4HJLB

Naphthalene 1,2-dioxygenase bound to 1-chloronaphthalene
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
192
Chain Sequence
b'INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to 1-chloronaphthalene
rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 57
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hjlB00
3K7CA 1O7NB 3EBTA 5BXQA 4WYKA 2GBWB 1W00A 5BVBA 3KZTA 1QMAA 4X2OA 3FLJA 4HM3B 5IF6A 5D81A 5AIIA 1EA2A 5DREA 4J9AA 3G0KA 5CK6A 3RGRA 1IDPA 3NHXA 2HMNB 5AIGA 3M8CA 1JKGA 2B24B 4XDWA 3T8UA 3EN8A 5JPPA 1DMQA 1NU3A 1JN5B 2BMQB 3DZLA 3BLZA 1O7MB 2IMJA 2HMMB 3G16A 5IG3A 3JUMA 2HMKB 2B1XB 2CHCA 4R9LA 3D9RA 5AIFA 1Z1SA 2PZVA 3WMDA 4U13A 3I0YA 1OH0A 3KKGA 3SOAA 2Z76A 4HVNA 1OHPA 3B4OA 1OGXA 3EJVA 4HM8B 5IG5A 1OPYA 4OUQA 3FF0A 3LYGA 4Q53A 4CDLA 4OVMA 3FGYA 5IG0A 5TGNA 1E97A 1O7GB 4LEHA 3NUVA 1Q42A 3MG3A 2STDA 2GEXA 5FW5A 3JUQA 5AEUB 3B8LA 2INXA 1AR0A 4STDA 3UNLA 5AIHA 1TUHA 4XBYA 3F8XA 2CKFB 3JUOA 2RFRA 1DMNA 3F40A 3T8NA 3FSDA 4LGQA 1JB2A 3DUKA 1OF5B 3CNXA 3H51A 1OUNA 3F7SA 3VGNA 4X2HA 3CPOA 4FCMA 4WYKB 5JPUA 1A2KA 1HKXA 3OX9A 1W02A 4HM2B 2HMOB 3EBYA 2UX0A 3F9SA 1QJGA 3NBRA 3FH1A 3MSOA 4XBXA 5KP3A 2YFIB 4N3VA 1DMMA 3OWSA 3EX9A 5IERA 1U5OA 2W2CA 1K41A 3FKAA 4HM7B 4I4KA 1JB5A 3F8HA 1Q40A 3K0ZA 3NM2A 1O7PB 4HJLB 3MKIA 1ASKA 8CHOA 5G2GA 1VZZA 1ULIB 1WQLB 2XSHB 2JQ5A 3RGAA 3ECFA 3GZXB 2Z77A 2F99A 2K54A 3MG1A 1GS3A 5IENA 4L8OA 5AI1A 5IEOA 4XBTA 4XM4A 1NWWA 1GYBA 3OWYA 5D83A 4WP5A 2GEYA 5HGRA 5STDA 3MYTA 1S5AA 3OXAA 4HKVB 3HX8A 4XDVA 3EN1B 2QGUA 3KE7A 1ZO2A 7STDA 1W6YA 3NV0B 3EHCA 4R1KA 2XRXB 2BNGA 1ISKA 3GRDA 3F14A 1GY5A 1EG9B 2QIYA 3EQQB 1GY6A 3OV4A 4HZBB 5IG4A 3JUPA 4LMIA 2YFJB 4KVHA 5EVHA 1UUVB 4XB5A 3H3HA 1NDOB 3FZWA 5KP1A 3VSYA 4HM1B 3DMCA 5CLKA 3SEDA 3A76A 5AEWB 4IIAA 3GWRA 4K1UA 3S5CA 4HM4B 3CU3A 2F86B 3SOYA 1GY7A 6STDA 3IPTA 1UUWB 1OCVA 4MJDA 2YFLB 3NXJA 3F7XA 3EC9A 2XSOB 3GZRA 1JB4A 3HZPA 4WWUC 1JKGB 3STDA 1JN5A 4GB5A 2HMJB 2GXFA 4H3UA 4L8PA 1OHSA 3GZBA 3B4PA 3DM8A 1W01A 3G8ZA 4HM5B 2GBXB 2RGQA 5IEPA 4J8TA 1ZX2A 1BUQA 1E3VA 1Q40B 1ULJB 5CXOA 3HK4A 4ORLA 2BMRB 4HM6B 5D82A 1CQSA 3DXOA 2XR8B 1E3RA 4R9KA 1TP6A 1C7HA 3MG2A 4L7KA 2RCDA 3EF8A 2BMOB 4HZ9B 2OWPA 3GZYB 2A15A 3LZAA 1OHOA 3MHEA 4FCJA 4HM0B 3E99A 4K1VA 1O7WB 3KSPA 3BB9A 1STDA 5CF1A 4PEJA 2Z7AA 4RZMA 2I9WA 3NV0A 5DRVA 2R4IA 2HMLB 3ER7A 1O7HB 3FF2A 5KP4A 2F98A 3CNMA 3UJMA 3JUNA 3B7CA 3OWUA 1OGZA 3ROBA 5CF2A 1OF5A 1SJWA 3Q90A
chains in the Genus database with same CATH superfamily
1GOYA 3PCRA 3CCU3 1W2B2 4MEIA 2OCTA 4EV2A 3K7CA 1O7NB 3EBTA 4FMDA 1BSBA 4LSOA 1TFOA 2ML5A 4CCVA 5BXQA 3S67A 1YJN3 4WYKA 2GBWB 1U8CB 3FCSB 1W00A 4FMBA 5BVBA 5BIRA 3KZTA 1QMAA 1V74A 1N8R4 1TJDA 3LTAA 3FLJA 4HM3B 4X2OA 1MWTA 1MGWA 1LRAA 3S28A 1VQO3 1DVDA 5IF6A 1X1UA 1BRGA 1IVWA 1RSNA 1I0VA 5D81A 1Y4KA 5AIIA 2IYJA 1EA2A 4CJNA 5DREA 4EYCA 4J9AA 1EKMA 2CFGA 3G0KA 5CK6A 3RGRA 3V98A 1IT7A 1IDPA 1YGEA 3NHXA 4N6UA 2HMNB 1CEWI 1GOVA 1RRLA 2IUJA 4K61A 1B20A 5AIGA 3CC43 3M8CA 5M19A 3PZWA 3DGNA 3JVCA 1JKGA 2B24B 1BNJA 1JZDA 3DGMA 4FMCA 3EN8A 2W9QA 4XDWA 1L5GB 3T8UA 5JPPA 2IUKA 1BRJA 1DMQA 2Q07A 2D1WA 1NU3A 1JN5B 1IT8A 1I8VA 1W6GA 2BMQB 3DZLA 1RRHA 1UCLA 3BLZA 1O7MB 1RGKA 4N6TA 1BUJA 4KT3B 2IMJA 2HMMB 3G16A 4ZM8A 1LNHA 3SVAA 5IG3A 1RMSA 3JUMA 3G4S3 2HMKB 3LOYA 1N9JA 2B1XB 2CHCA 3ZG5A 4EW5A 2E2VA 1JBSA 4R9LA 1US1A 5LC6A 3QK9A 2CG1A 3X41A 1TU5A 3FG3A 1VQN3 2ZL8A 1BNSA 3D9RA 5AIFA 4KFFA 3X3YA 2XH9A 1Z1SA 2PZVA 3WMDA 1MWUA 3I0YA 4U13A 3O8YA 1OH0A 3KKGA 1LQGC 3K63A 3SOAA 1B2SA 3AMOA 2ZA4A 4ILFA 2Z76A 1AY7A 1BSAA 3ZG0A 3G713 3BIRA 4HVNA 1OHPA 2CWTA 3CCV3 3NBJA 3V99A 3CMA3 3B4OA 4AEQA 2OTL3 1BIRA 3LTDA 1OGXA 4N6OB 1I2EA 3G6E3 1G96A 2OTJ3 1M904 1I3FA 3DGOA 1BSEA 2C10A 1UGHI 3EJVA 4O2HA 3I563 4HM8B 2CG0A 1OPYA 2WGQA 5IG5A 3WDGB 4OUQA 6RNTA 3FF0A 4JRFA 1CYVA 4N6LA 5BU4A 1IQYA 3LYGA 1KWIA 4DKIA 4Q53A 1B3SA 4CDLA 4MMYB 1YIT3 1MWRA 2H0HA 1NO3A 1IV9A 4OVMA 3D79A 3FGYA 1BRSA 1W5ZA 5IG0A 5TGNA 4LYLB 1E97A 1O7GB 1SARA 4LEHA 3AGNA 2GSPA 3NUVA 2XGLA 1RGFA 2SARA 2E2UA 5ELJA 1N9EA 1Q42A 2P0XA 3AHSA 3MG3A 2STDA 3Q3FA 1IVXA 4K90B 2GEXA 3WA2X 1UW1A 1D6ZA 5FW5A 3X3ZA 1RCLA 1B2UA 1MWSA 1FUTA 2CH9A 4GL6A 4N6NB 2H0GA 1HYFA 3UB1A 1T5YA 2CX1A 1VQQA 1WMOA 3JUQA 2Z6BA 5AEUB 1FYSA 4BTWA 4EV5A 1K734 2CFWA 3KSED 1IK3A 1PFPA 2INXA 3B8LA 5A0OB 1AR0A 4STDA 3UNLA 5AIHA 1RGLA 1RGCA 1TUHA 1BRIA 2CW9A 2OOVC 4XBYA 1K9M4 3WOEB 3KFQC 1SIHA 3F8XA 3HI7A 2CKFB 3BU4A 1RGAA 4BL3A 1NJI4 2BT3A 3JUOA 2L4VA 1SIIA 4KFEA 2RFRA 1YGWA 4HBRA 5M18A 9RNTA 3CCJ3 3CCQ3 1DMNA 2O9UX 3DY5A 3F40A 3FSDA 3T8NA 1STFI 1JB2A 1Q9EA 2ZHXB 1V58A 2GU1A 3DUKA 3EE1A 4LGQA 4NPBA 3CCE3 1BNIA 1OF5B 1QAFA 5I97A 1F8NA 3CNXA 4IT7A 1KD14 3H51A 1OUNA 2KCDA 4HYZA 3F7SA 3VGNA 1T2HA 1BNGA 3AHWA 1YHQ3 2F56A 4X2HA 1YIJ3 1OACA 3CPOA 1DYUA 4FCMA 2J8XB 4WYKB 3X40A 5JPUA 2AAEA 3PXMA 1A2KA 2OQEC 1FGQA 1GMRA 1HKXA 1I3IA 1W02A 3OX9A 1N8QA 3WA3A 2UGIA 1JBTA 1JV2B 4HM2B 2HMOB 1RN7A 3BNEA 1WTHA 3UL5A 3EBYA 1ZGXA 2UX0A 3QRDA 5LC7A 3F9SA 4AKZA 1G02A 1B21A 1QJGA 3NBRA 2QEX3 3FH1A 3MSOA 4XBXA 1B2MA 2BU4A 1RKYA 1BRNL 1A2VA 1AVKA 3T0UA 1X1XA 4O8SA 5KP3A 2W56B 1YJ93 1RNBA 2YFIB 4N3VA 4BL2A 3PGBA 3LTBA 1B2ZA 2MC8A 1LOXA 1VQ73 1CYUA 2QA43 1DMMA 1N5PA 3HIIA 1LQMB 3WR2A 1BGSA 2O3OA 1TRPA 3X42A 3OWSA 1RGHA 2W0QA 2E2TA 3EX9A 3X3XA 5IERA 1RN4A 1U5OA 2W2CA 3EB8A 5AYRB 1LOWA 1VQM3 1K41A 3NBBA 3GAXA 3FKAA 4HM7B 4I4KA 3LH4A 3Q1CA 1JB5A 1MOLA 1FGRA 3F8HA 4JF8A 1Q40A 2HOHA 3K0ZA 3LT8A 6GSPA 1RNTA 3MPHA 3NM2A 1JRQA 3KN4A 1N5HA 3D5GA 2P38A 1O7PB 4HJLB 4RNYA 2XEPA 3V92A 3MKIA 1BNFA 1ASKA 1FZUA 8CHOA 3HIGA 4N6MA 5G2GA 2KXGA 1VZZA 3D3LA 3FG1A 1ULIB 1WQLB 2XSHB 2JQ5A 3RGAA 3ECFA 2XFTA 1AQZA 1LOYA 3AMOB 2CFKA 5GSPA 3I553 3GZXB 4BTXA 2CWUA 2XGNA 2Z77A 2F99A 2K54A 1GD4A 2C4BA 3MG1A 2K3DA 4WFOA 3CC23 1BSDA 2GU3A 3IJEB 1GS3A 3LXUX 1DETA 5IENA 4L8OA 2PNCA 1UCJA 5AI1A 1EUIC 1MGRA 4R80A 1BVIA 2LYXA 2RSXA 2W03A 1HU9A 1RCKA 1YVSA 5IEOA 4XBTA 4XM4A 1W6CA 1GYBA 1NWWA 3OWYA 4EBGA 4AKYA 5RNTA 2OOVA 1KSIA 1HZ1A 5D83A 4WP5A 2GEYA 1FGMA 2H0IA 3N8BA 5HGRA 3URPA 3VF1A 1D6YA 5STDA 4G1MB 1RN1A 3MYTA 1S5AA 3OXAA 4FCZA 4HKVB 2CX0A 2R41A 3HX8A 3L0RA 4XDVA 1UI7A 3EN1B 2QGUA 3KE7A 3CCS3 3N9HA 1ZO2A 3SLUA 7STDA 4O02B 1CH0A 1IVVA 3CC73 1DE3A 1I0XA 1W6YA 3NV0B 1QAKA 3EHCA 1UI8A 4FMAA 4NHFA 4R1KA 2XRXB 3PS8A 1BANA 1YI23 2BNGA 3GSPA 1ISKA 3DGYA 3GRDA 3F14A 1GY5A 1EG9B 1FGTA 3TDGA 2QIYA 4HOHA 4I5QA 1WMNA 3EQQB 3ALAA 3DH2A 1GY6A 3OV4A 4HZBB 2CC3A 5IG4A 2IA7A 3JUPA 1BNRA 4LMIA 2XF3A 4GSPA 2OQEA 2YFJB 1EEJA 1A67A 2C11A 4KVHA 4O3VA 1IU7A 2LQVA 3RDEA 5EVHA 1UUVB 2UUGC 2YX9A 4N6V0 1BAOA 1PYLA 1VQ63 1IV7A 4XB5A 3H3HA 8RNTA 1A2PA 4KZ1A 1GOUA 1QALA 2FGTA 4EXRA 1A90A 2IY2A 7GSPA 1NDOB 2P0MA 3FZWA 1VQP3 5KP1A 1FA3A 1IVUA 1BSCA 3U1WA 1Q7HA 4GHOA 3NQYA 2Y73A 1JBRA 2WOHA 1FUWA 1RJOA 1VQ93 3VSYA 4HM1B 1B2XA 1BOXA 2WGOA 3DMCA 2Y74A 5CLKA 3SEDA 4CPKA 1S723 1QVG2 3A76A 4KFDA 4EC6A 4J5GA 5AEWB 3CCL3 4IIAA 1M1K4 1T2IA 3HOHA 3OW22 1EQKA 1T3BA 1V57A 3BNCA 3GWRA 4K1UA 3J7Yd 3S5CA 1M9GA 4HM4B 3CU3A 2F86B 2V1LA 4QWTA 3SOYA 1GY7A 6STDA 2CWVA 3IPTA 1VQL3 2FXTA 1UUWB 3ZFZA 1OCVA 3PCSA 4BIRA 1JNQA 1YVBI 1NB5I 1UCKA 2FNQA 3UL6A 1I70A 1LOVA 3IMAB 3D5IA 2W04A 3N54B 1FGOA 1LXEA 3K5TA 2YFLB 4MJDA 3NXJA 3F7XA 3EC9A 2XSOB 3GZRA 4FR9A 1JB4A 3HZPA 3Q2PA 4WWUC 1JKGB 3STDA 2W56A 1W7CA 1QVF2 1JN5A 3D4AA 1SPUA 2KF4A 5IW9A 1GD3A 4GB5A 2HMJB 1Q864 2GXFA 4H3UA 4L8PA 1OHSA 3GZBA 2ZDJA 1ZS7A 3B4PA 1IQ8A 3BNDA 3DM8A 1W01A 1Q7Y4 1RTUA 1SQWA 3BNBA 3LMLA 1Q814 4MMZB 3G8ZA 4HM5B 4IPBA 1BRKA 1C54A 2GBXB 2RGQA 3K9MC 3KCHA 1LNIA 2KF6A 1KC84 3LTCA 1X1WA 4BTYA 1PY3A 1R4YA 1BU4A 2W9PA 5IEPA 1GMQA 2M7OA 2WOFA 1UUGB 4J8TA 2MF7A 1K8A4 3S27A 1ZX2A 2JDIH 3CXC2 1BUQA 1E3VA 1G0TA 1Q40B 1RHLA 1UDII 1ULJB 3PYJA 5CXOA 1LVNA 2F4YA 3NQZA 3HK4A 5JBSA 2F5MA 1RGEA 4RNTA 1AVLA 1VQK3 4ORLA 2BMRB 2P09A 4R4KA 4HM6B 3SYUA 4LZIA 5D82A 1VQ43 1CQSA 3DXOA 1MNLA 4H61A 2XR8B 1RLSA 1E3RA 2BHMA 1VQ53 1UGIA 3NX0A 1Q824 3MWZA 3LT9A 4R9KA 1TP6A 1D6UA 1C7HA 2CIUA 3MG2A 4L7KA 2BO9B 2RCDA 3EF8A 1RDSA 1I2FA 1TTOA 2RNTA 3U97A 1TFKA 5M1AA 1PU4A 2W6JH 3SX1A 2BMOB 5FGOA 2WO0A 4HZ9B 2OWPA 5EEOA 3GZYB 1WMPA 2CK3H 1ROAA 2F5WA 2A15A 4HAAA 4WHAA 1M1XB 5G1LA 3AGOA 3LZAA 1OHOA 2SBLA 2XFSA 2ML6A 3CME3 3CD63 1BNEA 3MHEA 7RNTA 3A5EA 4FCJA 3CCM3 1TIJA 3DGLA 1YNVX 4HM0B 3E99A 1GMPA 5HOHA 1GSPA 1JJ22 4K1VA 1O7WB 3KSPA 3WOFB 3BB9A 1STDA 5CF1A 2CFLA 2P05A 4OK0A 4PEJA 1I2GA 4J5KA 2L1SA 4BU4A 1VQ83 1AV4A 2D42A 3RNTA 2Z7AA 1R4CA 1W4NA 1WNHA 4RZMA 2I9WA 3CPW2 1ROVA 2K0MA 3NV0A 2CFDA 2KF3A 4TX4A 5DRVA 2R4IA 1J2BA 2HMLB 5EQLA 3SXXA 3ER7A 1O7HB 5ELUA 3FG4A 1UCIA 3FF2A 3WODG 5KP4A 1TRQA 2F98A 5G1KA 1RGGA 1NB3I 3CNMA 1BRHA 3UJMA 1FUSA 1JZOA 2BIRA 1B27A 2KRTA 4NREA 3S29A 3JUNA 5AYSC 2AADA 1NNVA 3B7CA 1KQS2 3NM7A 2RBIA 3OWUA 4RNZA 3CCR3 2KF5A 3WHOA 1OGZA 1W2ZA 2KAAA 3ROBA 4MMXB 1FW7A 1IQXA 4RBNA 1IYYA 5CF2A 1YJW3 1K28A 1OF5A 1SJWA 1X1YA 3KIIA 1DVCA 3Q90A
chains in the Genus database with same CATH topology
3PCRA 3CCU3 1W2B2 4MEIA 2OCTA 4EV2A 3K7CA 1O7NB 3EBTA 4FMDA 4LSOA 1TFOA 2ML5A 4CCVA 5BXQA 3S67A 1YJN3 4WYKA 2GBWB 1U8CB 3FCSB 1W00A 4FMBA 5BVBA 3KZTA 1QMAA 1V74A 1N8R4 3LTAA 4X2OA 3FLJA 4HM3B 3S28A 1VQO3 1DVDA 5IF6A 1IVWA 5D81A 1Y4KA 5AIIA 1EA2A 5DREA 4EYCA 4J9AA 1EKMA 2CFGA 3G0KA 5CK6A 3RGRA 3V98A 1IT7A 1IDPA 1YGEA 3NHXA 4N6UA 2HMNB 1CEWI 2IUJA 1RRLA 4K61A 3CC43 5AIGA 3M8CA 3PZWA 3DGNA 3JVCA 1JKGA 2B24B 4XDWA 3DGMA 4FMCA 3EN8A 2W9QA 1L5GB 3T8UA 5JPPA 2IUKA 1DMQA 2Q07A 2D1WA 1NU3A 1JN5B 1IT8A 1W6GA 2BMQB 3DZLA 1RRHA 3BLZA 1O7MB 4N6TA 2IMJA 2HMMB 3G16A 4ZM8A 1LNHA 3SVAA 5IG3A 3JUMA 3G4S3 2HMKB 3LOYA 1N9JA 2B1XB 2CHCA 2E2VA 4R9LA 1US1A 5LC6A 3QK9A 2CG1A 3X41A 1TU5A 3FG3A 1VQN3 2ZL8A 3D9RA 5AIFA 4KFFA 3X3YA 2XH9A 1Z1SA 2PZVA 3WMDA 4U13A 3I0YA 3O8YA 1OH0A 3KKGA 3K63A 3SOAA 3AMOA 2Z76A 3G713 4HVNA 1OHPA 2CWTA 3CCV3 3NBJA 3V99A 3CMA3 3B4OA 4AEQA 2OTL3 3LTDA 1OGXA 4N6OB 3G6E3 1G96A 2OTJ3 1M904 3DGOA 2C10A 3EJVA 4O2HA 3I563 4HM8B 2CG0A 1OPYA 2WGQA 5IG5A 3WDGB 4OUQA 3FF0A 4JRFA 1CYVA 4N6LA 1IQYA 3LYGA 1KWIA 4Q53A 4CDLA 4MMYB 1YIT3 1NO3A 1IV9A 4OVMA 3FGYA 1W5ZA 5IG0A 5TGNA 1E97A 1O7GB 4LEHA 3NUVA 2XGLA 2E2UA 5ELJA 1N9EA 1Q42A 2P0XA 3MG3A 2STDA 1IVXA 4K90B 2GEXA 3WA2X 1UW1A 1D6ZA 5FW5A 3X3ZA 2CH9A 4GL6A 4N6NB 3UB1A 1T5YA 1WMOA 3JUQA 2Z6BA 5AEUB 4BTWA 4EV5A 1K734 2CFWA 3KSED 1IK3A 1PFPA 2INXA 3B8LA 5A0OB 1AR0A 4STDA 3UNLA 5AIHA 1TUHA 2CW9A 2OOVC 4XBYA 1K9M4 3WOEB 3KFQC 1SIHA 3F8XA 3HI7A 2CKFB 1NJI4 2BT3A 3JUOA 2L4VA 1SIIA 4KFEA 2RFRA 4HBRA 3CCJ3 3CCQ3 1DMNA 2O9UX 3DY5A 3F40A 3FSDA 3T8NA 1STFI 1JB2A 4LGQA 3CCE3 2GU1A 3DUKA 3EE1A 1OF5B 1QAFA 5I97A 1F8NA 3CNXA 4IT7A 1KD14 3H51A 1OUNA 2KCDA 4HYZA 3F7SA 3VGNA 1YHQ3 4X2HA 1YIJ3 1OACA 3CPOA 1DYUA 4FCMA 4WYKB 3X40A 5JPUA 3PXMA 1A2KA 2OQEC 1FGQA 1HKXA 3OX9A 1W02A 1N8QA 3WA3A 1JV2B 4HM2B 2HMOB 1RN7A 3BNEA 1WTHA 3UL5A 3EBYA 2UX0A 3QRDA 5LC7A 4AKZA 3F9SA 1QJGA 3NBRA 2QEX3 3FH1A 3MSOA 4XBXA 1RKYA 1A2VA 1AVKA 3T0UA 4O8SA 5KP3A 2W56B 1YJ93 2YFIB 4N3VA 3PGBA 3LTBA 2MC8A 1LOXA 1VQ73 1CYUA 2QA43 1DMMA 1N5PA 3HIIA 2O3OA 3X42A 3OWSA 2W0QA 2E2TA 3EX9A 3X3XA 5IERA 1U5OA 2W2CA 3EB8A 5AYRB 1VQM3 1K41A 3NBBA 3GAXA 3FKAA 4HM7B 4I4KA 3LH4A 3Q1CA 1JB5A 1MOLA 1FGRA 3F8HA 4JF8A 1Q40A 3K0ZA 3LT8A 3MPHA 3NM2A 1JRQA 3KN4A 1N5HA 2P38A 1O7PB 4HJLB 4RNYA 2XEPA 3V92A 3MKIA 1ASKA 8CHOA 3HIGA 4N6MA 5G2GA 2KXGA 1VZZA 3D3LA 3FG1A 1ULIB 1WQLB 2XSHB 2JQ5A 3RGAA 3ECFA 2XFTA 3AMOB 2CFKA 3I553 3GZXB 4BTXA 2CWUA 2XGNA 2Z77A 2F99A 2K54A 1GD4A 3MG1A 3CC23 4WFOA 2GU3A 3IJEB 1GS3A 3LXUX 5IENA 4L8OA 2PNCA 5AI1A 4R80A 2LYXA 2RSXA 2W03A 1HU9A 5IEOA 4XBTA 4XM4A 1W6CA 1GYBA 1NWWA 3OWYA 4EBGA 4AKYA 2OOVA 1KSIA 5D83A 4WP5A 2GEYA 1FGMA 3N8BA 5HGRA 3VF1A 1D6YA 5STDA 4G1MB 3MYTA 1S5AA 3OXAA 4FCZA 4HKVB 3L0RA 3HX8A 4XDVA 1UI7A 3EN1B 2QGUA 3KE7A 3CCS3 3N9HA 1ZO2A 3SLUA 7STDA 4O02B 3CC73 1IVVA 1W6YA 3NV0B 1QAKA 3EHCA 1UI8A 4FMAA 4NHFA 4R1KA 2XRXB 3PS8A 1YI23 2BNGA 1ISKA 3GRDA 3F14A 1GY5A 1EG9B 1FGTA 3TDGA 2QIYA 1WMNA 3EQQB 3ALAA 1GY6A 3OV4A 4HZBB 2CC3A 5IG4A 2IA7A 3JUPA 4LMIA 2XF3A 2OQEA 2YFJB 1A67A 2C11A 4KVHA 4O3VA 1IU7A 2LQVA 3RDEA 5EVHA 1UUVB 2YX9A 4N6V0 1VQ63 1IV7A 4XB5A 3H3HA 4KZ1A 2FGTA 1QALA 4EXRA 1A90A 1NDOB 2P0MA 3FZWA 1VQP3 5KP1A 1FA3A 1IVUA 3U1WA 3NQYA 2Y73A 2WOHA 1FUWA 1RJOA 1VQ93 3VSYA 4HM1B 3DMCA 2WGOA 2Y74A 5CLKA 3SEDA 1S723 1QVG2 3A76A 4KFDA 4EC6A 1M1K4 5AEWB 3CCL3 4IIAA 3OW22 1EQKA 3BNCA 3GWRA 4K1UA 3J7Yd 3S5CA 1M9GA 4HM4B 3CU3A 2F86B 2V1LA 4QWTA 3SOYA 1GY7A 6STDA 2CWVA 3IPTA 1VQL3 2FXTA 1UUWB 1OCVA 3PCSA 1JNQA 1YVBI 1NB5I 3UL6A 2FNQA 3IMAB 2W04A 3N54B 1FGOA 1LXEA 3K5TA 2YFLB 4MJDA 3NXJA 3F7XA 3EC9A 2XSOB 3GZRA 4FR9A 1JB4A 3HZPA 3Q2PA 4WWUC 1JKGB 3STDA 2W56A 1W7CA 1QVF2 1JN5A 5IW9A 1SPUA 1GD3A 4GB5A 2HMJB 1Q864 2GXFA 4H3UA 4L8PA 1OHSA 3GZBA 2ZDJA 3B4PA 1IQ8A 3BNDA 3DM8A 1W01A 1Q7Y4 1SQWA 3BNBA 3LMLA 1Q814 4MMZB 3G8ZA 4HM5B 4IPBA 2GBXB 2RGQA 3K9MC 1KC84 3LTCA 4BTYA 2W9PA 5IEPA 2M7OA 2WOFA 1K8A4 4J8TA 2MF7A 3S27A 1ZX2A 2JDIH 3CXC2 1BUQA 1E3VA 1Q40B 3PYJA 1ULJB 5CXOA 1LVNA 3NQZA 3HK4A 5JBSA 1AVLA 1VQK3 4ORLA 2BMRB 2P09A 4R4KA 4HM6B 4LZIA 5D82A 1VQ43 1CQSA 3DXOA 1MNLA 4H61A 2XR8B 1VQ53 1E3RA 2BHMA 3NX0A 1Q824 3MWZA 3LT9A 4R9KA 1TP6A 1C7HA 1D6UA 2CIUA 3MG2A 4L7KA 2BO9B 2RCDA 3EF8A 3U97A 1TFKA 1PU4A 2W6JH 3SX1A 2BMOB 5FGOA 2WO0A 4HZ9B 2OWPA 5EEOA 3GZYB 1WMPA 2CK3H 1ROAA 2A15A 4WHAA 1M1XB 3LZAA 1OHOA 2SBLA 2XFSA 2ML6A 3CME3 3CD63 3MHEA 4FCJA 3CCM3 1TIJA 3DGLA 4HM0B 3E99A 1JJ22 4K1VA 1O7WB 3KSPA 3WOFB 3BB9A 1STDA 5CF1A 2CFLA 2P05A 4OK0A 4PEJA 1VQ83 1AV4A 2D42A 2Z7AA 1R4CA 1W4NA 1WNHA 4RZMA 2I9WA 3CPW2 1ROVA 2K0MA 3NV0A 2CFDA 4TX4A 5DRVA 2R4IA 1J2BA 2HMLB 5EQLA 3SXXA 3ER7A 1O7HB 5ELUA 3FG4A 3FF2A 3WODG 5KP4A 2F98A 1NB3I 3CNMA 3UJMA 2KRTA 4NREA 3S29A 3JUNA 5AYSC 3B7CA 1KQS2 3NM7A 3OWUA 4RNZA 3CCR3 1OGZA 1W2ZA 3ROBA 4MMXB 1IQXA 4RBNA 5CF2A 1YJW3 1K28A 1OF5A 1SJWA 3KIIA 1DVCA 3Q90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7C A;  1O7N B;  3EBT A;  5BXQ A;  4WYK A;  2GBW B;  1W00 A;  5BVB A;  3KZT A;  1QMA A;  4X2O A;  3FLJ A;  4HM3 B;  5IF6 A;  5D81 A;  5AII A;  1EA2 A;  5DRE A;  4J9A A;  3G0K A;  5CK6 A;  3RGR A;  1IDP A;  3NHX A;  2HMN B;  5AIG A;  3M8C A;  1JKG A;  2B24 B;  4XDW A;  3T8U A;  3EN8 A;  5JPP A;  1DMQ A;  1NU3 A;  1JN5 B;  2BMQ B;  3DZL A;  3BLZ A;  1O7M B;  2IMJ A;  2HMM B;  3G16 A;  5IG3 A;  3JUM A;  2HMK B;  2B1X B;  2CHC A;  4R9L A;  3D9R A;  5AIF A;  1Z1S A;  2PZV A;  3WMD A;  4U13 A;  3I0Y A;  1OH0 A;  3KKG A;  3SOA A;  2Z76 A;  4HVN A;  1OHP A;  3B4O A;  1OGX A;  3EJV A;  4HM8 B;  5IG5 A;  1OPY A;  4OUQ A;  3FF0 A;  3LYG A;  4Q53 A;  4CDL A;  4OVM A;  3FGY A;  5IG0 A;  5TGN A;  1E97 A;  1O7G B;  4LEH A;  3NUV A;  1Q42 A;  3MG3 A;  2STD A;  2GEX A;  5FW5 A;  3JUQ A;  5AEU B;  3B8L A;  2INX A;  1AR0 A;  4STD A;  3UNL A;  5AIH A;  1TUH A;  4XBY A;  3F8X A;  2CKF B;  3JUO A;  2RFR A;  1DMN A;  3F40 A;  3T8N A;  3FSD A;  4LGQ A;  1JB2 A;  3DUK A;  1OF5 B;  3CNX A;  3H51 A;  1OUN A;  3F7S A;  3VGN A;  4X2H A;  3CPO A;  4FCM A;  4WYK B;  5JPU A;  1A2K A;  1HKX A;  3OX9 A;  1W02 A;  4HM2 B;  2HMO B;  3EBY A;  2UX0 A;  3F9S A;  1QJG A;  3NBR A;  3FH1 A;  3MSO A;  4XBX A;  5KP3 A;  2YFI B;  4N3V A;  1DMM A;  3OWS A;  3EX9 A;  5IER A;  1U5O A;  2W2C A;  1K41 A;  3FKA A;  4HM7 B;  4I4K A;  1JB5 A;  3F8H A;  1Q40 A;  3K0Z A;  3NM2 A;  1O7P B;  4HJL B;  3MKI A;  1ASK A;  8CHO A;  5G2G A;  1VZZ A;  1ULI B;  1WQL B;  2XSH B;  2JQ5 A;  3RGA A;  3ECF A;  3GZX B;  2Z77 A;  2F99 A;  2K54 A;  3MG1 A;  1GS3 A;  5IEN A;  4L8O A;  5AI1 A;  5IEO A;  4XBT A;  4XM4 A;  1NWW A;  1GYB A;  3OWY A;  5D83 A;  4WP5 A;  2GEY A;  5HGR A;  5STD A;  3MYT A;  1S5A A;  3OXA A;  4HKV B;  3HX8 A;  4XDV A;  3EN1 B;  2QGU A;  3KE7 A;  1ZO2 A;  7STD A;  1W6Y A;  3NV0 B;  3EHC A;  4R1K A;  2XRX B;  2BNG A;  1ISK A;  3GRD A;  3F14 A;  1GY5 A;  1EG9 B;  2QIY A;  3EQQ B;  1GY6 A;  3OV4 A;  4HZB B;  5IG4 A;  3JUP A;  4LMI A;  2YFJ B;  4KVH A;  5EVH A;  1UUV B;  4XB5 A;  3H3H A;  1NDO B;  3FZW A;  5KP1 A;  3VSY A;  4HM1 B;  3DMC A;  5CLK A;  3SED A;  3A76 A;  5AEW B;  4IIA A;  3GWR A;  4K1U A;  3S5C A;  4HM4 B;  3CU3 A;  2F86 B;  3SOY A;  1GY7 A;  6STD A;  3IPT A;  1UUW B;  1OCV A;  4MJD A;  2YFL B;  3NXJ A;  3F7X A;  3EC9 A;  2XSO B;  3GZR A;  1JB4 A;  3HZP A;  4WWU C;  1JKG B;  3STD A;  1JN5 A;  4GB5 A;  2HMJ B;  2GXF A;  4H3U A;  4L8P A;  1OHS A;  3GZB A;  3B4P A;  3DM8 A;  1W01 A;  3G8Z A;  4HM5 B;  2GBX B;  2RGQ A;  5IEP A;  4J8T A;  1ZX2 A;  1BUQ A;  1E3V A;  1Q40 B;  1ULJ B;  5CXO A;  3HK4 A;  4ORL A;  2BMR B;  4HM6 B;  5D82 A;  1CQS A;  3DXO A;  2XR8 B;  1E3R A;  4R9K A;  1TP6 A;  1C7H A;  3MG2 A;  4L7K A;  2RCD A;  3EF8 A;  2BMO B;  4HZ9 B;  2OWP A;  3GZY B;  2A15 A;  3LZA A;  1OHO A;  3MHE A;  4FCJ A;  4HM0 B;  3E99 A;  4K1V A;  1O7W B;  3KSP A;  3BB9 A;  1STD A;  5CF1 A;  4PEJ A;  2Z7A A;  4RZM A;  2I9W A;  3NV0 A;  5DRV A;  2R4I A;  2HML B;  3ER7 A;  1O7H B;  3FF2 A;  5KP4 A;  2F98 A;  3CNM A;  3UJM A;  3JUN A;  3B7C A;  3OWU A;  1OGZ A;  3ROB A;  5CF2 A;  1OF5 A;  1SJW A;  3Q90 A; 
#chains in the Genus database with same CATH topology
 1GOY A;  3PCR A;  3CCU 3;  1W2B 2;  4MEI A;  2OCT A;  4EV2 A;  3K7C A;  1O7N B;  3EBT A;  4FMD A;  1BSB A;  4LSO A;  1TFO A;  2ML5 A;  4CCV A;  5BXQ A;  3S67 A;  1YJN 3;  4WYK A;  2GBW B;  1U8C B;  3FCS B;  1W00 A;  4FMB A;  5BVB A;  5BIR A;  3KZT A;  1QMA A;  1V74 A;  1N8R 4;  1TJD A;  3LTA A;  3FLJ A;  4HM3 B;  4X2O A;  1MWT A;  1MGW A;  1LRA A;  3S28 A;  1VQO 3;  1DVD A;  5IF6 A;  1X1U A;  1BRG A;  1IVW A;  1RSN A;  1I0V A;  5D81 A;  1Y4K A;  5AII A;  2IYJ A;  1EA2 A;  4CJN A;  5DRE A;  4EYC A;  4J9A A;  1EKM A;  2CFG A;  3G0K A;  5CK6 A;  3RGR A;  3V98 A;  1IT7 A;  1IDP A;  1YGE A;  3NHX A;  4N6U A;  2HMN B;  1CEW I;  1GOV A;  1RRL A;  2IUJ A;  4K61 A;  1B20 A;  5AIG A;  3CC4 3;  3M8C A;  5M19 A;  3PZW A;  3DGN A;  3JVC A;  1JKG A;  2B24 B;  1BNJ A;  1JZD A;  3DGM A;  4FMC A;  3EN8 A;  2W9Q A;  4XDW A;  1L5G B;  3T8U A;  5JPP A;  2IUK A;  1BRJ A;  1DMQ A;  2Q07 A;  2D1W A;  1NU3 A;  1JN5 B;  1IT8 A;  1I8V A;  1W6G A;  2BMQ B;  3DZL A;  1RRH A;  1UCL A;  3BLZ A;  1O7M B;  1RGK A;  4N6T A;  1BUJ A;  4KT3 B;  2IMJ A;  2HMM B;  3G16 A;  4ZM8 A;  1LNH A;  3SVA A;  5IG3 A;  1RMS A;  3JUM A;  3G4S 3;  2HMK B;  3LOY A;  1N9J A;  2B1X B;  2CHC A;  3ZG5 A;  4EW5 A;  2E2V A;  1JBS A;  4R9L A;  1US1 A;  5LC6 A;  3QK9 A;  2CG1 A;  3X41 A;  1TU5 A;  3FG3 A;  1VQN 3;  2ZL8 A;  1BNS A;  3D9R A;  5AIF A;  4KFF A;  3X3Y A;  2XH9 A;  1Z1S A;  2PZV A;  3WMD A;  1MWU A;  3I0Y A;  4U13 A;  3O8Y A;  1OH0 A;  3KKG A;  1LQG C;  3K63 A;  3SOA A;  1B2S A;  3AMO A;  2ZA4 A;  4ILF A;  2Z76 A;  1AY7 A;  1BSA A;  3ZG0 A;  3G71 3;  3BIR A;  4HVN A;  1OHP A;  2CWT A;  3CCV 3;  3NBJ A;  3V99 A;  3CMA 3;  3B4O A;  4AEQ A;  2OTL 3;  1BIR A;  3LTD A;  1OGX A;  4N6O B;  1I2E A;  3G6E 3;  1G96 A;  2OTJ 3;  1M90 4;  1I3F A;  3DGO A;  1BSE A;  2C10 A;  1UGH I;  3EJV A;  4O2H A;  3I56 3;  4HM8 B;  2CG0 A;  1OPY A;  2WGQ A;  5IG5 A;  3WDG B;  4OUQ A;  6RNT A;  3FF0 A;  4JRF A;  1CYV A;  4N6L A;  5BU4 A;  1IQY A;  3LYG A;  1KWI A;  4DKI A;  4Q53 A;  1B3S A;  4CDL A;  4MMY B;  1YIT 3;  1MWR A;  2H0H A;  1NO3 A;  1IV9 A;  4OVM A;  3D79 A;  3FGY A;  1BRS A;  1W5Z A;  5IG0 A;  5TGN A;  4LYL B;  1E97 A;  1O7G B;  1SAR A;  4LEH A;  3AGN A;  2GSP A;  3NUV A;  2XGL A;  1RGF A;  2SAR A;  2E2U A;  5ELJ A;  1N9E A;  1Q42 A;  2P0X A;  3AHS A;  3MG3 A;  2STD A;  3Q3F A;  1IVX A;  4K90 B;  2GEX A;  3WA2 X;  1UW1 A;  1D6Z A;  5FW5 A;  3X3Z A;  1RCL A;  1B2U A;  1MWS A;  1FUT A;  2CH9 A;  4GL6 A;  4N6N B;  2H0G A;  1HYF A;  3UB1 A;  1T5Y A;  2CX1 A;  1VQQ A;  1WMO A;  3JUQ A;  2Z6B A;  5AEU B;  1FYS A;  4BTW A;  4EV5 A;  1K73 4;  2CFW A;  3KSE D;  1IK3 A;  1PFP A;  2INX A;  3B8L A;  5A0O B;  1AR0 A;  4STD A;  3UNL A;  5AIH A;  1RGL A;  1RGC A;  1TUH A;  1BRI A;  2CW9 A;  2OOV C;  4XBY A;  1K9M 4;  3WOE B;  3KFQ C;  1SIH A;  3F8X A;  3HI7 A;  2CKF B;  3BU4 A;  1RGA A;  4BL3 A;  1NJI 4;  2BT3 A;  3JUO A;  2L4V A;  1SII A;  4KFE A;  2RFR A;  1YGW A;  4HBR A;  5M18 A;  9RNT A;  3CCJ 3;  3CCQ 3;  1DMN A;  2O9U X;  3DY5 A;  3F40 A;  3FSD A;  3T8N A;  1STF I;  1JB2 A;  1Q9E A;  2ZHX B;  1V58 A;  2GU1 A;  3DUK A;  3EE1 A;  4LGQ A;  4NPB A;  3CCE 3;  1BNI A;  1OF5 B;  1QAF A;  5I97 A;  1F8N A;  3CNX A;  4IT7 A;  1KD1 4;  3H51 A;  1OUN A;  2KCD A;  4HYZ A;  3F7S A;  3VGN A;  1T2H A;  1BNG A;  3AHW A;  1YHQ 3;  2F56 A;  4X2H A;  1YIJ 3;  1OAC A;  3CPO A;  1DYU A;  4FCM A;  2J8X B;  4WYK B;  3X40 A;  5JPU A;  2AAE A;  3PXM A;  1A2K A;  2OQE C;  1FGQ A;  1GMR A;  1HKX A;  1I3I A;  1W02 A;  3OX9 A;  1N8Q A;  3WA3 A;  2UGI A;  1JBT A;  1JV2 B;  4HM2 B;  2HMO B;  1RN7 A;  3BNE A;  1WTH A;  3UL5 A;  3EBY A;  1ZGX A;  2UX0 A;  3QRD A;  5LC7 A;  3F9S A;  4AKZ A;  1G02 A;  1B21 A;  1QJG A;  3NBR A;  2QEX 3;  3FH1 A;  3MSO A;  4XBX A;  1B2M A;  2BU4 A;  1RKY A;  1BRN L;  1A2V A;  1AVK A;  3T0U A;  1X1X A;  4O8S A;  5KP3 A;  2W56 B;  1YJ9 3;  1RNB A;  2YFI B;  4N3V A;  4BL2 A;  3PGB A;  3LTB A;  1B2Z A;  2MC8 A;  1LOX A;  1VQ7 3;  1CYU A;  2QA4 3;  1DMM A;  1N5P A;  3HII A;  1LQM B;  3WR2 A;  1BGS A;  2O3O A;  1TRP A;  3X42 A;  3OWS A;  1RGH A;  2W0Q A;  2E2T A;  3EX9 A;  3X3X A;  5IER A;  1RN4 A;  1U5O A;  2W2C A;  3EB8 A;  5AYR B;  1LOW A;  1VQM 3;  1K41 A;  3NBB A;  3GAX A;  3FKA A;  4HM7 B;  4I4K A;  3LH4 A;  3Q1C A;  1JB5 A;  1MOL A;  1FGR A;  3F8H A;  4JF8 A;  1Q40 A;  2HOH A;  3K0Z A;  3LT8 A;  6GSP A;  1RNT A;  3MPH A;  3NM2 A;  1JRQ A;  3KN4 A;  1N5H A;  3D5G A;  2P38 A;  1O7P B;  4HJL B;  4RNY A;  2XEP A;  3V92 A;  3MKI A;  1BNF A;  1ASK A;  1FZU A;  8CHO A;  3HIG A;  4N6M A;  5G2G A;  2KXG A;  1VZZ A;  3D3L A;  3FG1 A;  1ULI B;  1WQL B;  2XSH B;  2JQ5 A;  3RGA A;  3ECF A;  2XFT A;  1AQZ A;  1LOY A;  3AMO B;  2CFK A;  5GSP A;  3I55 3;  3GZX B;  4BTX A;  2CWU A;  2XGN A;  2Z77 A;  2F99 A;  2K54 A;  1GD4 A;  2C4B A;  3MG1 A;  2K3D A;  4WFO A;  3CC2 3;  1BSD A;  2GU3 A;  3IJE B;  1GS3 A;  3LXU X;  1DET A;  5IEN A;  4L8O A;  2PNC A;  1UCJ A;  5AI1 A;  1EUI C;  1MGR A;  4R80 A;  1BVI A;  2LYX A;  2RSX A;  2W03 A;  1HU9 A;  1RCK A;  1YVS A;  5IEO A;  4XBT A;  4XM4 A;  1W6C A;  1GYB A;  1NWW A;  3OWY A;  4EBG A;  4AKY A;  5RNT A;  2OOV A;  1KSI A;  1HZ1 A;  5D83 A;  4WP5 A;  2GEY A;  1FGM A;  2H0I A;  3N8B A;  5HGR A;  3URP A;  3VF1 A;  1D6Y A;  5STD A;  4G1M B;  1RN1 A;  3MYT A;  1S5A A;  3OXA A;  4FCZ A;  4HKV B;  2CX0 A;  2R41 A;  3HX8 A;  3L0R A;  4XDV A;  1UI7 A;  3EN1 B;  2QGU A;  3KE7 A;  3CCS 3;  3N9H A;  1ZO2 A;  3SLU A;  7STD A;  4O02 B;  1CH0 A;  1IVV A;  3CC7 3;  1DE3 A;  1I0X A;  1W6Y A;  3NV0 B;  1QAK A;  3EHC A;  1UI8 A;  4FMA A;  4NHF A;  4R1K A;  2XRX B;  3PS8 A;  1BAN A;  1YI2 3;  2BNG A;  3GSP A;  1ISK A;  3DGY A;  3GRD A;  3F14 A;  1GY5 A;  1EG9 B;  1FGT A;  3TDG A;  2QIY A;  4HOH A;  4I5Q A;  1WMN A;  3EQQ B;  3ALA A;  3DH2 A;  1GY6 A;  3OV4 A;  4HZB B;  2CC3 A;  5IG4 A;  2IA7 A;  3JUP A;  1BNR A;  4LMI A;  2XF3 A;  4GSP A;  2OQE A;  2YFJ B;  1EEJ A;  1A67 A;  2C11 A;  4KVH A;  4O3V A;  1IU7 A;  2LQV A;  3RDE A;  5EVH A;  1UUV B;  2UUG C;  2YX9 A;  4N6V 0;  1BAO A;  1PYL A;  1VQ6 3;  1IV7 A;  4XB5 A;  3H3H A;  8RNT A;  1A2P A;  4KZ1 A;  1GOU A;  1QAL A;  2FGT A;  4EXR A;  1A90 A;  2IY2 A;  7GSP A;  1NDO B;  2P0M A;  3FZW A;  1VQP 3;  5KP1 A;  1FA3 A;  1IVU A;  1BSC A;  3U1W A;  1Q7H A;  4GHO A;  3NQY A;  2Y73 A;  1JBR A;  2WOH A;  1FUW A;  1RJO A;  1VQ9 3;  3VSY A;  4HM1 B;  1B2X A;  1BOX A;  2WGO A;  3DMC A;  2Y74 A;  5CLK A;  3SED A;  4CPK A;  1S72 3;  1QVG 2;  3A76 A;  4KFD A;  4EC6 A;  4J5G A;  5AEW B;  3CCL 3;  4IIA A;  1M1K 4;  1T2I A;  3HOH A;  3OW2 2;  1EQK A;  1T3B A;  1V57 A;  3BNC A;  3GWR A;  4K1U A;  3J7Y d;  3S5C A;  1M9G A;  4HM4 B;  3CU3 A;  2F86 B;  2V1L A;  4QWT A;  3SOY A;  1GY7 A;  6STD A;  2CWV A;  3IPT A;  1VQL 3;  2FXT A;  1UUW B;  3ZFZ A;  1OCV A;  3PCS A;  4BIR A;  1JNQ A;  1YVB I;  1NB5 I;  1UCK A;  2FNQ A;  3UL6 A;  1I70 A;  1LOV A;  3IMA B;  3D5I A;  2W04 A;  3N54 B;  1FGO A;  1LXE A;  3K5T A;  2YFL B;  4MJD A;  3NXJ A;  3F7X A;  3EC9 A;  2XSO B;  3GZR A;  4FR9 A;  1JB4 A;  3HZP A;  3Q2P A;  4WWU C;  1JKG B;  3STD A;  2W56 A;  1W7C A;  1QVF 2;  1JN5 A;  3D4A A;  1SPU A;  2KF4 A;  5IW9 A;  1GD3 A;  4GB5 A;  2HMJ B;  1Q86 4;  2GXF A;  4H3U A;  4L8P A;  1OHS A;  3GZB A;  2ZDJ A;  1ZS7 A;  3B4P A;  1IQ8 A;  3BND A;  3DM8 A;  1W01 A;  1Q7Y 4;  1RTU A;  1SQW A;  3BNB A;  3LML A;  1Q81 4;  4MMZ B;  3G8Z A;  4HM5 B;  4IPB A;  1BRK A;  1C54 A;  2GBX B;  2RGQ A;  3K9M C;  3KCH A;  1LNI A;  2KF6 A;  1KC8 4;  3LTC A;  1X1W A;  4BTY A;  1PY3 A;  1R4Y A;  1BU4 A;  2W9P A;  5IEP A;  1GMQ A;  2M7O A;  2WOF A;  1UUG B;  4J8T A;  2MF7 A;  1K8A 4;  3S27 A;  1ZX2 A;  2JDI H;  3CXC 2;  1BUQ A;  1E3V A;  1G0T A;  1Q40 B;  1RHL A;  1UDI I;  1ULJ B;  3PYJ A;  5CXO A;  1LVN A;  2F4Y A;  3NQZ A;  3HK4 A;  5JBS A;  2F5M A;  1RGE A;  4RNT A;  1AVL A;  1VQK 3;  4ORL A;  2BMR B;  2P09 A;  4R4K A;  4HM6 B;  3SYU A;  4LZI A;  5D82 A;  1VQ4 3;  1CQS A;  3DXO A;  1MNL A;  4H61 A;  2XR8 B;  1RLS A;  1E3R A;  2BHM A;  1VQ5 3;  1UGI A;  3NX0 A;  1Q82 4;  3MWZ A;  3LT9 A;  4R9K A;  1TP6 A;  1D6U A;  1C7H A;  2CIU A;  3MG2 A;  4L7K A;  2BO9 B;  2RCD A;  3EF8 A;  1RDS A;  1I2F A;  1TTO A;  2RNT A;  3U97 A;  1TFK A;  5M1A A;  1PU4 A;  2W6J H;  3SX1 A;  2BMO B;  5FGO A;  2WO0 A;  4HZ9 B;  2OWP A;  5EEO A;  3GZY B;  1WMP A;  2CK3 H;  1ROA A;  2F5W A;  2A15 A;  4HAA A;  4WHA A;  1M1X B;  5G1L A;  3AGO A;  3LZA A;  1OHO A;  2SBL A;  2XFS A;  2ML6 A;  3CME 3;  3CD6 3;  1BNE A;  3MHE A;  7RNT A;  3A5E A;  4FCJ A;  3CCM 3;  1TIJ A;  3DGL A;  1YNV X;  4HM0 B;  3E99 A;  1GMP A;  5HOH A;  1GSP A;  1JJ2 2;  4K1V A;  1O7W B;  3KSP A;  3WOF B;  3BB9 A;  1STD A;  5CF1 A;  2CFL A;  2P05 A;  4OK0 A;  4PEJ A;  1I2G A;  4J5K A;  2L1S A;  4BU4 A;  1VQ8 3;  1AV4 A;  2D42 A;  3RNT A;  2Z7A A;  1R4C A;  1W4N A;  1WNH A;  4RZM A;  2I9W A;  3CPW 2;  1ROV A;  2K0M A;  3NV0 A;  2CFD A;  2KF3 A;  4TX4 A;  5DRV A;  2R4I A;  1J2B A;  2HML B;  5EQL A;  3SXX A;  3ER7 A;  1O7H B;  5ELU A;  3FG4 A;  1UCI A;  3FF2 A;  3WOD G;  5KP4 A;  1TRQ A;  2F98 A;  5G1K A;  1RGG A;  1NB3 I;  3CNM A;  1BRH A;  3UJM A;  1FUS A;  1JZO A;  2BIR A;  1B27 A;  2KRT A;  4NRE A;  3S29 A;  3JUN A;  5AYS C;  2AAD A;  1NNV A;  3B7C A;  1KQS 2;  3NM7 A;  2RBI A;  3OWU A;  4RNZ A;  3CCR 3;  2KF5 A;  3WHO A;  1OGZ A;  1W2Z A;  2KAA A;  3ROB A;  4MMX B;  1FW7 A;  1IQX A;  4RBN A;  1IYY A;  5CF2 A;  1YJW 3;  1K28 A;  1OF5 A;  1SJW A;  1X1Y A;  3KII A;  1DVC A;  3Q90 A; 
#chains in the Genus database with same CATH homology
 3PCR A;  3CCU 3;  1W2B 2;  4MEI A;  2OCT A;  4EV2 A;  3K7C A;  1O7N B;  3EBT A;  4FMD A;  4LSO A;  1TFO A;  2ML5 A;  4CCV A;  5BXQ A;  3S67 A;  1YJN 3;  4WYK A;  2GBW B;  1U8C B;  3FCS B;  1W00 A;  4FMB A;  5BVB A;  3KZT A;  1QMA A;  1V74 A;  1N8R 4;  3LTA A;  4X2O A;  3FLJ A;  4HM3 B;  3S28 A;  1VQO 3;  1DVD A;  5IF6 A;  1IVW A;  5D81 A;  1Y4K A;  5AII A;  1EA2 A;  5DRE A;  4EYC A;  4J9A A;  1EKM A;  2CFG A;  3G0K A;  5CK6 A;  3RGR A;  3V98 A;  1IT7 A;  1IDP A;  1YGE A;  3NHX A;  4N6U A;  2HMN B;  1CEW I;  2IUJ A;  1RRL A;  4K61 A;  3CC4 3;  5AIG A;  3M8C A;  3PZW A;  3DGN A;  3JVC A;  1JKG A;  2B24 B;  4XDW A;  3DGM A;  4FMC A;  3EN8 A;  2W9Q A;  1L5G B;  3T8U A;  5JPP A;  2IUK A;  1DMQ A;  2Q07 A;  2D1W A;  1NU3 A;  1JN5 B;  1IT8 A;  1W6G A;  2BMQ B;  3DZL A;  1RRH A;  3BLZ A;  1O7M B;  4N6T A;  2IMJ A;  2HMM B;  3G16 A;  4ZM8 A;  1LNH A;  3SVA A;  5IG3 A;  3JUM A;  3G4S 3;  2HMK B;  3LOY A;  1N9J A;  2B1X B;  2CHC A;  2E2V A;  4R9L A;  1US1 A;  5LC6 A;  3QK9 A;  2CG1 A;  3X41 A;  1TU5 A;  3FG3 A;  1VQN 3;  2ZL8 A;  3D9R A;  5AIF A;  4KFF A;  3X3Y A;  2XH9 A;  1Z1S A;  2PZV A;  3WMD A;  4U13 A;  3I0Y A;  3O8Y A;  1OH0 A;  3KKG A;  3K63 A;  3SOA A;  3AMO A;  2Z76 A;  3G71 3;  4HVN A;  1OHP A;  2CWT A;  3CCV 3;  3NBJ A;  3V99 A;  3CMA 3;  3B4O A;  4AEQ A;  2OTL 3;  3LTD A;  1OGX A;  4N6O B;  3G6E 3;  1G96 A;  2OTJ 3;  1M90 4;  3DGO A;  2C10 A;  3EJV A;  4O2H A;  3I56 3;  4HM8 B;  2CG0 A;  1OPY A;  2WGQ A;  5IG5 A;  3WDG B;  4OUQ A;  3FF0 A;  4JRF A;  1CYV A;  4N6L A;  1IQY A;  3LYG A;  1KWI A;  4Q53 A;  4CDL A;  4MMY B;  1YIT 3;  1NO3 A;  1IV9 A;  4OVM A;  3FGY A;  1W5Z A;  5IG0 A;  5TGN A;  1E97 A;  1O7G B;  4LEH A;  3NUV A;  2XGL A;  2E2U A;  5ELJ A;  1N9E A;  1Q42 A;  2P0X A;  3MG3 A;  2STD A;  1IVX A;  4K90 B;  2GEX A;  3WA2 X;  1UW1 A;  1D6Z A;  5FW5 A;  3X3Z A;  2CH9 A;  4GL6 A;  4N6N B;  3UB1 A;  1T5Y A;  1WMO A;  3JUQ A;  2Z6B A;  5AEU B;  4BTW A;  4EV5 A;  1K73 4;  2CFW A;  3KSE D;  1IK3 A;  1PFP A;  2INX A;  3B8L A;  5A0O B;  1AR0 A;  4STD A;  3UNL A;  5AIH A;  1TUH A;  2CW9 A;  2OOV C;  4XBY A;  1K9M 4;  3WOE B;  3KFQ C;  1SIH A;  3F8X A;  3HI7 A;  2CKF B;  1NJI 4;  2BT3 A;  3JUO A;  2L4V A;  1SII A;  4KFE A;  2RFR A;  4HBR A;  3CCJ 3;  3CCQ 3;  1DMN A;  2O9U X;  3DY5 A;  3F40 A;  3FSD A;  3T8N A;  1STF I;  1JB2 A;  4LGQ A;  3CCE 3;  2GU1 A;  3DUK A;  3EE1 A;  1OF5 B;  1QAF A;  5I97 A;  1F8N A;  3CNX A;  4IT7 A;  1KD1 4;  3H51 A;  1OUN A;  2KCD A;  4HYZ A;  3F7S A;  3VGN A;  1YHQ 3;  4X2H A;  1YIJ 3;  1OAC A;  3CPO A;  1DYU A;  4FCM A;  4WYK B;  3X40 A;  5JPU A;  3PXM A;  1A2K A;  2OQE C;  1FGQ A;  1HKX A;  3OX9 A;  1W02 A;  1N8Q A;  3WA3 A;  1JV2 B;  4HM2 B;  2HMO B;  1RN7 A;  3BNE A;  1WTH A;  3UL5 A;  3EBY A;  2UX0 A;  3QRD A;  5LC7 A;  4AKZ A;  3F9S A;  1QJG A;  3NBR A;  2QEX 3;  3FH1 A;  3MSO A;  4XBX A;  1RKY A;  1A2V A;  1AVK A;  3T0U A;  4O8S A;  5KP3 A;  2W56 B;  1YJ9 3;  2YFI B;  4N3V A;  3PGB A;  3LTB A;  2MC8 A;  1LOX A;  1VQ7 3;  1CYU A;  2QA4 3;  1DMM A;  1N5P A;  3HII A;  2O3O A;  3X42 A;  3OWS A;  2W0Q A;  2E2T A;  3EX9 A;  3X3X A;  5IER A;  1U5O A;  2W2C A;  3EB8 A;  5AYR B;  1VQM 3;  1K41 A;  3NBB A;  3GAX A;  3FKA A;  4HM7 B;  4I4K A;  3LH4 A;  3Q1C A;  1JB5 A;  1MOL A;  1FGR A;  3F8H A;  4JF8 A;  1Q40 A;  3K0Z A;  3LT8 A;  3MPH A;  3NM2 A;  1JRQ A;  3KN4 A;  1N5H A;  2P38 A;  1O7P B;  4HJL B;  4RNY A;  2XEP A;  3V92 A;  3MKI A;  1ASK A;  8CHO A;  3HIG A;  4N6M A;  5G2G A;  2KXG A;  1VZZ A;  3D3L A;  3FG1 A;  1ULI B;  1WQL B;  2XSH B;  2JQ5 A;  3RGA A;  3ECF A;  2XFT A;  3AMO B;  2CFK A;  3I55 3;  3GZX B;  4BTX A;  2CWU A;  2XGN A;  2Z77 A;  2F99 A;  2K54 A;  1GD4 A;  3MG1 A;  3CC2 3;  4WFO A;  2GU3 A;  3IJE B;  1GS3 A;  3LXU X;  5IEN A;  4L8O A;  2PNC A;  5AI1 A;  4R80 A;  2LYX A;  2RSX A;  2W03 A;  1HU9 A;  5IEO A;  4XBT A;  4XM4 A;  1W6C A;  1GYB A;  1NWW A;  3OWY A;  4EBG A;  4AKY A;  2OOV A;  1KSI A;  5D83 A;  4WP5 A;  2GEY A;  1FGM A;  3N8B A;  5HGR A;  3VF1 A;  1D6Y A;  5STD A;  4G1M B;  3MYT A;  1S5A A;  3OXA A;  4FCZ A;  4HKV B;  3L0R A;  3HX8 A;  4XDV A;  1UI7 A;  3EN1 B;  2QGU A;  3KE7 A;  3CCS 3;  3N9H A;  1ZO2 A;  3SLU A;  7STD A;  4O02 B;  3CC7 3;  1IVV A;  1W6Y A;  3NV0 B;  1QAK A;  3EHC A;  1UI8 A;  4FMA A;  4NHF A;  4R1K A;  2XRX B;  3PS8 A;  1YI2 3;  2BNG A;  1ISK A;  3GRD A;  3F14 A;  1GY5 A;  1EG9 B;  1FGT A;  3TDG A;  2QIY A;  1WMN A;  3EQQ B;  3ALA A;  1GY6 A;  3OV4 A;  4HZB B;  2CC3 A;  5IG4 A;  2IA7 A;  3JUP A;  4LMI A;  2XF3 A;  2OQE A;  2YFJ B;  1A67 A;  2C11 A;  4KVH A;  4O3V A;  1IU7 A;  2LQV A;  3RDE A;  5EVH A;  1UUV B;  2YX9 A;  4N6V 0;  1VQ6 3;  1IV7 A;  4XB5 A;  3H3H A;  4KZ1 A;  2FGT A;  1QAL A;  4EXR A;  1A90 A;  1NDO B;  2P0M A;  3FZW A;  1VQP 3;  5KP1 A;  1FA3 A;  1IVU A;  3U1W A;  3NQY A;  2Y73 A;  2WOH A;  1FUW A;  1RJO A;  1VQ9 3;  3VSY A;  4HM1 B;  3DMC A;  2WGO A;  2Y74 A;  5CLK A;  3SED A;  1S72 3;  1QVG 2;  3A76 A;  4KFD A;  4EC6 A;  1M1K 4;  5AEW B;  3CCL 3;  4IIA A;  3OW2 2;  1EQK A;  3BNC A;  3GWR A;  4K1U A;  3J7Y d;  3S5C A;  1M9G A;  4HM4 B;  3CU3 A;  2F86 B;  2V1L A;  4QWT A;  3SOY A;  1GY7 A;  6STD A;  2CWV A;  3IPT A;  1VQL 3;  2FXT A;  1UUW B;  1OCV A;  3PCS A;  1JNQ A;  1YVB I;  1NB5 I;  3UL6 A;  2FNQ A;  3IMA B;  2W04 A;  3N54 B;  1FGO A;  1LXE A;  3K5T A;  2YFL B;  4MJD A;  3NXJ A;  3F7X A;  3EC9 A;  2XSO B;  3GZR A;  4FR9 A;  1JB4 A;  3HZP A;  3Q2P A;  4WWU C;  1JKG B;  3STD A;  2W56 A;  1W7C A;  1QVF 2;  1JN5 A;  5IW9 A;  1SPU A;  1GD3 A;  4GB5 A;  2HMJ B;  1Q86 4;  2GXF A;  4H3U A;  4L8P A;  1OHS A;  3GZB A;  2ZDJ A;  3B4P A;  1IQ8 A;  3BND A;  3DM8 A;  1W01 A;  1Q7Y 4;  1SQW A;  3BNB A;  3LML A;  1Q81 4;  4MMZ B;  3G8Z A;  4HM5 B;  4IPB A;  2GBX B;  2RGQ A;  3K9M C;  1KC8 4;  3LTC A;  4BTY A;  2W9P A;  5IEP A;  2M7O A;  2WOF A;  1K8A 4;  4J8T A;  2MF7 A;  3S27 A;  1ZX2 A;  2JDI H;  3CXC 2;  1BUQ A;  1E3V A;  1Q40 B;  3PYJ A;  1ULJ B;  5CXO A;  1LVN A;  3NQZ A;  3HK4 A;  5JBS A;  1AVL A;  1VQK 3;  4ORL A;  2BMR B;  2P09 A;  4R4K A;  4HM6 B;  4LZI A;  5D82 A;  1VQ4 3;  1CQS A;  3DXO A;  1MNL A;  4H61 A;  2XR8 B;  1VQ5 3;  1E3R A;  2BHM A;  3NX0 A;  1Q82 4;  3MWZ A;  3LT9 A;  4R9K A;  1TP6 A;  1C7H A;  1D6U A;  2CIU A;  3MG2 A;  4L7K A;  2BO9 B;  2RCD A;  3EF8 A;  3U97 A;  1TFK A;  1PU4 A;  2W6J H;  3SX1 A;  2BMO B;  5FGO A;  2WO0 A;  4HZ9 B;  2OWP A;  5EEO A;  3GZY B;  1WMP A;  2CK3 H;  1ROA A;  2A15 A;  4WHA A;  1M1X B;  3LZA A;  1OHO A;  2SBL A;  2XFS A;  2ML6 A;  3CME 3;  3CD6 3;  3MHE A;  4FCJ A;  3CCM 3;  1TIJ A;  3DGL A;  4HM0 B;  3E99 A;  1JJ2 2;  4K1V A;  1O7W B;  3KSP A;  3WOF B;  3BB9 A;  1STD A;  5CF1 A;  2CFL A;  2P05 A;  4OK0 A;  4PEJ A;  1VQ8 3;  1AV4 A;  2D42 A;  2Z7A A;  1R4C A;  1W4N A;  1WNH A;  4RZM A;  2I9W A;  3CPW 2;  1ROV A;  2K0M A;  3NV0 A;  2CFD A;  4TX4 A;  5DRV A;  2R4I A;  1J2B A;  2HML B;  5EQL A;  3SXX A;  3ER7 A;  1O7H B;  5ELU A;  3FG4 A;  3FF2 A;  3WOD G;  5KP4 A;  2F98 A;  1NB3 I;  3CNM A;  3UJM A;  2KRT A;  4NRE A;  3S29 A;  3JUN A;  5AYS C;  3B7C A;  1KQS 2;  3NM7 A;  3OWU A;  4RNZ A;  3CCR 3;  1OGZ A;  1W2Z A;  3ROB A;  4MMX B;  1IQX A;  4RBN A;  5CF2 A;  1YJW 3;  1K28 A;  1OF5 A;  1SJW A;  3KII A;  1DVC A;  3Q90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...