4R9LA

Structure of a thermostable elevenfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis, containing two stabilizing disulfide bonds
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
147
structure length
147
Chain Sequence
KCEQPRWASKDPAAGKASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFKVMSIDAVCVFHICSCKGLVFTERVDVLRALPTGKSYNLSILGVFQLTDGKITGWRDYFDLREFEEAVDLPLRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
publication title X-ray crystallographic validation of structure predictions used in computational design for protein stabilization.
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 44
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r9lA00
4U13A 3FF2A 2K54A 3EN1B 4X2OA 5CF2A 2BMOB 3B7CA 3F7SA 2CKFB 2STDA 1UUWB 3FLJA 1NU3A 2GBWB 3SOYA 1GY5A 2OWPA 1U5OA 1OCVA 1ISKA 5JPUA 1JB2A 3OX9A 2F99A 2F86B 4L7KA 1STDA 3B8LA 3I0YA 1C7HA 5AI1A 2Z76A 1O7NB 4HM8B 3ER7A 3HZPA 1Q42A 3NHXA 4PEJA 5TGNA 4HKVB 2Z77A 3G8ZA 3FGYA 4K1VA 5IG0A 1SJWA 2PZVA 1OPYA 4LEHA 2A15A 5CF1A 3HX8A 3BB9A 5CXOA 3F40A 3WMDA 1OHPA 5JPPA 5KP1A 5DRVA 2CHCA 2RCDA 5AEWB 3F8XA 1O7HB 3FF0A 2RFRA 3LYGA 3JUPA 2Z7AA 4R9LA 3NXJA 4XBYA 2R4IA 1JN5B 3S5CA 2F98A 1IDPA 4OUQA 1OHSA 2UX0A 4K1UA 4ORLA 5IEOA 1W6YA 1OH0A 2B1XB 3OWSA 4X2HA 3OXAA 3DMCA 3EBTA 4RZMA 4CDLA 1E3RA 3DZLA 1CQSA 1AR0A 1E3VA 3Q90A 1JN5A 3CPOA 3KKGA 3UNLA 2GBXB 3EC9A 1TP6A 4HM6B 5IERA 1NWWA 5KP3A 1O7MB 4HM3B 1BUQA 1OF5B 4MJDA 3KSPA 1O7WB 3MG2A 4J8TA 3NUVA 5AIGA 3JUNA 4WYKB 5CK6A 3MG1A 5D81A 1E97A 1GY6A 2BNGA 4HM4B 1OHOA 1EG9B 1OF5A 1JKGB 1GS3A 4XB5A 3SOAA 3FH1A 3IPTA 3JUMA 4N3VA 2INXA 1W01A 4WYKA 4LMIA 3MG3A 5EVHA 4XBXA 3DUKA 4XDVA 1HKXA 5IEPA 5IF6A 1A2KA 3RGAA 3CNXA 2I9WA 5CLKA 1JKGA 4GB5A 4L8OA 2JQ5A 5KP4A 1OGZA 7STDA 4R1KA 4WP5A 5D82A 1WQLB 5AIFA 4XBTA 1K41A 1O7GB 3OWUA 3MKIA 2BMQB 3GZYB 3G16A 3LZAA 1OUNA 3MHEA 1DMNA 2GEYA 4HM7B 4HM1B 5AIHA 3GZRA 4IIAA 4KVHA 8CHOA 4HM2B 1GY7A 4XDWA 3E99A 1ASKA 3VSYA 3CU3A 1ULIB 3FKAA 1TUHA 3K0ZA 5AIIA 6STDA 1Z1SA 2XSOB 5DREA 3FZWA 1VZZA 1JB5A 3ROBA 3H3HA 1S5AA 3F14A 3STDA 3MYTA 4L8PA 2HMKB 3H51A 3K7CA 4OVMA 2YFJB 3T8NA 3F7XA 4HVNA 3MSOA 3JUQA 3EF8A 5D83A 3BLZA 3F8HA 1DMMA 3OWYA 3B4PA 2GEXA 4HZBB 4STDA 3EBYA 1OGXA 5BXQA 3T8UA 3FSDA 3A76A 1QJGA 4Q53A 4H3UA 5HGRA 2BMRB 5IG5A 4R9KA 3GWRA 4HM0B 3KZTA 3NBRA 3UJMA 1QMAA 4FCJA 1ZO2A 2IMJA 3GRDA 5IG4A 1Q40B 2HMOB 2QIYA 3NV0B 3GZXB 3EX9A 2XRXB 3JUOA 3M8CA 4XM4A 2RGQA 3RGRA 3DM8A 2XR8B 2HMMB 3EJVA 2GXFA 3CNMA 3HK4A 1Q40A 3D9RA 3B4OA 3NV0A 3SEDA 2YFIB 4I4KA 5AEUB 3EHCA 3OV4A 3ECFA 4HM5B 1EA2A 1JB4A 4FCMA 1GYBA 4WWUC 5IENA 4HJLB 1W02A 3F9SA 1UUVB 1NDOB 3G0KA 4LGQA 3DXOA 2XSHB 5FW5A 1ULJB 1W00A 3VGNA 1O7PB 3EQQB 3EN8A 2HMJB 3GZBA 3KE7A 4HZ9B 5IG3A 1ZX2A 2QGUA 2W2CA 5BVBA 5G2GA 2B24B 1DMQA 2HMLB 3NM2A 5STDA 2YFLB 4J9AA 2HMNB
chains in the Genus database with same CATH superfamily
4U13A 2JDIH 3DGNA 3FF2A 2FXTA 2K54A 2W6JH 1I3IA 3EN1B 1Q7Y4 5M1AA 1BNJA 4X2OA 5CF2A 2BMOB 2CFDA 1NB5I 3B7CA 3WOFB 5I97A 3F7SA 2CKFB 2STDA 1UUWB 4HYZA 4R4KA 1UCLA 3Q2PA 2ML5A 4O02B 5AYRB 1ROAA 1JJ22 2BU4A 1RKYA 3FLJA 1NU3A 2GBWB 1YJ93 1W2B2 3LOYA 3SOYA 1GY5A 1EEJA 1A2VA 1U5OA 2OWPA 1I3FA 2KAAA 5G1LA 1YVBI 4N6UA 1IQXA 1OCVA 1LNIA 1A90A 1ISKA 4FMAA 1I70A 2KCDA 1JB2A 3JVCA 3OX9A 2F56A 1EUIC 5JPUA 3EB8A 1IV9A 1X1UA 2F99A 1RNBA 2F86B 4L7KA 1YGEA 1WMPA 1STDA 4TX4A 3B8LA 3I0YA 1C7HA 1V74A 5AI1A 2CFGA 1MWRA 1S723 2Z76A 1T3BA 2XFSA 3DY5A 1O7NB 3KFQC 3LT9A 5ELJA 1N8R4 2E2UA 1BVIA 4HM8B 1UI8A 3KCHA 3ER7A 3HZPA 1Q42A 3NHXA 4PEJA 3WODG 4CPKA 1IK3A 5TGNA 1N9JA 2CC3A 4RNTA 3CCR3 4HKVB 2Z77A 1FUSA 3EE1A 3G8ZA 3FGYA 4K1VA 4N6TA 1BUJA 2MC8A 3G6E3 5IG0A 1SJWA 1FYSA 1NO3A 2PZVA 1BRHA 1OPYA 4LEHA 1A67A 4BTWA 1I0VA 1I0XA 4EXRA 2A15A 2SARA 5CF1A 5DREA 3HX8A 1B2XA 1SARA 3BB9A 3MPHA 4K61A 1JBTA 3CME3 3CD63 2CFKA 1SPUA 5CXOA 1I8VA 1K8A4 3F40A 2OCTA 3TDGA 3WMDA 1OHPA 5JPPA 1RRLA 5KP1A 3LTAA 1IVVA 2C10A 5DRVA 2CHCA 1MNLA 1Q814 2WGQA 4MMXB 3VF1A 4AKZA 3FG4A 2BIRA 4NREA 1RRHA 2RCDA 5AEWB 3F8XA 1B2MA 3WA2X 1MWUA 2V1LA 2OOVA 1Y4KA 1O7HB 3FF0A 2GU1A 2RFRA 3LYGA 4K90B 1IYYA 3JUPA 2J8XB 2Z7AA 1B20A 4R9LA 3NXJA 2YX9A 4JF8A 1BAOA 3G713 1B2SA 4XBYA 2KF6A 3UL6A 1FA3A 2R4IA 1I2EA 1JN5B 3S5CA 2F98A 4ILFA 2K0MA 4RBNA 3V99A 1IDPA 4OUQA 4BTYA 1OHSA 5EEOA 1F8NA 5ELUA 1B2UA 2XEPA 2UX0A 4EW5A 2K3DA 1T2HA 3SLUA 3J7Yd 1TRQA 4I5QA 1MWTA 4K1UA 2KF5A 4MMYB 3Q1CA 4NHFA 4ORLA 1VQL3 4IT7A 4MMZB 5IEOA 2P09A 3U1WA 1QAKA 1OH0A 1W6YA 2CWVA 2B1XB 1IVUA 2CG1A 3OWSA 3ZFZA 4X2HA 1TTOA 1RGGA 3OXAA 3DMCA 3EBTA 3BNDA 4RZMA 2QEX3 4CDLA 2M7OA 1E3RA 3DZLA 1M9GA 1BANA 1CQSA 4N6V0 5GSPA 1AR0A 1VQ93 3X3XA 1E3VA 3Q90A 3Q3FA 1JNQA 3HI7A 1JN5A 3CPOA 1X1XA 1Q824 3KKGA 1AY7A 1DVCA 2GBXB 3UNLA 4BTXA 2LYXA 3CCJ3 3NM7A 3X40A 3EC9A 2KF3A 1TP6A 4HM6B 3BIRA 3CMA3 4N6OB 1NWWA 1YNVX 3WOEB 3X42A 5IERA 1M1XB 1TU5A 4G1MB 2ML6A 5KP3A 1TRPA 1QVG2 3CPW2 1FGRA 3X41A 1CEWI 1VQQA 1I2FA 1O7MB 1US1A 1LNHA 1BNEA 3WDGB 8RNTA 3CC43 1FUWA 4BL3A 1VQ83 2IUKA 4HM3B 1BRKA 1N9EA 1BUQA 3BU4A 1R4CA 1GMQA 1OF5B 1GD4A 2H0IA 1WMNA 1MWSA 2C11A 4MJDA 4O8SA 2HOHA 2UUGC 3KSPA 4IPBA 3AHWA 6GSPA 2D1WA 1O7WB 3MG2A 4J8TA 5M18A 3N54B 5JBSA 1G0TA 1BGSA 1IQ8A 3NUVA 5AIGA 1IT7A 3JUNA 1JRQA 3BNCA 4WYKB 5CK6A 6RNTA 4MEIA 1WNHA 1RHLA 3MG1A 2ZA4A 1BOXA 2XGLA 5D81A 1E97A 1GY6A 1V57A 4DKIA 2BNGA 4HM4B 1OHOA 3A5EA 3PCSA 1MGWA 1EG9B 1I2GA 1KWIA 1PY3A 1OF5A 1JKGB 1T5YA 2CX1A 1VQK3 3V92A 1KQS2 1GS3A 4XB5A 2O3OA 1SIIA 3AHSA 3SOAA 1G96A 2H0GA 3FH1A 1RDSA 1RTUA 1VQO3 1LOYA 3IPTA 2WO0A 3JUMA 4N3VA 1SIHA 1RGKA 1W7CA 2INXA 3S29A 1GOUA 1VQP3 2CFWA 3CC23 1W01A 4WYKA 4LMIA 3MG3A 3NBBA 3SYUA 5EVHA 3KIIA 3L0RA 4LYLB 1AV4A 1RGCA 1V58A 2CK3H 3LTBA 4XBXA 3V98A 3DUKA 4XDVA 4KFEA 4EYCA 1HKXA 5IEPA 5IF6A 1A2KA 4FCZA 2RNTA 3ZG5A 4H61A 3RGAA 1RMSA 1LRAA 2WOHA 3CNXA 2CFLA 2I9WA 2XH9A 1FUTA 1YVSA 5CLKA 1JKGA 2IUJA 4GB5A 4L8OA 1YHQ3 2JQ5A 5KP4A 1OGZA 7STDA 1RGLA 4KZ1A 1JV2B 1RN4A 4R1KA 3FG1A 4WP5A 1J2BA 5D82A 1SQWA 3O8YA 5M19A 1BRGA 2XGNA 1WQLB 1JZOA 5AIFA 3FG3A 4KFDA 1VQ53 1CYUA 4CCVA 1JBSA 1PYLA 4XBTA 4ZM8A 3PCRA 3RNTA 4GHOA 1TFKA 5BIRA 4AEQA 1UCKA 2IYJA 1K41A 2WOFA 1BRJA 1O7GB 2O9UX 3IJEB 3MKIA 3OWUA 2BMQB 3GZYB 2PNCA 3G16A 1Q9EA 3LT8A 3LZAA 3I563 1OUNA 3G4S3 3MHEA 1FGOA 1KC84 1IQYA 1DMNA 3N9HA 2GU3A 2GEYA 2UGIA 1VQ43 3SX1A 4HM7B 4HM1B 3ALAA 5AIHA 5G1KA 1OACA 4AKYA 2SBLA 3URPA 1G02A 3GZRA 3CXC2 4IIAA 1TJDA 4KVHA 4HM2B 8CHOA 1GY7A 4KT3B 2E2VA 4XDWA 1UGIA 1D6YA 1K734 3U97A 2OQEC 2H0HA 1ASKA 3E99A 3VSYA 5A0OB 1YIT3 3CU3A 1UGHI 3PYJA 3MWZA 4FMBA 1NJI4 5HOHA 1ULIB 4N6LA 3FKAA 1ROVA 1TUHA 1BSAA 4RNZA 2ZDJA 3RDEA 3K0ZA 1BSBA 1FGMA 2RBIA 5AIIA 3PGBA 4EC6A 3CCQ3 1X1WA 1WMOA 6STDA 3CCE3 1W2ZA 1Z1SA 1LVNA 2F5MA 5RNTA 5BU4A 3HIGA 4LSOA 1W6CA 2XSOB 1RGFA 1TFOA 3DGLA 1U8CB 2R41A 3FZWA 1VZZA 2C4BA 1JB5A 3CCS3 1FGTA 1T2IA 3ROBA 3H3HA 2CX0A 3GSPA 1S5AA 1IVXA 4N6NB 2BT3A 3F14A 3LH4A 3NQZA 3STDA 1B2ZA 3MYTA 4EV5A 1YGWA 4L8PA 1GOYA 2W04A 1RNTA 1BNFA 1CH0A 2HMKB 3H51A 3K7CA 1AVLA 2E2TA 1BNGA 3PZWA 4OVMA 3BNBA 2YFJB 3UB1A 1DE3A 2BO9B 3D79A 1B27A 3I553 3T8NA 3F7XA 1YJN3 1UDII 1C54A 1RLSA 4BU4A 1VQ63 1ZS7A 1RCLA 1GOVA 4HOHA 4HVNA 2IY2A 2CG0A 3MSOA 3JUQA 3X3YA 3EF8A 1MOLA 3K9MC 2QA43 5D83A 1RN7A 1W6GA 3BLZA 4FMCA 3F8HA 1DMMA 1LQMB 1YIJ3 4O2HA 1RGAA 3DGOA 2XF3A 3OWYA 5LC6A 1R4YA 3B4PA 3SVAA 2OTJ3 1VQ73 2MF7A 3NX0A 3DGYA 3HOHA 4FR9A 4WFOA 3QRDA 1GMPA 1MGRA 2GEXA 2P0MA 4HZBB 1LQGC 3LTCA 3AGOA 4STDA 2Y73A 1IVWA 3EBYA 1UCJA 2CW9A 3WHOA 2CWUA 1OGXA 1BU4A 5BXQA 3T8UA 1KSIA 3D4AA 3FSDA 3CCM3 1GSPA 3A76A 2P38A 1RN1A 2RSXA 1QJGA 4EV2A 1VQN3 1HU9A 4WHAA 1BRNL 3CCU3 4Q53A 1YI23 3IMAB 9RNTA 3CC73 4H3UA 5HGRA 1KD14 1K9M4 2BMRB 5IG5A 4R9KA 2W9PA 1N5HA 1UCIA 1W5ZA 3GWRA 4BL2A 1TIJA 2W9QA 2Z6BA 5AYSC 1BNIA 4HM0B 1HYFA 3KZTA 1FZUA 3LTDA 3AGNA 1K28A 2F4YA 3NBRA 3UJMA 1N5PA 1QMAA 4JRFA 3D5IA 3FCSB 1B21A 3T0UA 1HZ1A 1BSCA 2LQVA 4FCJA 4HAAA 1QVF2 1JZDA 1ZO2A 2CWTA 3WA3A 2IMJA 3GRDA 5IG4A 1Q40B 3GAXA 1B3SA 2HMOB 2QIYA 1RCKA 3NV0B 3KN4A 3GZXB 1PFPA 3EX9A 5EQLA 3AMOB 2XRXB 2ZHXB 3K5TA 2W56B 1LXEA 2OOVC 3S67A 2CH9A 1DETA 1W4NA 4KFFA 1BSEA 4LZIA 3JUOA 3M8CA 4XM4A 2RGQA 3WR2A 3RGRA 3DM8A 3D3LA 2AAEA 1VQM3 1DYUA 3OW22 1PU4A 2XR8B 1EQKA 1UUGB 3S27A 1LOVA 1BSDA 1BNRA 4HBRA 2HMMB 3EJVA 1AQZA 1UW1A 2L4VA 2GXFA 1BRIA 1X1YA 3HIIA 7RNTA 2AADA 1Q7HA 2F5WA 3CNMA 3HK4A 1Q40A 2BHMA 3K63A 1RSNA 3D9RA 3B4OA 4FMDA 2ZL8A 3BNEA 3NV0A 3SEDA 2YFIB 2FGTA 3AMOA 4I4KA 5AEUB 3NBJA 2W56A 3EHCA 3OV4A 4GSPA 3ECFA 1LOXA 3D5GA 4HM5B 4NPBA 3S28A 4CJNA 1EA2A 1D6UA 1JB4A 2KF4A 4FCMA 1GYBA 4WWUC 5IENA 4HJLB 1DVDA 1W02A 3F9SA 3X3ZA 1L5GB 1CYVA 3SXXA 4QWTA 3DH2A 1UUVB 3NQYA 1BRSA 5LC7A 1QALA 1NDOB 4OK0A 3DGMA 1NNVA 3G0KA 2L1SA 1IV7A 3QK9A 1WTHA 3DXOA 2P0XA 1IT8A 2XSHB 1BIRA 4LGQA 4R80A 5FW5A 2OQEA 2P05A 1ULJB 1ZGXA 7GSPA 5IW9A 4J5KA 3LMLA 2WGOA 3CCL3 1W00A 3VGNA 1EKMA 1A2PA 4BIRA 1AVKA 2IA7A 4J5GA 2KXGA 1O7PB 3CCV3 3EQQB 3EN8A 2HMJB 3GZBA 3KE7A 4HZ9B 1STFI 5IG3A 3PXMA 2D42A 1N8QA 4RNYA 1D6ZA 2CIUA 1FGQA 1NB3I 3KSED 1UI7A 4EBGA 1YJW3 2Y74A 1GMRA 1M904 1RGEA 1Q864 1JBRA 1ZX2A 1RJOA 2KRTA 3LXUX 1RGHA 3ZG0A 2QGUA 3PS8A 2W2CA 1IU7A 5BVBA 5G2GA 2B24B 1DMQA 2Q07A 1QAFA 2HMLB 4N6MA 2XFTA 3NM2A 5FGOA 5STDA 3UL5A 4O3VA 1GD3A 2YFLB 4J9AA 1LOWA 1FW7A 2OTL3 2GSPA 2W03A 2HMNB 4GL6A 1M1K4 2W0QA 1BNSA 2FNQA 3N8BA
chains in the Genus database with same CATH topology
4U13A 2JDIH 3DGNA 3FF2A 2FXTA 2K54A 2W6JH 3EN1B 1Q7Y4 4X2OA 5CF2A 2BMOB 2CFDA 1NB5I 3B7CA 3WOFB 5I97A 3F7SA 2CKFB 2STDA 1UUWB 4HYZA 4R4KA 3Q2PA 2ML5A 4O02B 5AYRB 1ROAA 1JJ22 1RKYA 3FLJA 1NU3A 2GBWB 1YJ93 1W2B2 3LOYA 3SOYA 1GY5A 2OWPA 1A2VA 1U5OA 1YVBI 4N6UA 1IQXA 1OCVA 1A90A 1ISKA 4FMAA 5JPUA 2KCDA 1JB2A 3JVCA 3OX9A 3EB8A 1IV9A 2F99A 2F86B 4L7KA 1YGEA 1WMPA 1STDA 4TX4A 3B8LA 3I0YA 1C7HA 1V74A 5AI1A 2CFGA 1S723 2Z76A 2XFSA 3DY5A 1O7NB 3KFQC 3LT9A 5ELJA 1N8R4 2E2UA 4HM8B 1UI8A 3ER7A 3HZPA 1Q42A 3NHXA 4PEJA 3WODG 1IK3A 5TGNA 1N9JA 2CC3A 3CCR3 4HKVB 2Z77A 3EE1A 3G8ZA 3FGYA 4K1VA 4N6TA 2MC8A 3G6E3 5IG0A 1NO3A 1SJWA 2PZVA 1OPYA 4LEHA 1A67A 4BTWA 4EXRA 2A15A 5CF1A 3HX8A 3BB9A 3MPHA 4K61A 3CD63 3CME3 2CFKA 1SPUA 5CXOA 1K8A4 3F40A 2OCTA 3TDGA 3WMDA 1OHPA 5JPPA 1RRLA 5KP1A 3LTAA 1IVVA 2C10A 5DRVA 2CHCA 1MNLA 1Q814 2WGQA 4MMXB 3VF1A 4AKZA 3FG4A 4NREA 1RRHA 2RCDA 5AEWB 3F8XA 3WA2X 2V1LA 2OOVA 1Y4KA 1O7HB 3FF0A 2GU1A 2RFRA 3LYGA 4K90B 3JUPA 2Z7AA 4R9LA 3NXJA 2YX9A 4JF8A 3G713 4XBYA 3UL6A 1FA3A 2R4IA 1JN5B 3S5CA 2F98A 2K0MA 4RBNA 3V99A 1IDPA 4OUQA 4BTYA 1OHSA 5EEOA 1F8NA 5ELUA 2XEPA 2UX0A 3SLUA 3J7Yd 4K1UA 4NHFA 4MMYB 3Q1CA 4ORLA 1VQL3 4IT7A 4MMZB 5IEOA 2P09A 3U1WA 1QAKA 1OH0A 1W6YA 2CWVA 2B1XB 1IVUA 2CG1A 3OWSA 4X2HA 3OXAA 3DMCA 3EBTA 3BNDA 4RZMA 2QEX3 4CDLA 2M7OA 1E3RA 3DZLA 1M9GA 1CQSA 4N6V0 1AR0A 1VQ93 3X3XA 1E3VA 3Q90A 1JNQA 3HI7A 1JN5A 3CPOA 1Q824 3KKGA 1DVCA 3UNLA 2GBXB 3CCJ3 4BTXA 2LYXA 3NM7A 3X40A 3EC9A 1TP6A 4HM6B 3CMA3 4N6OB 1NWWA 3WOEB 3X42A 5IERA 1M1XB 1TU5A 4G1MB 2ML6A 5KP3A 1QVG2 1FGRA 3X41A 1CEWI 1O7MB 1US1A 1LNHA 3WDGB 3CC43 1FUWA 1VQ83 2IUKA 4HM3B 1N9EA 1BUQA 1R4CA 1OF5B 1GD4A 1WMNA 2C11A 4MJDA 4O8SA 3KSPA 4IPBA 2D1WA 1O7WB 3MG2A 4J8TA 3N54B 5JBSA 1IQ8A 3NUVA 5AIGA 1IT7A 3JUNA 1JRQA 3BNCA 4WYKB 5CK6A 4MEIA 1WNHA 3MG1A 2XGLA 5D81A 1E97A 1GY6A 2BNGA 4HM4B 1OHOA 3PCSA 1EG9B 1KWIA 1T5YA 1OF5A 1JKGB 1VQK3 1KQS2 3V92A 1GS3A 4XB5A 2O3OA 1SIIA 3SOAA 1G96A 3FH1A 1VQO3 3IPTA 2WO0A 3JUMA 4N3VA 1SIHA 1W7CA 2INXA 3S29A 1VQP3 2CFWA 3CC23 1W01A 4WYKA 4LMIA 3MG3A 3NBBA 5EVHA 3KIIA 3L0RA 1AV4A 3LTBA 4XBXA 2CK3H 3V98A 3DUKA 4XDVA 4KFEA 4EYCA 1HKXA 5IEPA 5IF6A 1A2KA 4FCZA 4H61A 3RGAA 2WOHA 3CNXA 2CFLA 2I9WA 2XH9A 5CLKA 1JKGA 2IUJA 4GB5A 4L8OA 1YHQ3 2JQ5A 5KP4A 1OGZA 7STDA 4KZ1A 1JV2B 4R1KA 3FG1A 4WP5A 1J2BA 5D82A 1SQWA 3O8YA 2XGNA 1WQLB 5AIFA 3FG3A 4KFDA 1VQ53 1CYUA 4CCVA 4XBTA 4ZM8A 3PCRA 1TFKA 4AEQA 2WOFA 1K41A 1O7GB 3IJEB 2O9UX 3MKIA 3OWUA 2BMQB 3GZYB 2PNCA 3G16A 3LT8A 3LZAA 3G4S3 3I563 1OUNA 3CPW2 3MHEA 1FGOA 1KC84 1IQYA 1DMNA 3N9HA 2GU3A 2GEYA 1VQ43 3SX1A 4HM7B 4HM1B 3ALAA 5AIHA 4AKYA 1OACA 2SBLA 3GZRA 3CXC2 4IIAA 4KVHA 8CHOA 4HM2B 1GY7A 2E2VA 4XDWA 1K734 1D6YA 3U97A 2OQEC 3E99A 1ASKA 3VSYA 5A0OB 1YIT3 3CU3A 3PYJA 3MWZA 4FMBA 1NJI4 1ULIB 4N6LA 3FKAA 1ROVA 1TUHA 4RNZA 2ZDJA 3RDEA 3K0ZA 1FGMA 5AIIA 3PGBA 4EC6A 3CCQ3 1WMOA 6STDA 3CCE3 1W2ZA 1Z1SA 1LVNA 3HIGA 4LSOA 1W6CA 2XSOB 1TFOA 3DGLA 3FZWA 1U8CB 5DREA 1VZZA 1JB5A 3CCS3 1FGTA 3ROBA 3H3HA 1S5AA 1IVXA 4N6NB 2BT3A 3F14A 3LH4A 3NQZA 3STDA 3MYTA 4EV5A 4L8PA 2W04A 2HMKB 3H51A 3K7CA 1AVLA 2E2TA 3PZWA 4OVMA 3BNBA 2YFJB 3UB1A 2BO9B 3I553 3T8NA 3F7XA 1YJN3 1VQ63 4HVNA 2CG0A 3MSOA 3JUQA 3X3YA 3EF8A 1MOLA 3K9MC 2QA43 5D83A 1RN7A 1W6GA 3BLZA 4FMCA 3F8HA 1DMMA 1YIJ3 4O2HA 3DGOA 2XF3A 3OWYA 5LC6A 3B4PA 3SVAA 2OTJ3 1VQ73 2MF7A 3NX0A 4FR9A 4WFOA 3QRDA 2GEXA 2P0MA 4HZBB 3LTCA 4STDA 2Y73A 1IVWA 3EBYA 2CW9A 2CWUA 1OGXA 5BXQA 3T8UA 1KSIA 3FSDA 3CCM3 3A76A 2P38A 2RSXA 1QJGA 4EV2A 1VQN3 1HU9A 4WHAA 3CCU3 4Q53A 1YI23 3IMAB 3CC73 4H3UA 5HGRA 1KD14 1K9M4 2BMRB 5IG5A 4R9KA 2W9PA 1N5HA 1W5ZA 3GWRA 1TIJA 2Z6BA 2W9QA 5AYSC 4HM0B 3KZTA 3LTDA 1K28A 3NBRA 3UJMA 1N5PA 1QMAA 4JRFA 3FCSB 3T0UA 2LQVA 4FCJA 1QVF2 1ZO2A 2CWTA 3WA3A 2IMJA 3GRDA 5IG4A 1Q40B 3GAXA 2HMOB 2QIYA 3NV0B 3KN4A 3GZXB 1PFPA 3EX9A 5EQLA 3AMOB 2XRXB 3K5TA 2W56B 1LXEA 2OOVC 3S67A 2CH9A 1W4NA 4KFFA 4LZIA 3JUOA 3M8CA 4XM4A 2RGQA 3RGRA 3DM8A 3D3LA 1VQM3 1DYUA 3OW22 1PU4A 2XR8B 1EQKA 3S27A 4HBRA 2HMMB 3EJVA 3HIIA 1UW1A 2L4VA 2GXFA 3CNMA 3HK4A 1Q40A 2BHMA 3K63A 3D9RA 3B4OA 4FMDA 2ZL8A 3BNEA 3NV0A 3SEDA 2YFIB 2FGTA 3AMOA 4I4KA 5AEUB 3NBJA 2W56A 3EHCA 3OV4A 3ECFA 1LOXA 4HM5B 3S28A 1EA2A 1D6UA 1JB4A 4FCMA 1GYBA 4WWUC 5IENA 4HJLB 1DVDA 1W02A 3F9SA 3X3ZA 1L5GB 1CYVA 3SXXA 4QWTA 1UUVB 3NQYA 5LC7A 1QALA 1NDOB 4OK0A 3DGMA 3G0KA 3QK9A 1IV7A 4LGQA 1WTHA 3DXOA 2P0XA 1IT8A 2XSHB 4R80A 5FW5A 2OQEA 2P05A 1ULJB 5IW9A 3LMLA 2WGOA 3CCL3 1W00A 3VGNA 1EKMA 1AVKA 2IA7A 2KXGA 1O7PB 3CCV3 3EQQB 3EN8A 2HMJB 3GZBA 3KE7A 4HZ9B 1STFI 5IG3A 3PXMA 2D42A 1N8QA 4RNYA 1D6ZA 2CIUA 1FGQA 1NB3I 3KSED 1UI7A 4EBGA 1YJW3 2Y74A 1M904 1Q864 1ZX2A 1RJOA 2KRTA 3LXUX 2QGUA 3PS8A 2W2CA 1IU7A 5BVBA 5G2GA 2B24B 1DMQA 2Q07A 1QAFA 2HMLB 4N6MA 2XFTA 3NM2A 5FGOA 5STDA 3UL5A 4O3VA 1GD3A 2YFLB 4J9AA 2OTL3 2W03A 2HMNB 4GL6A 1M1K4 2W0QA 2FNQA 3N8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U13 A;  3FF2 A;  2K54 A;  3EN1 B;  4X2O A;  5CF2 A;  2BMO B;  3B7C A;  3F7S A;  2CKF B;  2STD A;  1UUW B;  3FLJ A;  1NU3 A;  2GBW B;  3SOY A;  1GY5 A;  2OWP A;  1U5O A;  1OCV A;  1ISK A;  5JPU A;  1JB2 A;  3OX9 A;  2F99 A;  2F86 B;  4L7K A;  1STD A;  3B8L A;  3I0Y A;  1C7H A;  5AI1 A;  2Z76 A;  1O7N B;  4HM8 B;  3ER7 A;  3HZP A;  1Q42 A;  3NHX A;  4PEJ A;  5TGN A;  4HKV B;  2Z77 A;  3G8Z A;  3FGY A;  4K1V A;  5IG0 A;  1SJW A;  2PZV A;  1OPY A;  4LEH A;  2A15 A;  5CF1 A;  3HX8 A;  3BB9 A;  5CXO A;  3F40 A;  3WMD A;  1OHP A;  5JPP A;  5KP1 A;  5DRV A;  2CHC A;  2RCD A;  5AEW B;  3F8X A;  1O7H B;  3FF0 A;  2RFR A;  3LYG A;  3JUP A;  2Z7A A;  4R9L A;  3NXJ A;  4XBY A;  2R4I A;  1JN5 B;  3S5C A;  2F98 A;  1IDP A;  4OUQ A;  1OHS A;  2UX0 A;  4K1U A;  4ORL A;  5IEO A;  1W6Y A;  1OH0 A;  2B1X B;  3OWS A;  4X2H A;  3OXA A;  3DMC A;  3EBT A;  4RZM A;  4CDL A;  1E3R A;  3DZL A;  1CQS A;  1AR0 A;  1E3V A;  3Q90 A;  1JN5 A;  3CPO A;  3KKG A;  3UNL A;  2GBX B;  3EC9 A;  1TP6 A;  4HM6 B;  5IER A;  1NWW A;  5KP3 A;  1O7M B;  4HM3 B;  1BUQ A;  1OF5 B;  4MJD A;  3KSP A;  1O7W B;  3MG2 A;  4J8T A;  3NUV A;  5AIG A;  3JUN A;  4WYK B;  5CK6 A;  3MG1 A;  5D81 A;  1E97 A;  1GY6 A;  2BNG A;  4HM4 B;  1OHO A;  1EG9 B;  1OF5 A;  1JKG B;  1GS3 A;  4XB5 A;  3SOA A;  3FH1 A;  3IPT A;  3JUM A;  4N3V A;  2INX A;  1W01 A;  4WYK A;  4LMI A;  3MG3 A;  5EVH A;  4XBX A;  3DUK A;  4XDV A;  1HKX A;  5IEP A;  5IF6 A;  1A2K A;  3RGA A;  3CNX A;  2I9W A;  5CLK A;  1JKG A;  4GB5 A;  4L8O A;  2JQ5 A;  5KP4 A;  1OGZ A;  7STD A;  4R1K A;  4WP5 A;  5D82 A;  1WQL B;  5AIF A;  4XBT A;  1K41 A;  1O7G B;  3OWU A;  3MKI A;  2BMQ B;  3GZY B;  3G16 A;  3LZA A;  1OUN A;  3MHE A;  1DMN A;  2GEY A;  4HM7 B;  4HM1 B;  5AIH A;  3GZR A;  4IIA A;  4KVH A;  8CHO A;  4HM2 B;  1GY7 A;  4XDW A;  3E99 A;  1ASK A;  3VSY A;  3CU3 A;  1ULI B;  3FKA A;  1TUH A;  3K0Z A;  5AII A;  6STD A;  1Z1S A;  2XSO B;  5DRE A;  3FZW A;  1VZZ A;  1JB5 A;  3ROB A;  3H3H A;  1S5A A;  3F14 A;  3STD A;  3MYT A;  4L8P A;  2HMK B;  3H51 A;  3K7C A;  4OVM A;  2YFJ B;  3T8N A;  3F7X A;  4HVN A;  3MSO A;  3JUQ A;  3EF8 A;  5D83 A;  3BLZ A;  3F8H A;  1DMM A;  3OWY A;  3B4P A;  2GEX A;  4HZB B;  4STD A;  3EBY A;  1OGX A;  5BXQ A;  3T8U A;  3FSD A;  3A76 A;  1QJG A;  4Q53 A;  4H3U A;  5HGR A;  2BMR B;  5IG5 A;  4R9K A;  3GWR A;  4HM0 B;  3KZT A;  3NBR A;  3UJM A;  1QMA A;  4FCJ A;  1ZO2 A;  2IMJ A;  3GRD A;  5IG4 A;  1Q40 B;  2HMO B;  2QIY A;  3NV0 B;  3GZX B;  3EX9 A;  2XRX B;  3JUO A;  3M8C A;  4XM4 A;  2RGQ A;  3RGR A;  3DM8 A;  2XR8 B;  2HMM B;  3EJV A;  2GXF A;  3CNM A;  3HK4 A;  1Q40 A;  3D9R A;  3B4O A;  3NV0 A;  3SED A;  2YFI B;  4I4K A;  5AEU B;  3EHC A;  3OV4 A;  3ECF A;  4HM5 B;  1EA2 A;  1JB4 A;  4FCM A;  1GYB A;  4WWU C;  5IEN A;  4HJL B;  1W02 A;  3F9S A;  1UUV B;  1NDO B;  3G0K A;  4LGQ A;  3DXO A;  2XSH B;  5FW5 A;  1ULJ B;  1W00 A;  3VGN A;  1O7P B;  3EQQ B;  3EN8 A;  2HMJ B;  3GZB A;  3KE7 A;  4HZ9 B;  5IG3 A;  1ZX2 A;  2QGU A;  2W2C A;  5BVB A;  5G2G A;  2B24 B;  1DMQ A;  2HML B;  3NM2 A;  5STD A;  2YFL B;  4J9A A;  2HMN B; 
#chains in the Genus database with same CATH topology
 4U13 A;  2JDI H;  3DGN A;  3FF2 A;  2FXT A;  2K54 A;  2W6J H;  1I3I A;  3EN1 B;  1Q7Y 4;  5M1A A;  1BNJ A;  4X2O A;  5CF2 A;  2BMO B;  2CFD A;  1NB5 I;  3B7C A;  3WOF B;  5I97 A;  3F7S A;  2CKF B;  2STD A;  1UUW B;  4HYZ A;  4R4K A;  1UCL A;  3Q2P A;  2ML5 A;  4O02 B;  5AYR B;  1ROA A;  1JJ2 2;  2BU4 A;  1RKY A;  3FLJ A;  1NU3 A;  2GBW B;  1YJ9 3;  1W2B 2;  3LOY A;  3SOY A;  1GY5 A;  1EEJ A;  1A2V A;  1U5O A;  2OWP A;  1I3F A;  2KAA A;  5G1L A;  1YVB I;  4N6U A;  1IQX A;  1OCV A;  1LNI A;  1A90 A;  1ISK A;  4FMA A;  1I70 A;  2KCD A;  1JB2 A;  3JVC A;  3OX9 A;  2F56 A;  1EUI C;  5JPU A;  3EB8 A;  1IV9 A;  1X1U A;  2F99 A;  1RNB A;  2F86 B;  4L7K A;  1YGE A;  1WMP A;  1STD A;  4TX4 A;  3B8L A;  3I0Y A;  1C7H A;  1V74 A;  5AI1 A;  2CFG A;  1MWR A;  1S72 3;  2Z76 A;  1T3B A;  2XFS A;  3DY5 A;  1O7N B;  3KFQ C;  3LT9 A;  5ELJ A;  1N8R 4;  2E2U A;  1BVI A;  4HM8 B;  1UI8 A;  3KCH A;  3ER7 A;  3HZP A;  1Q42 A;  3NHX A;  4PEJ A;  3WOD G;  4CPK A;  1IK3 A;  5TGN A;  1N9J A;  2CC3 A;  4RNT A;  3CCR 3;  4HKV B;  2Z77 A;  1FUS A;  3EE1 A;  3G8Z A;  3FGY A;  4K1V A;  4N6T A;  1BUJ A;  2MC8 A;  3G6E 3;  5IG0 A;  1SJW A;  1FYS A;  1NO3 A;  2PZV A;  1BRH A;  1OPY A;  4LEH A;  1A67 A;  4BTW A;  1I0V A;  1I0X A;  4EXR A;  2A15 A;  2SAR A;  5CF1 A;  5DRE A;  3HX8 A;  1B2X A;  1SAR A;  3BB9 A;  3MPH A;  4K61 A;  1JBT A;  3CME 3;  3CD6 3;  2CFK A;  1SPU A;  5CXO A;  1I8V A;  1K8A 4;  3F40 A;  2OCT A;  3TDG A;  3WMD A;  1OHP A;  5JPP A;  1RRL A;  5KP1 A;  3LTA A;  1IVV A;  2C10 A;  5DRV A;  2CHC A;  1MNL A;  1Q81 4;  2WGQ A;  4MMX B;  3VF1 A;  4AKZ A;  3FG4 A;  2BIR A;  4NRE A;  1RRH A;  2RCD A;  5AEW B;  3F8X A;  1B2M A;  3WA2 X;  1MWU A;  2V1L A;  2OOV A;  1Y4K A;  1O7H B;  3FF0 A;  2GU1 A;  2RFR A;  3LYG A;  4K90 B;  1IYY A;  3JUP A;  2J8X B;  2Z7A A;  1B20 A;  4R9L A;  3NXJ A;  2YX9 A;  4JF8 A;  1BAO A;  3G71 3;  1B2S A;  4XBY A;  2KF6 A;  3UL6 A;  1FA3 A;  2R4I A;  1I2E A;  1JN5 B;  3S5C A;  2F98 A;  4ILF A;  2K0M A;  4RBN A;  3V99 A;  1IDP A;  4OUQ A;  4BTY A;  1OHS A;  5EEO A;  1F8N A;  5ELU A;  1B2U A;  2XEP A;  2UX0 A;  4EW5 A;  2K3D A;  1T2H A;  3SLU A;  3J7Y d;  1TRQ A;  4I5Q A;  1MWT A;  4K1U A;  2KF5 A;  4MMY B;  3Q1C A;  4NHF A;  4ORL A;  1VQL 3;  4IT7 A;  4MMZ B;  5IEO A;  2P09 A;  3U1W A;  1QAK A;  1OH0 A;  1W6Y A;  2CWV A;  2B1X B;  1IVU A;  2CG1 A;  3OWS A;  3ZFZ A;  4X2H A;  1TTO A;  1RGG A;  3OXA A;  3DMC A;  3EBT A;  3BND A;  4RZM A;  2QEX 3;  4CDL A;  2M7O A;  1E3R A;  3DZL A;  1M9G A;  1BAN A;  1CQS A;  4N6V 0;  5GSP A;  1AR0 A;  1VQ9 3;  3X3X A;  1E3V A;  3Q90 A;  3Q3F A;  1JNQ A;  3HI7 A;  1JN5 A;  3CPO A;  1X1X A;  1Q82 4;  3KKG A;  1AY7 A;  1DVC A;  2GBX B;  3UNL A;  4BTX A;  2LYX A;  3CCJ 3;  3NM7 A;  3X40 A;  3EC9 A;  2KF3 A;  1TP6 A;  4HM6 B;  3BIR A;  3CMA 3;  4N6O B;  1NWW A;  1YNV X;  3WOE B;  3X42 A;  5IER A;  1M1X B;  1TU5 A;  4G1M B;  2ML6 A;  5KP3 A;  1TRP A;  1QVG 2;  3CPW 2;  1FGR A;  3X41 A;  1CEW I;  1VQQ A;  1I2F A;  1O7M B;  1US1 A;  1LNH A;  1BNE A;  3WDG B;  8RNT A;  3CC4 3;  1FUW A;  4BL3 A;  1VQ8 3;  2IUK A;  4HM3 B;  1BRK A;  1N9E A;  1BUQ A;  3BU4 A;  1R4C A;  1GMQ A;  1OF5 B;  1GD4 A;  2H0I A;  1WMN A;  1MWS A;  2C11 A;  4MJD A;  4O8S A;  2HOH A;  2UUG C;  3KSP A;  4IPB A;  3AHW A;  6GSP A;  2D1W A;  1O7W B;  3MG2 A;  4J8T A;  5M18 A;  3N54 B;  5JBS A;  1G0T A;  1BGS A;  1IQ8 A;  3NUV A;  5AIG A;  1IT7 A;  3JUN A;  1JRQ A;  3BNC A;  4WYK B;  5CK6 A;  6RNT A;  4MEI A;  1WNH A;  1RHL A;  3MG1 A;  2ZA4 A;  1BOX A;  2XGL A;  5D81 A;  1E97 A;  1GY6 A;  1V57 A;  4DKI A;  2BNG A;  4HM4 B;  1OHO A;  3A5E A;  3PCS A;  1MGW A;  1EG9 B;  1I2G A;  1KWI A;  1PY3 A;  1OF5 A;  1JKG B;  1T5Y A;  2CX1 A;  1VQK 3;  3V92 A;  1KQS 2;  1GS3 A;  4XB5 A;  2O3O A;  1SII A;  3AHS A;  3SOA A;  1G96 A;  2H0G A;  3FH1 A;  1RDS A;  1RTU A;  1VQO 3;  1LOY A;  3IPT A;  2WO0 A;  3JUM A;  4N3V A;  1SIH A;  1RGK A;  1W7C A;  2INX A;  3S29 A;  1GOU A;  1VQP 3;  2CFW A;  3CC2 3;  1W01 A;  4WYK A;  4LMI A;  3MG3 A;  3NBB A;  3SYU A;  5EVH A;  3KII A;  3L0R A;  4LYL B;  1AV4 A;  1RGC A;  1V58 A;  2CK3 H;  3LTB A;  4XBX A;  3V98 A;  3DUK A;  4XDV A;  4KFE A;  4EYC A;  1HKX A;  5IEP A;  5IF6 A;  1A2K A;  4FCZ A;  2RNT A;  3ZG5 A;  4H61 A;  3RGA A;  1RMS A;  1LRA A;  2WOH A;  3CNX A;  2CFL A;  2I9W A;  2XH9 A;  1FUT A;  1YVS A;  5CLK A;  1JKG A;  2IUJ A;  4GB5 A;  4L8O A;  1YHQ 3;  2JQ5 A;  5KP4 A;  1OGZ A;  7STD A;  1RGL A;  4KZ1 A;  1JV2 B;  1RN4 A;  4R1K A;  3FG1 A;  4WP5 A;  1J2B A;  5D82 A;  1SQW A;  3O8Y A;  5M19 A;  1BRG A;  2XGN A;  1WQL B;  1JZO A;  5AIF A;  3FG3 A;  4KFD A;  1VQ5 3;  1CYU A;  4CCV A;  1JBS A;  1PYL A;  4XBT A;  4ZM8 A;  3PCR A;  3RNT A;  4GHO A;  1TFK A;  5BIR A;  4AEQ A;  1UCK A;  2IYJ A;  1K41 A;  2WOF A;  1BRJ A;  1O7G B;  2O9U X;  3IJE B;  3MKI A;  3OWU A;  2BMQ B;  3GZY B;  2PNC A;  3G16 A;  1Q9E A;  3LT8 A;  3LZA A;  3I56 3;  1OUN A;  3G4S 3;  3MHE A;  1FGO A;  1KC8 4;  1IQY A;  1DMN A;  3N9H A;  2GU3 A;  2GEY A;  2UGI A;  1VQ4 3;  3SX1 A;  4HM7 B;  4HM1 B;  3ALA A;  5AIH A;  5G1K A;  1OAC A;  4AKY A;  2SBL A;  3URP A;  1G02 A;  3GZR A;  3CXC 2;  4IIA A;  1TJD A;  4KVH A;  4HM2 B;  8CHO A;  1GY7 A;  4KT3 B;  2E2V A;  4XDW A;  1UGI A;  1D6Y A;  1K73 4;  3U97 A;  2OQE C;  2H0H A;  1ASK A;  3E99 A;  3VSY A;  5A0O B;  1YIT 3;  3CU3 A;  1UGH I;  3PYJ A;  3MWZ A;  4FMB A;  1NJI 4;  5HOH A;  1ULI B;  4N6L A;  3FKA A;  1ROV A;  1TUH A;  1BSA A;  4RNZ A;  2ZDJ A;  3RDE A;  3K0Z A;  1BSB A;  1FGM A;  2RBI A;  5AII A;  3PGB A;  4EC6 A;  3CCQ 3;  1X1W A;  1WMO A;  6STD A;  3CCE 3;  1W2Z A;  1Z1S A;  1LVN A;  2F5M A;  5RNT A;  5BU4 A;  3HIG A;  4LSO A;  1W6C A;  2XSO B;  1RGF A;  1TFO A;  3DGL A;  1U8C B;  2R41 A;  3FZW A;  1VZZ A;  2C4B A;  1JB5 A;  3CCS 3;  1FGT A;  1T2I A;  3ROB A;  3H3H A;  2CX0 A;  3GSP A;  1S5A A;  1IVX A;  4N6N B;  2BT3 A;  3F14 A;  3LH4 A;  3NQZ A;  3STD A;  1B2Z A;  3MYT A;  4EV5 A;  1YGW A;  4L8P A;  1GOY A;  2W04 A;  1RNT A;  1BNF A;  1CH0 A;  2HMK B;  3H51 A;  3K7C A;  1AVL A;  2E2T A;  1BNG A;  3PZW A;  4OVM A;  3BNB A;  2YFJ B;  3UB1 A;  1DE3 A;  2BO9 B;  3D79 A;  1B27 A;  3I55 3;  3T8N A;  3F7X A;  1YJN 3;  1UDI I;  1C54 A;  1RLS A;  4BU4 A;  1VQ6 3;  1ZS7 A;  1RCL A;  1GOV A;  4HOH A;  4HVN A;  2IY2 A;  2CG0 A;  3MSO A;  3JUQ A;  3X3Y A;  3EF8 A;  1MOL A;  3K9M C;  2QA4 3;  5D83 A;  1RN7 A;  1W6G A;  3BLZ A;  4FMC A;  3F8H A;  1DMM A;  1LQM B;  1YIJ 3;  4O2H A;  1RGA A;  3DGO A;  2XF3 A;  3OWY A;  5LC6 A;  1R4Y A;  3B4P A;  3SVA A;  2OTJ 3;  1VQ7 3;  2MF7 A;  3NX0 A;  3DGY A;  3HOH A;  4FR9 A;  4WFO A;  3QRD A;  1GMP A;  1MGR A;  2GEX A;  2P0M A;  4HZB B;  1LQG C;  3LTC A;  3AGO A;  4STD A;  2Y73 A;  1IVW A;  3EBY A;  1UCJ A;  2CW9 A;  3WHO A;  2CWU A;  1OGX A;  1BU4 A;  5BXQ A;  3T8U A;  1KSI A;  3D4A A;  3FSD A;  3CCM 3;  1GSP A;  3A76 A;  2P38 A;  1RN1 A;  2RSX A;  1QJG A;  4EV2 A;  1VQN 3;  1HU9 A;  4WHA A;  1BRN L;  3CCU 3;  4Q53 A;  1YI2 3;  3IMA B;  9RNT A;  3CC7 3;  4H3U A;  5HGR A;  1KD1 4;  1K9M 4;  2BMR B;  5IG5 A;  4R9K A;  2W9P A;  1N5H A;  1UCI A;  1W5Z A;  3GWR A;  4BL2 A;  1TIJ A;  2W9Q A;  2Z6B A;  5AYS C;  1BNI A;  4HM0 B;  1HYF A;  3KZT A;  1FZU A;  3LTD A;  3AGN A;  1K28 A;  2F4Y A;  3NBR A;  3UJM A;  1N5P A;  1QMA A;  4JRF A;  3D5I A;  3FCS B;  1B21 A;  3T0U A;  1HZ1 A;  1BSC A;  2LQV A;  4FCJ A;  4HAA A;  1QVF 2;  1JZD A;  1ZO2 A;  2CWT A;  3WA3 A;  2IMJ A;  3GRD A;  5IG4 A;  1Q40 B;  3GAX A;  1B3S A;  2HMO B;  2QIY A;  1RCK A;  3NV0 B;  3KN4 A;  3GZX B;  1PFP A;  3EX9 A;  5EQL A;  3AMO B;  2XRX B;  2ZHX B;  3K5T A;  2W56 B;  1LXE A;  2OOV C;  3S67 A;  2CH9 A;  1DET A;  1W4N A;  4KFF A;  1BSE A;  4LZI A;  3JUO A;  3M8C A;  4XM4 A;  2RGQ A;  3WR2 A;  3RGR A;  3DM8 A;  3D3L A;  2AAE A;  1VQM 3;  1DYU A;  3OW2 2;  1PU4 A;  2XR8 B;  1EQK A;  1UUG B;  3S27 A;  1LOV A;  1BSD A;  1BNR A;  4HBR A;  2HMM B;  3EJV A;  1AQZ A;  1UW1 A;  2L4V A;  2GXF A;  1BRI A;  1X1Y A;  3HII A;  7RNT A;  2AAD A;  1Q7H A;  2F5W A;  3CNM A;  3HK4 A;  1Q40 A;  2BHM A;  3K63 A;  1RSN A;  3D9R A;  3B4O A;  4FMD A;  2ZL8 A;  3BNE A;  3NV0 A;  3SED A;  2YFI B;  2FGT A;  3AMO A;  4I4K A;  5AEU B;  3NBJ A;  2W56 A;  3EHC A;  3OV4 A;  4GSP A;  3ECF A;  1LOX A;  3D5G A;  4HM5 B;  4NPB A;  3S28 A;  4CJN A;  1EA2 A;  1D6U A;  1JB4 A;  2KF4 A;  4FCM A;  1GYB A;  4WWU C;  5IEN A;  4HJL B;  1DVD A;  1W02 A;  3F9S A;  3X3Z A;  1L5G B;  1CYV A;  3SXX A;  4QWT A;  3DH2 A;  1UUV B;  3NQY A;  1BRS A;  5LC7 A;  1QAL A;  1NDO B;  4OK0 A;  3DGM A;  1NNV A;  3G0K A;  2L1S A;  1IV7 A;  3QK9 A;  1WTH A;  3DXO A;  2P0X A;  1IT8 A;  2XSH B;  1BIR A;  4LGQ A;  4R80 A;  5FW5 A;  2OQE A;  2P05 A;  1ULJ B;  1ZGX A;  7GSP A;  5IW9 A;  4J5K A;  3LML A;  2WGO A;  3CCL 3;  1W00 A;  3VGN A;  1EKM A;  1A2P A;  4BIR A;  1AVK A;  2IA7 A;  4J5G A;  2KXG A;  1O7P B;  3CCV 3;  3EQQ B;  3EN8 A;  2HMJ B;  3GZB A;  3KE7 A;  4HZ9 B;  1STF I;  5IG3 A;  3PXM A;  2D42 A;  1N8Q A;  4RNY A;  1D6Z A;  2CIU A;  1FGQ A;  1NB3 I;  3KSE D;  1UI7 A;  4EBG A;  1YJW 3;  2Y74 A;  1GMR A;  1M90 4;  1RGE A;  1Q86 4;  1JBR A;  1ZX2 A;  1RJO A;  2KRT A;  3LXU X;  1RGH A;  3ZG0 A;  2QGU A;  3PS8 A;  2W2C A;  1IU7 A;  5BVB A;  5G2G A;  2B24 B;  1DMQ A;  2Q07 A;  1QAF A;  2HML B;  4N6M A;  2XFT A;  3NM2 A;  5FGO A;  5STD A;  3UL5 A;  4O3V A;  1GD3 A;  2YFL B;  4J9A A;  1LOW A;  1FW7 A;  2OTL 3;  2GSP A;  2W03 A;  2HMN B;  4GL6 A;  1M1K 4;  2W0Q A;  1BNS A;  2FNQ A;  3N8B A; 
#chains in the Genus database with same CATH homology
 4U13 A;  2JDI H;  3DGN A;  3FF2 A;  2FXT A;  2K54 A;  2W6J H;  3EN1 B;  1Q7Y 4;  4X2O A;  5CF2 A;  2BMO B;  2CFD A;  1NB5 I;  3B7C A;  3WOF B;  5I97 A;  3F7S A;  2CKF B;  2STD A;  1UUW B;  4HYZ A;  4R4K A;  3Q2P A;  2ML5 A;  4O02 B;  5AYR B;  1ROA A;  1JJ2 2;  1RKY A;  3FLJ A;  1NU3 A;  2GBW B;  1YJ9 3;  1W2B 2;  3LOY A;  3SOY A;  1GY5 A;  2OWP A;  1A2V A;  1U5O A;  1YVB I;  4N6U A;  1IQX A;  1OCV A;  1A90 A;  1ISK A;  4FMA A;  5JPU A;  2KCD A;  1JB2 A;  3JVC A;  3OX9 A;  3EB8 A;  1IV9 A;  2F99 A;  2F86 B;  4L7K A;  1YGE A;  1WMP A;  1STD A;  4TX4 A;  3B8L A;  3I0Y A;  1C7H A;  1V74 A;  5AI1 A;  2CFG A;  1S72 3;  2Z76 A;  2XFS A;  3DY5 A;  1O7N B;  3KFQ C;  3LT9 A;  5ELJ A;  1N8R 4;  2E2U A;  4HM8 B;  1UI8 A;  3ER7 A;  3HZP A;  1Q42 A;  3NHX A;  4PEJ A;  3WOD G;  1IK3 A;  5TGN A;  1N9J A;  2CC3 A;  3CCR 3;  4HKV B;  2Z77 A;  3EE1 A;  3G8Z A;  3FGY A;  4K1V A;  4N6T A;  2MC8 A;  3G6E 3;  5IG0 A;  1NO3 A;  1SJW A;  2PZV A;  1OPY A;  4LEH A;  1A67 A;  4BTW A;  4EXR A;  2A15 A;  5CF1 A;  3HX8 A;  3BB9 A;  3MPH A;  4K61 A;  3CD6 3;  3CME 3;  2CFK A;  1SPU A;  5CXO A;  1K8A 4;  3F40 A;  2OCT A;  3TDG A;  3WMD A;  1OHP A;  5JPP A;  1RRL A;  5KP1 A;  3LTA A;  1IVV A;  2C10 A;  5DRV A;  2CHC A;  1MNL A;  1Q81 4;  2WGQ A;  4MMX B;  3VF1 A;  4AKZ A;  3FG4 A;  4NRE A;  1RRH A;  2RCD A;  5AEW B;  3F8X A;  3WA2 X;  2V1L A;  2OOV A;  1Y4K A;  1O7H B;  3FF0 A;  2GU1 A;  2RFR A;  3LYG A;  4K90 B;  3JUP A;  2Z7A A;  4R9L A;  3NXJ A;  2YX9 A;  4JF8 A;  3G71 3;  4XBY A;  3UL6 A;  1FA3 A;  2R4I A;  1JN5 B;  3S5C A;  2F98 A;  2K0M A;  4RBN A;  3V99 A;  1IDP A;  4OUQ A;  4BTY A;  1OHS A;  5EEO A;  1F8N A;  5ELU A;  2XEP A;  2UX0 A;  3SLU A;  3J7Y d;  4K1U A;  4NHF A;  4MMY B;  3Q1C A;  4ORL A;  1VQL 3;  4IT7 A;  4MMZ B;  5IEO A;  2P09 A;  3U1W A;  1QAK A;  1OH0 A;  1W6Y A;  2CWV A;  2B1X B;  1IVU A;  2CG1 A;  3OWS A;  4X2H A;  3OXA A;  3DMC A;  3EBT A;  3BND A;  4RZM A;  2QEX 3;  4CDL A;  2M7O A;  1E3R A;  3DZL A;  1M9G A;  1CQS A;  4N6V 0;  1AR0 A;  1VQ9 3;  3X3X A;  1E3V A;  3Q90 A;  1JNQ A;  3HI7 A;  1JN5 A;  3CPO A;  1Q82 4;  3KKG A;  1DVC A;  3UNL A;  2GBX B;  3CCJ 3;  4BTX A;  2LYX A;  3NM7 A;  3X40 A;  3EC9 A;  1TP6 A;  4HM6 B;  3CMA 3;  4N6O B;  1NWW A;  3WOE B;  3X42 A;  5IER A;  1M1X B;  1TU5 A;  4G1M B;  2ML6 A;  5KP3 A;  1QVG 2;  1FGR A;  3X41 A;  1CEW I;  1O7M B;  1US1 A;  1LNH A;  3WDG B;  3CC4 3;  1FUW A;  1VQ8 3;  2IUK A;  4HM3 B;  1N9E A;  1BUQ A;  1R4C A;  1OF5 B;  1GD4 A;  1WMN A;  2C11 A;  4MJD A;  4O8S A;  3KSP A;  4IPB A;  2D1W A;  1O7W B;  3MG2 A;  4J8T A;  3N54 B;  5JBS A;  1IQ8 A;  3NUV A;  5AIG A;  1IT7 A;  3JUN A;  1JRQ A;  3BNC A;  4WYK B;  5CK6 A;  4MEI A;  1WNH A;  3MG1 A;  2XGL A;  5D81 A;  1E97 A;  1GY6 A;  2BNG A;  4HM4 B;  1OHO A;  3PCS A;  1EG9 B;  1KWI A;  1T5Y A;  1OF5 A;  1JKG B;  1VQK 3;  1KQS 2;  3V92 A;  1GS3 A;  4XB5 A;  2O3O A;  1SII A;  3SOA A;  1G96 A;  3FH1 A;  1VQO 3;  3IPT A;  2WO0 A;  3JUM A;  4N3V A;  1SIH A;  1W7C A;  2INX A;  3S29 A;  1VQP 3;  2CFW A;  3CC2 3;  1W01 A;  4WYK A;  4LMI A;  3MG3 A;  3NBB A;  5EVH A;  3KII A;  3L0R A;  1AV4 A;  3LTB A;  4XBX A;  2CK3 H;  3V98 A;  3DUK A;  4XDV A;  4KFE A;  4EYC A;  1HKX A;  5IEP A;  5IF6 A;  1A2K A;  4FCZ A;  4H61 A;  3RGA A;  2WOH A;  3CNX A;  2CFL A;  2I9W A;  2XH9 A;  5CLK A;  1JKG A;  2IUJ A;  4GB5 A;  4L8O A;  1YHQ 3;  2JQ5 A;  5KP4 A;  1OGZ A;  7STD A;  4KZ1 A;  1JV2 B;  4R1K A;  3FG1 A;  4WP5 A;  1J2B A;  5D82 A;  1SQW A;  3O8Y A;  2XGN A;  1WQL B;  5AIF A;  3FG3 A;  4KFD A;  1VQ5 3;  1CYU A;  4CCV A;  4XBT A;  4ZM8 A;  3PCR A;  1TFK A;  4AEQ A;  2WOF A;  1K41 A;  1O7G B;  3IJE B;  2O9U X;  3MKI A;  3OWU A;  2BMQ B;  3GZY B;  2PNC A;  3G16 A;  3LT8 A;  3LZA A;  3G4S 3;  3I56 3;  1OUN A;  3CPW 2;  3MHE A;  1FGO A;  1KC8 4;  1IQY A;  1DMN A;  3N9H A;  2GU3 A;  2GEY A;  1VQ4 3;  3SX1 A;  4HM7 B;  4HM1 B;  3ALA A;  5AIH A;  4AKY A;  1OAC A;  2SBL A;  3GZR A;  3CXC 2;  4IIA A;  4KVH A;  8CHO A;  4HM2 B;  1GY7 A;  2E2V A;  4XDW A;  1K73 4;  1D6Y A;  3U97 A;  2OQE C;  3E99 A;  1ASK A;  3VSY A;  5A0O B;  1YIT 3;  3CU3 A;  3PYJ A;  3MWZ A;  4FMB A;  1NJI 4;  1ULI B;  4N6L A;  3FKA A;  1ROV A;  1TUH A;  4RNZ A;  2ZDJ A;  3RDE A;  3K0Z A;  1FGM A;  5AII A;  3PGB A;  4EC6 A;  3CCQ 3;  1WMO A;  6STD A;  3CCE 3;  1W2Z A;  1Z1S A;  1LVN A;  3HIG A;  4LSO A;  1W6C A;  2XSO B;  1TFO A;  3DGL A;  3FZW A;  1U8C B;  5DRE A;  1VZZ A;  1JB5 A;  3CCS 3;  1FGT A;  3ROB A;  3H3H A;  1S5A A;  1IVX A;  4N6N B;  2BT3 A;  3F14 A;  3LH4 A;  3NQZ A;  3STD A;  3MYT A;  4EV5 A;  4L8P A;  2W04 A;  2HMK B;  3H51 A;  3K7C A;  1AVL A;  2E2T A;  3PZW A;  4OVM A;  3BNB A;  2YFJ B;  3UB1 A;  2BO9 B;  3I55 3;  3T8N A;  3F7X A;  1YJN 3;  1VQ6 3;  4HVN A;  2CG0 A;  3MSO A;  3JUQ A;  3X3Y A;  3EF8 A;  1MOL A;  3K9M C;  2QA4 3;  5D83 A;  1RN7 A;  1W6G A;  3BLZ A;  4FMC A;  3F8H A;  1DMM A;  1YIJ 3;  4O2H A;  3DGO A;  2XF3 A;  3OWY A;  5LC6 A;  3B4P A;  3SVA A;  2OTJ 3;  1VQ7 3;  2MF7 A;  3NX0 A;  4FR9 A;  4WFO A;  3QRD A;  2GEX A;  2P0M A;  4HZB B;  3LTC A;  4STD A;  2Y73 A;  1IVW A;  3EBY A;  2CW9 A;  2CWU A;  1OGX A;  5BXQ A;  3T8U A;  1KSI A;  3FSD A;  3CCM 3;  3A76 A;  2P38 A;  2RSX A;  1QJG A;  4EV2 A;  1VQN 3;  1HU9 A;  4WHA A;  3CCU 3;  4Q53 A;  1YI2 3;  3IMA B;  3CC7 3;  4H3U A;  5HGR A;  1KD1 4;  1K9M 4;  2BMR B;  5IG5 A;  4R9K A;  2W9P A;  1N5H A;  1W5Z A;  3GWR A;  1TIJ A;  2Z6B A;  2W9Q A;  5AYS C;  4HM0 B;  3KZT A;  3LTD A;  1K28 A;  3NBR A;  3UJM A;  1N5P A;  1QMA A;  4JRF A;  3FCS B;  3T0U A;  2LQV A;  4FCJ A;  1QVF 2;  1ZO2 A;  2CWT A;  3WA3 A;  2IMJ A;  3GRD A;  5IG4 A;  1Q40 B;  3GAX A;  2HMO B;  2QIY A;  3NV0 B;  3KN4 A;  3GZX B;  1PFP A;  3EX9 A;  5EQL A;  3AMO B;  2XRX B;  3K5T A;  2W56 B;  1LXE A;  2OOV C;  3S67 A;  2CH9 A;  1W4N A;  4KFF A;  4LZI A;  3JUO A;  3M8C A;  4XM4 A;  2RGQ A;  3RGR A;  3DM8 A;  3D3L A;  1VQM 3;  1DYU A;  3OW2 2;  1PU4 A;  2XR8 B;  1EQK A;  3S27 A;  4HBR A;  2HMM B;  3EJV A;  3HII A;  1UW1 A;  2L4V A;  2GXF A;  3CNM A;  3HK4 A;  1Q40 A;  2BHM A;  3K63 A;  3D9R A;  3B4O A;  4FMD A;  2ZL8 A;  3BNE A;  3NV0 A;  3SED A;  2YFI B;  2FGT A;  3AMO A;  4I4K A;  5AEU B;  3NBJ A;  2W56 A;  3EHC A;  3OV4 A;  3ECF A;  1LOX A;  4HM5 B;  3S28 A;  1EA2 A;  1D6U A;  1JB4 A;  4FCM A;  1GYB A;  4WWU C;  5IEN A;  4HJL B;  1DVD A;  1W02 A;  3F9S A;  3X3Z A;  1L5G B;  1CYV A;  3SXX A;  4QWT A;  1UUV B;  3NQY A;  5LC7 A;  1QAL A;  1NDO B;  4OK0 A;  3DGM A;  3G0K A;  3QK9 A;  1IV7 A;  4LGQ A;  1WTH A;  3DXO A;  2P0X A;  1IT8 A;  2XSH B;  4R80 A;  5FW5 A;  2OQE A;  2P05 A;  1ULJ B;  5IW9 A;  3LML A;  2WGO A;  3CCL 3;  1W00 A;  3VGN A;  1EKM A;  1AVK A;  2IA7 A;  2KXG A;  1O7P B;  3CCV 3;  3EQQ B;  3EN8 A;  2HMJ B;  3GZB A;  3KE7 A;  4HZ9 B;  1STF I;  5IG3 A;  3PXM A;  2D42 A;  1N8Q A;  4RNY A;  1D6Z A;  2CIU A;  1FGQ A;  1NB3 I;  3KSE D;  1UI7 A;  4EBG A;  1YJW 3;  2Y74 A;  1M90 4;  1Q86 4;  1ZX2 A;  1RJO A;  2KRT A;  3LXU X;  2QGU A;  3PS8 A;  2W2C A;  1IU7 A;  5BVB A;  5G2G A;  2B24 B;  1DMQ A;  2Q07 A;  1QAF A;  2HML B;  4N6M A;  2XFT A;  3NM2 A;  5FGO A;  5STD A;  3UL5 A;  4O3V A;  1GD3 A;  2YFL B;  4J9A A;  2OTL 3;  2W03 A;  2HMN B;  4GL6 A;  1M1K 4;  2W0Q A;  2FNQ A;  3N8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...