A;  4IPB A;  5AIH A;  1VQK 3;  4HM7 B;  1BNE A;  2WOF A;  1Q86 4;  4NRE A;  5EEO A;  4WHA A;  1GY5 A;  2CWU A;  4ORL A;  4DKI A;  5IF6 A;  2LYX A;  3T8N A;  1OUN A;  5D83 A;  3CD6 3;  2I9W A;  3RGR A;  1BRI A;  3CCV 3;  1UCJ A;  3DGO A;  3SLU A;  2ZHX B;  1SII A;  3UL5 A;  2CW9 A;  3MYT A;  1TU5 A;  3N54 B;  2QGU A;  1BNJ A;  4KFD A;  1DMM A;  1YJN 3;  1Q81 4;  2GU3 A;  3J7Y d;  2OCT A;  2UUG C;  3LTC A;  2W6J H;  3NV0 A;  4G1M B;  3STD A;  1DE3 A;  4KVH A;  1HKX A;  3GAX A;  1G02 A;  4H61 A;  4J5K A;  1OF5 B;  3ZFZ A;  1RN4 A;  1JB4 A;  1U8C B;  1N8R 4;  2CG0 A;  2CX1 A;  2J8X B;  1RNB A;  3RNT A;  2BHM A;  4HM1 B;  1I2G A;  2E2T A;  4X2H A;  1BRG A;  1RSN A;  5CK6 A;  3TDG A;  1VQ4 3;  2L1S A;  1QVF 2;  1UUV B;  1RGH A;  2C11 A;  6STD A;  1OAC A;  2KF4 A;  8RNT A;  1V58 A;  4BL3 A;  1YVB I;  4ILF A;  2PZV A;  3MPH A;  5LC7 A;  5JBS A;  2OQE A;  3X3Z A;  2CK3 H;  1I2F A;  3D79 A;  3EHC A;  3CCE 3;  1GOV A;  1W4N A;  1RGL A;  3UL6 A;  1VQN 3;  1B2Z A;  1VQ8 3;  2BMQ B;  3LOY A;  1E3V A;  3WOE B;  4BTX A;  1SAR A;  4XBX A;  5AIG A;  5KP4 A;  1A67 A;  3Q3F A;  4HVN A;  5IEO A;  1HU9 A;  5DRV A;  2FGT A;  2OOV C;  3BU4 A;  3K7C A;  1NJI 4;  2W03 A;  1KQS 2;  3WDG B;  1JJ2 2;  2BMO B;  3AGN A;  1KWI A;  4RNT A;  2XRX B;  3EF8 A;  1G0T A;  5CLK A;  3SYU A;  1D6Z A;  3NQZ A;  1IQX A;  2L4V A;  4U13 A;  1UI7 A;  3K5T A;  2BMR B;  1RGK A;  2WGQ A;  1CQS A;  1YJW 3;  4IT7 A;  3NBB A;  8CHO A;  1YIJ 3;  1BGS A;  3X3X A;  1BUJ A;  1JRQ A;  1GY7 A;  4X2O A;  1JV2 B;  2YFJ B;  4JRF A;  1MWR A;  3PCS A;  2D1W A;  2YFI B;  5IEP A;  1I2E A;  2E2V A;  3FG1 A;  1FUS A;  1K41 A;  1LNI A;  1O7W B;  2KAA A;  2ZA4 A;  1I0V A;  1T5Y A;  1DMN A;  2Z7A A;  1T2H A;  2W0Q A;  2GEY A;  3LZA A;  3GRD A;  4RNY A;  4AKY A;  1GOY A;  3DGL A;  3SX1 A;  3VF1 A;  1VQ7 3;  3B8L A;  2BU4 A;  2K3D A;  3M8C A;  3G8Z A;  4WFO A;  3FH1 A;  3KSP A;  3LTD A;  2ZL8 A;  2IY2 A;  1BNI A;  4IIA A;  4MMY B;  4WYK B;  3A5E A;  1YIT 3;  5BU4 A;  3OWU A;  1OF5 A;  3URP A;  4AEQ A;  3G4S 3;  3G71 3;  1NO3 A;  3IJE B;  2Y74 A;  3HIG A;  1QVG 2;  1BRH A;  1K8A 4;  2CX0 A;  1BNG A;  1TFK A;  4HYZ A;  1IU7 A;  4HKV B;  3SXX A;  2KRT A;  1R4Y A;  2STD A;  3EBT A;  1OHP A;  1IK3 A;  1ZO2 A;  3DMC A;  3KE7 A;  3S27 A;  1B21 A;  1OGZ A;  3S67 A;  3KKG A;  1VQ6 3;  5AYR B;  1VQO 3;  2E2U A;  1CEW I;  4LMI A;  3B7C A;  1D6Y A;  1W6C A;  2FXT A;  1FGO A;  3EJV A;  3F7X A;  4HJL B;  4STD A;  1RHL A;  2AAD A;  2W04 A;  4PEJ A;  4JF8 A;  3ZG0 A;  1VQL 3;  3ER7 A;  1RCL A;  1DET A;  1LNH A;  3NUV A;  5GSP A;  4BTY A;  5IG5 A;  3OWY A;  1SIH A;  5I97 A;  2F98 A;  3T0U A;  2GXF A;  1US1 A;  1S5A A;  3MKI A;  3LYG A;  3H3H A;  1IV9 A;  1BSE A;  1RGC A;  1FYS A;  1HYF A;  3AHW A;  3DH2 A;  4HM6 B;  4K90 B;  2KCD A;  2MC8 A;  3CMA 3;  1ULJ B;  2W9Q A;  2WO0 A;  1BRK A;  2Q07 A;  1YHQ 3;  4HOH A;  3AMO B;  2RFR A;  3FKA A;  7RNT A;  1GMP A;  2CHC A;  4HM0 B;  5ELU A;  1MWT A;  1YI2 3;  1OGX A;  2FNQ A;  4O02 B;  3WA3 A;  1YJ9 3;  1BSC A;  1EQK A;  1YGW A;  4EXR A;  1M9G A;  3FLJ A;  2HMJ B;  1W2B 2;  1RGF A;  2GSP A;  4K1V A;  5CF1 A;  1A2V A; 
#chains in the Genus database with same CATH homology
 3FF2 A;  1EA2 A;  3F14 A;  7STD A;  3ECF A;  1PU4 A;  2Z76 A;  1OHS A;  3LXU X;  3OV4 A;  3VSY A;  4WWU C;  1A2K A;  2BNG A;  2O3O A;  2CWT A;  1QMA A;  4AKZ A;  2BO9 B;  3F9S A;  1M90 4;  3DXO A;  1OHO A;  1K28 A;  1AV4 A;  1CYV A;  4N6T A;  3V92 A;  3MG3 A;  1S72 3;  1F8N A;  4WYK A;  4N6U A;  1GD4 A;  2CWV A;  3PZW A;  3EC9 A;  3VGN A;  1FA3 A;  1JN5 B;  1NWW A;  3DGN A;  3K9M C;  4EV2 A;  1JNQ A;  1TUH A;  1JB5 A;  2GEX A;  2ZDJ A;  5D82 A;  1J2B A;  1WNH A;  4R9K A;  1MNL A;  2CH9 A;  2F99 A;  2O9U X;  5IG4 A;  1AR0 A;  3B4P A;  4KFF A;  3K0Z A;  5JPU A;  1TP6 A;  3CC4 3;  2Z6B A;  4GB5 A;  3T8U A;  2ML6 A;  3SVA A;  2XR8 B;  3F7S A;  1N8Q A;  3Q1C A;  3D9R A;  3FF0 A;  3EB8 A;  1MOL A;  2F86 B;  3DGM A;  4HZ9 B;  2LQV A;  4K61 A;  3G0K A;  3S29 A;  4XBT A;  3NBR A;  3JUN A;  3SOA A;  2QA4 3;  3LT8 A;  1ISK A;  3PS8 A;  1EKM A;  3AMO A;  1FGR A;  4HZB B;  3ALA A;  2P0M A;  4XM4 A;  1Q82 4;  3Q90 A;  2SBL A;  1VQM 3;  4R1K A;  2CG1 A;  3FZW A;  1N5P A;  1SQW A;  1N9E A;  3NXJ A;  2GBW B;  3FGY A;  3U97 A;  1OH0 A;  1W5Z A;  1W02 A;  3CCL 3;  2PNC A;  4LEH A;  1IQ8 A;  3NM7 A;  3CPW 2;  1GS3 A;  1RN7 A;  2WGO A;  4J9A A;  1VQP 3;  1ZX2 A;  4CDL A;  3CCU 3;  2Y73 A;  3MSO A;  1QAK A;  3G16 A;  2YFL B;  1M1K 4;  2GBX B;  2RSX A;  2W2C A;  4HM8 B;  5EQL A;  1VQ9 3;  1IVW A;  3HI7 A;  3V98 A;  5AYS C;  4HM3 B;  4L8P A;  4EC6 A;  2BT3 A;  4FCM A;  1ULI B;  3DM8 A;  2GU1 A;  5AII A;  4LSO A;  1KSI A;  1QAF A;  2B1X B;  4OVM A;  1LOX A;  4HM4 B;  1N5H A;  2XGN A;  3CCQ 3;  2IA7 A;  3EE1 A;  1AVL A;  3PXM A;  1Q42 A;  2A15 A;  3FSD A;  4O2H A;  1K9M 4;  1JN5 A;  3KFQ C;  1VZZ A;  4N6V 0;  4K1U A;  2P09 A;  3EN1 B;  3LML A;  3DUK A;  4FMD A;  4N6O B;  5AIF A;  1IDP A;  2JDI H;  4Q53 A;  5FW5 A;  2XFT A;  1QJG A;  3N8B A;  5LC6 A;  2HML B;  1GY6 A;  3RDE A;  4N6M A;  4MMZ B;  4J8T A;  1O7N B;  4O3V A;  3HZP A;  2OOV A;  3K63 A;  3BNB A;  5AEW B;  4KFE A;  5IW9 A;  2OQE C;  2CFL A;  3UNL A;  4GL6 A;  1VQ5 3;  5IER A;  3I56 3;  3S5C A;  1FUW A;  3QRD A;  1QAL A;  3FG4 A;  4H3U A;  3X40 A;  3MG1 A;  3PGB A;  2HMN B;  3NHX A;  1O7H B;  5FGO A;  3S28 A;  1NU3 A;  3UJM A;  3RGA A;  3BNE A;  3F8H A;  5IG0 A;  4BTW A;  2MF7 A;  1RJO A;  4I4K A;  1RRH A;  3I55 3;  3OW2 2;  3BNC A;  2HMK B;  4EBG A;  2INX A;  1WTH A;  5A0O B;  1NB3 I;  1U5O A;  2RGQ A;  3NX0 A;  4CCV A;  1L5G B;  4FMC A;  4R4K A;  3NM2 A;  4OK0 A;  1W2Z A;  2JQ5 A;  3BLZ A;  1OCV A;  4HM5 B;  3CCS 3;  2HMM B;  1V74 A;  3SOY A;  3CCM 3;  2HMO B;  3CCJ 3;  4XB5 A;  3MWZ A;  3OXA A;  3X3Y A;  1IV7 A;  1GYB A;  1YGE A;  3FCS B;  3N9H A;  4R80 A;  3LT9 A;  2P05 A;  5ELJ A;  1FGQ A;  5TGN A;  1AVK A;  2XH9 A;  3IMA B;  3LTB A;  2CFD A;  4EYC A;  4OUQ A;  5BVB A;  1JB2 A;  4MMX B;  5CF2 A;  2OWP A;  3GZB A;  2D42 A;  2IUJ A;  1Z1S A;  3PCR A;  3NBJ A;  1Q7Y 4;  3EBY A;  3EN8 A;  3JUM A;  3O8Y A;  3LH4 A;  2OTL 3;  1NDO B;  2ML5 A;  4TX4 A;  1W2B 2;  1TFO A;  3LTA A;  1O7P B;  2CKF B;  3H51 A;  4HBR A;  3QK9 A;  1WQL B;  2P38 A;  3OX9 A;  2XSO B;  3IPT A;  1K73 4;  1W6Y A;  4FCZ A;  3WOF B;  1KC8 4;  1IQY A;  1W7C A;  3X41 A;  1STD A;  2XFS A;  2KXG A;  3CNM A;  3WA2 X;  3EQQ B;  4R9L A;  2M7O A;  2RCD A;  3BB9 A;  1SJW A;  2XF3 A;  2IUK A;  3B4O A;  3WOD G;  5AI1 A;  5HGR A;  4RZM A;  1Y4K A;  3CME 3;  4N3V A;  3UB1 A;  5AEU B;  1RRL A;  5IG3 A;  1Q40 B;  2W56 B;  4L8O A;  4XDW A;  4NHF A;  3HX8 A;  4N6L A;  1GD3 A;  4QWT A;  4RNZ A;  3CU3 A;  4FCJ A;  1IT8 A;  3BND A;  1WMP A;  3JUO A;  2UX0 A;  3G6E 3;  4O8S A;  2XSH B;  5D81 A;  1ASK A;  3I0Y A;  4L7K A;  2WOH A;  1BUQ A;  3CPO A;  3FG3 A;  5KP1 A;  5G2G A;  3X42 A;  1W6G A;  3DY5 A;  3WMD A;  1E97 A;  3PYJ A;  1WMN A;  2CFW A;  3MHE A;  3SED A;  3L0R A;  3JUQ A;  1W01 A;  1KD1 4;  3EX9 A;  3CC7 3;  2K54 A;  1LVN A;  2CFG A;  3KSE D;  1JKG B;  1C7H A;  1IVU A;  3JUP A;  3V99 A;  3CXC 2;  4FMA A;  2QEX 3;  5STD A;  1O7M B;  4LZI A;  4MEI A;  3CNX A;  4XDV A;  3CC2 3;  2IMJ A;  3GZR A;  3KN4 A;  1UW1 A;  4EV5 A;  1PFP A;  1W00 A;  3GZY B;  3NV0 B;  1DMQ A;  2R4I A;  3DZL A;  1WMO A;  4N6N B;  2C10 A;  4ZM8 A;  1LXE A;  1CYU A;  3HK4 A;  5CXO A;  1O7G B;  1FGT A;  1STF I;  1D6U A;  1UI8 A;  3E99 A;  4FR9 A;  1N9J A;  2CFK A;  1IT7 A;  3NQY A;  4LGQ A;  5JPP A;  3Q2P A;  3KII A;  4HM2 B;  2P0X A;  3F8X A;  1RKY A;  2K0M A;  4RBN A;  1G96 A;  2CC3 A;  2OTJ 3;  4XBY A;  2W9P A;  5EVH A;  3HII A;  3GZX B;  1Q40 A;  1ROV A;  2W56 A;  5IEN A;  3JVC A;  1FGM A;  1R4C A;  1SPU A;  2B24 B;  1NB5 I;  1IVX A;  2V1L A;  3GWR A;  4KZ1 A;  2YX9 A;  3D3L A;  1UUW B;  3U1W A;  1IVV A;  1DYU A;  5KP3 A;  3CCR 3;  5DRE A;  1M1X B;  1ROA A;  1TIJ A;  2CIU A;  5BXQ A;  4MJD A;  1DVC A;  2XEP A;  1DVD A;  3KZT A;  1OPY A;  1EG9 B;  2Z77 A;  3MG2 A;  4FMB A;  4WP5 A;  3ROB A;  3F40 A;  2QIY A;  3OWS A;  1A90 A;  1JKG A;  3A76 A;  2XGL A;  1E3R A;  4IPB A;  5AIH A;  1VQK 3;  4HM7 B;  2WOF A;  1Q86 4;  4NRE A;  5EEO A;  4WHA A;  1GY5 A;  2CWU A;  4ORL A;  5IF6 A;  2LYX A;  3T8N A;  1OUN A;  5D83 A;  3CD6 3;  2I9W A;  3RGR A;  3CCV 3;  3DGO A;  3SLU A;  3UL5 A;  1SII A;  2CW9 A;  3MYT A;  1TU5 A;  3N54 B;  2QGU A;  4KFD A;  1DMM A;  1YJN 3;  1Q81 4;  2GU3 A;  3J7Y d;  2OCT A;  3LTC A;  2W6J H;  3NV0 A;  4G1M B;  3STD A;  4KVH A;  1HKX A;  3GAX A;  4H61 A;  1OF5 B;  1JB4 A;  1U8C B;  1N8R 4;  2CG0 A;  2BHM A;  4HM1 B;  2E2T A;  4X2H A;  1VQ4 3;  5CK6 A;  3TDG A;  1QVF 2;  1UUV B;  2C11 A;  6STD A;  1OAC A;  1YVB I;  2PZV A;  3MPH A;  5LC7 A;  5JBS A;  2OQE A;  3X3Z A;  2CK3 H;  3EHC A;  3CCE 3;  3UL6 A;  1W4N A;  1VQN 3;  1VQ8 3;  2BMQ B;  3LOY A;  1E3V A;  3WOE B;  4BTX A;  4XBX A;  5AIG A;  5KP4 A;  1A67 A;  4HVN A;  5IEO A;  1HU9 A;  5DRV A;  2FGT A;  2OOV C;  1NJI 4;  3K7C A;  2W03 A;  1KQS 2;  3WDG B;  1JJ2 2;  2BMO B;  1KWI A;  2XRX B;  3EF8 A;  5CLK A;  1D6Z A;  3NQZ A;  1IQX A;  2L4V A;  4U13 A;  1UI7 A;  3K5T A;  2BMR B;  2WGQ A;  1CQS A;  1YJW 3;  4IT7 A;  3NBB A;  8CHO A;  1YIJ 3;  3X3X A;  1JRQ A;  1GY7 A;  4X2O A;  1JV2 B;  2YFJ B;  4JRF A;  3PCS A;  2D1W A;  2YFI B;  5IEP A;  2E2V A;  3FG1 A;  1K41 A;  1O7W B;  1T5Y A;  1DMN A;  2Z7A A;  2W0Q A;  2GEY A;  3LZA A;  3GRD A;  4RNY A;  4AKY A;  3DGL A;  3SX1 A;  3VF1 A;  1VQ7 3;  3B8L A;  3M8C A;  4WFO A;  3G8Z A;  3FH1 A;  3KSP A;  3LTD A;  2ZL8 A;  4IIA A;  4MMY B;  4WYK B;  1YIT 3;  3OWU A;  1OF5 A;  4AEQ A;  3G4S 3;  3G71 3;  1NO3 A;  3IJE B;  2Y74 A;  3HIG A;  1QVG 2;  1K8A 4;  1TFK A;  4HYZ A;  1IU7 A;  4HKV B;  3SXX A;  2KRT A;  2STD A;  3EBT A;  1OHP A;  1IK3 A;  1ZO2 A;  3DMC A;  3KE7 A;  3S27 A;  1OGZ A;  3S67 A;  3KKG A;  1VQ6 3;  5AYR B;  1VQO 3;  2E2U A;  1CEW I;  4LMI A;  3B7C A;  1D6Y A;  1W6C A;  2FXT A;  1FGO A;  3EJV A;  3F7X A;  4HJL B;  4STD A;  1VQL 3;  2W04 A;  4PEJ A;  4JF8 A;  3ER7 A;  1LNH A;  3NUV A;  5IG5 A;  4BTY A;  3OWY A;  1SIH A;  5I97 A;  2F98 A;  3T0U A;  2GXF A;  1US1 A;  1S5A A;  3MKI A;  3LYG A;  3H3H A;  1IV9 A;  2MC8 A;  4HM6 B;  4K90 B;  2KCD A;  3CMA 3;  2W9Q A;  1ULJ B;  2WO0 A;  2Q07 A;  1YHQ 3;  3AMO B;  2RFR A;  3FKA A;  2CHC A;  4HM0 B;  5ELU A;  1YI2 3;  1OGX A;  2FNQ A;  4O02 B;  3WA3 A;  1YJ9 3;  1EQK A;  4EXR A;  1M9G A;  3FLJ A;  2HMJ B;  4K1V A;  5CF1 A;  1A2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...