1K9M4

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k9m400
3CC73 3CCV3 1Q864 1VQL3 3CCL3 1VQN3 1S723 2QEX3 1K734 1VQ83 3CCQ3 3I563 1W2B2 1K8A4 1KQS2 1VQK3 2OTL3 1YIJ3 2OTJ3 3CCM3 1VQM3 1YJW3 1YHQ3 1QVG2 1VQ53 3I553 3G4S3 1QVF2 1VQ63 2QA43 3OW22 3CPW2 1N8R4 3CD63 1Q824 1KC84 3CME3 3CCR3 1NJI4 1M904 3CC43 3G6E3 1K9M4 1VQ73 3CXC2 1Q7Y4 1YJ93 3CC23 1YJN3 1YI23 3CCE3 3CCS3 1M1K4 1VQ43 3CCU3 1Q814 1VQO3 3CCJ3 1VQP3 1YIT3 1KD14 3CMA3 3G713 1VQ93 1JJ22
chains in the Genus database with same CATH superfamily
1BAOA 3EBYA 3STDA 1K734 1GY5A 3I563 2P0MA 3KFQC 3PZWA 1D6ZA 5M19A 2I9WA 3PCSA 1WTHA 2LQVA 1QAFA 3BNEA 1I0VA 4L7KA 3HK4A 1BU4A 2UGIA 5AEUB 3MSOA 1AQZA 4ORLA 2W56B 4LEHA 1UCIA 2XR8B 4KFFA 1HZ1A 3DGOA 5ELUA 2W04A 2YX9A 1ROAA 1Y4KA 3F14A 1X1XA 1UCLA 1N9JA 2H0GA 3QK9A 4TX4A 3D4AA 1VQO3 2IMJA 4KT3B 3MG3A 1V58A 8CHOA 2CKFB 1YVSA 1RCLA 1IVXA 1MWRA 4GL6A 1JB5A 1SJWA 4EC6A 4FMBA 1FW7A 4U13A 1ZGXA 3S5CA 3T8UA 3MKIA 2CWUA 2XGNA 2J8XB 3OWYA 2W03A 5BVBA 1W5ZA 2P38A 3FSDA 1LVNA 2RGQA 4HZBB 3WODG 1X1UA 3NM2A 4MMXB 4GB5A 1BRGA 3S29A 3G0KA 1RGGA 4XDWA 2H0IA 5D81A 4I4KA 2JDIH 6STDA 1NB3I 3NXJA 1RGAA 1BNRA 1N5HA 1GOVA 4N6TA 3BNBA 2MC8A 3EHCA 4IIAA 5G2GA 3U97A 3ZG0A 4FCMA 1VQP3 1R4YA 3OV4A 5CK6A 4J8TA 1BRIA 5EQLA 1ULJB 3GZYB 3D3LA 4XDVA 2F56A 1QJGA 3NUVA 3NV0B 1S723 3F8XA 3KIIA 1U8CB 3EQQB 1RGHA 3MG2A 3JUNA 1IT7A 3VSYA 5IF6A 1FUSA 2Y74A 5TGNA 4CCVA 4HJLB 4KFDA 3B7CA 2D42A 2RBIA 1BNSA 2CH9A 4H3UA 3SVAA 1RN1A 1UUGB 3RGRA 4EXRA 3URPA 1BSCA 5KP1A 3UNLA 1LQMB 1JN5A 1GD3A 1JKGB 4CPKA 1TTOA 2R4IA 3BNCA 4G1MB 2C4BA 2QGUA 3H51A 1X1YA 2HOHA 1O7NB 3GWRA 3KSED 1TRQA 1LOYA 1RNTA 3CCL3 3RNTA 1BRHA 4HM2B 2MF7A 4HM7B 2HMJB 3F7SA 3FF0A 3N54B 2CK3H 8RNTA 2RCDA 1QVF2 1MWUA 2QA43 5D83A 3AHWA 4HAAA 1FGQA 2CHCA 2CWVA 1UDII 2BHMA 2LYXA 2WGOA 1B2ZA 1PYLA 1RLSA 2FXTA 2HMMB 6GSPA 1M904 3G16A 4XBTA 1K9M4 3JUMA 1B21A 1UI7A 4HYZA 3MG1A 1A2KA 5EVHA 3UB1A 4O02B 3X42A 2Z7AA 1JNQA 2XF3A 3CCS3 1BRKA 2KF4A 3K9MC 5HGRA 3VF1A 3CCU3 1MWTA 2INXA 4HM6B 4X2HA 3DMCA 4BIRA 5AIFA 4R9KA 2BIRA 1EUIC 1GS3A 5BU4A 3FLJA 1BNJA 1I3FA 5AYRB 1STFI 5LC6A 2D1WA 3HIIA 5CLKA 1B2SA 1O7HB 1OF5B 1STDA 3JVCA 1OHOA 3LOYA 2ML5A 1MGWA 2HMOB 4QWTA 3UJMA 4HBRA 1RGKA 1RRLA 1W6GA 3ALAA 3OWUA 3V98A 5IG3A 1HKXA 1GYBA 1KWIA 2YFLB 2YFIB 1OPYA 5JPPA 3KZTA 3OXAA 1S5AA 3K0ZA 1JBSA 1YGWA 3K5TA 3PS8A 3CME3 3T8NA 5BIRA 1UGIA 4WYKB 4HOHA 3G8ZA 3NM7A 3JUPA 1IVWA 3LZAA 1V57A 1W7CA 4HM1B 3WHOA 1JB2A 3AGNA 4J5GA 1VQ43 2XFSA 3X3ZA 3F7XA 2W0QA 2GEXA 1TRPA 2OQEA 4LYLB 4N6OB 4NHFA 1IQYA 5STDA 1US1A 2Y73A 4FMCA 5KP3A 1T3BA 1VQL3 2FGTA 2Z76A 2E2VA 1R4CA 1BIRA 5IW9A 1O7GB 1RJOA 3TDGA 5IG5A 5AEWB 3CCM3 1HU9A 3KCHA 7GSPA 1QVG2 3I553 1BRJA 3S27A 3KN4A 1JZDA 4WWUC 3CPOA 1W01A 2CX0A 1I0XA 3CC43 2GSPA 2GU1A 2V1LA 4R1KA 2K0MA 3A5EA 1ISKA 2K54A 3WOFB 3ECFA 3LTCA 4AEQA 3HIGA 1GY6A 3PCRA 5IENA 7RNTA 1QALA 3K63A 3S28A 1U5OA 3GZBA 1DETA 1Q7HA 1IDPA 4HM5B 4L8PA 1KD14 4LSOA 5IEOA 1B20A 1Q864 1VQN3 2KAAA 3X3XA 1K8A4 1W2B2 4LGQA 1OACA 1Q40B 1UW1A 2A15A 4HVNA 4HZ9B 3LYGA 3SYUA 3G4S3 1BNIA 2RNTA 4RNTA 5HOHA 1IVVA 1VZZA 1AVKA 1BSAA 1OGXA 5IG0A 1C54A 1W4NA 3HI7A 2Q07A 1JRQA 1RDSA 4FCJA 2HMKB 4X2OA 4BU4A 5CF1A 1GOYA 1G0TA 1E3RA 2STDA 1GD4A 2CFDA 2BT3A 2Z77A 1M9GA 1D6UA 2CW9A 3SOAA 1IK3A 3ZFZA 1YIT3 3FKAA 3IMAB 1MNLA 3E99A 3PGBA 3EC9A 3S67A 3M8CA 3WA3A 4AKZA 1X1WA 4XM4A 1IU7A 2CFKA 1OHPA 2OTL3 4O3VA 3DGLA 4BTWA 4KVHA 1RNBA 3UL6A 4PEJA 1VQ63 2IY2A 1W6CA 3GSPA 4JRFA 4RZMA 4R4KA 2O3OA 3U1WA 1IQXA 2CFLA 1I3IA 3AMOB 5AYSC 2SARA 3CXC2 3IJEB 1VQQA 1FGTA 3D5IA 4MJDA 4XB5A 4K90B 2XSHB 4EBGA 1G96A 1BSBA 2HMLB 3D5GA 1LXEA 2F5WA 2F99A 1JBTA 2W9PA 3MWZA 3N8BA 4OK0A 1EEJA 1RKYA 1V74A 4H61A 4N3VA 1PU4A 3MPHA 1RGLA 3QRDA 5KP4A 3Q1CA 3FH1A 1DE3A 1RHLA 1LQGC 1VQ93 3GAXA 1IVUA 2XGLA 1IV7A 2CWTA 4XBXA 2B1XB 1BUQA 1VQK3 2W56A 4R9LA 2ZHXB 4RNYA 2KXGA 3UL5A 2R41A 2BNGA 3F40A 4GSPA 1CH0A 1NO3A 3IPTA 3SXXA 3L0RA 9RNTA 1HYFA 1RN4A 1W00A 3AHSA 2C10A 1CQSA 1T2HA 1RSNA 1SIHA 4OVMA 4RBNA 1RCKA 3OX9A 4FR9A 1TIJA 1YVBI 1NDOB 2GXFA 4HM3B 2BMRB 2OOVC 1UI8A 1SARA 1I2EA 2CX1A 1Z1SA 2GEYA 2Z6BA 3DXOA 3X41A 4EV5A 3MYTA 1BVIA 2E2TA 2WOFA 1DMQA 4WHAA 2ZDJA 3HOHA 1I2FA 3OWSA 5AIGA 1VQM3 1YHQ3 4IPBA 1B2MA 1N8R4 4LMIA 3LT9A 3CPW2 3FG1A 2WO0A 2CFGA 3DGYA 4MEIA 4AKYA 2SBLA 3FGYA 4OUQA 3NBJA 3ZG5A 2W2CA 5IERA 3BNDA 1BNGA 5RNTA 3LTBA 3Q2PA 1YJ93 1WMPA 2W9QA 1OGZA 1W6YA 5G1KA 1M1K4 1BUJA 4EW5A 1MGRA 3NV0A 2BO9B 1Q814 3FZWA 4KZ1A 4J9AA 2O9UX 4HM8B 4FCZA 3V99A 1K28A 3EX9A 1UUVB 4O2HA 1WQLB 4K1UA 1K41A 4DKIA 2XFTA 3EN1B 1ZO2A 1PY3A 2UX0A 3SX1A 1WMOA 1KQS2 2BMQB 1YIJ3 1TU5A 1EA2A 2PNCA 1YJW3 1CEWI 4BL3A 6RNTA 1DVDA 1JKGA 3DH2A 3GZRA 4Q53A 1BGSA 1OUNA 2CIUA 2P0XA 1ROVA 2ZA4A 3EBTA 3F8HA 5EEOA 5I97A 1OHSA 1AR0A 4N6NB 3FG4A 4MMZB 2IYJA 3X3YA 1Q42A 1T5YA 1TJDA 4J5KA 3H3HA 1FGRA 3N9HA 1BNFA 5AI1A 5LC7A 3CD63 1RGFA 2IA7A 3LH4A 1BOXA 2ZL8A 3J7Yd 1RGCA 2WGQA 1JN5B 1SIIA 2KF3A 3CC73 1QAKA 1OCVA 1G02A 1E97A 5M18A 1MOLA 1TUHA 3B4OA 3FG3A 2E2UA 4BL2A 1YGEA 1JV2B 3BLZA 1LOXA 1A67A 1CYVA 1LRAA 2ML6A 2XSOB 3FF2A 3NQYA 1PFPA 3GZXB 2IUJA 5AIHA 1NU3A 1SQWA 1DYUA 2AADA 3DGNA 1MWSA 3RGAA 1EQKA 1GMRA 5DREA 2RSXA 2F5MA 3Q90A 1OF5A 2W6JH 1RRHA 2CFWA 1T2IA 1BSDA 3LT8A 3CCJ3 2F86B 2M7OA 3GRDA 4XBYA 3EF8A 3G713 3BIRA 1JJ22 1A90A 1LNIA 1RTUA 3NBBA 3KE7A 4CDLA 5IG4A 1M1XB 3KKGA 1O7MB 3O8YA 4WYKA 5D82A 4EV2A 4K61A 2OCTA 1B3SA 1LNHA 1ZX2A 2OWPA 1BRNL 1VQ53 5JPUA 1LOWA 1UCJA 1D6YA 1NNVA 2P05A 1WNHA 1ULIB 3DY5A 1VQ83 1Q824 5A0OB 5BXQA 3CCR3 1RMSA 1RGEA 3BB9A 1BNEA 1I2GA 4BTXA 1FGOA 4RNZA 4WFOA 5AIIA 2L4VA 1DVCA 2F98A 1JB4A 2XH9A 2YFJB 1IT8A 1YI23 3CCE3 2QIYA 3LTAA 4L8OA 2CG1A 2KF6A 4STDA 3CU3A 1BRSA 2AAEA 4O8SA 1GMQA 3DGMA 2K3DA 1B2UA 1UGHI 1B27A 3T0UA 2IUKA 1DMMA 1GSPA 1I8VA 3A76A 3Q3FA 3SLUA 2RFRA 2WOHA 1UUWB 3BU4A 1Q9EA 3CCQ3 1NB5I 1W2ZA 1WMNA 3ROBA 4N6LA 1FGMA 4R80A 1JBRA 2CC3A 1IYYA 3EN8A 3WA2X 2B24B 3OW22 1FYSA 4GHOA 3X40A 1B2XA 2PZVA 1AV4A 1N5PA 1VQ73 5JBSA 2XEPA 1RN7A 1Q7Y4 3FCSB 3NQZA 1A2VA 1N9EA 1EG9B 1ASKA 2BMOB 2KCDA 3NBRA 3NX0A 4HM0B 3EB8A 1UCKA 3EE1A 2L1SA 3V92A 3RDEA 1YJN3 2P09A 1O7WB 3VGNA 3SOYA 2FNQA 3WR2A 5G1LA 3B8LA 4LZIA 1SPUA 3DM8A 1Q40A 3WDGB 1GMPA 2GU3A 3CNXA 4HM4B 1FA3A 2HMNB 3CCV3 3EJVA 5GSPA 5FGOA 4IT7A 5DRVA 4EYCA 4N6V0 3CNMA 2OTJ3 1YNVX 3KSPA 5M1AA 3HX8A 3SEDA 3LMLA 1BANA 1JZOA 3LXUX 4HKVB 4I5QA 4CJNA 1AVLA 4JF8A 1O7PB 3DZLA 1OH0A 1IV9A 1KC84 4MMYB 3DUKA 2GBWB 1NWWA 2C11A 1IQ8A 1AY7A 4FMDA 2H0HA 2F4YA 3K7CA 7STDA 5ELJA 2CG0A 3D9RA 3JUQA 2OOVA 1TFKA 5CF2A 5IEPA 1TP6A 1LOVA 1L5GB 3ER7A 2OQEC 3B4PA 4NPBA 3HZPA 2KF5A 1N8QA 2BU4A 4BTYA 4NREA 4WP5A 2QEX3 3AMOA 1FZUA 4ZM8A 3WMDA 1QMAA 2GBXB 1TFOA 2UUGC 1E3VA 1F8NA 4FMAA 4N6MA 1W02A 3NHXA 4KFEA 1GOUA 5FW5A 1NJI4 3AGOA 1FUTA 3G6E3 1J2BA 3MHEA 3WOEB 3PXMA 1I70A 3F9SA 3PYJA 3LTDA 2XRXB 3I0YA 3CC23 5CXOA 1BSEA 1GY7A 1A2PA 1CYUA 1ZS7A 1C7HA 4ILFA 1EKMA 2JQ5A 3JUOA 4K1VA 1DMNA 1FUWA 1KSIA 2KRTA 3CMA3 3D79A 4N6UA
chains in the Genus database with same CATH topology
3EBYA 3STDA 1K734 1GY5A 3I563 2P0MA 3KFQC 3PZWA 1D6ZA 2I9WA 3PCSA 1WTHA 2LQVA 1QAFA 3BNEA 4L7KA 3HK4A 5AEUB 3MSOA 4ORLA 2W56B 4LEHA 2XR8B 4KFFA 3DGOA 5ELUA 2W04A 2YX9A 1ROAA 1Y4KA 3F14A 1N9JA 3QK9A 4TX4A 1VQO3 2IMJA 3MG3A 8CHOA 2CKFB 1IVXA 4GL6A 1JB5A 1SJWA 4EC6A 4FMBA 4U13A 3S5CA 3T8UA 3MKIA 2CWUA 2XGNA 3OWYA 2W03A 5BVBA 1W5ZA 2P38A 3FSDA 1LVNA 2RGQA 4HZBB 3WODG 3NM2A 4MMXB 4GB5A 3S29A 3G0KA 4XDWA 5D81A 4I4KA 2JDIH 6STDA 1NB3I 3NXJA 1N5HA 4N6TA 3BNBA 2MC8A 3EHCA 4IIAA 5G2GA 3U97A 4FCMA 1VQP3 3OV4A 5CK6A 4J8TA 5EQLA 1ULJB 3GZYB 3D3LA 4XDVA 1QJGA 3NUVA 3NV0B 1S723 3F8XA 3KIIA 1U8CB 3EQQB 3MG2A 3JUNA 1IT7A 3VSYA 5IF6A 2Y74A 5TGNA 4CCVA 4HJLB 4KFDA 3B7CA 2D42A 2CH9A 4H3UA 3SVAA 3RGRA 4EXRA 5KP1A 3UNLA 1JN5A 1GD3A 1JKGB 3BNCA 2R4IA 4G1MB 2QGUA 3H51A 1O7NB 3GWRA 3KSED 3CCL3 4HM2B 2MF7A 4HM7B 2HMJB 3F7SA 3FF0A 3N54B 2CK3H 1QVF2 2RCDA 2QA43 5D83A 5LC7A 3CD63 2WO0A 1FGQA 2CHCA 2CWVA 2LYXA 2BHMA 2WGOA 2HMMB 2FXTA 1M904 3G16A 4XBTA 1K9M4 3JUMA 1UI7A 4HYZA 3MG1A 1A2KA 5EVHA 3UB1A 4O02B 3X42A 2Z7AA 1JNQA 2XF3A 3CCS3 3K9MC 5HGRA 3VF1A 3CCU3 2INXA 4HM6B 4X2HA 3DMCA 5AIFA 4R9KA 1GS3A 3FLJA 5AYRB 1STFI 5LC6A 2D1WA 3HIIA 5CLKA 1O7HB 1OF5B 1STDA 3JVCA 1OHOA 3LOYA 2ML5A 2HMOB 4QWTA 3UJMA 4HBRA 1RRLA 1W6GA 3ALAA 3OWUA 3V98A 5IG3A 1HKXA 1GYBA 1KWIA 2YFLB 2YFIB 1OPYA 5JPPA 3KZTA 3OXAA 1S5AA 3K0ZA 3K5TA 3PS8A 3CME3 3T8NA 4WYKB 3G8ZA 3NM7A 3JUPA 1IVWA 3LZAA 1W7CA 4HM1B 1VQ43 1JB2A 2XFSA 3X3ZA 3F7XA 2W0QA 2GEXA 2OQEA 4N6OB 4NHFA 1IQYA 5STDA 1US1A 2Y73A 4FMCA 5KP3A 1VQL3 2FGTA 2Z76A 2E2VA 1R4CA 5IW9A 1O7GB 1RJOA 3TDGA 5IG5A 5AEWB 3CCM3 1HU9A 1QVG2 3I553 3S27A 3KN4A 4WWUC 3CPOA 1W01A 3CC43 2GU1A 2V1LA 4R1KA 2K0MA 1ISKA 2K54A 3WOFB 3ECFA 3LTCA 4AEQA 3HIGA 1GY6A 3PCRA 5IENA 1QALA 3K63A 3S28A 1U5OA 3GZBA 1IDPA 4HM5B 4L8PA 1KD14 4LSOA 5IEOA 1Q864 1VQN3 3X3XA 1K8A4 1W2B2 4LGQA 1OACA 1Q40B 1UW1A 2A15A 4HVNA 4HZ9B 3LYGA 3G4S3 1IVVA 1VZZA 1AVKA 1OGXA 5IG0A 1W4NA 3HI7A 2Q07A 1JRQA 4X2OA 4FCJA 2HMKB 5CF1A 1E3RA 2STDA 1GD4A 2CFDA 2Z77A 2BT3A 1M9GA 1D6UA 2CW9A 3SOAA 1IK3A 1YIT3 3FKAA 3IMAB 1MNLA 3E99A 3PGBA 3EC9A 3S67A 3M8CA 3WA3A 4AKZA 4XM4A 1IU7A 2CFKA 1OHPA 2OTL3 4O3VA 3DGLA 4BTWA 4KVHA 3UL6A 4PEJA 1VQ63 1W6CA 4JRFA 4RZMA 4R4KA 2O3OA 3U1WA 1IQXA 2CFLA 3AMOB 5AYSC 3CXC2 3IJEB 4MJDA 1FGTA 4XB5A 4K90B 2XSHB 4EBGA 1G96A 2HMLB 1LXEA 2F99A 2W9PA 3MWZA 3N8BA 4OK0A 1RKYA 1V74A 4H61A 4N3VA 1PU4A 3MPHA 3QRDA 5KP4A 3Q1CA 3FH1A 1VQ93 3GAXA 1IVUA 2XGLA 1IV7A 2CWTA 4XBXA 2B1XB 1BUQA 1VQK3 2W56A 4R9LA 4RNYA 2KXGA 3UL5A 2BNGA 3F40A 1NO3A 3IPTA 3SXXA 3L0RA 1W00A 2C10A 1CQSA 1SIHA 4OVMA 4RBNA 3OX9A 4FR9A 1TIJA 1YVBI 1NDOB 2GXFA 4HM3B 2BMRB 2OOVC 1UI8A 3DXOA 2GEYA 1Z1SA 3X41A 2Z6BA 4EV5A 3MYTA 2E2TA 2WOFA 1DMQA 4WHAA 2ZDJA 3OWSA 5AIGA 1VQM3 1YHQ3 4IPBA 1N8R4 4LMIA 3LT9A 3CPW2 3FG1A 2CFGA 4MEIA 4AKYA 2SBLA 3FGYA 4OUQA 3NBJA 2W2CA 5IERA 3BNDA 3LTBA 3Q2PA 1YJ93 1WMPA 2W9QA 1OGZA 1W6YA 1M1K4 3NV0A 2BO9B 1Q814 3FZWA 4KZ1A 4J9AA 2O9UX 4HM8B 4FCZA 1K28A 3EX9A 1UUVB 4O2HA 1WQLB 4K1UA 1K41A 2XFTA 3EN1B 1ZO2A 2UX0A 3SX1A 1WMOA 1KQS2 2BMQB 1YIJ3 1TU5A 1EA2A 2PNCA 1YJW3 1CEWI 1DVDA 1JKGA 3GZRA 4Q53A 2CIUA 1OUNA 2P0XA 1ROVA 3EBTA 3F8HA 5I97A 5EEOA 1OHSA 1AR0A 4N6NB 3FG4A 4MMZB 3X3YA 1Q42A 1T5YA 3H3HA 1FGRA 3N9HA 5AI1A 2IA7A 3LH4A 2ZL8A 3J7Yd 2WGQA 1JN5B 1SIIA 3CC73 1QAKA 1OCVA 1E97A 1MOLA 1TUHA 3B4OA 3FG3A 2E2UA 1YGEA 1JV2B 3BLZA 1LOXA 1A67A 1CYVA 2XSOB 2ML6A 3FF2A 3NQYA 1PFPA 3GZXB 2IUJA 5AIHA 1NU3A 1SQWA 1DYUA 3DGNA 3RGAA 1EQKA 5DREA 2RSXA 3Q90A 1OF5A 2W6JH 1RRHA 2CFWA 3LT8A 3CCJ3 2F86B 2M7OA 3GRDA 4XBYA 3EF8A 3G713 1JJ22 1A90A 3NBBA 3KE7A 4CDLA 5IG4A 1M1XB 3KKGA 1O7MB 3O8YA 4WYKA 5D82A 4EV2A 4K61A 2OCTA 1LNHA 1ZX2A 2OWPA 1VQ53 5JPUA 1D6YA 2P05A 1WNHA 1ULIB 3DY5A 1VQ83 1Q824 5A0OB 5BXQA 3CCR3 3BB9A 4BTXA 1FGOA 4RNZA 4WFOA 5AIIA 2L4VA 1DVCA 2F98A 1JB4A 2YFJB 2XH9A 1IT8A 1YI23 3CCE3 2QIYA 3LTAA 4L8OA 2CG1A 4STDA 3CU3A 4O8SA 3DGMA 3T0UA 2IUKA 1DMMA 3A76A 3SLUA 2RFRA 2WOHA 1UUWB 3CCQ3 1NB5I 1W2ZA 1WMNA 3ROBA 4N6LA 1FGMA 4R80A 2CC3A 3EN8A 3WA2X 2B24B 3OW22 3X40A 2PZVA 1AV4A 1N5PA 1VQ73 5JBSA 2XEPA 1RN7A 1Q7Y4 3FCSB 3NQZA 1A2VA 1N9EA 1EG9B 1ASKA 2BMOB 2KCDA 3NBRA 3NX0A 4HM0B 3EB8A 3EE1A 3V92A 1YJN3 3RDEA 2P09A 1O7WB 3VGNA 3SOYA 2FNQA 3B8LA 4LZIA 1SPUA 3DM8A 1Q40A 3WDGB 2GU3A 3CNXA 4HM4B 1FA3A 2HMNB 3CCV3 3EJVA 5FGOA 4IT7A 5DRVA 4EYCA 4N6V0 3CNMA 2OTJ3 3KSPA 3HX8A 3SEDA 3LMLA 3LXUX 4HKVB 1AVLA 4JF8A 1O7PB 3DZLA 1OH0A 1IV9A 1KC84 4MMYB 3DUKA 2GBWB 1NWWA 2C11A 1IQ8A 4FMDA 3K7CA 7STDA 5ELJA 2CG0A 3D9RA 3JUQA 2OOVA 1TFKA 5CF2A 5IEPA 1TP6A 1L5GB 3ER7A 2OQEC 3B4PA 3HZPA 1N8QA 4BTYA 4NREA 4WP5A 2QEX3 3AMOA 4ZM8A 3WMDA 1QMAA 2GBXB 1TFOA 1E3VA 1F8NA 4FMAA 4N6MA 1W02A 3NHXA 4KFEA 5FW5A 1NJI4 3G6E3 1J2BA 3MHEA 3WOEB 3PXMA 3F9SA 3PYJA 3LTDA 2XRXB 3I0YA 3CC23 5CXOA 1GY7A 1CYUA 1C7HA 1EKMA 2JQ5A 3JUOA 4K1VA 1DMNA 1FUWA 1KSIA 2KRTA 3CMA3 3V99A 4N6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 3;  3CCV 3;  1Q86 4;  1VQL 3;  3CCL 3;  1VQN 3;  1S72 3;  2QEX 3;  1K73 4;  1VQ8 3;  3CCQ 3;  3I56 3;  1W2B 2;  1K8A 4;  1KQS 2;  1VQK 3;  2OTL 3;  1YIJ 3;  2OTJ 3;  3CCM 3;  1VQM 3;  1YJW 3;  1YHQ 3;  1QVG 2;  1VQ5 3;  3I55 3;  3G4S 3;  1QVF 2;  1VQ6 3;  2QA4 3;  3OW2 2;  3CPW 2;  1N8R 4;  3CD6 3;  1Q82 4;  1KC8 4;  3CME 3;  3CCR 3;  1NJI 4;  1M90 4;  3CC4 3;  3G6E 3;  1K9M 4;  1VQ7 3;  3CXC 2;  1Q7Y 4;  1YJ9 3;  3CC2 3;  1YJN 3;  1YI2 3;  3CCE 3;  3CCS 3;  1M1K 4;  1VQ4 3;  3CCU 3;  1Q81 4;  1VQO 3;  3CCJ 3;  1VQP 3;  1YIT 3;  1KD1 4;  3CMA 3;  3G71 3;  1VQ9 3;  1JJ2 2; 
#chains in the Genus database with same CATH topology
 1BAO A;  3EBY A;  3STD A;  1K73 4;  1GY5 A;  3I56 3;  2P0M A;  3KFQ C;  3PZW A;  1D6Z A;  5M19 A;  2I9W A;  3PCS A;  1WTH A;  2LQV A;  1QAF A;  3BNE A;  1I0V A;  4L7K A;  3HK4 A;  1BU4 A;  2UGI A;  5AEU B;  3MSO A;  1AQZ A;  4ORL A;  2W56 B;  4LEH A;  1UCI A;  2XR8 B;  4KFF A;  1HZ1 A;  3DGO A;  5ELU A;  2W04 A;  2YX9 A;  1ROA A;  1Y4K A;  3F14 A;  1X1X A;  1UCL A;  1N9J A;  2H0G A;  3QK9 A;  4TX4 A;  3D4A A;  1VQO 3;  2IMJ A;  4KT3 B;  3MG3 A;  1V58 A;  8CHO A;  2CKF B;  1YVS A;  1RCL A;  1IVX A;  1MWR A;  4GL6 A;  1JB5 A;  1SJW A;  4EC6 A;  4FMB A;  1FW7 A;  4U13 A;  1ZGX A;  3S5C A;  3T8U A;  3MKI A;  2CWU A;  2XGN A;  2J8X B;  3OWY A;  2W03 A;  5BVB A;  1W5Z A;  2P38 A;  3FSD A;  1LVN A;  2RGQ A;  4HZB B;  3WOD G;  1X1U A;  3NM2 A;  4MMX B;  4GB5 A;  1BRG A;  3S29 A;  3G0K A;  1RGG A;  4XDW A;  2H0I A;  5D81 A;  4I4K A;  2JDI H;  6STD A;  1NB3 I;  3NXJ A;  1RGA A;  1BNR A;  1N5H A;  1GOV A;  4N6T A;  3BNB A;  2MC8 A;  3EHC A;  4IIA A;  5G2G A;  3U97 A;  3ZG0 A;  4FCM A;  1VQP 3;  1R4Y A;  3OV4 A;  5CK6 A;  4J8T A;  1BRI A;  5EQL A;  1ULJ B;  3GZY B;  3D3L A;  4XDV A;  2F56 A;  1QJG A;  3NUV A;  3NV0 B;  1S72 3;  3F8X A;  3KII A;  1U8C B;  3EQQ B;  1RGH A;  3MG2 A;  3JUN A;  1IT7 A;  3VSY A;  5IF6 A;  1FUS A;  2Y74 A;  5TGN A;  4CCV A;  4HJL B;  4KFD A;  3B7C A;  2D42 A;  2RBI A;  1BNS A;  2CH9 A;  4H3U A;  3SVA A;  1RN1 A;  1UUG B;  3RGR A;  4EXR A;  3URP A;  1BSC A;  5KP1 A;  3UNL A;  1LQM B;  1JN5 A;  1GD3 A;  1JKG B;  4CPK A;  1TTO A;  2R4I A;  3BNC A;  4G1M B;  2C4B A;  2QGU A;  3H51 A;  1X1Y A;  2HOH A;  1O7N B;  3GWR A;  3KSE D;  1TRQ A;  1LOY A;  1RNT A;  3CCL 3;  3RNT A;  1BRH A;  4HM2 B;  2MF7 A;  4HM7 B;  2HMJ B;  3F7S A;  3FF0 A;  3N54 B;  2CK3 H;  8RNT A;  2RCD A;  1QVF 2;  1MWU A;  2QA4 3;  5D83 A;  3AHW A;  4HAA A;  1FGQ A;  2CHC A;  2CWV A;  1UDI I;  2BHM A;  2LYX A;  2WGO A;  1B2Z A;  1PYL A;  1RLS A;  2FXT A;  2HMM B;  6GSP A;  1M90 4;  3G16 A;  4XBT A;  1K9M 4;  3JUM A;  1B21 A;  1UI7 A;  4HYZ A;  3MG1 A;  1A2K A;  5EVH A;  3UB1 A;  4O02 B;  3X42 A;  2Z7A A;  1JNQ A;  2XF3 A;  3CCS 3;  1BRK A;  2KF4 A;  3K9M C;  5HGR A;  3VF1 A;  3CCU 3;  1MWT A;  2INX A;  4HM6 B;  4X2H A;  3DMC A;  4BIR A;  5AIF A;  4R9K A;  2BIR A;  1EUI C;  1GS3 A;  5BU4 A;  3FLJ A;  1BNJ A;  1I3F A;  5AYR B;  1STF I;  5LC6 A;  2D1W A;  3HII A;  5CLK A;  1B2S A;  1O7H B;  1OF5 B;  1STD A;  3JVC A;  1OHO A;  3LOY A;  2ML5 A;  1MGW A;  2HMO B;  4QWT A;  3UJM A;  4HBR A;  1RGK A;  1RRL A;  1W6G A;  3ALA A;  3OWU A;  3V98 A;  5IG3 A;  1HKX A;  1GYB A;  1KWI A;  2YFL B;  2YFI B;  1OPY A;  5JPP A;  3KZT A;  3OXA A;  1S5A A;  3K0Z A;  1JBS A;  1YGW A;  3K5T A;  3PS8 A;  3CME 3;  3T8N A;  5BIR A;  1UGI A;  4WYK B;  4HOH A;  3G8Z A;  3NM7 A;  3JUP A;  1IVW A;  3LZA A;  1V57 A;  1W7C A;  4HM1 B;  3WHO A;  1JB2 A;  3AGN A;  4J5G A;  1VQ4 3;  2XFS A;  3X3Z A;  3F7X A;  2W0Q A;  2GEX A;  1TRP A;  2OQE A;  4LYL B;  4N6O B;  4NHF A;  1IQY A;  5STD A;  1US1 A;  2Y73 A;  4FMC A;  5KP3 A;  1T3B A;  1VQL 3;  2FGT A;  2Z76 A;  2E2V A;  1R4C A;  1BIR A;  5IW9 A;  1O7G B;  1RJO A;  3TDG A;  5IG5 A;  5AEW B;  3CCM 3;  1HU9 A;  3KCH A;  7GSP A;  1QVG 2;  3I55 3;  1BRJ A;  3S27 A;  3KN4 A;  1JZD A;  4WWU C;  3CPO A;  1W01 A;  2CX0 A;  1I0X A;  3CC4 3;  2GSP A;  2GU1 A;  2V1L A;  4R1K A;  2K0M A;  3A5E A;  1ISK A;  2K54 A;  3WOF B;  3ECF A;  3LTC A;  4AEQ A;  3HIG A;  1GY6 A;  3PCR A;  5IEN A;  7RNT A;  1QAL A;  3K63 A;  3S28 A;  1U5O A;  3GZB A;  1DET A;  1Q7H A;  1IDP A;  4HM5 B;  4L8P A;  1KD1 4;  4LSO A;  5IEO A;  1B20 A;  1Q86 4;  1VQN 3;  2KAA A;  3X3X A;  1K8A 4;  1W2B 2;  4LGQ A;  1OAC A;  1Q40 B;  1UW1 A;  2A15 A;  4HVN A;  4HZ9 B;  3LYG A;  3SYU A;  3G4S 3;  1BNI A;  2RNT A;  4RNT A;  5HOH A;  1IVV A;  1VZZ A;  1AVK A;  1BSA A;  1OGX A;  5IG0 A;  1C54 A;  1W4N A;  3HI7 A;  2Q07 A;  1JRQ A;  1RDS A;  4FCJ A;  2HMK B;  4X2O A;  4BU4 A;  5CF1 A;  1GOY A;  1G0T A;  1E3R A;  2STD A;  1GD4 A;  2CFD A;  2BT3 A;  2Z77 A;  1M9G A;  1D6U A;  2CW9 A;  3SOA A;  1IK3 A;  3ZFZ A;  1YIT 3;  3FKA A;  3IMA B;  1MNL A;  3E99 A;  3PGB A;  3EC9 A;  3S67 A;  3M8C A;  3WA3 A;  4AKZ A;  1X1W A;  4XM4 A;  1IU7 A;  2CFK A;  1OHP A;  2OTL 3;  4O3V A;  3DGL A;  4BTW A;  4KVH A;  1RNB A;  3UL6 A;  4PEJ A;  1VQ6 3;  2IY2 A;  1W6C A;  3GSP A;  4JRF A;  4RZM A;  4R4K A;  2O3O A;  3U1W A;  1IQX A;  2CFL A;  1I3I A;  3AMO B;  5AYS C;  2SAR A;  3CXC 2;  3IJE B;  1VQQ A;  1FGT A;  3D5I A;  4MJD A;  4XB5 A;  4K90 B;  2XSH B;  4EBG A;  1G96 A;  1BSB A;  2HML B;  3D5G A;  1LXE A;  2F5W A;  2F99 A;  1JBT A;  2W9P A;  3MWZ A;  3N8B A;  4OK0 A;  1EEJ A;  1RKY A;  1V74 A;  4H61 A;  4N3V A;  1PU4 A;  3MPH A;  1RGL A;  3QRD A;  5KP4 A;  3Q1C A;  3FH1 A;  1DE3 A;  1RHL A;  1LQG C;  1VQ9 3;  3GAX A;  1IVU A;  2XGL A;  1IV7 A;  2CWT A;  4XBX A;  2B1X B;  1BUQ A;  1VQK 3;  2W56 A;  4R9L A;  2ZHX B;  4RNY A;  2KXG A;  3UL5 A;  2R41 A;  2BNG A;  3F40 A;  4GSP A;  1CH0 A;  1NO3 A;  3IPT A;  3SXX A;  3L0R A;  9RNT A;  1HYF A;  1RN4 A;  1W00 A;  3AHS A;  2C10 A;  1CQS A;  1T2H A;  1RSN A;  1SIH A;  4OVM A;  4RBN A;  1RCK A;  3OX9 A;  4FR9 A;  1TIJ A;  1YVB I;  1NDO B;  2GXF A;  4HM3 B;  2BMR B;  2OOV C;  1UI8 A;  1SAR A;  1I2E A;  2CX1 A;  1Z1S A;  2GEY A;  2Z6B A;  3DXO A;  3X41 A;  4EV5 A;  3MYT A;  1BVI A;  2E2T A;  2WOF A;  1DMQ A;  4WHA A;  2ZDJ A;  3HOH A;  1I2F A;  3OWS A;  5AIG A;  1VQM 3;  1YHQ 3;  4IPB A;  1B2M A;  1N8R 4;  4LMI A;  3LT9 A;  3CPW 2;  3FG1 A;  2WO0 A;  2CFG A;  3DGY A;  4MEI A;  4AKY A;  2SBL A;  3FGY A;  4OUQ A;  3NBJ A;  3ZG5 A;  2W2C A;  5IER A;  3BND A;  1BNG A;  5RNT A;  3LTB A;  3Q2P A;  1YJ9 3;  1WMP A;  2W9Q A;  1OGZ A;  1W6Y A;  5G1K A;  1M1K 4;  1BUJ A;  4EW5 A;  1MGR A;  3NV0 A;  2BO9 B;  1Q81 4;  3FZW A;  4KZ1 A;  4J9A A;  2O9U X;  4HM8 B;  4FCZ A;  3V99 A;  1K28 A;  3EX9 A;  1UUV B;  4O2H A;  1WQL B;  4K1U A;  1K41 A;  4DKI A;  2XFT A;  3EN1 B;  1ZO2 A;  1PY3 A;  2UX0 A;  3SX1 A;  1WMO A;  1KQS 2;  2BMQ B;  1YIJ 3;  1TU5 A;  1EA2 A;  2PNC A;  1YJW 3;  1CEW I;  4BL3 A;  6RNT A;  1DVD A;  1JKG A;  3DH2 A;  3GZR A;  4Q53 A;  1BGS A;  1OUN A;  2CIU A;  2P0X A;  1ROV A;  2ZA4 A;  3EBT A;  3F8H A;  5EEO A;  5I97 A;  1OHS A;  1AR0 A;  4N6N B;  3FG4 A;  4MMZ B;  2IYJ A;  3X3Y A;  1Q42 A;  1T5Y A;  1TJD A;  4J5K A;  3H3H A;  1FGR A;  3N9H A;  1BNF A;  5AI1 A;  5LC7 A;  3CD6 3;  1RGF A;  2IA7 A;  3LH4 A;  1BOX A;  2ZL8 A;  3J7Y d;  1RGC A;  2WGQ A;  1JN5 B;  1SII A;  2KF3 A;  3CC7 3;  1QAK A;  1OCV A;  1G02 A;  1E97 A;  5M18 A;  1MOL A;  1TUH A;  3B4O A;  3FG3 A;  2E2U A;  4BL2 A;  1YGE A;  1JV2 B;  3BLZ A;  1LOX A;  1A67 A;  1CYV A;  1LRA A;  2ML6 A;  2XSO B;  3FF2 A;  3NQY A;  1PFP A;  3GZX B;  2IUJ A;  5AIH A;  1NU3 A;  1SQW A;  1DYU A;  2AAD A;  3DGN A;  1MWS A;  3RGA A;  1EQK A;  1GMR A;  5DRE A;  2RSX A;  2F5M A;  3Q90 A;  1OF5 A;  2W6J H;  1RRH A;  2CFW A;  1T2I A;  1BSD A;  3LT8 A;  3CCJ 3;  2F86 B;  2M7O A;  3GRD A;  4XBY A;  3EF8 A;  3G71 3;  3BIR A;  1JJ2 2;  1A90 A;  1LNI A;  1RTU A;  3NBB A;  3KE7 A;  4CDL A;  5IG4 A;  1M1X B;  3KKG A;  1O7M B;  3O8Y A;  4WYK A;  5D82 A;  4EV2 A;  4K61 A;  2OCT A;  1B3S A;  1LNH A;  1ZX2 A;  2OWP A;  1BRN L;  1VQ5 3;  5JPU A;  1LOW A;  1UCJ A;  1D6Y A;  1NNV A;  2P05 A;  1WNH A;  1ULI B;  3DY5 A;  1VQ8 3;  1Q82 4;  5A0O B;  5BXQ A;  3CCR 3;  1RMS A;  1RGE A;  3BB9 A;  1BNE A;  1I2G A;  4BTX A;  1FGO A;  4RNZ A;  4WFO A;  5AII A;  2L4V A;  1DVC A;  2F98 A;  1JB4 A;  2XH9 A;  2YFJ B;  1IT8 A;  1YI2 3;  3CCE 3;  2QIY A;  3LTA A;  4L8O A;  2CG1 A;  2KF6 A;  4STD A;  3CU3 A;  1BRS A;  2AAE A;  4O8S A;  1GMQ A;  3DGM A;  2K3D A;  1B2U A;  1UGH I;  1B27 A;  3T0U A;  2IUK A;  1DMM A;  1GSP A;  1I8V A;  3A76 A;  3Q3F A;  3SLU A;  2RFR A;  2WOH A;  1UUW B;  3BU4 A;  1Q9E A;  3CCQ 3;  1NB5 I;  1W2Z A;  1WMN A;  3ROB A;  4N6L A;  1FGM A;  4R80 A;  1JBR A;  2CC3 A;  1IYY A;  3EN8 A;  3WA2 X;  2B24 B;  3OW2 2;  1FYS A;  4GHO A;  3X40 A;  1B2X A;  2PZV A;  1AV4 A;  1N5P A;  1VQ7 3;  5JBS A;  2XEP A;  1RN7 A;  1Q7Y 4;  3FCS B;  3NQZ A;  1A2V A;  1N9E A;  1EG9 B;  1ASK A;  2BMO B;  2KCD A;  3NBR A;  3NX0 A;  4HM0 B;  3EB8 A;  1UCK A;  3EE1 A;  2L1S A;  3V92 A;  3RDE A;  1YJN 3;  2P09 A;  1O7W B;  3VGN A;  3SOY A;  2FNQ A;  3WR2 A;  5G1L A;  3B8L A;  4LZI A;  1SPU A;  3DM8 A;  1Q40 A;  3WDG B;  1GMP A;  2GU3 A;  3CNX A;  4HM4 B;  1FA3 A;  2HMN B;  3CCV 3;  3EJV A;  5GSP A;  5FGO A;  4IT7 A;  5DRV A;  4EYC A;  4N6V 0;  3CNM A;  2OTJ 3;  1YNV X;  3KSP A;  5M1A A;  3HX8 A;  3SED A;  3LML A;  1BAN A;  1JZO A;  3LXU X;  4HKV B;  4I5Q A;  4CJN A;  1AVL A;  4JF8 A;  1O7P B;  3DZL A;  1OH0 A;  1IV9 A;  1KC8 4;  4MMY B;  3DUK A;  2GBW B;  1NWW A;  2C11 A;  1IQ8 A;  1AY7 A;  4FMD A;  2H0H A;  2F4Y A;  3K7C A;  7STD A;  5ELJ A;  2CG0 A;  3D9R A;  3JUQ A;  2OOV A;  1TFK A;  5CF2 A;  5IEP A;  1TP6 A;  1LOV A;  1L5G B;  3ER7 A;  2OQE C;  3B4P A;  4NPB A;  3HZP A;  2KF5 A;  1N8Q A;  2BU4 A;  4BTY A;  4NRE A;  4WP5 A;  2QEX 3;  3AMO A;  1FZU A;  4ZM8 A;  3WMD A;  1QMA A;  2GBX B;  1TFO A;  2UUG C;  1E3V A;  1F8N A;  4FMA A;  4N6M A;  1W02 A;  3NHX A;  4KFE A;  1GOU A;  5FW5 A;  1NJI 4;  3AGO A;  1FUT A;  3G6E 3;  1J2B A;  3MHE A;  3WOE B;  3PXM A;  1I70 A;  3F9S A;  3PYJ A;  3LTD A;  2XRX B;  3I0Y A;  3CC2 3;  5CXO A;  1BSE A;  1GY7 A;  1A2P A;  1CYU A;  1ZS7 A;  1C7H A;  4ILF A;  1EKM A;  2JQ5 A;  3JUO A;  4K1V A;  1DMN A;  1FUW A;  1KSI A;  2KRT A;  3CMA 3;  3D79 A;  4N6U A; 
#chains in the Genus database with same CATH homology
 3EBY A;  3STD A;  1K73 4;  1GY5 A;  3I56 3;  2P0M A;  3KFQ C;  3PZW A;  1D6Z A;  2I9W A;  3PCS A;  1WTH A;  2LQV A;  1QAF A;  3BNE A;  4L7K A;  3HK4 A;  5AEU B;  3MSO A;  4ORL A;  2W56 B;  4LEH A;  2XR8 B;  4KFF A;  3DGO A;  5ELU A;  2W04 A;  2YX9 A;  1ROA A;  1Y4K A;  3F14 A;  1N9J A;  3QK9 A;  4TX4 A;  1VQO 3;  2IMJ A;  3MG3 A;  8CHO A;  2CKF B;  1IVX A;  4GL6 A;  1JB5 A;  1SJW A;  4EC6 A;  4FMB A;  4U13 A;  3S5C A;  3T8U A;  3MKI A;  2CWU A;  2XGN A;  3OWY A;  2W03 A;  5BVB A;  1W5Z A;  2P38 A;  3FSD A;  1LVN A;  2RGQ A;  4HZB B;  3WOD G;  3NM2 A;  4MMX B;  4GB5 A;  3S29 A;  3G0K A;  4XDW A;  5D81 A;  4I4K A;  2JDI H;  6STD A;  1NB3 I;  3NXJ A;  1N5H A;  4N6T A;  3BNB A;  2MC8 A;  3EHC A;  4IIA A;  5G2G A;  3U97 A;  4FCM A;  1VQP 3;  3OV4 A;  5CK6 A;  4J8T A;  5EQL A;  1ULJ B;  3GZY B;  3D3L A;  4XDV A;  1QJG A;  3NUV A;  3NV0 B;  1S72 3;  3F8X A;  3KII A;  1U8C B;  3EQQ B;  3MG2 A;  3JUN A;  1IT7 A;  3VSY A;  5IF6 A;  2Y74 A;  5TGN A;  4CCV A;  4HJL B;  4KFD A;  3B7C A;  2D42 A;  2CH9 A;  4H3U A;  3SVA A;  3RGR A;  4EXR A;  5KP1 A;  3UNL A;  1JN5 A;  1GD3 A;  1JKG B;  3BNC A;  2R4I A;  4G1M B;  2QGU A;  3H51 A;  1O7N B;  3GWR A;  3KSE D;  3CCL 3;  4HM2 B;  2MF7 A;  4HM7 B;  2HMJ B;  3F7S A;  3FF0 A;  3N54 B;  2CK3 H;  1QVF 2;  2RCD A;  2QA4 3;  5D83 A;  5LC7 A;  3CD6 3;  2WO0 A;  1FGQ A;  2CHC A;  2CWV A;  2LYX A;  2BHM A;  2WGO A;  2HMM B;  2FXT A;  1M90 4;  3G16 A;  4XBT A;  1K9M 4;  3JUM A;  1UI7 A;  4HYZ A;  3MG1 A;  1A2K A;  5EVH A;  3UB1 A;  4O02 B;  3X42 A;  2Z7A A;  1JNQ A;  2XF3 A;  3CCS 3;  3K9M C;  5HGR A;  3VF1 A;  3CCU 3;  2INX A;  4HM6 B;  4X2H A;  3DMC A;  5AIF A;  4R9K A;  1GS3 A;  3FLJ A;  5AYR B;  1STF I;  5LC6 A;  2D1W A;  3HII A;  5CLK A;  1O7H B;  1OF5 B;  1STD A;  3JVC A;  1OHO A;  3LOY A;  2ML5 A;  2HMO B;  4QWT A;  3UJM A;  4HBR A;  1RRL A;  1W6G A;  3ALA A;  3OWU A;  3V98 A;  5IG3 A;  1HKX A;  1GYB A;  1KWI A;  2YFL B;  2YFI B;  1OPY A;  5JPP A;  3KZT A;  3OXA A;  1S5A A;  3K0Z A;  3K5T A;  3PS8 A;  3CME 3;  3T8N A;  4WYK B;  3G8Z A;  3NM7 A;  3JUP A;  1IVW A;  3LZA A;  1W7C A;  4HM1 B;  1VQ4 3;  1JB2 A;  2XFS A;  3X3Z A;  3F7X A;  2W0Q A;  2GEX A;  2OQE A;  4N6O B;  4NHF A;  1IQY A;  5STD A;  1US1 A;  2Y73 A;  4FMC A;  5KP3 A;  1VQL 3;  2FGT A;  2Z76 A;  2E2V A;  1R4C A;  5IW9 A;  1O7G B;  1RJO A;  3TDG A;  5IG5 A;  5AEW B;  3CCM 3;  1HU9 A;  1QVG 2;  3I55 3;  3S27 A;  3KN4 A;  4WWU C;  3CPO A;  1W01 A;  3CC4 3;  2GU1 A;  2V1L A;  4R1K A;  2K0M A;  1ISK A;  2K54 A;  3WOF B;  3ECF A;  3LTC A;  4AEQ A;  3HIG A;  1GY6 A;  3PCR A;  5IEN A;  1QAL A;  3K63 A;  3S28 A;  1U5O A;  3GZB A;  1IDP A;  4HM5 B;  4L8P A;  1KD1 4;  4LSO A;  5IEO A;  1Q86 4;  1VQN 3;  3X3X A;  1K8A 4;  1W2B 2;  4LGQ A;  1OAC A;  1Q40 B;  1UW1 A;  2A15 A;  4HVN A;  4HZ9 B;  3LYG A;  3G4S 3;  1IVV A;  1VZZ A;  1AVK A;  1OGX A;  5IG0 A;  1W4N A;  3HI7 A;  2Q07 A;  1JRQ A;  4X2O A;  4FCJ A;  2HMK B;  5CF1 A;  1E3R A;  2STD A;  1GD4 A;  2CFD A;  2Z77 A;  2BT3 A;  1M9G A;  1D6U A;  2CW9 A;  3SOA A;  1IK3 A;  1YIT 3;  3FKA A;  3IMA B;  1MNL A;  3E99 A;  3PGB A;  3EC9 A;  3S67 A;  3M8C A;  3WA3 A;  4AKZ A;  4XM4 A;  1IU7 A;  2CFK A;  1OHP A;  2OTL 3;  4O3V A;  3DGL A;  4BTW A;  4KVH A;  3UL6 A;  4PEJ A;  1VQ6 3;  1W6C A;  4JRF A;  4RZM A;  4R4K A;  2O3O A;  3U1W A;  1IQX A;  2CFL A;  3AMO B;  5AYS C;  3CXC 2;  3IJE B;  4MJD A;  1FGT A;  4XB5 A;  4K90 B;  2XSH B;  4EBG A;  1G96 A;  2HML B;  1LXE A;  2F99 A;  2W9P A;  3MWZ A;  3N8B A;  4OK0 A;  1RKY A;  1V74 A;  4H61 A;  4N3V A;  1PU4 A;  3MPH A;  3QRD A;  5KP4 A;  3Q1C A;  3FH1 A;  1VQ9 3;  3GAX A;  1IVU A;  2XGL A;  1IV7 A;  2CWT A;  4XBX A;  2B1X B;  1BUQ A;  1VQK 3;  2W56 A;  4R9L A;  4RNY A;  2KXG A;  3UL5 A;  2BNG A;  3F40 A;  1NO3 A;  3IPT A;  3SXX A;  3L0R A;  1W00 A;  2C10 A;  1CQS A;  1SIH A;  4OVM A;  4RBN A;  3OX9 A;  4FR9 A;  1TIJ A;  1YVB I;  1NDO B;  2GXF A;  4HM3 B;  2BMR B;  2OOV C;  1UI8 A;  3DXO A;  2GEY A;  1Z1S A;  3X41 A;  2Z6B A;  4EV5 A;  3MYT A;  2E2T A;  2WOF A;  1DMQ A;  4WHA A;  2ZDJ A;  3OWS A;  5AIG A;  1VQM 3;  1YHQ 3;  4IPB A;  1N8R 4;  4LMI A;  3LT9 A;  3CPW 2;  3FG1 A;  2CFG A;  4MEI A;  4AKY A;  2SBL A;  3FGY A;  4OUQ A;  3NBJ A;  2W2C A;  5IER A;  3BND A;  3LTB A;  3Q2P A;  1YJ9 3;  1WMP A;  2W9Q A;  1OGZ A;  1W6Y A;  1M1K 4;  3NV0 A;  2BO9 B;  1Q81 4;  3FZW A;  4KZ1 A;  4J9A A;  2O9U X;  4HM8 B;  4FCZ A;  1K28 A;  3EX9 A;  1UUV B;  4O2H A;  1WQL B;  4K1U A;  1K41 A;  2XFT A;  3EN1 B;  1ZO2 A;  2UX0 A;  3SX1 A;  1WMO A;  1KQS 2;  2BMQ B;  1YIJ 3;  1TU5 A;  1EA2 A;  2PNC A;  1YJW 3;  1CEW I;  1DVD A;  1JKG A;  3GZR A;  4Q53 A;  2CIU A;  1OUN A;  2P0X A;  1ROV A;  3EBT A;  3F8H A;  5I97 A;  5EEO A;  1OHS A;  1AR0 A;  4N6N B;  3FG4 A;  4MMZ B;  3X3Y A;  1Q42 A;  1T5Y A;  3H3H A;  1FGR A;  3N9H A;  5AI1 A;  2IA7 A;  3LH4 A;  2ZL8 A;  3J7Y d;  2WGQ A;  1JN5 B;  1SII A;  3CC7 3;  1QAK A;  1OCV A;  1E97 A;  1MOL A;  1TUH A;  3B4O A;  3FG3 A;  2E2U A;  1YGE A;  1JV2 B;  3BLZ A;  1LOX A;  1A67 A;  1CYV A;  2XSO B;  2ML6 A;  3FF2 A;  3NQY A;  1PFP A;  3GZX B;  2IUJ A;  5AIH A;  1NU3 A;  1SQW A;  1DYU A;  3DGN A;  3RGA A;  1EQK A;  5DRE A;  2RSX A;  3Q90 A;  1OF5 A;  2W6J H;  1RRH A;  2CFW A;  3LT8 A;  3CCJ 3;  2F86 B;  2M7O A;  3GRD A;  4XBY A;  3EF8 A;  3G71 3;  1JJ2 2;  1A90 A;  3NBB A;  3KE7 A;  4CDL A;  5IG4 A;  1M1X B;  3KKG A;  1O7M B;  3O8Y A;  4WYK A;  5D82 A;  4EV2 A;  4K61 A;  2OCT A;  1LNH A;  1ZX2 A;  2OWP A;  1VQ5 3;  5JPU A;  1D6Y A;  2P05 A;  1WNH A;  1ULI B;  3DY5 A;  1VQ8 3;  1Q82 4;  5A0O B;  5BXQ A;  3CCR 3;  3BB9 A;  4BTX A;  1FGO A;  4RNZ A;  4WFO A;  5AII A;  2L4V A;  1DVC A;  2F98 A;  1JB4 A;  2YFJ B;  2XH9 A;  1IT8 A;  1YI2 3;  3CCE 3;  2QIY A;  3LTA A;  4L8O A;  2CG1 A;  4STD A;  3CU3 A;  4O8S A;  3DGM A;  3T0U A;  2IUK A;  1DMM A;  3A76 A;  3SLU A;  2RFR A;  2WOH A;  1UUW B;  3CCQ 3;  1NB5 I;  1W2Z A;  1WMN A;  3ROB A;  4N6L A;  1FGM A;  4R80 A;  2CC3 A;  3EN8 A;  3WA2 X;  2B24 B;  3OW2 2;  3X40 A;  2PZV A;  1AV4 A;  1N5P A;  1VQ7 3;  5JBS A;  2XEP A;  1RN7 A;  1Q7Y 4;  3FCS B;  3NQZ A;  1A2V A;  1N9E A;  1EG9 B;  1ASK A;  2BMO B;  2KCD A;  3NBR A;  3NX0 A;  4HM0 B;  3EB8 A;  3EE1 A;  3V92 A;  1YJN 3;  3RDE A;  2P09 A;  1O7W B;  3VGN A;  3SOY A;  2FNQ A;  3B8L A;  4LZI A;  1SPU A;  3DM8 A;  1Q40 A;  3WDG B;  2GU3 A;  3CNX A;  4HM4 B;  1FA3 A;  2HMN B;  3CCV 3;  3EJV A;  5FGO A;  4IT7 A;  5DRV A;  4EYC A;  4N6V 0;  3CNM A;  2OTJ 3;  3KSP A;  3HX8 A;  3SED A;  3LML A;  3LXU X;  4HKV B;  1AVL A;  4JF8 A;  1O7P B;  3DZL A;  1OH0 A;  1IV9 A;  1KC8 4;  4MMY B;  3DUK A;  2GBW B;  1NWW A;  2C11 A;  1IQ8 A;  4FMD A;  3K7C A;  7STD A;  5ELJ A;  2CG0 A;  3D9R A;  3JUQ A;  2OOV A;  1TFK A;  5CF2 A;  5IEP A;  1TP6 A;  1L5G B;  3ER7 A;  2OQE C;  3B4P A;  3HZP A;  1N8Q A;  4BTY A;  4NRE A;  4WP5 A;  2QEX 3;  3AMO A;  4ZM8 A;  3WMD A;  1QMA A;  2GBX B;  1TFO A;  1E3V A;  1F8N A;  4FMA A;  4N6M A;  1W02 A;  3NHX A;  4KFE A;  5FW5 A;  1NJI 4;  3G6E 3;  1J2B A;  3MHE A;  3WOE B;  3PXM A;  3F9S A;  3PYJ A;  3LTD A;  2XRX B;  3I0Y A;  3CC2 3;  5CXO A;  1GY7 A;  1CYU A;  1C7H A;  1EKM A;  2JQ5 A;  3JUO A;  4K1V A;  1DMN A;  1FUW A;  1KSI A;  2KRT A;  3CMA 3;  3V99 A;  4N6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...