4HJLB

Naphthalene 1,2-dioxygenase bound to 1-chloronaphthalene
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to 1-chloronaphthalene
rcsb
source organism Pseudomonas sp.
total genus 57
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hjlB00
1OHSA 3K0ZA 3WMDA 4HM7B 3F9SA 3GWRA 3KSPA 3K7CA 5IG5A 5IEPA 1ULIB 3E99A 3GZRA 3BB9A 1GYBA 5DREA 5IEOA 5AIFA 5TGNA 2HMMB 5AIHA 5CXOA 3EHCA 2Z77A 3B4OA 2UX0A 3JUQA 5IF6A 3CNMA 3EBTA 4WYKA 1OPYA 4STDA 1JKGB 1JB5A 1E3VA 2XSOB 3FKAA 4ORLA 3OWYA 5D82A 3T8UA 1CQSA 2HMJB 3LZAA 3GZYB 3T8NA 3EBYA 3EF8A 4HM6B 3ECFA 3SOAA 3EX9A 1DMMA 4WP5A 3F40A 1OF5B 1GS3A 3SEDA 2IMJA 2INXA 2F86B 3CU3A 3FH1A 3M8CA 5AEUB 1EA2A 2Z76A 3FGYA 3H51A 1OHOA 5G2GA 5BVBA 1GY7A 4K1VA 5CF2A 3JUPA 1ULJB 4R9LA 2YFLB 3BLZA 3KZTA 1NWWA 1ISKA 1QMAA 4FCJA 3H3HA 4WWUC 1U5OA 2YFJB 1JN5B 2K54A 6STDA 3CPOA 3HK4A 4HM1B 3EC9A 3EN1B 4J9AA 3JUOA 3NV0A 4HJLB 1OHPA 5HGRA 4HZBB 1E97A 4HM0B 1O7PB 3EQQB 4R9KA 3ER7A 2CHCA 1OH0A 3B8LA 5FW5A 3HZPA 3A76A 2BMQB 1K41A 4L7KA 1Q40A 2HMKB 3Q90A 3ROBA 2QIYA 5JPUA 1BUQA 2B24B 1JN5A 3HX8A 1HKXA 2GBWB 2PZVA 1ASKA 4KVHA 1Q42A 3B4PA 3MG1A 3EN8A 1O7MB 3OV4A 1GY5A 2STDA 3S5CA 8CHOA 4X2HA 4XBXA 1ZO2A 4IIAA 1AR0A 1W02A 2B1XB 2RCDA 5CK6A 3MG2A 4RZMA 4HM3B 3VSYA 5KP1A 3OWUA 5STDA 1A2KA 3F8XA 4HKVB 2GEYA 4K1UA 2HMOB 1OCVA 1W00A 2YFIB 2GBXB 3DZLA 2RGQA 1OUNA 1Z1SA 5D83A 5IG0A 2RFRA 4HM8B 1JKGA 2A15A 5EVHA 1O7GB 3DM8A 5JPPA 4XBYA 4HZ9B 5BXQA 4MJDA 4XBTA 3DUKA 1WQLB 3UNLA 2XR8B 1W01A 4HM2B 4LGQA 5KP3A 3MKIA 4HM4B 1OF5A 3FLJA 3MSOA 1VZZA 3VGNA 3NXJA 3NBRA 1O7WB 3OWSA 3B7CA 4Q53A 4XM4A 4L8OA 5AI1A 4J8TA 3OXAA 5KP4A 2GEXA 4H3UA 4HVNA 3KKGA 1EG9B 4FCMA 5IENA 2XRXB 2BNGA 3EJVA 2XSHB 1S5AA 2BMOB 5AIGA 4OVMA 5AIIA 3F7XA 3SOYA 3GZXB 2JQ5A 1GY6A 3DXOA 3JUNA 1NU3A 4XDWA 3G16A 3CNXA 3MG3A 3JUMA 4OUQA 3D9RA 5AEWB 1IDPA 1NDOB 2W2CA 1C7HA 4U13A 1E3RA 4HM5B 3NM2A 3NUVA 4L8PA 1JB4A 2HMNB 4I4KA 3FZWA 5DRVA 1UUWB 4XDVA 3GZBA 1UUVB 2I9WA 3MHEA 3FF2A 4X2OA 3STDA 5IG3A 1QJGA 5CF1A 2R4IA 3GRDA 5IERA 3KE7A 4XB5A 3NV0B 5IG4A 4LEHA 1DMNA 3G0KA 3RGRA 3RGAA 1STDA 2GXFA 1OGXA 1O7HB 1JB2A 4R1KA 3OX9A 1ZX2A 3UJMA 2Z7AA 3IPTA 4PEJA 7STDA 2F99A 3NHXA 3F14A 5D81A 3FF0A 4WYKB 3F8HA 1TUHA 3FSDA 4CDLA 1Q40B 3LYGA 3G8ZA 3I0YA 4N3VA 1O7NB 2HMLB 4LMIA 3DMCA 2BMRB 4GB5A 1DMQA 1OGZA 2OWPA 3MYTA 1SJWA 2QGUA 2CKFB 1TP6A 3F7SA 5CLKA 1W6YA 2F98A
chains in the Genus database with same CATH superfamily
1YVBI 1OHSA 3K0ZA 3WMDA 4HM7B 3F9SA 3GWRA 3KSPA 1YVSA 3K7CA 2SARA 4BL2A 1EKMA 5IG5A 2L1SA 2E2TA 2OTL3 1G96A 5GSPA 2D1WA 5IEPA 2SBLA 1ULIB 1RGGA 1SPUA 3RDEA 3E99A 2XGNA 1FGQA 2CK3H 3SYUA 1B3SA 1RRHA 3GZRA 1OACA 3BB9A 3NM7A 1BNJA 3FG1A 1GYBA 5DREA 1GMPA 1VQQA 4KFEA 3U1WA 4HAAA 2E2UA 2CWUA 1N5PA 2YX9A 4RNYA 5IEOA 2CWTA 4N6NB 3CME3 1C54A 5AIFA 5TGNA 2HMMB 1ROVA 2Q07A 2CC3A 2KF3A 5CXOA 5AIHA 5BIRA 3EHCA 1D6ZA 1UUGB 2Z77A 3B4OA 2UX0A 5HOHA 1RGFA 3JUQA 1BNRA 3MPHA 5IF6A 3CD63 3CNMA 2CFDA 3X3ZA 1WNHA 1QALA 3EBTA 3TDGA 2CG0A 1K8A4 4OK0A 1IK3A 3BIRA 4WYKA 4O8SA 1JZDA 3LXUX 1OPYA 4K61A 3SVAA 4STDA 1JKGB 2W6JH 1HU9A 1UI7A 1WTHA 4FMCA 1X1YA 1M904 1JB5A 1E3VA 2XSOB 1UCJA 3FKAA 4TX4A 1BNGA 2RSXA 1A67A 2OCTA 1JV2B 1X1UA 4N6TA 3D4AA 4KFDA 1B2SA 3GAXA 1I2FA 3OWYA 1W4NA 4ORLA 5D82A 5LC7A 3T8UA 1UCKA 1CQSA 3WOEB 3SLUA 2HMJB 1RSNA 3PCRA 4BU4A 1VQL3 2IA7A 3L0RA 4MEIA 3LZAA 3GZYB 1A2PA 3O8YA 4N6UA 2OTJ3 3T8NA 1G02A 1LOYA 1EQKA 2CFKA 3EBYA 3D5GA 3EF8A 4HM6B 4CPKA 1J2BA 3ECFA 3SOAA 3AMOB 3G6E3 1B21A 1TJDA 3AGOA 3EX9A 3CCM3 1DMMA 1VQ73 1RGLA 4WP5A 1BSAA 3S29A 5I97A 1Y4KA 3F40A 1JJ22 1A90A 1TRQA 3LH4A 2P09A 1LOXA 1FA3A 4EYCA 1OF5B 4N6OB 1GS3A 4HYZA 3SEDA 1KWIA 2IMJA 2ZL8A 3RNTA 1FYSA 3I563 2INXA 4WFOA 4RNTA 1RN4A 3NQZA 1VQ93 2F86B 3CU3A 5RNTA 1UCLA 1BGSA 3IMAB 1RNBA 3FH1A 2F5WA 1B2MA 1VQP3 2KF6A 2UUGC 3M8CA 4LZIA 5AEUB 1CYVA 1TTOA 1MGWA 3LT9A 1UCIA 5A0OB 1EA2A 2Z76A 3FGYA 5ELUA 1T2HA 3H51A 1OHOA 4EBGA 5G2GA 2C4BA 4MMZB 5BVBA 1Q814 1BNSA 1GY7A 1MNLA 1TFOA 2C11A 3N9HA 4K1VA 1IQXA 1EEJA 4EV2A 1DVCA 5CF2A 1JBSA 4EW5A 3JUPA 1N9JA 1DE3A 6RNTA 1ULJB 3DGOA 4R9LA 2YFLB 3BLZA 1TFKA 4AKYA 3KZTA 3LOYA 2ZDJA 1NWWA 2CH9A 1IVWA 1RTUA 1T2IA 1RHLA 1ISKA 1QMAA 3HI7A 4KT3B 3CPW2 1I70A 1IQYA 1BNEA 3H3HA 4FCJA 3D5IA 2XH9A 2K3DA 1FUTA 3V92A 1LRAA 1ZGXA 4WWUC 1BRSA 1CH0A 3ZG5A 1U5OA 4LYLB 2KF4A 1M1XB 2YFJB 1JN5B 1W6GA 2CFLA 2IUKA 2K54A 1MOLA 6STDA 3CPOA 3HIIA 4HOHA 4CCVA 3J7Yd 3HK4A 1BRGA 4GSPA 2P05A 4HM1B 1RCLA 3WODG 3X42A 1BIRA 3MWZA 4NPBA 3EC9A 3EN1B 1FGTA 5G1LA 4J9AA 3JUOA 3NV0A 2OQEC 3G4S3 1KQS2 4HJLB 1OHPA 3DGNA 5HGRA 2BO9B 1Q7HA 3LTAA 1CEWI 2CFWA 3U97A 1MGRA 4HZBB 1E97A 2LQVA 4HM0B 1Q7Y4 1I2GA 1O7PB 3EQQB 3FG3A 1RN1A 4R9KA 3CCU3 3FG4A 3UL5A 2O9UX 1GD3A 1I8VA 3NBBA 4WHAA 3ER7A 2CHCA 3Q1CA 1V58A 2H0GA 2WO0A 3CC43 2M7OA 3FCSB 2K0MA 1OH0A 3X3YA 3B8LA 3CCJ3 4QWTA 1D6YA 5FW5A 1BRHA 3D3LA 3HZPA 3A76A 4HBRA 2BHMA 3CCV3 2FNQA 1L5GB 1MWTA 3BNDA 2BT3A 1RMSA 2BMQB 3UL6A 3N54B 1NO3A 1FUSA 1FZUA 1K41A 5M18A 3CCL3 3HIGA 1VQ83 1AVKA 4L7KA 1Q40A 1KD14 2ML6A 1N8R4 1SIIA 3IJEB 3AHWA 1M9GA 2HMKB 1SQWA 3Q90A 1RNTA 4DKIA 3ROBA 1TU5A 2QIYA 1AV4A 2W56B 5JPUA 1BUQA 4BTXA 2B24B 1JN5A 3HX8A 1LXEA 1UDII 1HKXA 2GBWB 2P0MA 1YHQ3 1W2ZA 5IW9A 5G1KA 1BNIA 2OOVC 2PZVA 3KFQC 1NJI4 3EB8A 4EV5A 1IQ8A 1ASKA 3WA2X 3X41A 1VQ53 4KVHA 4KFFA 1BSCA 1IT8A 1LNIA 1Q42A 1PY3A 3B4PA 3EE1A 3MG1A 3EN8A 1BRIA 1O7MB 4GL6A 3V99A 1VQO3 4FMBA 1EUIC 3OV4A 1FGRA 2MC8A 1ZS7A 1GY5A 2STDA 3S5CA 1BSDA 8CHOA 1GMQA 1R4CA 4X2HA 2FGTA 4XBXA 1GMRA 1ZO2A 2AAEA 4IIAA 4GHOA 2QA43 1AR0A 1YJW3 1W02A 2B1XB 2RCDA 5CK6A 1LQMB 3WHOA 4MMYB 1IV7A 1LVNA 3MG2A 2ZA4A 1AVLA 1BRKA 3DGMA 1A2VA 4HM3B 4RZMA 3OWUA 3VSYA 5KP1A 1QVF2 5STDA 1A2KA 1JNQA 1MWRA 1R4YA 4K90B 4KZ1A 1K9M4 3F8XA 3CCR3 1Q864 4N6V0 4HKVB 2CX0A 2GEYA 3K63A 4FMAA 2HMOB 4K1UA 1OCVA 1VQ43 3URPA 1W00A 2YFIB 1BAOA 1RGHA 2GBXB 3DZLA 2RGQA 1STFI 1OUNA 2HOHA 1CYUA 1Z1SA 2JDIH 1B2XA 7GSPA 5D83A 2XEPA 1VQ63 3QRDA 5IG0A 3D79A 1IT7A 2ZHXB 2RFRA 4LSOA 4FR9A 2MF7A 4HM8B 9RNTA 1JKGA 1RLSA 2A15A 5M19A 2WGQA 5EVHA 1O7GB 4I5QA 2OQEA 2RBIA 3DM8A 5JPPA 1UGIA 1W6CA 2F56A 1RN7A 1I0VA 4XBYA 2GU3A 3LT8A 2CWVA 7RNTA 4HZ9B 1BANA 3UB1A 5BXQA 4MJDA 3CXC2 1FW7A 1RGAA 3CCE3 1S723 1RGEA 4XBTA 2RNTA 1WQLB 3DUKA 3PXMA 3UNLA 4O2HA 4G1MB 2XR8B 1W01A 2Y73A 3AMOA 1NNVA 3Q3FA 4HM2B 4LGQA 1BNFA 3CMA3 2ML5A 3LTDA 3SXXA 1RJOA 5KP3A 3MKIA 3KCHA 2KCDA 2V1LA 3PCSA 2XFTA 4HM4B 1IU7A 1GOVA 1OF5A 3FLJA 1K734 3LMLA 1GOUA 1D6UA 3MSOA 1VZZA 4R4KA 3VGNA 1IVVA 3GSPA 1I2EA 3NXJA 3NBRA 1N5HA 1O7WB 3Q2PA 3OWSA 3B7CA 5M1AA 4Q53A 4BTYA 4XM4A 4L8OA 1I0XA 1RCKA 4FCZA 5AI1A 4ILFA 4J8TA 3OXAA 5ELJA 5AYSC 3WDGB 3WA3A 1G0TA 5KP4A 1YJN3 2Y74A 3KSED 3KN4A 5EQLA 4AEQA 2GEXA 4H3UA 1NB3I 2W9PA 4HVNA 4O02B 1BRJA 3CCS3 1NB5I 3KKGA 2QEX3 1B20A 1PFPA 4BL3A 3T0UA 3CCQ3 1EG9B 1W7CA 1B27A 1HZ1A 4FCMA 5IENA 2LYXA 3K9MC 3X3XA 3A5EA 1I3FA 3X40A 3S28A 2XRXB 2BNGA 2KAAA 8RNTA 3EJVA 3DH2A 3KIIA 4N6MA 2WGOA 5AYRB 3ZG0A 3WR2A 2KRTA 1M1K4 2XSHB 1S5AA 2OOVA 2BMOB 5AIGA 3CC23 1JBRA 2BU4A 4NREA 1RGCA 4OVMA 1V57A 1YGWA 2KF5A 5AIIA 2XGLA 3F7XA 2GSPA 1N9EA 3SOYA 3AHSA 3GZXB 1X1WA 2JQ5A 3K5TA 5EEOA 3S27A 1GY6A 3DXOA 1MWSA 3V98A 3JUNA 1LOVA 1NU3A 4XDWA 1YJ93 2J8XB 3LTBA 2XF3A 3G16A 3CNXA 4JRFA 1RGKA 1U8CB 3MG3A 3JUMA 1YIJ3 3DGLA 2E2VA 3PYJA 3PZWA 3BNBA 4OUQA 3D9RA 4IPBA 5AEWB 1K28A 3NQYA 1IDPA 4JF8A 4AKZA 5BU4A 3LTCA 1YIT3 2F5MA 3HOHA 1NDOB 2W2CA 1C7HA 2GU1A 1E3RA 2R41A 1GOYA 3NM2A 2D42A 4HM5B 4U13A 3OW22 1JBTA 3NUVA 4L8PA 2XFSA 1JB4A 1BVIA 1DVDA 4RBNA 3BNCA 1YGEA 3BNEA 1WMNA 4ZM8A 1DYUA 2HMNB 3N8BA 1FUWA 1WMPA 4BIRA 4I4KA 2W0QA 3FZWA 3PS8A 1UUWB 4XDVA 5DRVA 3GZBA 1UUVB 2I9WA 5LC6A 3MHEA 1BSEA 1BUJA 1B2ZA 1IVXA 1DETA 1T3BA 2H0IA 2W9QA 3VF1A 3ZFZA 3FF2A 2CW9A 4RNZA 4X2OA 1QAKA 2UGIA 2Z6BA 1Q9EA 4MMXB 1KC84 3STDA 1JRQA 4IT7A 5IG3A 1QJGA 5CF1A 1UI8A 2H0HA 2R4IA 1IYYA 1VQK3 1F8NA 3GRDA 2BIRA 5IERA 2KXGA 3KE7A 1RKYA 4XB5A 3NV0B 5IG4A 4LEHA 1DMNA 2IY2A 1FGMA 1GSPA 1W5ZA 3G0KA 1W2B2 1JZOA 1BU4A 3G713 1IVUA 1SIHA 3RGRA 1BOXA 3DGYA 1LQGC 1PYLA 3RGAA 1YNVX 1HYFA 1KSIA 1STDA 1TIJA 1OGXA 2GXFA 1MWUA 3ALAA 3I553 1BRNL 2PNCA 1AQZA 4EXRA 1O7HB 1JB2A 2W03A 1YI23 3JVCA 1V74A 4R1KA 1QAFA 3OX9A 3PGBA 1IV9A 1ZX2A 1BSBA 3UJMA 1VQM3 4H61A 2CX1A 2Z7AA 1LOWA 3IPTA 3NX0A 4BTWA 1ROAA 2W56A 4R80A 1T5YA 2P38A 4PEJA 1PU4A 2O3OA 7STDA 2W04A 4N6LA 2F99A 4J5KA 1X1XA 3SX1A 5FGOA 3NHXA 3F14A 1LNHA 5D81A 2F4YA 1GD4A 2FXTA 6GSPA 3FF0A 1N8QA 4WYKB 3F8HA 2AADA 1TUHA 1Q824 3FSDA 1VQN3 4CDLA 1Q40B 3LYGA 3G8ZA 3QK9A 1TRPA 5JBSA 1WMOA 3I0YA 4CJNA 4N3VA 1O7NB 1QVG2 2HMLB 4O3VA 4NHFA 4LMIA 3BU4A 4J5GA 1RRLA 1B2UA 3DMCA 2IUJA 1UGHI 2BMRB 4FMDA 4GB5A 1DMQA 1OGZA 2WOHA 1SARA 2CG1A 2OWPA 3MYTA 1SJWA 2QGUA 2L4VA 2CKFB 2WOFA 2CFGA 1TP6A 3F7SA 1I3IA 1FGOA 2IYJA 2C10A 3NBJA 5CLKA 4EC6A 1W6YA 3S67A 3CC73 3WOFB 3DY5A 2F98A 1UW1A 1AY7A 3AGNA 2P0XA 2CIUA 1RDSA 1US1A
chains in the Genus database with same CATH topology
1YVBI 1OHSA 3K0ZA 3WMDA 4HM7B 3F9SA 3GWRA 3KSPA 3K7CA 1EKMA 5IG5A 2E2TA 2OTL3 1G96A 2D1WA 5IEPA 2SBLA 1ULIB 1SPUA 3RDEA 3E99A 2XGNA 1FGQA 2CK3H 1RRHA 3GZRA 1OACA 3BB9A 3NM7A 3FG1A 1GYBA 5DREA 3U1WA 4KFEA 2E2UA 2CWUA 1N5PA 2YX9A 4RNYA 5IEOA 2CWTA 4N6NB 3CME3 5AIFA 5TGNA 2HMMB 1ROVA 2Q07A 2CC3A 5AIHA 5CXOA 3EHCA 1D6ZA 2Z77A 3B4OA 2UX0A 3JUQA 3MPHA 5IF6A 3CD63 3CNMA 2CFDA 3X3ZA 1WNHA 1QALA 3EBTA 3TDGA 2CG0A 1K8A4 4OK0A 1IK3A 4WYKA 4O8SA 3LXUX 1OPYA 4K61A 3SVAA 4STDA 1JKGB 2W6JH 1HU9A 1UI7A 1WTHA 4FMCA 1M904 1JB5A 1E3VA 2XSOB 3FKAA 4TX4A 2RSXA 1A67A 2OCTA 1JV2B 4N6TA 4KFDA 3GAXA 4ORLA 3OWYA 5D82A 1W4NA 5LC7A 3T8UA 1CQSA 3WOEB 3SLUA 2HMJB 3PCRA 1VQL3 2IA7A 3L0RA 4MEIA 3LZAA 3GZYB 3O8YA 4N6UA 2OTJ3 3T8NA 1EQKA 2CFKA 3EBYA 3EF8A 4HM6B 1J2BA 3ECFA 3SOAA 3AMOB 3G6E3 1VQ73 3EX9A 3CCM3 1DMMA 4WP5A 3S29A 5I97A 1Y4KA 3F40A 1JJ22 1A90A 3LH4A 2P09A 1LOXA 1FA3A 4EYCA 1OF5B 4N6OB 1GS3A 4HYZA 3SEDA 1KWIA 2IMJA 2ZL8A 3I563 2INXA 4WFOA 1VQ93 3NQZA 2F86B 3CU3A 3IMAB 3FH1A 1VQP3 3M8CA 4LZIA 5AEUB 1CYVA 3LT9A 5A0OB 1EA2A 2Z76A 3FGYA 5ELUA 3H51A 1OHOA 4EBGA 5G2GA 4MMZB 1Q814 5BVBA 1GY7A 1MNLA 2C11A 1TFOA 3N9HA 4K1VA 1IQXA 4EV2A 1DVCA 5CF2A 3JUPA 1N9JA 1ULJB 3DGOA 4R9LA 2YFLB 3BLZA 1TFKA 4AKYA 3KZTA 3LOYA 2ZDJA 1NWWA 2CH9A 1IVWA 1ISKA 1QMAA 3HI7A 3CPW2 1IQYA 3H3HA 4FCJA 2XH9A 3V92A 4WWUC 1U5OA 1M1XB 2YFJB 1JN5B 1W6GA 2CFLA 2IUKA 2K54A 1MOLA 6STDA 3CPOA 3HIIA 4CCVA 3J7Yd 3HK4A 2P05A 4HM1B 3WODG 3X42A 3MWZA 3EC9A 3EN1B 1FGTA 4J9AA 3JUOA 3NV0A 2OQEC 3G4S3 1KQS2 4HJLB 1OHPA 3DGNA 5HGRA 2BO9B 3LTAA 1CEWI 2CFWA 3U97A 4HZBB 1E97A 2LQVA 4HM0B 1Q7Y4 1O7PB 3EQQB 3FG3A 4R9KA 3CCU3 3FG4A 3UL5A 2O9UX 1GD3A 3NBBA 4WHAA 3ER7A 2CHCA 3Q1CA 2WO0A 3CC43 2M7OA 3FCSB 2K0MA 1OH0A 3X3YA 3B8LA 3CCJ3 4QWTA 1D6YA 5FW5A 3D3LA 3HZPA 3A76A 4HBRA 2BHMA 3CCV3 2FNQA 1L5GB 3BNDA 2BT3A 2BMQB 3UL6A 3N54B 1NO3A 1K41A 3CCL3 1VQ83 3HIGA 1AVKA 4L7KA 1Q40A 1KD14 2ML6A 1N8R4 1SIIA 3IJEB 1M9GA 2HMKB 1SQWA 3Q90A 3ROBA 1TU5A 2QIYA 1AV4A 2W56B 5JPUA 1BUQA 4BTXA 2B24B 1JN5A 3HX8A 1LXEA 1HKXA 2GBWB 2P0MA 1YHQ3 1W2ZA 5IW9A 2OOVC 2PZVA 3KFQC 1NJI4 3EB8A 4EV5A 1IQ8A 1ASKA 3WA2X 3X41A 1VQ53 4KVHA 4KFFA 1IT8A 1Q42A 3B4PA 3MG1A 3EE1A 3EN8A 1O7MB 4GL6A 3V99A 1VQO3 4FMBA 3OV4A 1FGRA 2MC8A 1GY5A 2STDA 3S5CA 8CHOA 1R4CA 4X2HA 2FGTA 4XBXA 1ZO2A 4IIAA 2QA43 1AR0A 1YJW3 1W02A 2B1XB 2RCDA 5CK6A 4MMYB 1IV7A 1LVNA 3MG2A 4HM3B 1AVLA 4RZMA 3DGMA 1A2VA 3VSYA 5KP1A 3OWUA 1QVF2 5STDA 1A2KA 1JNQA 4K90B 4KZ1A 1K9M4 3F8XA 3CCR3 1Q864 4N6V0 4HKVB 2GEYA 3K63A 4FMAA 2HMOB 4K1UA 1OCVA 1VQ43 1W00A 2YFIB 2GBXB 3DZLA 2RGQA 1STFI 1OUNA 1CYUA 1Z1SA 2JDIH 5D83A 2XEPA 1VQ63 3QRDA 5IG0A 1IT7A 2RFRA 4LSOA 4FR9A 2MF7A 4HM8B 1JKGA 2A15A 2WGQA 5EVHA 1O7GB 2OQEA 3DM8A 5JPPA 1W6CA 1RN7A 4XBYA 2GU3A 3LT8A 2CWVA 4HZ9B 3UB1A 5BXQA 3CXC2 4MJDA 3CCE3 1S723 4XBTA 3DUKA 1WQLB 3PXMA 3UNLA 4O2HA 4G1MB 2XR8B 1W01A 2Y73A 3AMOA 4HM2B 4LGQA 3CMA3 2ML5A 3LTDA 3SXXA 1RJOA 5KP3A 3MKIA 2KCDA 2V1LA 3PCSA 2XFTA 4HM4B 1IU7A 1OF5A 3FLJA 1K734 3LMLA 3MSOA 1D6UA 1VZZA 4R4KA 3VGNA 3NXJA 3NBRA 1N5HA 1O7WB 3Q2PA 3OWSA 3B7CA 4Q53A 4BTYA 4XM4A 4L8OA 4FCZA 5AI1A 5ELJA 4J8TA 3OXAA 5AYSC 3WDGB 1YJN3 3WA3A 5KP4A 2Y74A 3KSED 3KN4A 5EQLA 4AEQA 2GEXA 4H3UA 1NB3I 2W9PA 4HVNA 4O02B 3CCS3 1NB5I 3KKGA 2QEX3 1PFPA 3T0UA 3CCQ3 1EG9B 1W7CA 4FCMA 5IENA 2LYXA 3K9MC 3X3XA 3X40A 3S28A 2XRXB 2BNGA 3EJVA 3KIIA 4N6MA 5AYRB 2WGOA 2KRTA 1M1K4 2XSHB 1S5AA 2OOVA 2BMOB 5AIGA 3CC23 4NREA 4OVMA 5AIIA 2XGLA 3F7XA 1N9EA 3SOYA 3GZXB 2JQ5A 3K5TA 5EEOA 3S27A 1GY6A 3DXOA 3V98A 3JUNA 1NU3A 4XDWA 1YJ93 3LTBA 2XF3A 3G16A 3CNXA 4JRFA 1U8CB 3MG3A 3JUMA 1YIJ3 3DGLA 2E2VA 3PYJA 3PZWA 3BNBA 4OUQA 3D9RA 4IPBA 5AEWB 1K28A 3NQYA 1IDPA 4JF8A 4AKZA 3LTCA 1YIT3 1NDOB 2W2CA 1C7HA 2GU1A 1E3RA 4HM5B 3NM2A 4U13A 2D42A 3OW22 3NUVA 4L8PA 2XFSA 1JB4A 1DVDA 4RBNA 3BNCA 1YGEA 3BNEA 1WMNA 4ZM8A 1DYUA 2HMNB 3N8BA 1FUWA 1WMPA 4I4KA 2W0QA 3FZWA 3PS8A 1UUWB 4XDVA 5DRVA 3GZBA 1UUVB 2I9WA 5LC6A 3MHEA 1IVXA 2W9QA 3VF1A 3FF2A 2CW9A 4RNZA 4X2OA 1QAKA 2Z6BA 4MMXB 1KC84 3STDA 1JRQA 4IT7A 5IG3A 1QJGA 5CF1A 1UI8A 2R4IA 1VQK3 1F8NA 3GRDA 5IERA 2KXGA 3KE7A 1RKYA 4XB5A 3NV0B 5IG4A 4LEHA 1DMNA 1FGMA 1W5ZA 3G0KA 1W2B2 3G713 1IVUA 1SIHA 3RGRA 3RGAA 1KSIA 1STDA 1TIJA 2GXFA 3ALAA 1OGXA 3I553 2PNCA 4EXRA 1O7HB 1JB2A 2W03A 1YI23 3JVCA 1V74A 4R1KA 1QAFA 3OX9A 3PGBA 1IV9A 1ZX2A 3UJMA 1VQM3 4H61A 2Z7AA 3NX0A 3IPTA 4BTWA 1ROAA 2W56A 4R80A 1T5YA 2P38A 4PEJA 1PU4A 2O3OA 7STDA 2W04A 4N6LA 2F99A 3SX1A 5FGOA 3NHXA 3F14A 1LNHA 5D81A 1GD4A 2FXTA 3FF0A 1N8QA 4WYKB 3F8HA 1TUHA 1Q824 3FSDA 1VQN3 4CDLA 1Q40B 3LYGA 3G8ZA 3QK9A 5JBSA 1WMOA 3I0YA 4N3VA 1O7NB 1QVG2 2HMLB 4O3VA 4NHFA 4LMIA 1RRLA 3DMCA 2IUJA 2BMRB 4FMDA 4GB5A 1DMQA 1OGZA 2WOHA 2CG1A 2OWPA 3MYTA 1SJWA 2QGUA 2L4VA 2CKFB 2WOFA 2CFGA 1TP6A 3F7SA 5CLKA 1FGOA 3NBJA 2C10A 3CC73 4EC6A 1W6YA 3S67A 3WOFB 3DY5A 2F98A 1UW1A 2P0XA 2CIUA 1IVVA 1US1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHS A;  3K0Z A;  3WMD A;  4HM7 B;  3F9S A;  3GWR A;  3KSP A;  3K7C A;  5IG5 A;  5IEP A;  1ULI B;  3E99 A;  3GZR A;  3BB9 A;  1GYB A;  5DRE A;  5IEO A;  5AIF A;  5TGN A;  2HMM B;  5AIH A;  5CXO A;  3EHC A;  2Z77 A;  3B4O A;  2UX0 A;  3JUQ A;  5IF6 A;  3CNM A;  3EBT A;  4WYK A;  1OPY A;  4STD A;  1JKG B;  1JB5 A;  1E3V A;  2XSO B;  3FKA A;  4ORL A;  3OWY A;  5D82 A;  3T8U A;  1CQS A;  2HMJ B;  3LZA A;  3GZY B;  3T8N A;  3EBY A;  3EF8 A;  4HM6 B;  3ECF A;  3SOA A;  3EX9 A;  1DMM A;  4WP5 A;  3F40 A;  1OF5 B;  1GS3 A;  3SED A;  2IMJ A;  2INX A;  2F86 B;  3CU3 A;  3FH1 A;  3M8C A;  5AEU B;  1EA2 A;  2Z76 A;  3FGY A;  3H51 A;  1OHO A;  5G2G A;  5BVB A;  1GY7 A;  4K1V A;  5CF2 A;  3JUP A;  1ULJ B;  4R9L A;  2YFL B;  3BLZ A;  3KZT A;  1NWW A;  1ISK A;  1QMA A;  4FCJ A;  3H3H A;  4WWU C;  1U5O A;  2YFJ B;  1JN5 B;  2K54 A;  6STD A;  3CPO A;  3HK4 A;  4HM1 B;  3EC9 A;  3EN1 B;  4J9A A;  3JUO A;  3NV0 A;  4HJL B;  1OHP A;  5HGR A;  4HZB B;  1E97 A;  4HM0 B;  1O7P B;  3EQQ B;  4R9K A;  3ER7 A;  2CHC A;  1OH0 A;  3B8L A;  5FW5 A;  3HZP A;  3A76 A;  2BMQ B;  1K41 A;  4L7K A;  1Q40 A;  2HMK B;  3Q90 A;  3ROB A;  2QIY A;  5JPU A;  1BUQ A;  2B24 B;  1JN5 A;  3HX8 A;  1HKX A;  2GBW B;  2PZV A;  1ASK A;  4KVH A;  1Q42 A;  3B4P A;  3MG1 A;  3EN8 A;  1O7M B;  3OV4 A;  1GY5 A;  2STD A;  3S5C A;  8CHO A;  4X2H A;  4XBX A;  1ZO2 A;  4IIA A;  1AR0 A;  1W02 A;  2B1X B;  2RCD A;  5CK6 A;  3MG2 A;  4RZM A;  4HM3 B;  3VSY A;  5KP1 A;  3OWU A;  5STD A;  1A2K A;  3F8X A;  4HKV B;  2GEY A;  4K1U A;  2HMO B;  1OCV A;  1W00 A;  2YFI B;  2GBX B;  3DZL A;  2RGQ A;  1OUN A;  1Z1S A;  5D83 A;  5IG0 A;  2RFR A;  4HM8 B;  1JKG A;  2A15 A;  5EVH A;  1O7G B;  3DM8 A;  5JPP A;  4XBY A;  4HZ9 B;  5BXQ A;  4MJD A;  4XBT A;  3DUK A;  1WQL B;  3UNL A;  2XR8 B;  1W01 A;  4HM2 B;  4LGQ A;  5KP3 A;  3MKI A;  4HM4 B;  1OF5 A;  3FLJ A;  3MSO A;  1VZZ A;  3VGN A;  3NXJ A;  3NBR A;  1O7W B;  3OWS A;  3B7C A;  4Q53 A;  4XM4 A;  4L8O A;  5AI1 A;  4J8T A;  3OXA A;  5KP4 A;  2GEX A;  4H3U A;  4HVN A;  3KKG A;  1EG9 B;  4FCM A;  5IEN A;  2XRX B;  2BNG A;  3EJV A;  2XSH B;  1S5A A;  2BMO B;  5AIG A;  4OVM A;  5AII A;  3F7X A;  3SOY A;  3GZX B;  2JQ5 A;  1GY6 A;  3DXO A;  3JUN A;  1NU3 A;  4XDW A;  3G16 A;  3CNX A;  3MG3 A;  3JUM A;  4OUQ A;  3D9R A;  5AEW B;  1IDP A;  1NDO B;  2W2C A;  1C7H A;  4U13 A;  1E3R A;  4HM5 B;  3NM2 A;  3NUV A;  4L8P A;  1JB4 A;  2HMN B;  4I4K A;  3FZW A;  5DRV A;  1UUW B;  4XDV A;  3GZB A;  1UUV B;  2I9W A;  3MHE A;  3FF2 A;  4X2O A;  3STD A;  5IG3 A;  1QJG A;  5CF1 A;  2R4I A;  3GRD A;  5IER A;  3KE7 A;  4XB5 A;  3NV0 B;  5IG4 A;  4LEH A;  1DMN A;  3G0K A;  3RGR A;  3RGA A;  1STD A;  2GXF A;  1OGX A;  1O7H B;  1JB2 A;  4R1K A;  3OX9 A;  1ZX2 A;  3UJM A;  2Z7A A;  3IPT A;  4PEJ A;  7STD A;  2F99 A;  3NHX A;  3F14 A;  5D81 A;  3FF0 A;  4WYK B;  3F8H A;  1TUH A;  3FSD A;  4CDL A;  1Q40 B;  3LYG A;  3G8Z A;  3I0Y A;  4N3V A;  1O7N B;  2HML B;  4LMI A;  3DMC A;  2BMR B;  4GB5 A;  1DMQ A;  1OGZ A;  2OWP A;  3MYT A;  1SJW A;  2QGU A;  2CKF B;  1TP6 A;  3F7S A;  5CLK A;  1W6Y A;  2F98 A; 
#chains in the Genus database with same CATH topology
 1YVB I;  1OHS A;  3K0Z A;  3WMD A;  4HM7 B;  3F9S A;  3GWR A;  3KSP A;  1YVS A;  3K7C A;  2SAR A;  4BL2 A;  1EKM A;  5IG5 A;  2L1S A;  2E2T A;  2OTL 3;  1G96 A;  5GSP A;  2D1W A;  5IEP A;  2SBL A;  1ULI B;  1RGG A;  1SPU A;  3RDE A;  3E99 A;  2XGN A;  1FGQ A;  2CK3 H;  3SYU A;  1B3S A;  1RRH A;  3GZR A;  1OAC A;  3BB9 A;  3NM7 A;  1BNJ A;  3FG1 A;  1GYB A;  5DRE A;  1GMP A;  1VQQ A;  4KFE A;  3U1W A;  4HAA A;  2E2U A;  2CWU A;  1N5P A;  2YX9 A;  4RNY A;  5IEO A;  2CWT A;  4N6N B;  3CME 3;  1C54 A;  5AIF A;  5TGN A;  2HMM B;  1ROV A;  2Q07 A;  2CC3 A;  2KF3 A;  5CXO A;  5AIH A;  5BIR A;  3EHC A;  1D6Z A;  1UUG B;  2Z77 A;  3B4O A;  2UX0 A;  5HOH A;  1RGF A;  3JUQ A;  1BNR A;  3MPH A;  5IF6 A;  3CD6 3;  3CNM A;  2CFD A;  3X3Z A;  1WNH A;  1QAL A;  3EBT A;  3TDG A;  2CG0 A;  1K8A 4;  4OK0 A;  1IK3 A;  3BIR A;  4WYK A;  4O8S A;  1JZD A;  3LXU X;  1OPY A;  4K61 A;  3SVA A;  4STD A;  1JKG B;  2W6J H;  1HU9 A;  1UI7 A;  1WTH A;  4FMC A;  1X1Y A;  1M90 4;  1JB5 A;  1E3V A;  2XSO B;  1UCJ A;  3FKA A;  4TX4 A;  1BNG A;  2RSX A;  1A67 A;  2OCT A;  1JV2 B;  1X1U A;  4N6T A;  3D4A A;  4KFD A;  1B2S A;  3GAX A;  1I2F A;  3OWY A;  1W4N A;  4ORL A;  5D82 A;  5LC7 A;  3T8U A;  1UCK A;  1CQS A;  3WOE B;  3SLU A;  2HMJ B;  1RSN A;  3PCR A;  4BU4 A;  1VQL 3;  2IA7 A;  3L0R A;  4MEI A;  3LZA A;  3GZY B;  1A2P A;  3O8Y A;  4N6U A;  2OTJ 3;  3T8N A;  1G02 A;  1LOY A;  1EQK A;  2CFK A;  3EBY A;  3D5G A;  3EF8 A;  4HM6 B;  4CPK A;  1J2B A;  3ECF A;  3SOA A;  3AMO B;  3G6E 3;  1B21 A;  1TJD A;  3AGO A;  3EX9 A;  3CCM 3;  1DMM A;  1VQ7 3;  1RGL A;  4WP5 A;  1BSA A;  3S29 A;  5I97 A;  1Y4K A;  3F40 A;  1JJ2 2;  1A90 A;  1TRQ A;  3LH4 A;  2P09 A;  1LOX A;  1FA3 A;  4EYC A;  1OF5 B;  4N6O B;  1GS3 A;  4HYZ A;  3SED A;  1KWI A;  2IMJ A;  2ZL8 A;  3RNT A;  1FYS A;  3I56 3;  2INX A;  4WFO A;  4RNT A;  1RN4 A;  3NQZ A;  1VQ9 3;  2F86 B;  3CU3 A;  5RNT A;  1UCL A;  1BGS A;  3IMA B;  1RNB A;  3FH1 A;  2F5W A;  1B2M A;  1VQP 3;  2KF6 A;  2UUG C;  3M8C A;  4LZI A;  5AEU B;  1CYV A;  1TTO A;  1MGW A;  3LT9 A;  1UCI A;  5A0O B;  1EA2 A;  2Z76 A;  3FGY A;  5ELU A;  1T2H A;  3H51 A;  1OHO A;  4EBG A;  5G2G A;  2C4B A;  4MMZ B;  5BVB A;  1Q81 4;  1BNS A;  1GY7 A;  1MNL A;  1TFO A;  2C11 A;  3N9H A;  4K1V A;  1IQX A;  1EEJ A;  4EV2 A;  1DVC A;  5CF2 A;  1JBS A;  4EW5 A;  3JUP A;  1N9J A;  1DE3 A;  6RNT A;  1ULJ B;  3DGO A;  4R9L A;  2YFL B;  3BLZ A;  1TFK A;  4AKY A;  3KZT A;  3LOY A;  2ZDJ A;  1NWW A;  2CH9 A;  1IVW A;  1RTU A;  1T2I A;  1RHL A;  1ISK A;  1QMA A;  3HI7 A;  4KT3 B;  3CPW 2;  1I70 A;  1IQY A;  1BNE A;  3H3H A;  4FCJ A;  3D5I A;  2XH9 A;  2K3D A;  1FUT A;  3V92 A;  1LRA A;  1ZGX A;  4WWU C;  1BRS A;  1CH0 A;  3ZG5 A;  1U5O A;  4LYL B;  2KF4 A;  1M1X B;  2YFJ B;  1JN5 B;  1W6G A;  2CFL A;  2IUK A;  2K54 A;  1MOL A;  6STD A;  3CPO A;  3HII A;  4HOH A;  4CCV A;  3J7Y d;  3HK4 A;  1BRG A;  4GSP A;  2P05 A;  4HM1 B;  1RCL A;  3WOD G;  3X42 A;  1BIR A;  3MWZ A;  4NPB A;  3EC9 A;  3EN1 B;  1FGT A;  5G1L A;  4J9A A;  3JUO A;  3NV0 A;  2OQE C;  3G4S 3;  1KQS 2;  4HJL B;  1OHP A;  3DGN A;  5HGR A;  2BO9 B;  1Q7H A;  3LTA A;  1CEW I;  2CFW A;  3U97 A;  1MGR A;  4HZB B;  1E97 A;  2LQV A;  4HM0 B;  1Q7Y 4;  1I2G A;  1O7P B;  3EQQ B;  3FG3 A;  1RN1 A;  4R9K A;  3CCU 3;  3FG4 A;  3UL5 A;  2O9U X;  1GD3 A;  1I8V A;  3NBB A;  4WHA A;  3ER7 A;  2CHC A;  3Q1C A;  1V58 A;  2H0G A;  2WO0 A;  3CC4 3;  2M7O A;  3FCS B;  2K0M A;  1OH0 A;  3X3Y A;  3B8L A;  3CCJ 3;  4QWT A;  1D6Y A;  5FW5 A;  1BRH A;  3D3L A;  3HZP A;  3A76 A;  4HBR A;  2BHM A;  3CCV 3;  2FNQ A;  1L5G B;  1MWT A;  3BND A;  2BT3 A;  1RMS A;  2BMQ B;  3UL6 A;  3N54 B;  1NO3 A;  1FUS A;  1FZU A;  1K41 A;  5M18 A;  3CCL 3;  3HIG A;  1VQ8 3;  1AVK A;  4L7K A;  1Q40 A;  1KD1 4;  2ML6 A;  1N8R 4;  1SII A;  3IJE B;  3AHW A;  1M9G A;  2HMK B;  1SQW A;  3Q90 A;  1RNT A;  4DKI A;  3ROB A;  1TU5 A;  2QIY A;  1AV4 A;  2W56 B;  5JPU A;  1BUQ A;  4BTX A;  2B24 B;  1JN5 A;  3HX8 A;  1LXE A;  1UDI I;  1HKX A;  2GBW B;  2P0M A;  1YHQ 3;  1W2Z A;  5IW9 A;  5G1K A;  1BNI A;  2OOV C;  2PZV A;  3KFQ C;  1NJI 4;  3EB8 A;  4EV5 A;  1IQ8 A;  1ASK A;  3WA2 X;  3X41 A;  1VQ5 3;  4KVH A;  4KFF A;  1BSC A;  1IT8 A;  1LNI A;  1Q42 A;  1PY3 A;  3B4P A;  3EE1 A;  3MG1 A;  3EN8 A;  1BRI A;  1O7M B;  4GL6 A;  3V99 A;  1VQO 3;  4FMB A;  1EUI C;  3OV4 A;  1FGR A;  2MC8 A;  1ZS7 A;  1GY5 A;  2STD A;  3S5C A;  1BSD A;  8CHO A;  1GMQ A;  1R4C A;  4X2H A;  2FGT A;  4XBX A;  1GMR A;  1ZO2 A;  2AAE A;  4IIA A;  4GHO A;  2QA4 3;  1AR0 A;  1YJW 3;  1W02 A;  2B1X B;  2RCD A;  5CK6 A;  1LQM B;  3WHO A;  4MMY B;  1IV7 A;  1LVN A;  3MG2 A;  2ZA4 A;  1AVL A;  1BRK A;  3DGM A;  1A2V A;  4HM3 B;  4RZM A;  3OWU A;  3VSY A;  5KP1 A;  1QVF 2;  5STD A;  1A2K A;  1JNQ A;  1MWR A;  1R4Y A;  4K90 B;  4KZ1 A;  1K9M 4;  3F8X A;  3CCR 3;  1Q86 4;  4N6V 0;  4HKV B;  2CX0 A;  2GEY A;  3K63 A;  4FMA A;  2HMO B;  4K1U A;  1OCV A;  1VQ4 3;  3URP A;  1W00 A;  2YFI B;  1BAO A;  1RGH A;  2GBX B;  3DZL A;  2RGQ A;  1STF I;  1OUN A;  2HOH A;  1CYU A;  1Z1S A;  2JDI H;  1B2X A;  7GSP A;  5D83 A;  2XEP A;  1VQ6 3;  3QRD A;  5IG0 A;  3D79 A;  1IT7 A;  2ZHX B;  2RFR A;  4LSO A;  4FR9 A;  2MF7 A;  4HM8 B;  9RNT A;  1JKG A;  1RLS A;  2A15 A;  5M19 A;  2WGQ A;  5EVH A;  1O7G B;  4I5Q A;  2OQE A;  2RBI A;  3DM8 A;  5JPP A;  1UGI A;  1W6C A;  2F56 A;  1RN7 A;  1I0V A;  4XBY A;  2GU3 A;  3LT8 A;  2CWV A;  7RNT A;  4HZ9 B;  1BAN A;  3UB1 A;  5BXQ A;  4MJD A;  3CXC 2;  1FW7 A;  1RGA A;  3CCE 3;  1S72 3;  1RGE A;  4XBT A;  2RNT A;  1WQL B;  3DUK A;  3PXM A;  3UNL A;  4O2H A;  4G1M B;  2XR8 B;  1W01 A;  2Y73 A;  3AMO A;  1NNV A;  3Q3F A;  4HM2 B;  4LGQ A;  1BNF A;  3CMA 3;  2ML5 A;  3LTD A;  3SXX A;  1RJO A;  5KP3 A;  3MKI A;  3KCH A;  2KCD A;  2V1L A;  3PCS A;  2XFT A;  4HM4 B;  1IU7 A;  1GOV A;  1OF5 A;  3FLJ A;  1K73 4;  3LML A;  1GOU A;  1D6U A;  3MSO A;  1VZZ A;  4R4K A;  3VGN A;  1IVV A;  3GSP A;  1I2E A;  3NXJ A;  3NBR A;  1N5H A;  1O7W B;  3Q2P A;  3OWS A;  3B7C A;  5M1A A;  4Q53 A;  4BTY A;  4XM4 A;  4L8O A;  1I0X A;  1RCK A;  4FCZ A;  5AI1 A;  4ILF A;  4J8T A;  3OXA A;  5ELJ A;  5AYS C;  3WDG B;  3WA3 A;  1G0T A;  5KP4 A;  1YJN 3;  2Y74 A;  3KSE D;  3KN4 A;  5EQL A;  4AEQ A;  2GEX A;  4H3U A;  1NB3 I;  2W9P A;  4HVN A;  4O02 B;  1BRJ A;  3CCS 3;  1NB5 I;  3KKG A;  2QEX 3;  1B20 A;  1PFP A;  4BL3 A;  3T0U A;  3CCQ 3;  1EG9 B;  1W7C A;  1B27 A;  1HZ1 A;  4FCM A;  5IEN A;  2LYX A;  3K9M C;  3X3X A;  3A5E A;  1I3F A;  3X40 A;  3S28 A;  2XRX B;  2BNG A;  2KAA A;  8RNT A;  3EJV A;  3DH2 A;  3KII A;  4N6M A;  2WGO A;  5AYR B;  3ZG0 A;  3WR2 A;  2KRT A;  1M1K 4;  2XSH B;  1S5A A;  2OOV A;  2BMO B;  5AIG A;  3CC2 3;  1JBR A;  2BU4 A;  4NRE A;  1RGC A;  4OVM A;  1V57 A;  1YGW A;  2KF5 A;  5AII A;  2XGL A;  3F7X A;  2GSP A;  1N9E A;  3SOY A;  3AHS A;  3GZX B;  1X1W A;  2JQ5 A;  3K5T A;  5EEO A;  3S27 A;  1GY6 A;  3DXO A;  1MWS A;  3V98 A;  3JUN A;  1LOV A;  1NU3 A;  4XDW A;  1YJ9 3;  2J8X B;  3LTB A;  2XF3 A;  3G16 A;  3CNX A;  4JRF A;  1RGK A;  1U8C B;  3MG3 A;  3JUM A;  1YIJ 3;  3DGL A;  2E2V A;  3PYJ A;  3PZW A;  3BNB A;  4OUQ A;  3D9R A;  4IPB A;  5AEW B;  1K28 A;  3NQY A;  1IDP A;  4JF8 A;  4AKZ A;  5BU4 A;  3LTC A;  1YIT 3;  2F5M A;  3HOH A;  1NDO B;  2W2C A;  1C7H A;  2GU1 A;  1E3R A;  2R41 A;  1GOY A;  3NM2 A;  2D42 A;  4HM5 B;  4U13 A;  3OW2 2;  1JBT A;  3NUV A;  4L8P A;  2XFS A;  1JB4 A;  1BVI A;  1DVD A;  4RBN A;  3BNC A;  1YGE A;  3BNE A;  1WMN A;  4ZM8 A;  1DYU A;  2HMN B;  3N8B A;  1FUW A;  1WMP A;  4BIR A;  4I4K A;  2W0Q A;  3FZW A;  3PS8 A;  1UUW B;  4XDV A;  5DRV A;  3GZB A;  1UUV B;  2I9W A;  5LC6 A;  3MHE A;  1BSE A;  1BUJ A;  1B2Z A;  1IVX A;  1DET A;  1T3B A;  2H0I A;  2W9Q A;  3VF1 A;  3ZFZ A;  3FF2 A;  2CW9 A;  4RNZ A;  4X2O A;  1QAK A;  2UGI A;  2Z6B A;  1Q9E A;  4MMX B;  1KC8 4;  3STD A;  1JRQ A;  4IT7 A;  5IG3 A;  1QJG A;  5CF1 A;  1UI8 A;  2H0H A;  2R4I A;  1IYY A;  1VQK 3;  1F8N A;  3GRD A;  2BIR A;  5IER A;  2KXG A;  3KE7 A;  1RKY A;  4XB5 A;  3NV0 B;  5IG4 A;  4LEH A;  1DMN A;  2IY2 A;  1FGM A;  1GSP A;  1W5Z A;  3G0K A;  1W2B 2;  1JZO A;  1BU4 A;  3G71 3;  1IVU A;  1SIH A;  3RGR A;  1BOX A;  3DGY A;  1LQG C;  1PYL A;  3RGA A;  1YNV X;  1HYF A;  1KSI A;  1STD A;  1TIJ A;  1OGX A;  2GXF A;  1MWU A;  3ALA A;  3I55 3;  1BRN L;  2PNC A;  1AQZ A;  4EXR A;  1O7H B;  1JB2 A;  2W03 A;  1YI2 3;  3JVC A;  1V74 A;  4R1K A;  1QAF A;  3OX9 A;  3PGB A;  1IV9 A;  1ZX2 A;  1BSB A;  3UJM A;  1VQM 3;  4H61 A;  2CX1 A;  2Z7A A;  1LOW A;  3IPT A;  3NX0 A;  4BTW A;  1ROA A;  2W56 A;  4R80 A;  1T5Y A;  2P38 A;  4PEJ A;  1PU4 A;  2O3O A;  7STD A;  2W04 A;  4N6L A;  2F99 A;  4J5K A;  1X1X A;  3SX1 A;  5FGO A;  3NHX A;  3F14 A;  1LNH A;  5D81 A;  2F4Y A;  1GD4 A;  2FXT A;  6GSP A;  3FF0 A;  1N8Q A;  4WYK B;  3F8H A;  2AAD A;  1TUH A;  1Q82 4;  3FSD A;  1VQN 3;  4CDL A;  1Q40 B;  3LYG A;  3G8Z A;  3QK9 A;  1TRP A;  5JBS A;  1WMO A;  3I0Y A;  4CJN A;  4N3V A;  1O7N B;  1QVG 2;  2HML B;  4O3V A;  4NHF A;  4LMI A;  3BU4 A;  4J5G A;  1RRL A;  1B2U A;  3DMC A;  2IUJ A;  1UGH I;  2BMR B;  4FMD A;  4GB5 A;  1DMQ A;  1OGZ A;  2WOH A;  1SAR A;  2CG1 A;  2OWP A;  3MYT A;  1SJW A;  2QGU A;  2L4V A;  2CKF B;  2WOF A;  2CFG A;  1TP6 A;  3F7S A;  1I3I A;  1FGO A;  2IYJ A;  2C10 A;  3NBJ A;  5CLK A;  4EC6 A;  1W6Y A;  3S67 A;  3CC7 3;  3WOF B;  3DY5 A;  2F98 A;  1UW1 A;  1AY7 A;  3AGN A;  2P0X A;  2CIU A;  1RDS A;  1US1 A; 
#chains in the Genus database with same CATH homology
 1YVB I;  1OHS A;  3K0Z A;  3WMD A;  4HM7 B;  3F9S A;  3GWR A;  3KSP A;  3K7C A;  1EKM A;  5IG5 A;  2E2T A;  2OTL 3;  1G96 A;  2D1W A;  5IEP A;  2SBL A;  1ULI B;  1SPU A;  3RDE A;  3E99 A;  2XGN A;  1FGQ A;  2CK3 H;  1RRH A;  3GZR A;  1OAC A;  3BB9 A;  3NM7 A;  3FG1 A;  1GYB A;  5DRE A;  3U1W A;  4KFE A;  2E2U A;  2CWU A;  1N5P A;  2YX9 A;  4RNY A;  5IEO A;  2CWT A;  4N6N B;  3CME 3;  5AIF A;  5TGN A;  2HMM B;  1ROV A;  2Q07 A;  2CC3 A;  5AIH A;  5CXO A;  3EHC A;  1D6Z A;  2Z77 A;  3B4O A;  2UX0 A;  3JUQ A;  3MPH A;  5IF6 A;  3CD6 3;  3CNM A;  2CFD A;  3X3Z A;  1WNH A;  1QAL A;  3EBT A;  3TDG A;  2CG0 A;  1K8A 4;  4OK0 A;  1IK3 A;  4WYK A;  4O8S A;  3LXU X;  1OPY A;  4K61 A;  3SVA A;  4STD A;  1JKG B;  2W6J H;  1HU9 A;  1UI7 A;  1WTH A;  4FMC A;  1M90 4;  1JB5 A;  1E3V A;  2XSO B;  3FKA A;  4TX4 A;  2RSX A;  1A67 A;  2OCT A;  1JV2 B;  4N6T A;  4KFD A;  3GAX A;  4ORL A;  3OWY A;  5D82 A;  1W4N A;  5LC7 A;  3T8U A;  1CQS A;  3WOE B;  3SLU A;  2HMJ B;  3PCR A;  1VQL 3;  2IA7 A;  3L0R A;  4MEI A;  3LZA A;  3GZY B;  3O8Y A;  4N6U A;  2OTJ 3;  3T8N A;  1EQK A;  2CFK A;  3EBY A;  3EF8 A;  4HM6 B;  1J2B A;  3ECF A;  3SOA A;  3AMO B;  3G6E 3;  1VQ7 3;  3EX9 A;  3CCM 3;  1DMM A;  4WP5 A;  3S29 A;  5I97 A;  1Y4K A;  3F40 A;  1JJ2 2;  1A90 A;  3LH4 A;  2P09 A;  1LOX A;  1FA3 A;  4EYC A;  1OF5 B;  4N6O B;  1GS3 A;  4HYZ A;  3SED A;  1KWI A;  2IMJ A;  2ZL8 A;  3I56 3;  2INX A;  4WFO A;  1VQ9 3;  3NQZ A;  2F86 B;  3CU3 A;  3IMA B;  3FH1 A;  1VQP 3;  3M8C A;  4LZI A;  5AEU B;  1CYV A;  3LT9 A;  5A0O B;  1EA2 A;  2Z76 A;  3FGY A;  5ELU A;  3H51 A;  1OHO A;  4EBG A;  5G2G A;  4MMZ B;  1Q81 4;  5BVB A;  1GY7 A;  1MNL A;  2C11 A;  1TFO A;  3N9H A;  4K1V A;  1IQX A;  4EV2 A;  1DVC A;  5CF2 A;  3JUP A;  1N9J A;  1ULJ B;  3DGO A;  4R9L A;  2YFL B;  3BLZ A;  1TFK A;  4AKY A;  3KZT A;  3LOY A;  2ZDJ A;  1NWW A;  2CH9 A;  1IVW A;  1ISK A;  1QMA A;  3HI7 A;  3CPW 2;  1IQY A;  3H3H A;  4FCJ A;  2XH9 A;  3V92 A;  4WWU C;  1U5O A;  1M1X B;  2YFJ B;  1JN5 B;  1W6G A;  2CFL A;  2IUK A;  2K54 A;  1MOL A;  6STD A;  3CPO A;  3HII A;  4CCV A;  3J7Y d;  3HK4 A;  2P05 A;  4HM1 B;  3WOD G;  3X42 A;  3MWZ A;  3EC9 A;  3EN1 B;  1FGT A;  4J9A A;  3JUO A;  3NV0 A;  2OQE C;  3G4S 3;  1KQS 2;  4HJL B;  1OHP A;  3DGN A;  5HGR A;  2BO9 B;  3LTA A;  1CEW I;  2CFW A;  3U97 A;  4HZB B;  1E97 A;  2LQV A;  4HM0 B;  1Q7Y 4;  1O7P B;  3EQQ B;  3FG3 A;  4R9K A;  3CCU 3;  3FG4 A;  3UL5 A;  2O9U X;  1GD3 A;  3NBB A;  4WHA A;  3ER7 A;  2CHC A;  3Q1C A;  2WO0 A;  3CC4 3;  2M7O A;  3FCS B;  2K0M A;  1OH0 A;  3X3Y A;  3B8L A;  3CCJ 3;  4QWT A;  1D6Y A;  5FW5 A;  3D3L A;  3HZP A;  3A76 A;  4HBR A;  2BHM A;  3CCV 3;  2FNQ A;  1L5G B;  3BND A;  2BT3 A;  2BMQ B;  3UL6 A;  3N54 B;  1NO3 A;  1K41 A;  3CCL 3;  1VQ8 3;  3HIG A;  1AVK A;  4L7K A;  1Q40 A;  1KD1 4;  2ML6 A;  1N8R 4;  1SII A;  3IJE B;  1M9G A;  2HMK B;  1SQW A;  3Q90 A;  3ROB A;  1TU5 A;  2QIY A;  1AV4 A;  2W56 B;  5JPU A;  1BUQ A;  4BTX A;  2B24 B;  1JN5 A;  3HX8 A;  1LXE A;  1HKX A;  2GBW B;  2P0M A;  1YHQ 3;  1W2Z A;  5IW9 A;  2OOV C;  2PZV A;  3KFQ C;  1NJI 4;  3EB8 A;  4EV5 A;  1IQ8 A;  1ASK A;  3WA2 X;  3X41 A;  1VQ5 3;  4KVH A;  4KFF A;  1IT8 A;  1Q42 A;  3B4P A;  3MG1 A;  3EE1 A;  3EN8 A;  1O7M B;  4GL6 A;  3V99 A;  1VQO 3;  4FMB A;  3OV4 A;  1FGR A;  2MC8 A;  1GY5 A;  2STD A;  3S5C A;  8CHO A;  1R4C A;  4X2H A;  2FGT A;  4XBX A;  1ZO2 A;  4IIA A;  2QA4 3;  1AR0 A;  1YJW 3;  1W02 A;  2B1X B;  2RCD A;  5CK6 A;  4MMY B;  1IV7 A;  1LVN A;  3MG2 A;  4HM3 B;  1AVL A;  4RZM A;  3DGM A;  1A2V A;  3VSY A;  5KP1 A;  3OWU A;  1QVF 2;  5STD A;  1A2K A;  1JNQ A;  4K90 B;  4KZ1 A;  1K9M 4;  3F8X A;  3CCR 3;  1Q86 4;  4N6V 0;  4HKV B;  2GEY A;  3K63 A;  4FMA A;  2HMO B;  4K1U A;  1OCV A;  1VQ4 3;  1W00 A;  2YFI B;  2GBX B;  3DZL A;  2RGQ A;  1STF I;  1OUN A;  1CYU A;  1Z1S A;  2JDI H;  5D83 A;  2XEP A;  1VQ6 3;  3QRD A;  5IG0 A;  1IT7 A;  2RFR A;  4LSO A;  4FR9 A;  2MF7 A;  4HM8 B;  1JKG A;  2A15 A;  2WGQ A;  5EVH A;  1O7G B;  2OQE A;  3DM8 A;  5JPP A;  1W6C A;  1RN7 A;  4XBY A;  2GU3 A;  3LT8 A;  2CWV A;  4HZ9 B;  3UB1 A;  5BXQ A;  3CXC 2;  4MJD A;  3CCE 3;  1S72 3;  4XBT A;  3DUK A;  1WQL B;  3PXM A;  3UNL A;  4O2H A;  4G1M B;  2XR8 B;  1W01 A;  2Y73 A;  3AMO A;  4HM2 B;  4LGQ A;  3CMA 3;  2ML5 A;  3LTD A;  3SXX A;  1RJO A;  5KP3 A;  3MKI A;  2KCD A;  2V1L A;  3PCS A;  2XFT A;  4HM4 B;  1IU7 A;  1OF5 A;  3FLJ A;  1K73 4;  3LML A;  3MSO A;  1D6U A;  1VZZ A;  4R4K A;  3VGN A;  3NXJ A;  3NBR A;  1N5H A;  1O7W B;  3Q2P A;  3OWS A;  3B7C A;  4Q53 A;  4BTY A;  4XM4 A;  4L8O A;  4FCZ A;  5AI1 A;  5ELJ A;  4J8T A;  3OXA A;  5AYS C;  3WDG B;  1YJN 3;  3WA3 A;  5KP4 A;  2Y74 A;  3KSE D;  3KN4 A;  5EQL A;  4AEQ A;  2GEX A;  4H3U A;  1NB3 I;  2W9P A;  4HVN A;  4O02 B;  3CCS 3;  1NB5 I;  3KKG A;  2QEX 3;  1PFP A;  3T0U A;  3CCQ 3;  1EG9 B;  1W7C A;  4FCM A;  5IEN A;  2LYX A;  3K9M C;  3X3X A;  3X40 A;  3S28 A;  2XRX B;  2BNG A;  3EJV A;  3KII A;  4N6M A;  5AYR B;  2WGO A;  2KRT A;  1M1K 4;  2XSH B;  1S5A A;  2OOV A;  2BMO B;  5AIG A;  3CC2 3;  4NRE A;  4OVM A;  5AII A;  2XGL A;  3F7X A;  1N9E A;  3SOY A;  3GZX B;  2JQ5 A;  3K5T A;  5EEO A;  3S27 A;  1GY6 A;  3DXO A;  3V98 A;  3JUN A;  1NU3 A;  4XDW A;  1YJ9 3;  3LTB A;  2XF3 A;  3G16 A;  3CNX A;  4JRF A;  1U8C B;  3MG3 A;  3JUM A;  1YIJ 3;  3DGL A;  2E2V A;  3PYJ A;  3PZW A;  3BNB A;  4OUQ A;  3D9R A;  4IPB A;  5AEW B;  1K28 A;  3NQY A;  1IDP A;  4JF8 A;  4AKZ A;  3LTC A;  1YIT 3;  1NDO B;  2W2C A;  1C7H A;  2GU1 A;  1E3R A;  4HM5 B;  3NM2 A;  4U13 A;  2D42 A;  3OW2 2;  3NUV A;  4L8P A;  2XFS A;  1JB4 A;  1DVD A;  4RBN A;  3BNC A;  1YGE A;  3BNE A;  1WMN A;  4ZM8 A;  1DYU A;  2HMN B;  3N8B A;  1FUW A;  1WMP A;  4I4K A;  2W0Q A;  3FZW A;  3PS8 A;  1UUW B;  4XDV A;  5DRV A;  3GZB A;  1UUV B;  2I9W A;  5LC6 A;  3MHE A;  1IVX A;  2W9Q A;  3VF1 A;  3FF2 A;  2CW9 A;  4RNZ A;  4X2O A;  1QAK A;  2Z6B A;  4MMX B;  1KC8 4;  3STD A;  1JRQ A;  4IT7 A;  5IG3 A;  1QJG A;  5CF1 A;  1UI8 A;  2R4I A;  1VQK 3;  1F8N A;  3GRD A;  5IER A;  2KXG A;  3KE7 A;  1RKY A;  4XB5 A;  3NV0 B;  5IG4 A;  4LEH A;  1DMN A;  1FGM A;  1W5Z A;  3G0K A;  1W2B 2;  3G71 3;  1IVU A;  1SIH A;  3RGR A;  3RGA A;  1KSI A;  1STD A;  1TIJ A;  2GXF A;  3ALA A;  1OGX A;  3I55 3;  2PNC A;  4EXR A;  1O7H B;  1JB2 A;  2W03 A;  1YI2 3;  3JVC A;  1V74 A;  4R1K A;  1QAF A;  3OX9 A;  3PGB A;  1IV9 A;  1ZX2 A;  3UJM A;  1VQM 3;  4H61 A;  2Z7A A;  3NX0 A;  3IPT A;  4BTW A;  1ROA A;  2W56 A;  4R80 A;  1T5Y A;  2P38 A;  4PEJ A;  1PU4 A;  2O3O A;  7STD A;  2W04 A;  4N6L A;  2F99 A;  3SX1 A;  5FGO A;  3NHX A;  3F14 A;  1LNH A;  5D81 A;  1GD4 A;  2FXT A;  3FF0 A;  1N8Q A;  4WYK B;  3F8H A;  1TUH A;  1Q82 4;  3FSD A;  1VQN 3;  4CDL A;  1Q40 B;  3LYG A;  3G8Z A;  3QK9 A;  5JBS A;  1WMO A;  3I0Y A;  4N3V A;  1O7N B;  1QVG 2;  2HML B;  4O3V A;  4NHF A;  4LMI A;  1RRL A;  3DMC A;  2IUJ A;  2BMR B;  4FMD A;  4GB5 A;  1DMQ A;  1OGZ A;  2WOH A;  2CG1 A;  2OWP A;  3MYT A;  1SJW A;  2QGU A;  2L4V A;  2CKF B;  2WOF A;  2CFG A;  1TP6 A;  3F7S A;  5CLK A;  1FGO A;  3NBJ A;  2C10 A;  3CC7 3;  4EC6 A;  1W6Y A;  3S67 A;  3WOF B;  3DY5 A;  2F98 A;  1UW1 A;  2P0X A;  2CIU A;  1IVV A;  1US1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...