4R9LA

Structure of a thermostable elevenfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis, containing two stabilizing disulfide bonds
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
147
structure length
147
Chain Sequence
b'KCEQPRWASKDPAAGKASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFKVMSIDAVCVFHICSCKGLVFTERVDVLRALPTGKSYNLSILGVFQLTDGKITGWRDYFDLREFEEAVDLPLRGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title X-ray crystallographic validation of structure predictions used in computational design for protein stabilization.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 44
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r9lA00
3JUNA 1OGXA 3EBTA 3EN1B 2BMRB 3FKAA 3F7SA 3HZPA 2IMJA 3FSDA 3STDA 3SOYA 1E3VA 4XBTA 2Z77A 1E3RA 5CK6A 3DMCA 3MSOA 3GRDA 3FLJA 4LGQA 4LMIA 5IEOA 1OUNA 3EQQB 5AEUB 2JQ5A 1UUWB 1JKGA 3K7CA 3ER7A 4HKVB 3I0YA 1ULIB 3G0KA 2HMNB 8CHOA 4R1KA 1K41A 3GZYB 4GB5A 4HM1B 3BB9A 3B8LA 2HMKB 2F86B 3DZLA 3CNMA 5JPPA 3JUMA 3F8XA 3EN8A 1ISKA 4HM2B 1JN5B 4HZBB 3H3HA 3BLZA 5JPUA 4HM3B 4X2HA 1ASKA 4K1UA 4R9KA 3T8NA 4WP5A 4STDA 4U13A 1Q42A 3F8HA 2QIYA 3D9RA 2QGUA 3EX9A 3KSPA 4FCMA 1STDA 4HZ9B 1DMQA 3ROBA 2XRXB 5KP3A 4I4KA 3B4PA 3FF2A 1A2KA 3G8ZA 4XM4A 3EF8A 3K0ZA 2CKFB 1GYBA 1E97A 3WMDA 1DMMA 4HJLB 5D82A 1O7PB 4R9LA 4MJDA 1WQLB 2XR8B 3LZAA 3NV0A 3DXOA 3MG3A 2GBWB 2R4IA 2I9WA 3HX8A 3B7CA 3GZBA 7STDA 5D83A 1HKXA 3KKGA 4HM8B 3H51A 4L8OA 3HK4A 3Q90A 1OHPA 1EA2A 5AEWB 1GS3A 1NDOB 3JUQA 5CLKA 1OHOA 3SEDA 5IEPA 4HM7B 3GZXB 4N3VA 4WYKB 2K54A 4K1VA 4ORLA 1QJGA 3OWYA 4XDVA 3DM8A 1O7WB 1AR0A 4Q53A 1U5OA 5BXQA 5AIFA 3OXAA 1TUHA 4FCJA 3ECFA 5CXOA 5HGRA 4L8PA 5DRVA 1W02A 5IG0A 2XSOB 4XBXA 1QMAA 4PEJA 3FZWA 3NM2A 3MYTA 2YFJB 1EG9B 1JN5A 4H3UA 1OF5B 3JUPA 2PZVA 5IG3A 2BMOB 3OWSA 3DUKA 3MG2A 4KVHA 5KP4A 2GEYA 6STDA 3IPTA 2STDA 3EC9A 1UUVB 2UX0A 4RZMA 4WWUC 5D81A 3UJMA 1GY7A 2BNGA 4CDLA 2HMMB 1OCVA 2RGQA 3T8UA 2BMQB 3FF0A 2Z7AA 4X2OA 3EBYA 4HM4B 3F14A 5TGNA 4OVMA 5IENA 2GBXB 3CU3A 1S5AA 3CNXA 2OWPA 3JUOA 5DREA 1OGZA 2B24B 3EJVA 1DMNA 1Q40B 2A15A 3MKIA 2RCDA 5CF2A 3GZRA 3SOAA 3VGNA 1Z1SA 2GXFA 5AI1A 3MG1A 4XBYA 4HVNA 5IG4A 3UNLA 2W2CA 4LEHA 3MHEA 3NBRA 2INXA 3OV4A 4J8TA 3OWUA 1VZZA 1OH0A 1GY6A 1W00A 3FGYA 1IDPA 3F40A 4XDWA 1O7HB 4WYKA 2HMOB 2XSHB 3KZTA 1JKGB 1O7GB 4HM6B 1C7HA 1ZX2A 5AIIA 1OPYA 1BUQA 3NXJA 3GWRA 3M8CA 5IERA 2Z76A 2F99A 5KP1A 1ZO2A 3G16A 1OF5A 1O7NB 1ULJB 1JB5A 1TP6A 3EHCA 3F9SA 5CF1A 2RFRA 5AIHA 5EVHA 4HM5B 2F98A 3RGAA 3CPOA 4J9AA 2GEXA 2HMLB 4HM0B 3RGRA 3VSYA 3NUVA 5G2GA 1JB4A 2YFIB 1JB2A 1W6YA 5AIGA 3E99A 2B1XB 5FW5A 5IG5A 2CHCA 3F7XA 3FH1A 1NWWA 1SJWA 1GY5A 1NU3A 4L7KA 3S5CA 5IF6A 4OUQA 4IIAA 4XB5A 5STDA 3A76A 3KE7A 1O7MB 2HMJB 1Q40A 1OHSA 3NHXA 3B4OA 3LYGA 3NV0B 1W01A 5BVBA 1CQSA 3OX9A 2YFLB
chains in the Genus database with same CATH superfamily
1A67A 3JUNA 2XFTA 3BNDA 1OGXA 3EBTA 5AYSC 3EN1B 1AVKA 1IT8A 3SYUA 3S27A 1W2ZA 3WOFB 2BMRB 1B2UA 4CCVA 1VQN3 2CX0A 1UGHI 3FKAA 3F7SA 2WGOA 3HZPA 1YIT3 2XEPA 1BUJA 1LOVA 2IMJA 3FSDA 1RJOA 3BU4A 3Q3FA 3STDA 4AKYA 1Q7Y4 1A2VA 4N6UA 2ML5A 4CPKA 3SOYA 3DY5A 4CJNA 3CCV3 1E3VA 3KIIA 4XBTA 5IW9A 1BU4A 1CYUA 3HOHA 2F5WA 1Q9EA 2Z77A 4K90B 1E3RA 2ML6A 5CK6A 1K9M4 3MWZA 1VQ73 1UI8A 2KXGA 2KRTA 3DMCA 4HBRA 4JRFA 3X3YA 2WOHA 3MSOA 1M9GA 1RGKA 2QEX3 1RGCA 3GRDA 3FLJA 1RCLA 1I0VA 5AYRB 4LGQA 4LMIA 5IEOA 1OUNA 1BRSA 3EQQB 1US1A 1UCJA 1M1K4 1HZ1A 1SIIA 1N8QA 5AEUB 2JQ5A 3WODG 1IVVA 3PS8A 1PU4A 1UUWB 2ZHXB 1JKGA 3K7CA 5I97A 3LMLA 1BANA 1I70A 3O8YA 3ER7A 1ZS7A 3I0YA 4HKVB 1ULIB 4BTXA 2CFLA 1NJI4 4NPBA 1UGIA 3CME3 2FXTA 2H0IA 3G0KA 1TJDA 4MMYB 1RGFA 3K5TA 2HMNB 8CHOA 1YJW3 1T3BA 4R1KA 2KCDA 1K41A 1MWSA 1RTUA 2IUKA 2BU4A 3GZYB 4GB5A 3T0UA 1JV2B 1IU7A 3CCS3 1Q7HA 2F56A 4WHAA 3LTDA 2GSPA 4HM1B 3WHOA 2W03A 3BB9A 3NBBA 1Q864 3PZWA 2H0HA 2HMKB 3B8LA 2F86B 3DZLA 4FMBA 2O9UX 3CNMA 1W6CA 1K28A 2CFDA 2CWVA 4R80A 5JPPA 3URPA 3JUMA 1IV7A 2K0MA 3F8XA 3Q2PA 3EN8A 1SPUA 5ELJA 1ISKA 1RN4A 2F5MA 3DGNA 1JN5B 3BNCA 4HM2B 4HZBB 3H3HA 3ALAA 4H61A 4EYCA 3BLZA 4O2HA 5JPUA 3BIRA 3KFQC 1RSNA 4HM3B 4X2HA 3HIGA 1LXEA 1BRHA 1ASKA 4K1UA 4R9KA 1VQO3 4N6OB 1BSBA 3PXMA 3WA2X 3T8NA 1FA3A 4WP5A 1LQMB 4EW5A 2UGIA 4IPBA 4STDA 1BGSA 4U13A 1MWUA 2P0MA 1Q42A 2UUGC 3F8HA 1GOUA 2QIYA 3X3ZA 3WOEB 4N6V0 3D9RA 4J5KA 2QGUA 3EX9A 3KSPA 3GAXA 4FCMA 1N5HA 1STDA 2OOVA 3S67A 4HZ9B 3ZFZA 4FMDA 3G4S3 4EC6A 2LQVA 1DMQA 3ROBA 9RNTA 3AMOA 1UCKA 1QVG2 2XRXB 3UL6A 1IVUA 5KP3A 3G6E3 2SARA 4I4KA 2CG1A 6RNTA 4G1MB 1WTHA 3S29A 1IV9A 3B4PA 3FF2A 1A2KA 1SQWA 4NREA 3CCM3 1W2B2 2W56B 3CPW2 3G8ZA 4XM4A 3EF8A 3K0ZA 2CKFB 3NX0A 4LYLB 1GYBA 1E97A 3D5GA 1WMPA 3WMDA 1VQ93 1BRNL 1BRJA 1DMMA 2CK3H 4RNZA 4HJLB 4EBGA 5D82A 1YJN3 1O7PB 3I563 2CG0A 1TFKA 4R9LA 4MJDA 3LTBA 3X42A 1WQLB 3FG3A 2XR8B 3SLUA 2WO0A 3LZAA 1EUIC 1DVCA 2CFGA 1STFI 3NV0A 3AHWA 1BAOA 3DXOA 1IK3A 2QA43 2P05A 3MG3A 1RCKA 1PY3A 2GBWB 2R4IA 2I9WA 4EV2A 1L5GB 1BNIA 5G1LA 2FGTA 3AGNA 1UW1A 3HX8A 5HOHA 3B7CA 4O3VA 3GZBA 1G96A 7STDA 1I3IA 1IVXA 3G713 5D83A 1HKXA 3KKGA 3VF1A 3BNBA 3I553 1BNGA 1BNRA 1BRIA 1RNTA 1SARA 4HM8B 2C11A 1PFPA 3H51A 3CCQ3 4GHOA 3GSPA 4L8OA 1MOLA 3HK4A 2Y74A 2YX9A 3D4AA 5EQLA 1B2MA 3Q90A 1OHPA 1EA2A 2SBLA 4KFFA 5AEWB 1GS3A 1QAFA 2CX1A 1NDOB 1JBTA 1BSCA 3NM7A 1RHLA 3CMA3 1YVBI 1MWRA 3JUQA 4BTWA 5CLKA 1OHOA 3LOYA 3SEDA 1T2HA 1C54A 5IEPA 1GD4A 4HM7B 4EXRA 1BSDA 3GZXB 3KN4A 3N8BA 3PCSA 5M1AA 1TIJA 4KFDA 5BU4A 3LH4A 1TRPA 2W6JH 2XH9A 1RGGA 1BSAA 5LC6A 4ILFA 1TFOA 1ROAA 4BU4A 2MF7A 2CWTA 4N3VA 1JRQA 1BNSA 2Q07A 1KC84 4WYKB 2K54A 4MEIA 4K1VA 2Y73A 4ORLA 1RDSA 3U97A 1QJGA 5RNTA 3N54B 3OWYA 4XDVA 3DM8A 1B2XA 1O7WB 3WR2A 1AR0A 3WDGB 5JBSA 1HU9A 4Q53A 1VQ43 2W04A 1MGWA 1U5OA 3HIIA 1RGAA 1MWTA 1IQYA 5BXQA 2OCTA 5AIFA 1BSEA 1B2ZA 3OXAA 2ZL8A 1TUHA 1AQZA 1PYLA 3ECFA 3LTCA 4FCJA 4KFEA 2IUJA 3CXC2 1ZGXA 3AGOA 2WGQA 5CXOA 1NNVA 5HGRA 1DYUA 1F8NA 2RBIA 3IMAB 1BIRA 3V98A 1GD3A 3EE1A 4L8PA 5DRVA 1W02A 1SIHA 1FGTA 2KF4A 2ZA4A 2XSOB 4J5GA 5IG0A 1BNJA 3FG4A 3DGLA 3K9MC 1QMAA 4XBXA 2GU1A 1T5YA 2CFWA 4PEJA 1YVSA 3FZWA 3MYTA 1FGOA 3NM2A 4AKZA 1FGRA 4N6MA 3J7Yd 2YFJB 1WMOA 1EG9B 1JN5A 4H3UA 4ZM8A 1OF5B 4N6LA 1BRGA 3JUPA 1GOVA 2PZVA 2AAEA 2BMOB 1FZUA 5IG3A 1FGMA 3DUKA 3OWSA 4I5QA 5GSPA 1YI23 3MG2A 2E2TA 1AY7A 1I2FA 3CC23 2BIRA 1TTOA 3U1WA 1R4CA 1N5PA 2HOHA 4KVHA 3SX1A 5KP4A 2GEYA 3IJEB 1VQK3 1NO3A 6STDA 3IPTA 4BTYA 2STDA 1V74A 4GSPA 3EC9A 2CW9A 1UUVB 2XGNA 4OK0A 3UB1A 1VQ53 2UX0A 3LT9A 1LNIA 1UUGB 7GSPA 1I2EA 4RZMA 1UCIA 1FYSA 4WWUC 5D81A 3UJMA 3A5EA 4RBNA 1IQXA 1UDII 1X1YA 2JDIH 1MNLA 1GY7A 2BNGA 2L1SA 3JVCA 4CDLA 1N9JA 3X41A 1M904 3D3LA 2HMMB 1GMRA 1HYFA 1OCVA 2RGQA 1JZOA 1YJ93 3T8UA 1LQGC 2BMQB 2W56A 3FF0A 1UCLA 2OOVC 3CD63 5BIRA 2Z7AA 1IYYA 4X2OA 3EBYA 1DVDA 4MMXB 3V92A 4HM4B 1W5ZA 1IQ8A 3F14A 5TGNA 3DGOA 4OVMA 5IENA 1KQS2 2P38A 3LTAA 3CCJ3 1A2PA 2IY2A 2GBXB 2XF3A 4KT3B 3CU3A 1S5AA 3KCHA 3CNXA 2OWPA 3QRDA 1W4NA 3JUOA 2PNCA 2OTJ3 3K63A 5DREA 4DKIA 1TRQA 2CFKA 1OGZA 1VQP3 1FUSA 2B24B 2CWUA 3EJVA 1DMNA 1NB3I 1Q40B 3Q1CA 1W7CA 2KF6A 2A15A 1DETA 4R4KA 1K734 3UL5A 4BL3A 1CEWI 3X40A 3X3XA 3MKIA 1LOXA 2BT3A 4K61A 2RCDA 3RNTA 5CF2A 3GZRA 3SOAA 1QAKA 2W9PA 3VGNA 1Z1SA 3HI7A 1B2SA 3NQYA 2C10A 1CYVA 2GXFA 2J8XB 1TU5A 1I8VA 2RNTA 2V1LA 5AI1A 1YIJ3 1GOYA 3MG1A 1RMSA 4XBYA 5G1KA 1V57A 1RN1A 2L4VA 4BL2A 3CC73 1KD14 4HVNA 3DH2A 3SXXA 3D79A 2P09A 3PYJA 4WFOA 5IG4A 4AEQA 4RNYA 4N6TA 1NB5I 3QK9A 3UNLA 2W2CA 4LEHA 3MHEA 4TX4A 3NBRA 2OTL3 3OW22 1RNBA 2INXA 1A90A 1AVLA 3OV4A 4J8TA 5FGOA 5EEOA 1BVIA 3OWUA 1T2IA 1VZZA 1OH0A 2GU3A 3FG1A 1GY6A 2ZDJA 1W00A 3FGYA 3KSED 1WNHA 1IDPA 2IA7A 4KZ1A 1D6ZA 2E2VA 1Q814 1O7HB 3F40A 4XDWA 1EKMA 4IT7A 1RN7A 4WYKA 1RKYA 1EQKA 3DGMA 2D42A 1IT7A 4HAAA 4O02B 2HMOB 1Q824 1VQ63 2XSHB 3CCR3 1WMNA 2KF5A 4RNTA 3EB8A 1J2BA 4LSOA 1G0TA 1RGHA 5A0OB 3KZTA 4MMZB 1JZDA 1JKGB 1LNHA 1GMPA 2IYJA 3CC43 1O7GB 2CC3A 2XGLA 4HM6B 1C7HA 4FR9A 2O3OA 3S28A 1ZX2A 1Y4KA 2W9QA 2XFSA 2K3DA 1KSIA 5AIIA 1OPYA 1ROVA 3MPHA 1BUQA 3NXJA 3GWRA 4HOHA 3M8CA 1RRHA 5IERA 1JBSA 2M7OA 4EV5A 1FGQA 3TDGA 5M18A 2Z76A 2F99A 2FNQA 1B27A 1LRAA 4BIRA 1BNEA 5KP1A 1B21A 1ZO2A 2KF3A 3G16A 1S723 1N8R4 1RGLA 2W0QA 1OF5A 1YGWA 1BOXA 1O7NB 1I3FA 1ULJB 2E2UA 2KAAA 3BNEA 1JB5A 3LXUX 1TP6A 3SVAA 3EHCA 3V99A 3F9SA 5CF1A 1AV4A 2RFRA 4FCZA 5AIHA 5EVHA 1VQL3 1QVF2 4HM5B 2F98A 2MC8A 3RGAA 2BO9B 1VQ83 3CPOA 2D1WA 1YNVX 4GL6A 4FMCA 1D6UA 1FW7A 3CCL3 5M19A 4J9AA 1FUWA 1LOYA 2P0XA 5LC7A 1MGRA 6GSPA 2GEXA 2HMLB 2F4YA 2WOFA 4HM0B 4NHFA 1YHQ3 1R4YA 7RNTA 1K8A4 3RGRA 3VSYA 3NUVA 1B3SA 2C4BA 5G2GA 1JB4A 1GMQA 2Z6BA 3CCE3 2YFIB 1JJ22 1JB2A 3AMOB 3NQZA 4N6NB 8RNTA 1W6YA 5AIGA 2R41A 3E99A 1UI7A 2B1XB 5FW5A 3N9HA 2BHMA 3PGBA 3L0RA 5IG5A 1BRKA 2CHCA 1IVWA 1I0XA 5ELUA 1VQQA 4FMAA 2H0GA 3F7XA 4JF8A 2OQEA 1G02A 3FH1A 1YGEA 3FCSB 1BNFA 1NWWA 1SJWA 1OACA 2RSXA 1GY5A 1EEJA 1NU3A 3CCU3 4HYZA 4LZIA 2CH9A 4L7KA 4QWTA 1M1XB 3S5CA 4O8SA 5IF6A 1X1XA 1JNQA 1U8CB 1RRLA 1B20A 1X1WA 3D5IA 3PCRA 1I2GA 1D6YA 1V58A 1JBRA 4OUQA 4IIAA 4XB5A 5STDA 3A76A 3ZG5A 3KE7A 1O7MB 1CH0A 2HMJB 1LOWA 2CIUA 1Q40A 1OHSA 1X1UA 1FUTA 1VQM3 3ZG0A 3WA3A 1LVNA 3B4OA 3NHXA 1RLSA 3LT8A 3DGYA 3LYGA 1N9EA 3NV0B 2OQEC 1W01A 2LYXA 2AADA 5BVBA 3NBJA 1W6GA 1QALA 3RDEA 1CQSA 3AHSA 3OX9A 1DE3A 1KWIA 1RGEA 1GSPA 2YFLB
chains in the Genus database with same CATH topology
1A67A 3JUNA 2XFTA 3BNDA 1OGXA 3EBTA 5AYSC 3EN1B 1AVKA 1IT8A 3S27A 1W2ZA 3WOFB 2BMRB 4CCVA 1VQN3 3FKAA 3F7SA 2WGOA 3HZPA 1YIT3 2XEPA 2IMJA 3FSDA 1RJOA 3STDA 4AKYA 1Q7Y4 1A2VA 4N6UA 2ML5A 3SOYA 3DY5A 3CCV3 1E3VA 3KIIA 4XBTA 5IW9A 1CYUA 2Z77A 4K90B 1E3RA 2ML6A 5CK6A 1K9M4 3MWZA 1VQ73 1UI8A 2KXGA 2KRTA 3DMCA 4HBRA 4JRFA 3X3YA 2WOHA 3MSOA 1M9GA 2QEX3 3GRDA 3FLJA 5AYRB 4LGQA 4LMIA 5IEOA 1OUNA 3EQQB 1US1A 1M1K4 5AEUB 1SIIA 1N8QA 2JQ5A 3WODG 1IVVA 3PS8A 1PU4A 1UUWB 1JKGA 3K7CA 5I97A 3LMLA 3O8YA 3ER7A 4HKVB 3I0YA 4BTXA 1ULIB 2CFLA 1NJI4 3CME3 2FXTA 3G0KA 4MMYB 3K5TA 1YJW3 2HMNB 8CHOA 4R1KA 2KCDA 1K41A 2IUKA 3GZYB 4GB5A 3T0UA 1JV2B 1IU7A 3CCS3 4WHAA 3LTDA 4HM1B 1Q864 2W03A 3BB9A 3NBBA 3PZWA 3B8LA 2HMKB 2F86B 3DZLA 4FMBA 2O9UX 3CNMA 1W6CA 1K28A 2CFDA 2CWVA 4R80A 5JPPA 3JUMA 1IV7A 2K0MA 3F8XA 3Q2PA 3EN8A 1SPUA 5ELJA 1ISKA 3DGNA 1JN5B 3BNCA 4HM2B 4HZBB 3H3HA 3ALAA 4H61A 4EYCA 3BLZA 4O2HA 5JPUA 3KFQC 4HM3B 4X2HA 3HIGA 1LXEA 1ASKA 4K1UA 4R9KA 1VQO3 4N6OB 3PXMA 3WA2X 3T8NA 1FA3A 4WP5A 4IPBA 4STDA 4U13A 2P0MA 1Q42A 3F8HA 2QIYA 3X3ZA 3WOEB 4N6V0 3D9RA 2QGUA 3EX9A 3KSPA 3GAXA 4FCMA 1N5HA 1STDA 2OOVA 3S67A 4HZ9B 4FMDA 4EC6A 2LQVA 1DMQA 3ROBA 3AMOA 1QVG2 2XRXB 3UL6A 1IVUA 5KP3A 3G6E3 4I4KA 2CG1A 4G1MB 1WTHA 3S29A 1IV9A 3B4PA 3FF2A 1A2KA 1SQWA 4NREA 3CCM3 1W2B2 2W56B 3CPW2 3G8ZA 4XM4A 3EF8A 3K0ZA 2CKFB 3NX0A 1GYBA 1E97A 1WMPA 3WMDA 1VQ93 1DMMA 2CK3H 4RNZA 4HJLB 4EBGA 5D82A 1YJN3 1O7PB 3I563 2CG0A 1TFKA 4R9LA 4MJDA 3LTBA 3X42A 1WQLB 3FG3A 2XR8B 3SLUA 2WO0A 3LZAA 2CFGA 1DVCA 1STFI 3NV0A 3DXOA 1IK3A 2QA43 2P05A 3MG3A 2GBWB 2R4IA 2I9WA 4EV2A 1L5GB 2FGTA 1UW1A 3HX8A 3B7CA 4O3VA 3GZBA 1G96A 7STDA 1IVXA 3G713 5D83A 1HKXA 3KKGA 3VF1A 3BNBA 3I553 4HM8B 2C11A 1PFPA 3H51A 3CCQ3 4L8OA 1MOLA 3HK4A 2Y74A 2YX9A 5EQLA 3Q90A 1OHPA 1EA2A 2SBLA 4KFFA 5AEWB 1GS3A 1QAFA 1NDOB 3NM7A 3CMA3 1YVBI 3JUQA 4BTWA 5CLKA 1OHOA 3LOYA 3SEDA 5IEPA 1GD4A 4HM7B 4EXRA 3KN4A 3GZXB 3N8BA 3PCSA 1TIJA 4KFDA 3LH4A 2W6JH 2XH9A 5LC6A 1TFOA 1ROAA 2MF7A 2CWTA 4N3VA 1JRQA 2Q07A 1KC84 4WYKB 2K54A 4MEIA 4K1VA 2Y73A 4ORLA 3U97A 1QJGA 3N54B 3OWYA 4XDVA 3DM8A 1O7WB 1AR0A 3WDGB 5JBSA 1HU9A 4Q53A 1VQ43 2W04A 1U5OA 3HIIA 1IQYA 5BXQA 2OCTA 5AIFA 3OXAA 2ZL8A 1TUHA 4FCJA 3ECFA 3LTCA 2IUJA 4KFEA 3CXC2 5CXOA 2WGQA 5HGRA 1DYUA 1F8NA 3IMAB 3V98A 1GD3A 3EE1A 4L8PA 5DRVA 1W02A 1SIHA 1FGTA 5IG0A 2XSOB 3FG4A 3DGLA 3K9MC 1QMAA 4XBXA 2GU1A 1T5YA 2CFWA 4PEJA 3FZWA 3MYTA 1FGOA 3NM2A 4AKZA 1FGRA 4N6MA 3J7Yd 2YFJB 1WMOA 1EG9B 1JN5A 4H3UA 4ZM8A 1OF5B 4N6LA 3JUPA 2PZVA 5IG3A 2BMOB 1FGMA 3DUKA 3OWSA 1YI23 3MG2A 2E2TA 3CC23 3U1WA 3OW22 1VQK3 1R4CA 1N5PA 4KVHA 3SX1A 5KP4A 1DVDA 2GEYA 3IJEB 1NO3A 6STDA 3IPTA 4BTYA 2STDA 1V74A 4OK0A 3EC9A 2CW9A 1UUVB 2XGNA 3UB1A 1VQ53 2UX0A 3LT9A 4RZMA 4WWUC 5D81A 3UJMA 4RBNA 1IQXA 2JDIH 1MNLA 1GY7A 2BNGA 3JVCA 4CDLA 1N9JA 3X41A 1M904 3D3LA 2HMMB 1OCVA 2RGQA 1YJ93 3T8UA 2BMQB 2W56A 3FF0A 2OOVC 3CD63 2Z7AA 4X2OA 3EBYA 4MMXB 3V92A 4HM4B 1W5ZA 1IQ8A 3F14A 5TGNA 3DGOA 4OVMA 5IENA 1KQS2 2P38A 3LTAA 3CCJ3 2GBXB 2XF3A 3CU3A 1S5AA 3CNXA 2OWPA 3QRDA 1W4NA 3JUOA 2PNCA 2OTJ3 3K63A 5DREA 1VQP3 2CFKA 1OGZA 2B24B 2CWUA 3EJVA 1DMNA 1NB3I 1Q40B 3Q1CA 1W7CA 2A15A 4R4KA 1K734 3UL5A 1CEWI 3X40A 3X3XA 3MKIA 1LOXA 2BT3A 4K61A 2RCDA 5CF2A 3GZRA 3SOAA 1QAKA 2W9PA 3VGNA 1Z1SA 3HI7A 3NQYA 2C10A 1CYVA 2GXFA 1TU5A 2V1LA 5AI1A 1YIJ3 3MG1A 4XBYA 3CC73 2L4VA 1KD14 4HVNA 3SXXA 2P09A 3PYJA 4WFOA 5IG4A 4AEQA 4RNYA 4N6TA 1NB5I 3QK9A 3UNLA 2W2CA 4LEHA 3MHEA 4TX4A 3NBRA 2OTL3 2INXA 1A90A 1AVLA 3OV4A 4J8TA 5FGOA 5EEOA 3OWUA 1VZZA 1OH0A 2GU3A 3FG1A 2ZDJA 1GY6A 1W00A 3FGYA 3KSED 1WNHA 1IDPA 2IA7A 4KZ1A 1D6ZA 2E2VA 1Q814 1O7HB 3F40A 4XDWA 1EKMA 4IT7A 1RN7A 4WYKA 1RKYA 1EQKA 3DGMA 2D42A 1IT7A 4O02B 1VQ63 2HMOB 1Q824 2XSHB 3CCR3 1WMNA 1J2BA 3EB8A 4LSOA 5A0OB 3KZTA 4MMZB 1JKGB 1LNHA 3CC43 1O7GB 2CC3A 2XGLA 4HM6B 1C7HA 4FR9A 2O3OA 3S28A 1ZX2A 1Y4KA 2W9QA 2XFSA 1KSIA 5AIIA 1OPYA 1ROVA 3MPHA 1BUQA 3NXJA 3GWRA 3M8CA 1RRHA 5IERA 2M7OA 4EV5A 1FGQA 3TDGA 2Z76A 2F99A 2FNQA 5KP1A 1ZO2A 3G16A 1S723 1N8R4 2W0QA 1OF5A 1O7NB 1ULJB 2E2UA 3BNEA 3LXUX 3G4S3 1JB5A 1TP6A 3SVAA 3EHCA 3V99A 3F9SA 5CF1A 1AV4A 2RFRA 4FCZA 5AIHA 5EVHA 1VQL3 1QVF2 4HM5B 2F98A 2MC8A 3RGAA 2BO9B 1VQ83 3CPOA 2D1WA 4GL6A 4FMCA 1D6UA 3CCL3 4J9AA 1FUWA 2P0XA 5LC7A 2GEXA 2HMLB 2WOFA 4HM0B 4NHFA 1YHQ3 1K8A4 3RGRA 3VSYA 3NUVA 5G2GA 1JB4A 2Z6BA 3CCE3 2YFIB 1JJ22 1JB2A 3AMOB 3NQZA 4N6NB 1W6YA 5AIGA 3E99A 1UI7A 2B1XB 5FW5A 3N9HA 2BHMA 3PGBA 3L0RA 5IG5A 2CHCA 1IVWA 5ELUA 4FMAA 3F7XA 4JF8A 2OQEA 3FH1A 1YGEA 3FCSB 1NWWA 1SJWA 1OACA 2RSXA 1GY5A 3CCU3 1NU3A 4HYZA 4LZIA 2CH9A 4L7KA 4QWTA 1M1XB 3S5CA 4O8SA 5IF6A 1JNQA 1U8CB 1RRLA 3PCRA 1D6YA 4OUQA 4IIAA 4XB5A 5STDA 3A76A 3KE7A 1O7MB 2HMJB 2CIUA 1Q40A 1OHSA 1VQM3 3WA3A 1LVNA 3B4OA 3NHXA 3LT8A 3LYGA 1N9EA 3NV0B 2OQEC 1W01A 2LYXA 5BVBA 3NBJA 1W6GA 1QALA 3RDEA 1CQSA 3OX9A 1KWIA 2YFLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUN A;  1OGX A;  3EBT A;  3EN1 B;  2BMR B;  3FKA A;  3F7S A;  3HZP A;  2IMJ A;  3FSD A;  3STD A;  3SOY A;  1E3V A;  4XBT A;  2Z77 A;  1E3R A;  5CK6 A;  3DMC A;  3MSO A;  3GRD A;  3FLJ A;  4LGQ A;  4LMI A;  5IEO A;  1OUN A;  3EQQ B;  5AEU B;  2JQ5 A;  1UUW B;  1JKG A;  3K7C A;  3ER7 A;  4HKV B;  3I0Y A;  1ULI B;  3G0K A;  2HMN B;  8CHO A;  4R1K A;  1K41 A;  3GZY B;  4GB5 A;  4HM1 B;  3BB9 A;  3B8L A;  2HMK B;  2F86 B;  3DZL A;  3CNM A;  5JPP A;  3JUM A;  3F8X A;  3EN8 A;  1ISK A;  4HM2 B;  1JN5 B;  4HZB B;  3H3H A;  3BLZ A;  5JPU A;  4HM3 B;  4X2H A;  1ASK A;  4K1U A;  4R9K A;  3T8N A;  4WP5 A;  4STD A;  4U13 A;  1Q42 A;  3F8H A;  2QIY A;  3D9R A;  2QGU A;  3EX9 A;  3KSP A;  4FCM A;  1STD A;  4HZ9 B;  1DMQ A;  3ROB A;  2XRX B;  5KP3 A;  4I4K A;  3B4P A;  3FF2 A;  1A2K A;  3G8Z A;  4XM4 A;  3EF8 A;  3K0Z A;  2CKF B;  1GYB A;  1E97 A;  3WMD A;  1DMM A;  4HJL B;  5D82 A;  1O7P B;  4R9L A;  4MJD A;  1WQL B;  2XR8 B;  3LZA A;  3NV0 A;  3DXO A;  3MG3 A;  2GBW B;  2R4I A;  2I9W A;  3HX8 A;  3B7C A;  3GZB A;  7STD A;  5D83 A;  1HKX A;  3KKG A;  4HM8 B;  3H51 A;  4L8O A;  3HK4 A;  3Q90 A;  1OHP A;  1EA2 A;  5AEW B;  1GS3 A;  1NDO B;  3JUQ A;  5CLK A;  1OHO A;  3SED A;  5IEP A;  4HM7 B;  3GZX B;  4N3V A;  4WYK B;  2K54 A;  4K1V A;  4ORL A;  1QJG A;  3OWY A;  4XDV A;  3DM8 A;  1O7W B;  1AR0 A;  4Q53 A;  1U5O A;  5BXQ A;  5AIF A;  3OXA A;  1TUH A;  4FCJ A;  3ECF A;  5CXO A;  5HGR A;  4L8P A;  5DRV A;  1W02 A;  5IG0 A;  2XSO B;  4XBX A;  1QMA A;  4PEJ A;  3FZW A;  3NM2 A;  3MYT A;  2YFJ B;  1EG9 B;  1JN5 A;  4H3U A;  1OF5 B;  3JUP A;  2PZV A;  5IG3 A;  2BMO B;  3OWS A;  3DUK A;  3MG2 A;  4KVH A;  5KP4 A;  2GEY A;  6STD A;  3IPT A;  2STD A;  3EC9 A;  1UUV B;  2UX0 A;  4RZM A;  4WWU C;  5D81 A;  3UJM A;  1GY7 A;  2BNG A;  4CDL A;  2HMM B;  1OCV A;  2RGQ A;  3T8U A;  2BMQ B;  3FF0 A;  2Z7A A;  4X2O A;  3EBY A;  4HM4 B;  3F14 A;  5TGN A;  4OVM A;  5IEN A;  2GBX B;  3CU3 A;  1S5A A;  3CNX A;  2OWP A;  3JUO A;  5DRE A;  1OGZ A;  2B24 B;  3EJV A;  1DMN A;  1Q40 B;  2A15 A;  3MKI A;  2RCD A;  5CF2 A;  3GZR A;  3SOA A;  3VGN A;  1Z1S A;  2GXF A;  5AI1 A;  3MG1 A;  4XBY A;  4HVN A;  5IG4 A;  3UNL A;  2W2C A;  4LEH A;  3MHE A;  3NBR A;  2INX A;  3OV4 A;  4J8T A;  3OWU A;  1VZZ A;  1OH0 A;  1GY6 A;  1W00 A;  3FGY A;  1IDP A;  3F40 A;  4XDW A;  1O7H B;  4WYK A;  2HMO B;  2XSH B;  3KZT A;  1JKG B;  1O7G B;  4HM6 B;  1C7H A;  1ZX2 A;  5AII A;  1OPY A;  1BUQ A;  3NXJ A;  3GWR A;  3M8C A;  5IER A;  2Z76 A;  2F99 A;  5KP1 A;  1ZO2 A;  3G16 A;  1OF5 A;  1O7N B;  1ULJ B;  1JB5 A;  1TP6 A;  3EHC A;  3F9S A;  5CF1 A;  2RFR A;  5AIH A;  5EVH A;  4HM5 B;  2F98 A;  3RGA A;  3CPO A;  4J9A A;  2GEX A;  2HML B;  4HM0 B;  3RGR A;  3VSY A;  3NUV A;  5G2G A;  1JB4 A;  2YFI B;  1JB2 A;  1W6Y A;  5AIG A;  3E99 A;  2B1X B;  5FW5 A;  5IG5 A;  2CHC A;  3F7X A;  3FH1 A;  1NWW A;  1SJW A;  1GY5 A;  1NU3 A;  4L7K A;  3S5C A;  5IF6 A;  4OUQ A;  4IIA A;  4XB5 A;  5STD A;  3A76 A;  3KE7 A;  1O7M B;  2HMJ B;  1Q40 A;  1OHS A;  3NHX A;  3B4O A;  3LYG A;  3NV0 B;  1W01 A;  5BVB A;  1CQS A;  3OX9 A;  2YFL B; 
#chains in the Genus database with same CATH topology
 1A67 A;  3JUN A;  2XFT A;  3BND A;  1OGX A;  3EBT A;  5AYS C;  3EN1 B;  1AVK A;  1IT8 A;  3SYU A;  3S27 A;  1W2Z A;  3WOF B;  2BMR B;  1B2U A;  4CCV A;  1VQN 3;  2CX0 A;  1UGH I;  3FKA A;  3F7S A;  2WGO A;  3HZP A;  1YIT 3;  2XEP A;  1BUJ A;  1LOV A;  2IMJ A;  3FSD A;  1RJO A;  3BU4 A;  3Q3F A;  3STD A;  4AKY A;  1Q7Y 4;  1A2V A;  4N6U A;  2ML5 A;  4CPK A;  3SOY A;  3DY5 A;  4CJN A;  3CCV 3;  1E3V A;  3KII A;  4XBT A;  5IW9 A;  1BU4 A;  1CYU A;  3HOH A;  2F5W A;  1Q9E A;  2Z77 A;  4K90 B;  1E3R A;  2ML6 A;  5CK6 A;  1K9M 4;  3MWZ A;  1VQ7 3;  1UI8 A;  2KXG A;  2KRT A;  3DMC A;  4HBR A;  4JRF A;  3X3Y A;  2WOH A;  3MSO A;  1M9G A;  1RGK A;  2QEX 3;  1RGC A;  3GRD A;  3FLJ A;  1RCL A;  1I0V A;  5AYR B;  4LGQ A;  4LMI A;  5IEO A;  1OUN A;  1BRS A;  3EQQ B;  1US1 A;  1UCJ A;  1M1K 4;  1HZ1 A;  1SII A;  1N8Q A;  5AEU B;  2JQ5 A;  3WOD G;  1IVV A;  3PS8 A;  1PU4 A;  1UUW B;  2ZHX B;  1JKG A;  3K7C A;  5I97 A;  3LML A;  1BAN A;  1I70 A;  3O8Y A;  3ER7 A;  1ZS7 A;  3I0Y A;  4HKV B;  1ULI B;  4BTX A;  2CFL A;  1NJI 4;  4NPB A;  1UGI A;  3CME 3;  2FXT A;  2H0I A;  3G0K A;  1TJD A;  4MMY B;  1RGF A;  3K5T A;  2HMN B;  8CHO A;  1YJW 3;  1T3B A;  4R1K A;  2KCD A;  1K41 A;  1MWS A;  1RTU A;  2IUK A;  2BU4 A;  3GZY B;  4GB5 A;  3T0U A;  1JV2 B;  1IU7 A;  3CCS 3;  1Q7H A;  2F56 A;  4WHA A;  3LTD A;  2GSP A;  4HM1 B;  3WHO A;  2W03 A;  3BB9 A;  3NBB A;  1Q86 4;  3PZW A;  2H0H A;  2HMK B;  3B8L A;  2F86 B;  3DZL A;  4FMB A;  2O9U X;  3CNM A;  1W6C A;  1K28 A;  2CFD A;  2CWV A;  4R80 A;  5JPP A;  3URP A;  3JUM A;  1IV7 A;  2K0M A;  3F8X A;  3Q2P A;  3EN8 A;  1SPU A;  5ELJ A;  1ISK A;  1RN4 A;  2F5M A;  3DGN A;  1JN5 B;  3BNC A;  4HM2 B;  4HZB B;  3H3H A;  3ALA A;  4H61 A;  4EYC A;  3BLZ A;  4O2H A;  5JPU A;  3BIR A;  3KFQ C;  1RSN A;  4HM3 B;  4X2H A;  3HIG A;  1LXE A;  1BRH A;  1ASK A;  4K1U A;  4R9K A;  1VQO 3;  4N6O B;  1BSB A;  3PXM A;  3WA2 X;  3T8N A;  1FA3 A;  4WP5 A;  1LQM B;  4EW5 A;  2UGI A;  4IPB A;  4STD A;  1BGS A;  4U13 A;  1MWU A;  2P0M A;  1Q42 A;  2UUG C;  3F8H A;  1GOU A;  2QIY A;  3X3Z A;  3WOE B;  4N6V 0;  3D9R A;  4J5K A;  2QGU A;  3EX9 A;  3KSP A;  3GAX A;  4FCM A;  1N5H A;  1STD A;  2OOV A;  3S67 A;  4HZ9 B;  3ZFZ A;  4FMD A;  3G4S 3;  4EC6 A;  2LQV A;  1DMQ A;  3ROB A;  9RNT A;  3AMO A;  1UCK A;  1QVG 2;  2XRX B;  3UL6 A;  1IVU A;  5KP3 A;  3G6E 3;  2SAR A;  4I4K A;  2CG1 A;  6RNT A;  4G1M B;  1WTH A;  3S29 A;  1IV9 A;  3B4P A;  3FF2 A;  1A2K A;  1SQW A;  4NRE A;  3CCM 3;  1W2B 2;  2W56 B;  3CPW 2;  3G8Z A;  4XM4 A;  3EF8 A;  3K0Z A;  2CKF B;  3NX0 A;  4LYL B;  1GYB A;  1E97 A;  3D5G A;  1WMP A;  3WMD A;  1VQ9 3;  1BRN L;  1BRJ A;  1DMM A;  2CK3 H;  4RNZ A;  4HJL B;  4EBG A;  5D82 A;  1YJN 3;  1O7P B;  3I56 3;  2CG0 A;  1TFK A;  4R9L A;  4MJD A;  3LTB A;  3X42 A;  1WQL B;  3FG3 A;  2XR8 B;  3SLU A;  2WO0 A;  3LZA A;  1EUI C;  1DVC A;  2CFG A;  1STF I;  3NV0 A;  3AHW A;  1BAO A;  3DXO A;  1IK3 A;  2QA4 3;  2P05 A;  3MG3 A;  1RCK A;  1PY3 A;  2GBW B;  2R4I A;  2I9W A;  4EV2 A;  1L5G B;  1BNI A;  5G1L A;  2FGT A;  3AGN A;  1UW1 A;  3HX8 A;  5HOH A;  3B7C A;  4O3V A;  3GZB A;  1G96 A;  7STD A;  1I3I A;  1IVX A;  3G71 3;  5D83 A;  1HKX A;  3KKG A;  3VF1 A;  3BNB A;  3I55 3;  1BNG A;  1BNR A;  1BRI A;  1RNT A;  1SAR A;  4HM8 B;  2C11 A;  1PFP A;  3H51 A;  3CCQ 3;  4GHO A;  3GSP A;  4L8O A;  1MOL A;  3HK4 A;  2Y74 A;  2YX9 A;  3D4A A;  5EQL A;  1B2M A;  3Q90 A;  1OHP A;  1EA2 A;  2SBL A;  4KFF A;  5AEW B;  1GS3 A;  1QAF A;  2CX1 A;  1NDO B;  1JBT A;  1BSC A;  3NM7 A;  1RHL A;  3CMA 3;  1YVB I;  1MWR A;  3JUQ A;  4BTW A;  5CLK A;  1OHO A;  3LOY A;  3SED A;  1T2H A;  1C54 A;  5IEP A;  1GD4 A;  4HM7 B;  4EXR A;  1BSD A;  3GZX B;  3KN4 A;  3N8B A;  3PCS A;  5M1A A;  1TIJ A;  4KFD A;  5BU4 A;  3LH4 A;  1TRP A;  2W6J H;  2XH9 A;  1RGG A;  1BSA A;  5LC6 A;  4ILF A;  1TFO A;  1ROA A;  4BU4 A;  2MF7 A;  2CWT A;  4N3V A;  1JRQ A;  1BNS A;  2Q07 A;  1KC8 4;  4WYK B;  2K54 A;  4MEI A;  4K1V A;  2Y73 A;  4ORL A;  1RDS A;  3U97 A;  1QJG A;  5RNT A;  3N54 B;  3OWY A;  4XDV A;  3DM8 A;  1B2X A;  1O7W B;  3WR2 A;  1AR0 A;  3WDG B;  5JBS A;  1HU9 A;  4Q53 A;  1VQ4 3;  2W04 A;  1MGW A;  1U5O A;  3HII A;  1RGA A;  1MWT A;  1IQY A;  5BXQ A;  2OCT A;  5AIF A;  1BSE A;  1B2Z A;  3OXA A;  2ZL8 A;  1TUH A;  1AQZ A;  1PYL A;  3ECF A;  3LTC A;  4FCJ A;  4KFE A;  2IUJ A;  3CXC 2;  1ZGX A;  3AGO A;  2WGQ A;  5CXO A;  1NNV A;  5HGR A;  1DYU A;  1F8N A;  2RBI A;  3IMA B;  1BIR A;  3V98 A;  1GD3 A;  3EE1 A;  4L8P A;  5DRV A;  1W02 A;  1SIH A;  1FGT A;  2KF4 A;  2ZA4 A;  2XSO B;  4J5G A;  5IG0 A;  1BNJ A;  3FG4 A;  3DGL A;  3K9M C;  1QMA A;  4XBX A;  2GU1 A;  1T5Y A;  2CFW A;  4PEJ A;  1YVS A;  3FZW A;  3MYT A;  1FGO A;  3NM2 A;  4AKZ A;  1FGR A;  4N6M A;  3J7Y d;  2YFJ B;  1WMO A;  1EG9 B;  1JN5 A;  4H3U A;  4ZM8 A;  1OF5 B;  4N6L A;  1BRG A;  3JUP A;  1GOV A;  2PZV A;  2AAE A;  2BMO B;  1FZU A;  5IG3 A;  1FGM A;  3DUK A;  3OWS A;  4I5Q A;  5GSP A;  1YI2 3;  3MG2 A;  2E2T A;  1AY7 A;  1I2F A;  3CC2 3;  2BIR A;  1TTO A;  3U1W A;  1R4C A;  1N5P A;  2HOH A;  4KVH A;  3SX1 A;  5KP4 A;  2GEY A;  3IJE B;  1VQK 3;  1NO3 A;  6STD A;  3IPT A;  4BTY A;  2STD A;  1V74 A;  4GSP A;  3EC9 A;  2CW9 A;  1UUV B;  2XGN A;  4OK0 A;  3UB1 A;  1VQ5 3;  2UX0 A;  3LT9 A;  1LNI A;  1UUG B;  7GSP A;  1I2E A;  4RZM A;  1UCI A;  1FYS A;  4WWU C;  5D81 A;  3UJM A;  3A5E A;  4RBN A;  1IQX A;  1UDI I;  1X1Y A;  2JDI H;  1MNL A;  1GY7 A;  2BNG A;  2L1S A;  3JVC A;  4CDL A;  1N9J A;  3X41 A;  1M90 4;  3D3L A;  2HMM B;  1GMR A;  1HYF A;  1OCV A;  2RGQ A;  1JZO A;  1YJ9 3;  3T8U A;  1LQG C;  2BMQ B;  2W56 A;  3FF0 A;  1UCL A;  2OOV C;  3CD6 3;  5BIR A;  2Z7A A;  1IYY A;  4X2O A;  3EBY A;  1DVD A;  4MMX B;  3V92 A;  4HM4 B;  1W5Z A;  1IQ8 A;  3F14 A;  5TGN A;  3DGO A;  4OVM A;  5IEN A;  1KQS 2;  2P38 A;  3LTA A;  3CCJ 3;  1A2P A;  2IY2 A;  2GBX B;  2XF3 A;  4KT3 B;  3CU3 A;  1S5A A;  3KCH A;  3CNX A;  2OWP A;  3QRD A;  1W4N A;  3JUO A;  2PNC A;  2OTJ 3;  3K63 A;  5DRE A;  4DKI A;  1TRQ A;  2CFK A;  1OGZ A;  1VQP 3;  1FUS A;  2B24 B;  2CWU A;  3EJV A;  1DMN A;  1NB3 I;  1Q40 B;  3Q1C A;  1W7C A;  2KF6 A;  2A15 A;  1DET A;  4R4K A;  1K73 4;  3UL5 A;  4BL3 A;  1CEW I;  3X40 A;  3X3X A;  3MKI A;  1LOX A;  2BT3 A;  4K61 A;  2RCD A;  3RNT A;  5CF2 A;  3GZR A;  3SOA A;  1QAK A;  2W9P A;  3VGN A;  1Z1S A;  3HI7 A;  1B2S A;  3NQY A;  2C10 A;  1CYV A;  2GXF A;  2J8X B;  1TU5 A;  1I8V A;  2RNT A;  2V1L A;  5AI1 A;  1YIJ 3;  1GOY A;  3MG1 A;  1RMS A;  4XBY A;  5G1K A;  1V57 A;  1RN1 A;  2L4V A;  4BL2 A;  3CC7 3;  1KD1 4;  4HVN A;  3DH2 A;  3SXX A;  3D79 A;  2P09 A;  3PYJ A;  4WFO A;  5IG4 A;  4AEQ A;  4RNY A;  4N6T A;  1NB5 I;  3QK9 A;  3UNL A;  2W2C A;  4LEH A;  3MHE A;  4TX4 A;  3NBR A;  2OTL 3;  3OW2 2;  1RNB A;  2INX A;  1A90 A;  1AVL A;  3OV4 A;  4J8T A;  5FGO A;  5EEO A;  1BVI A;  3OWU A;  1T2I A;  1VZZ A;  1OH0 A;  2GU3 A;  3FG1 A;  1GY6 A;  2ZDJ A;  1W00 A;  3FGY A;  3KSE D;  1WNH A;  1IDP A;  2IA7 A;  4KZ1 A;  1D6Z A;  2E2V A;  1Q81 4;  1O7H B;  3F40 A;  4XDW A;  1EKM A;  4IT7 A;  1RN7 A;  4WYK A;  1RKY A;  1EQK A;  3DGM A;  2D42 A;  1IT7 A;  4HAA A;  4O02 B;  2HMO B;  1Q82 4;  1VQ6 3;  2XSH B;  3CCR 3;  1WMN A;  2KF5 A;  4RNT A;  3EB8 A;  1J2B A;  4LSO A;  1G0T A;  1RGH A;  5A0O B;  3KZT A;  4MMZ B;  1JZD A;  1JKG B;  1LNH A;  1GMP A;  2IYJ A;  3CC4 3;  1O7G B;  2CC3 A;  2XGL A;  4HM6 B;  1C7H A;  4FR9 A;  2O3O A;  3S28 A;  1ZX2 A;  1Y4K A;  2W9Q A;  2XFS A;  2K3D A;  1KSI A;  5AII A;  1OPY A;  1ROV A;  3MPH A;  1BUQ A;  3NXJ A;  3GWR A;  4HOH A;  3M8C A;  1RRH A;  5IER A;  1JBS A;  2M7O A;  4EV5 A;  1FGQ A;  3TDG A;  5M18 A;  2Z76 A;  2F99 A;  2FNQ A;  1B27 A;  1LRA A;  4BIR A;  1BNE A;  5KP1 A;  1B21 A;  1ZO2 A;  2KF3 A;  3G16 A;  1S72 3;  1N8R 4;  1RGL A;  2W0Q A;  1OF5 A;  1YGW A;  1BOX A;  1O7N B;  1I3F A;  1ULJ B;  2E2U A;  2KAA A;  3BNE A;  1JB5 A;  3LXU X;  1TP6 A;  3SVA A;  3EHC A;  3V99 A;  3F9S A;  5CF1 A;  1AV4 A;  2RFR A;  4FCZ A;  5AIH A;  5EVH A;  1VQL 3;  1QVF 2;  4HM5 B;  2F98 A;  2MC8 A;  3RGA A;  2BO9 B;  1VQ8 3;  3CPO A;  2D1W A;  1YNV X;  4GL6 A;  4FMC A;  1D6U A;  1FW7 A;  3CCL 3;  5M19 A;  4J9A A;  1FUW A;  1LOY A;  2P0X A;  5LC7 A;  1MGR A;  6GSP A;  2GEX A;  2HML B;  2F4Y A;  2WOF A;  4HM0 B;  4NHF A;  1YHQ 3;  1R4Y A;  7RNT A;  1K8A 4;  3RGR A;  3VSY A;  3NUV A;  1B3S A;  2C4B A;  5G2G A;  1JB4 A;  1GMQ A;  2Z6B A;  3CCE 3;  2YFI B;  1JJ2 2;  1JB2 A;  3AMO B;  3NQZ A;  4N6N B;  8RNT A;  1W6Y A;  5AIG A;  2R41 A;  3E99 A;  1UI7 A;  2B1X B;  5FW5 A;  3N9H A;  2BHM A;  3PGB A;  3L0R A;  5IG5 A;  1BRK A;  2CHC A;  1IVW A;  1I0X A;  5ELU A;  1VQQ A;  4FMA A;  2H0G A;  3F7X A;  4JF8 A;  2OQE A;  1G02 A;  3FH1 A;  1YGE A;  3FCS B;  1BNF A;  1NWW A;  1SJW A;  1OAC A;  2RSX A;  1GY5 A;  1EEJ A;  1NU3 A;  3CCU 3;  4HYZ A;  4LZI A;  2CH9 A;  4L7K A;  4QWT A;  1M1X B;  3S5C A;  4O8S A;  5IF6 A;  1X1X A;  1JNQ A;  1U8C B;  1RRL A;  1B20 A;  1X1W A;  3D5I A;  3PCR A;  1I2G A;  1D6Y A;  1V58 A;  1JBR A;  4OUQ A;  4IIA A;  4XB5 A;  5STD A;  3A76 A;  3ZG5 A;  3KE7 A;  1O7M B;  1CH0 A;  2HMJ B;  1LOW A;  2CIU A;  1Q40 A;  1OHS A;  1X1U A;  1FUT A;  1VQM 3;  3ZG0 A;  3WA3 A;  1LVN A;  3B4O A;  3NHX A;  1RLS A;  3LT8 A;  3DGY A;  3LYG A;  1N9E A;  3NV0 B;  2OQE C;  1W01 A;  2LYX A;  2AAD A;  5BVB A;  3NBJ A;  1W6G A;  1QAL A;  3RDE A;  1CQS A;  3AHS A;  3OX9 A;  1DE3 A;  1KWI A;  1RGE A;  1GSP A;  2YFL B; 
#chains in the Genus database with same CATH homology
 1A67 A;  3JUN A;  2XFT A;  3BND A;  1OGX A;  3EBT A;  5AYS C;  3EN1 B;  1AVK A;  1IT8 A;  3S27 A;  1W2Z A;  3WOF B;  2BMR B;  4CCV A;  1VQN 3;  3FKA A;  3F7S A;  2WGO A;  3HZP A;  1YIT 3;  2XEP A;  2IMJ A;  3FSD A;  1RJO A;  3STD A;  4AKY A;  1Q7Y 4;  1A2V A;  4N6U A;  2ML5 A;  3SOY A;  3DY5 A;  3CCV 3;  1E3V A;  3KII A;  4XBT A;  5IW9 A;  1CYU A;  2Z77 A;  4K90 B;  1E3R A;  2ML6 A;  5CK6 A;  1K9M 4;  3MWZ A;  1VQ7 3;  1UI8 A;  2KXG A;  2KRT A;  3DMC A;  4HBR A;  4JRF A;  3X3Y A;  2WOH A;  3MSO A;  1M9G A;  2QEX 3;  3GRD A;  3FLJ A;  5AYR B;  4LGQ A;  4LMI A;  5IEO A;  1OUN A;  3EQQ B;  1US1 A;  1M1K 4;  5AEU B;  1SII A;  1N8Q A;  2JQ5 A;  3WOD G;  1IVV A;  3PS8 A;  1PU4 A;  1UUW B;  1JKG A;  3K7C A;  5I97 A;  3LML A;  3O8Y A;  3ER7 A;  4HKV B;  3I0Y A;  4BTX A;  1ULI B;  2CFL A;  1NJI 4;  3CME 3;  2FXT A;  3G0K A;  4MMY B;  3K5T A;  1YJW 3;  2HMN B;  8CHO A;  4R1K A;  2KCD A;  1K41 A;  2IUK A;  3GZY B;  4GB5 A;  3T0U A;  1JV2 B;  1IU7 A;  3CCS 3;  4WHA A;  3LTD A;  4HM1 B;  1Q86 4;  2W03 A;  3BB9 A;  3NBB A;  3PZW A;  3B8L A;  2HMK B;  2F86 B;  3DZL A;  4FMB A;  2O9U X;  3CNM A;  1W6C A;  1K28 A;  2CFD A;  2CWV A;  4R80 A;  5JPP A;  3JUM A;  1IV7 A;  2K0M A;  3F8X A;  3Q2P A;  3EN8 A;  1SPU A;  5ELJ A;  1ISK A;  3DGN A;  1JN5 B;  3BNC A;  4HM2 B;  4HZB B;  3H3H A;  3ALA A;  4H61 A;  4EYC A;  3BLZ A;  4O2H A;  5JPU A;  3KFQ C;  4HM3 B;  4X2H A;  3HIG A;  1LXE A;  1ASK A;  4K1U A;  4R9K A;  1VQO 3;  4N6O B;  3PXM A;  3WA2 X;  3T8N A;  1FA3 A;  4WP5 A;  4IPB A;  4STD A;  4U13 A;  2P0M A;  1Q42 A;  3F8H A;  2QIY A;  3X3Z A;  3WOE B;  4N6V 0;  3D9R A;  2QGU A;  3EX9 A;  3KSP A;  3GAX A;  4FCM A;  1N5H A;  1STD A;  2OOV A;  3S67 A;  4HZ9 B;  4FMD A;  4EC6 A;  2LQV A;  1DMQ A;  3ROB A;  3AMO A;  1QVG 2;  2XRX B;  3UL6 A;  1IVU A;  5KP3 A;  3G6E 3;  4I4K A;  2CG1 A;  4G1M B;  1WTH A;  3S29 A;  1IV9 A;  3B4P A;  3FF2 A;  1A2K A;  1SQW A;  4NRE A;  3CCM 3;  1W2B 2;  2W56 B;  3CPW 2;  3G8Z A;  4XM4 A;  3EF8 A;  3K0Z A;  2CKF B;  3NX0 A;  1GYB A;  1E97 A;  1WMP A;  3WMD A;  1VQ9 3;  1DMM A;  2CK3 H;  4RNZ A;  4HJL B;  4EBG A;  5D82 A;  1YJN 3;  1O7P B;  3I56 3;  2CG0 A;  1TFK A;  4R9L A;  4MJD A;  3LTB A;  3X42 A;  1WQL B;  3FG3 A;  2XR8 B;  3SLU A;  2WO0 A;  3LZA A;  2CFG A;  1DVC A;  1STF I;  3NV0 A;  3DXO A;  1IK3 A;  2QA4 3;  2P05 A;  3MG3 A;  2GBW B;  2R4I A;  2I9W A;  4EV2 A;  1L5G B;  2FGT A;  1UW1 A;  3HX8 A;  3B7C A;  4O3V A;  3GZB A;  1G96 A;  7STD A;  1IVX A;  3G71 3;  5D83 A;  1HKX A;  3KKG A;  3VF1 A;  3BNB A;  3I55 3;  4HM8 B;  2C11 A;  1PFP A;  3H51 A;  3CCQ 3;  4L8O A;  1MOL A;  3HK4 A;  2Y74 A;  2YX9 A;  5EQL A;  3Q90 A;  1OHP A;  1EA2 A;  2SBL A;  4KFF A;  5AEW B;  1GS3 A;  1QAF A;  1NDO B;  3NM7 A;  3CMA 3;  1YVB I;  3JUQ A;  4BTW A;  5CLK A;  1OHO A;  3LOY A;  3SED A;  5IEP A;  1GD4 A;  4HM7 B;  4EXR A;  3KN4 A;  3GZX B;  3N8B A;  3PCS A;  1TIJ A;  4KFD A;  3LH4 A;  2W6J H;  2XH9 A;  5LC6 A;  1TFO A;  1ROA A;  2MF7 A;  2CWT A;  4N3V A;  1JRQ A;  2Q07 A;  1KC8 4;  4WYK B;  2K54 A;  4MEI A;  4K1V A;  2Y73 A;  4ORL A;  3U97 A;  1QJG A;  3N54 B;  3OWY A;  4XDV A;  3DM8 A;  1O7W B;  1AR0 A;  3WDG B;  5JBS A;  1HU9 A;  4Q53 A;  1VQ4 3;  2W04 A;  1U5O A;  3HII A;  1IQY A;  5BXQ A;  2OCT A;  5AIF A;  3OXA A;  2ZL8 A;  1TUH A;  4FCJ A;  3ECF A;  3LTC A;  2IUJ A;  4KFE A;  3CXC 2;  5CXO A;  2WGQ A;  5HGR A;  1DYU A;  1F8N A;  3IMA B;  3V98 A;  1GD3 A;  3EE1 A;  4L8P A;  5DRV A;  1W02 A;  1SIH A;  1FGT A;  5IG0 A;  2XSO B;  3FG4 A;  3DGL A;  3K9M C;  1QMA A;  4XBX A;  2GU1 A;  1T5Y A;  2CFW A;  4PEJ A;  3FZW A;  3MYT A;  1FGO A;  3NM2 A;  4AKZ A;  1FGR A;  4N6M A;  3J7Y d;  2YFJ B;  1WMO A;  1EG9 B;  1JN5 A;  4H3U A;  4ZM8 A;  1OF5 B;  4N6L A;  3JUP A;  2PZV A;  5IG3 A;  2BMO B;  1FGM A;  3DUK A;  3OWS A;  1YI2 3;  3MG2 A;  2E2T A;  3CC2 3;  3U1W A;  3OW2 2;  1VQK 3;  1R4C A;  1N5P A;  4KVH A;  3SX1 A;  5KP4 A;  1DVD A;  2GEY A;  3IJE B;  1NO3 A;  6STD A;  3IPT A;  4BTY A;  2STD A;  1V74 A;  4OK0 A;  3EC9 A;  2CW9 A;  1UUV B;  2XGN A;  3UB1 A;  1VQ5 3;  2UX0 A;  3LT9 A;  4RZM A;  4WWU C;  5D81 A;  3UJM A;  4RBN A;  1IQX A;  2JDI H;  1MNL A;  1GY7 A;  2BNG A;  3JVC A;  4CDL A;  1N9J A;  3X41 A;  1M90 4;  3D3L A;  2HMM B;  1OCV A;  2RGQ A;  1YJ9 3;  3T8U A;  2BMQ B;  2W56 A;  3FF0 A;  2OOV C;  3CD6 3;  2Z7A A;  4X2O A;  3EBY A;  4MMX B;  3V92 A;  4HM4 B;  1W5Z A;  1IQ8 A;  3F14 A;  5TGN A;  3DGO A;  4OVM A;  5IEN A;  1KQS 2;  2P38 A;  3LTA A;  3CCJ 3;  2GBX B;  2XF3 A;  3CU3 A;  1S5A A;  3CNX A;  2OWP A;  3QRD A;  1W4N A;  3JUO A;  2PNC A;  2OTJ 3;  3K63 A;  5DRE A;  1VQP 3;  2CFK A;  1OGZ A;  2B24 B;  2CWU A;  3EJV A;  1DMN A;  1NB3 I;  1Q40 B;  3Q1C A;  1W7C A;  2A15 A;  4R4K A;  1K73 4;  3UL5 A;  1CEW I;  3X40 A;  3X3X A;  3MKI A;  1LOX A;  2BT3 A;  4K61 A;  2RCD A;  5CF2 A;  3GZR A;  3SOA A;  1QAK A;  2W9P A;  3VGN A;  1Z1S A;  3HI7 A;  3NQY A;  2C10 A;  1CYV A;  2GXF A;  1TU5 A;  2V1L A;  5AI1 A;  1YIJ 3;  3MG1 A;  4XBY A;  3CC7 3;  2L4V A;  1KD1 4;  4HVN A;  3SXX A;  2P09 A;  3PYJ A;  4WFO A;  5IG4 A;  4AEQ A;  4RNY A;  4N6T A;  1NB5 I;  3QK9 A;  3UNL A;  2W2C A;  4LEH A;  3MHE A;  4TX4 A;  3NBR A;  2OTL 3;  2INX A;  1A90 A;  1AVL A;  3OV4 A;  4J8T A;  5FGO A;  5EEO A;  3OWU A;  1VZZ A;  1OH0 A;  2GU3 A;  3FG1 A;  2ZDJ A;  1GY6 A;  1W00 A;  3FGY A;  3KSE D;  1WNH A;  1IDP A;  2IA7 A;  4KZ1 A;  1D6Z A;  2E2V A;  1Q81 4;  1O7H B;  3F40 A;  4XDW A;  1EKM A;  4IT7 A;  1RN7 A;  4WYK A;  1RKY A;  1EQK A;  3DGM A;  2D42 A;  1IT7 A;  4O02 B;  1VQ6 3;  2HMO B;  1Q82 4;  2XSH B;  3CCR 3;  1WMN A;  1J2B A;  3EB8 A;  4LSO A;  5A0O B;  3KZT A;  4MMZ B;  1JKG B;  1LNH A;  3CC4 3;  1O7G B;  2CC3 A;  2XGL A;  4HM6 B;  1C7H A;  4FR9 A;  2O3O A;  3S28 A;  1ZX2 A;  1Y4K A;  2W9Q A;  2XFS A;  1KSI A;  5AII A;  1OPY A;  1ROV A;  3MPH A;  1BUQ A;  3NXJ A;  3GWR A;  3M8C A;  1RRH A;  5IER A;  2M7O A;  4EV5 A;  1FGQ A;  3TDG A;  2Z76 A;  2F99 A;  2FNQ A;  5KP1 A;  1ZO2 A;  3G16 A;  1S72 3;  1N8R 4;  2W0Q A;  1OF5 A;  1O7N B;  1ULJ B;  2E2U A;  3BNE A;  3LXU X;  3G4S 3;  1JB5 A;  1TP6 A;  3SVA A;  3EHC A;  3V99 A;  3F9S A;  5CF1 A;  1AV4 A;  2RFR A;  4FCZ A;  5AIH A;  5EVH A;  1VQL 3;  1QVF 2;  4HM5 B;  2F98 A;  2MC8 A;  3RGA A;  2BO9 B;  1VQ8 3;  3CPO A;  2D1W A;  4GL6 A;  4FMC A;  1D6U A;  3CCL 3;  4J9A A;  1FUW A;  2P0X A;  5LC7 A;  2GEX A;  2HML B;  2WOF A;  4HM0 B;  4NHF A;  1YHQ 3;  1K8A 4;  3RGR A;  3VSY A;  3NUV A;  5G2G A;  1JB4 A;  2Z6B A;  3CCE 3;  2YFI B;  1JJ2 2;  1JB2 A;  3AMO B;  3NQZ A;  4N6N B;  1W6Y A;  5AIG A;  3E99 A;  1UI7 A;  2B1X B;  5FW5 A;  3N9H A;  2BHM A;  3PGB A;  3L0R A;  5IG5 A;  2CHC A;  1IVW A;  5ELU A;  4FMA A;  3F7X A;  4JF8 A;  2OQE A;  3FH1 A;  1YGE A;  3FCS B;  1NWW A;  1SJW A;  1OAC A;  2RSX A;  1GY5 A;  3CCU 3;  1NU3 A;  4HYZ A;  4LZI A;  2CH9 A;  4L7K A;  4QWT A;  1M1X B;  3S5C A;  4O8S A;  5IF6 A;  1JNQ A;  1U8C B;  1RRL A;  3PCR A;  1D6Y A;  4OUQ A;  4IIA A;  4XB5 A;  5STD A;  3A76 A;  3KE7 A;  1O7M B;  2HMJ B;  2CIU A;  1Q40 A;  1OHS A;  1VQM 3;  3WA3 A;  1LVN A;  3B4O A;  3NHX A;  3LT8 A;  3LYG A;  1N9E A;  3NV0 B;  2OQE C;  1W01 A;  2LYX A;  5BVB A;  3NBJ A;  1W6G A;  1QAL A;  3RDE A;  1CQS A;  3OX9 A;  1KWI A;  2YFL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...