4R9LA

Structure of a thermostable elevenfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis, containing two stabilizing disulfide bonds
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
147
structure length
147
Chain Sequence
KCEQPRWASKDPAAGKASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFKVMSIDAVCVFHICSCKGLVFTERVDVLRALPTGKSYNLSILGVFQLTDGKITGWRDYFDLREFEEAVDLPLRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title X-ray crystallographic validation of structure predictions used in computational design for protein stabilization.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 44
structure length 147
sequence length 147
chains with identical sequence B, C
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4r9lA00
3MKIA 3T8UA 3Q90A 4WP5A 3SOYA 3T8NA 3GZRA 1JKGB 6STDA 1OF5A 3BLZA 1W6YA 5AIGA 1A2KA 3UNLA 3VGNA 4MJDA 1DMMA 2Z76A 3RGAA 8CHOA 5G2GA 5CK6A 3UJMA 2HMMB 3MYTA 2XSHB 1UUVB 3FKAA 2YFLB 3FLJA 3GZYB 4L7KA 5BVBA 4HM5B 2W2CA 5IG5A 3GZXB 1TP6A 3HX8A 1E3VA 4GB5A 5IENA 3CNMA 3CNXA 5D81A 3K7CA 3G16A 5EVHA 3DM8A 1VZZA 1OHOA 4HM2B 3EJVA 3HK4A 3STDA 3GRDA 1OUNA 3F8HA 4LGQA 1OHSA 4R1KA 2B1XB 2K54A 2HMLB 2CKFB 2GXFA 3OWUA 1JN5B 5KP1A 7STDA 3WMDA 5CLKA 3JUMA 2HMJB 4ORLA 2STDA 2GBWB 1ULJB 4XBYA 2INXA 3F8XA 1CQSA 3OXAA 3EX9A 5BXQA 5AEWB 1TUHA 2BMRB 3D9RA 3EQQB 5TGNA 1U5OA 3H3HA 3BB9A 3JUQA 4LMIA 3LYGA 1QJGA 1O7HB 4XDWA 2HMKB 2QGUA 5D82A 3HZPA 3EHCA 3MG2A 3GWRA 1W02A 5KP3A 3FF2A 3I0YA 5IG0A 3NXJA 1OF5B 1DMNA 3OV4A 1OHPA 3M8CA 3ROBA 1ZO2A 3F7SA 3JUPA 5JPUA 5HGRA 4XBTA 4OVMA 4K1VA 5DRVA 2RFRA 4H3UA 3EC9A 3NUVA 3F14A 4HM6B 4HM4B 3EN8A 1HKXA 1O7MB 3S5CA 3SOAA 5AEUB 3GZBA 1NDOB 1Q40B 5AIHA 3FF0A 4FCJA 1ASKA 5IF6A 2B24B 1C7HA 3OWSA 2IMJA 2HMNB 3KZTA 3FZWA 5JPPA 4PEJA 3JUOA 5AIIA 3NV0A 2RCDA 3OX9A 2A15A 2Z7AA 1S5AA 3MG3A 3IPTA 1GS3A 4WYKA 4HM8B 3EN1B 3LZAA 1NU3A 2PZVA 1NWWA 3B4OA 3NHXA 5DREA 1GY7A 5IG3A 1W00A 4L8OA 4OUQA 3G8ZA 1JN5A 5FW5A 2CHCA 1QMAA 2YFJB 1ULIB 1O7WB 2BMQB 3A76A 4L8PA 3NM2A 2XSOB 3JUNA 4X2OA 4XBXA 3RGRA 1EA2A 3ER7A 1E3RA 4LEHA 1O7NB 1W01A 4Q53A 1AR0A 3FGYA 2YFIB 3KKGA 2I9WA 3F9SA 2GBXB 1JB2A 4K1UA 3B7CA 2F86B 3KE7A 1JKGA 3EF8A 4U13A 3DUKA 5IERA 4XDVA 4HZBB 5D83A 4HVNA 2JQ5A 3MSOA 2BMOB 3MG1A 3DZLA 3F40A 4HZ9B 3OWYA 5STDA 4HM7B 5IEOA 1IDPA 4J9AA 4XB5A 3MHEA 3K0ZA 3NBRA 3SEDA 1SJWA 1BUQA 3EBYA 4WWUC 2RGQA 4R9LA 5AI1A 1GY5A 1GYBA 1O7PB 1Q40A 4J8TA 4XM4A 5AIFA 1ZX2A 3F7XA 2GEYA 1OH0A 2BNGA 3CU3A 3DMCA 4RZMA 1JB4A 1Q42A 1STDA 1DMQA 4HM3B 3E99A 1GY6A 5IEPA 4R9KA 1JB5A 3H51A 3B8LA 1OGXA 3EBTA 1ISKA 3NV0B 5CXOA 4CDLA 4HKVB 3G0KA 4WYKB 3CPOA 3ECFA 1WQLB 5CF1A 4X2HA 1EG9B 2HMOB 1OPYA 1UUWB 4IIAA 1OGZA 3FSDA 3FH1A 4HM0B 1OCVA 2QIYA 1O7GB 1E97A 2F98A 4N3VA 4STDA 4HM1B 3VSYA 2OWPA 2F99A 4FCMA 2GEXA 5CF2A 2UX0A 2XRXB 4KVHA 4HJLB 1Z1SA 5KP4A 1K41A 2R4IA 2XR8B 3DXOA 5IG4A 4I4KA 3KSPA 3B4PA 2Z77A
chains in the Genus database with same CATH superfamily
4BTYA 3MKIA 1IU7A 1FGRA 3O8YA 3SLUA 1Q7HA 3T8UA 2HOHA 3Q90A 4WP5A 3J7Yd 3NBJA 2XFTA 4EBGA 3SOYA 1TRQA 1FUTA 3LMLA 3T8NA 1VQ43 1MWTA 1V74A 1JKGB 3GZRA 6STDA 2F56A 2QA43 4N6TA 1OF5A 1TFKA 4N6OB 3LTAA 1VQK3 1IT8A 3DGNA 5I97A 5LC7A 1Q9EA 3BLZA 1DVCA 2ZA4A 4RBNA 2Z77A 1IVXA 1W6YA 5AIGA 1KD14 5AYSC 4BTWA 5G1KA 1D6ZA 1A2KA 1RGKA 3UNLA 3VGNA 5BIRA 1W2ZA 2RSXA 3LTBA 1UW1A 4MJDA 1DMMA 2Z76A 1UCJA 2F5MA 2W0QA 3RGAA 4MMYB 1SIIA 2D1WA 1B3SA 1DE3A 1TU5A 3HIIA 1UCIA 4O8SA 2KAAA 8CHOA 2P09A 3PCSA 1BNRA 5G2GA 1MNLA 4EV5A 2KF5A 5CK6A 1B27A 1GSPA 1M1K4 3PCRA 3DGYA 3CCU3 1WNHA 3UJMA 3RDEA 2CWTA 2HMMB 1RGGA 3MYTA 4IT7A 3NBBA 2XSHB 3IJEB 1T5YA 4FMCA 1TJDA 1UUVB 3FKAA 4WHAA 2YFLB 4FMAA 3GSPA 4R4KA 3K63A 3HI7A 2W9QA 3FLJA 2IUJA 3GZYB 1I3FA 4L7KA 5BVBA 2R41A 1CEWI 3AHSA 2JDIH 2W2CA 4HM5B 4IPBA 3GZXB 1TFOA 4FMDA 4MMZB 5IG5A 1TP6A 3HX8A 4CPKA 1BU4A 1E3VA 1YJ93 1VQ73 4GB5A 4O2HA 1N8QA 1VQ83 2E2VA 2Z6BA 1W4NA 5IENA 2W04A 1BIRA 3X41A 3NX0A 1CH0A 3CNMA 4KFDA 2KCDA 2ML6A 3CNXA 5D81A 4CCVA 3S67A 3K7CA 3G16A 1DYUA 2OCTA 1UUGB 4EC6A 3IMAB 1RHLA 5IW9A 3EB8A 2M7OA 5EVHA 3D3LA 3DM8A 3PXMA 1B2ZA 1VZZA 1OHOA 4HM2B 1FA3A 3EJVA 3HK4A 2O9UX 2Q07A 3STDA 3HIGA 1YJW3 1RN7A 3GRDA 2W03A 3AGNA 4JF8A 1BNEA 2V1LA 3CCR3 1OUNA 1GOVA 1IQ8A 3F8HA 4OK0A 2BU4A 4LGQA 2C11A 2GU1A 1OHSA 3DH2A 4AKZA 5RNTA 1VQL3 5LC6A 3HOHA 1Q864 1AY7A 4R1KA 2ZHXB 2B1XB 3NQZA 2CIUA 2K54A 2HMLB 1SIHA 2WOHA 3X40A 2CKFB 2OTJ3 4KFFA 2GXFA 4JRFA 3OWUA 1YI23 4DKIA 1QVF2 1JN5B 2IYJA 3CC23 5KP1A 1VQ93 2FGTA 2YX9A 3BNDA 3X3ZA 3ZG5A 7STDA 1NO3A 1FYSA 2KXGA 1WTHA 1UDII 3WMDA 2ML5A 5CLKA 3JUMA 4MEIA 2H0HA 1W7CA 2HMJB 3AMOA 4I5QA 1YGEA 4ORLA 1EUIC 3DGMA 2STDA 4ILFA 3AHWA 3SVAA 1IQYA 2GBWB 3WA3A 1ULJB 2CFLA 3L0RA 4XBYA 1BUJA 2INXA 1RRLA 1CQSA 3F8XA 1RN1A 5FGOA 1TTOA 1AVLA 3OXAA 3G6E3 5ELUA 1RSNA 5BU4A 1W2B2 3WOFB 1FGQA 3EX9A 5BXQA 4EW5A 5AEWB 1YHQ3 1A90A 2W56A 1TUHA 2BMRB 3D9RA 1FW7A 5G1LA 2W6JH 3EQQB 1BGSA 5TGNA 1U5OA 3K5TA 1HU9A 1BNFA 3H3HA 1K734 3BB9A 1U8CB 1G96A 3KN4A 3JUQA 4LMIA 3LYGA 5M19A 1RLSA 5M1AA 2SARA 2P0XA 2RBIA 1QJGA 1AV4A 1VQM3 1O7HB 4K61A 3I553 4XDWA 2HMKB 3CCV3 1KC84 1B2SA 2CFGA 4GHOA 1VQ63 4O3VA 1IV9A 8RNTA 2QGUA 1RCLA 4LYLB 3HZPA 4G1MB 5D82A 3EHCA 2XEPA 3MG2A 2OOVA 1V57A 3GWRA 3V92A 2IA7A 1W02A 1PFPA 1FZUA 2CW9A 1X1XA 5KP3A 1R4YA 3CCE3 1JBTA 1I0XA 1B20A 1QALA 3FF2A 1IK3A 1G02A 2OOVC 1DETA 4BU4A 3I0YA 5IG0A 1UI7A 3NXJA 1OF5B 1DMNA 1BNGA 1BSEA 1OHPA 2IUKA 3M8CA 3OV4A 4O02B 1LOWA 3ROBA 1RGAA 1ZO2A 3Q3FA 3T0UA 2L4VA 3F7SA 1RGHA 3I563 1AQZA 1QAFA 3JUPA 3QRDA 5JPUA 3DGLA 1EKMA 1BVIA 1Q814 1BSDA 3PGBA 1QAKA 1YVSA 1FGMA 3ZFZA 3URPA 5HGRA 1BRNL 4XBTA 4J5KA 4OVMA 2J8XB 1B2UA 4K1VA 5DRVA 1BRJA 2XH9A 2RFRA 4H3UA 3BNEA 3EC9A 4BL3A 3NUVA 7RNTA 1WMPA 3SX1A 4HYZA 3ZG0A 3F14A 4HM6B 4HM4B 1B2MA 3EN8A 2UUGC 1RGEA 1HKXA 3FCSB 4RNZA 1GMPA 1O7MB 6GSPA 3S5CA 1J2BA 2E2UA 1FGOA 4LSOA 3SOAA 5AEUB 3GZBA 1G0TA 3Q2PA 1NDOB 4HOHA 1Q40B 5AIHA 3GAXA 3FF0A 4HBRA 4FCJA 1ASKA 5HOHA 1RJOA 1UGIA 5IF6A 1JRQA 2K0MA 2B24B 1C7HA 3OWSA 1LNHA 2IMJA 1FUWA 2XFSA 3SYUA 3KIIA 1EEJA 2HMNB 1VQP3 1D6YA 2XGNA 2Y74A 3FZWA 1RGFA 3ALAA 3KZTA 1W5ZA 1UI8A 1W6CA 1T2HA 1JZDA 2H0GA 2KRTA 1BNSA 1K28A 1PY3A 4PEJA 5JPPA 2OTL3 3LTDA 2LQVA 1V58A 3U97A 3Q1CA 4R80A 3CCQ3 3JUOA 1I8VA 2WO0A 2BT3A 1JNQA 4LZIA 1HYFA 4NHFA 1N9EA 4BIRA 4BL2A 1N5HA 1LXEA 5AIIA 2E2TA 3NV0A 2RCDA 3OX9A 2OQEA 2A15A 2Z7AA 1GMRA 5GSPA 1S5AA 4BTXA 3MG3A 1K9M4 2F4YA 3IPTA 2C4BA 1GS3A 3CMA3 1ROVA 1L5GB 2FNQA 1HZ1A 2MC8A 3LOYA 4WYKA 2OQEC 3A5EA 4NPBA 1Q824 1GMQA 1UGHI 1LQMB 1T2IA 2LYXA 3EN1B 2CFWA 3LZAA 1NU3A 4HM8B 1NWWA 4N6MA 3B4OA 3NHXA 5DREA 1BOXA 2PNCA 1GY7A 5IG3A 1BANA 1RMSA 1W00A 3DGOA 1IV7A 1SQWA 4L8OA 4OUQA 1N5PA 3G8ZA 3KFQC 6RNTA 1NJI4 2C10A 3S28A 1YIT3 1X1UA 1JN5A 1B21A 3PS8A 2BIRA 4H61A 1VQN3 3D4AA 3RNTA 5FW5A 3CME3 2CHCA 3S27A 1QMAA 3NQYA 2YFJB 1JZOA 1ULIB 1VQO3 2KF3A 1TRPA 1YNVX 2L1SA 3X3YA 1O7WB 3LTCA 1MOLA 3UB1A 2BMQB 3A76A 3AMOB 1FGTA 4L8PA 2XGLA 3NM2A 3G713 4KFEA 2XSOB 3D5GA 2CWVA 3JUNA 1Y4KA 4X2OA 5EQLA 3U1WA 4XBXA 3FG4A 3CPW2 1KQS2 3RGRA 1N8R4 3N8BA 1SPUA 1GOYA 1MWSA 3V99A 1YJN3 2W56B 3VF1A 4EXRA 1EA2A 3EE1A 2UGIA 1E3RA 3ER7A 4LEHA 3WA2X 3G4S3 1O7NB 3CCJ3 1JBSA 1A67A 2CFDA 1W01A 1YVBI 1K8A4 1RCKA 4Q53A 3D79A 1LOYA 1AR0A 4FMBA 4GL6A 2W9PA 3FGYA 2QEX3 2YFIB 3CD63 3WHOA 4EYCA 3KKGA 2I9WA 3F9SA 2P0MA 2GBXB 1RKYA 1JB2A 4K1UA 5M18A 7GSPA 3B7CA 1IVVA 1RNTA 1EQKA 2F86B 3CCS3 1GD4A 1UCLA 3AGOA 3BU4A 3KE7A 5AYRB 4AKYA 2BO9B 1JKGA 2CX1A 1C54A 3EF8A 1R4CA 4NREA 4U13A 4ZM8A 3LT8A 4KT3B 1A2VA 1PYLA 2XF3A 2O3OA 3DUKA 5IERA 1YIJ3 4XDVA 5EEOA 3K9MC 2ZL8A 1RGLA 1RGCA 4HZBB 5D83A 4HVNA 1US1A 1BSBA 2JQ5A 3MSOA 1IVWA 1BNIA 1OACA 2BMOB 2CFKA 3MG1A 3DZLA 1X1WA 3F40A 1JV2B 3LXUX 4HZ9B 3OWYA 1SARA 2CWUA 1RN4A 1NB3I 5STDA 3QK9A 1QVG2 4HM7B 3FG3A 4FR9A 5IEOA 1IDPA 3FG1A 1S723 4J9AA 4XB5A 1AVKA 3BNCA 3N9HA 2Y73A 3MHEA 4EV2A 1BRIA 3SXXA 3K0ZA 1WMOA 3NBRA 1BSAA 1SJWA 1TIJA 3SEDA 2RNTA 2FXTA 3OW22 1BSCA 2CK3H 2AADA 1BUQA 2P38A 1I2EA 2ZDJA 1GD3A 3EBYA 1VQQA 1BAOA 1X1YA 4WWUC 3CCL3 1MWUA 2RGQA 2BHMA 1T3BA 4R9LA 1KWIA 5AI1A 1LRAA 1MWRA 1GY5A 2MF7A 5A0OB 1BRHA 1GYBA 4N6V0 3WODG 1F8NA 1LQGC 2WGQA 4TX4A 1I2GA 1O7PB 2CG1A 1JJ22 2CG0A 4AEQA 1Q40A 1BRKA 3D5IA 4J8TA 2P05A 3WR2A 4MMXB 4XM4A 5AIFA 1ZX2A 1BNJA 2GEYA 3F7XA 3BIRA 1OH0A 2BNGA 3CU3A 2CC3A 2WGOA 3DMCA 4RZMA 1IVUA 1JB4A 1Q42A 1RDSA 1STDA 1UCKA 1DMQA 4CJNA 1B2XA 1LOVA 2WOFA 4HAAA 4HM3B 2KF6A 4QWTA 3S29A 3E99A 2SBLA 1GOUA 1GY6A 1YGWA 1PU4A 1D6UA 5JBSA 5IEPA 2CH9A 4RNTA 4R9KA 1JB5A 3H51A 3B8LA 2CX0A 3NM7A 1OGXA 2D42A 3EBTA 1ISKA 3NV0B 1VQ53 5CXOA 3WOEB 3WDGB 1N9JA 3BNBA 4CDLA 3X42A 1DVDA 4N6NB 3X3XA 4HKVB 1BRGA 3PZWA 5ELJA 3G0KA 3PYJA 1M9GA 4WYKB 1IYYA 3CPOA 1NNVA 3ECFA 1IT7A 4J5GA 1LOXA 1WQLB 1Q7Y4 4KZ1A 5CF1A 1CYVA 2K3DA 4X2HA 1EG9B 4N6UA 2HMOB 3UL5A 1BRSA 1OPYA 1UUWB 1JBRA 3MPHA 4IIAA 1OGZA 3FSDA 3CXC2 4GSPA 1I0VA 4FCZA 1IQXA 3FH1A 4HM0B 4K90B 3KSED 1OCVA 1RRHA 2QIYA 1O7GB 3UL6A 1E97A 2KF4A 1KSIA 1ZS7A 2F98A 1ROAA 3N54B 4N3VA 4STDA 3CC43 3CCM3 1CYUA 1M904 1RNBA 1I70A 1ZGXA 3LT9A 4HM1B 4WFOA 2AAEA 2GSPA 1MGWA 1M1XB 1MGRA 3TDGA 2OWPA 3VSYA 3KCHA 2F99A 1I3IA 1RTUA 1STFI 4FCMA 2F5WA 2GEXA 5CF2A 3CC73 1I2FA 2UX0A 1W6GA 3LH4A 2XRXB 2IY2A 4KVHA 2H0IA 4HJLB 1A2PA 1LNIA 1Z1SA 2GU3A 3MWZA 5KP4A 1NB5I 4RNYA 1FUSA 1K41A 2R4IA 3V98A 1LVNA 9RNTA 2XR8B 1WMNA 3DXOA 3JVCA 4N6LA 5IG4A 3DY5A 4I4KA 3KSPA 3B4PA 2PZVA
chains in the Genus database with same CATH topology
4BTYA 3MKIA 1IU7A 1FGRA 3O8YA 3SLUA 3T8UA 3Q90A 4WP5A 3J7Yd 3NBJA 2XFTA 4EBGA 3SOYA 3LMLA 3T8NA 1VQ43 1V74A 1JKGB 3GZRA 6STDA 2QA43 4N6TA 1OF5A 1TFKA 4N6OB 3LTAA 1VQK3 1IT8A 3DGNA 5I97A 5LC7A 3BLZA 1DVCA 4RBNA 2Z77A 1IVXA 1W6YA 5AIGA 1KD14 5AYSC 4BTWA 1D6ZA 1A2KA 3UNLA 3VGNA 1W2ZA 2RSXA 3LTBA 1UW1A 4MJDA 1DMMA 2Z76A 2W0QA 3RGAA 4MMYB 1SIIA 2D1WA 1TU5A 3HIIA 4O8SA 8CHOA 2P09A 3PCSA 5G2GA 1MNLA 4EV5A 5CK6A 1M1K4 3PCRA 3CCU3 1WNHA 3UJMA 3RDEA 2CWTA 2HMMB 3MYTA 4IT7A 3NBBA 2XSHB 3IJEB 1T5YA 4FMCA 1UUVB 3FKAA 4WHAA 2YFLB 4FMAA 4R4KA 3K63A 3HI7A 2W9QA 3FLJA 2IUJA 3GZYB 4L7KA 5BVBA 1CEWI 4HM5B 2JDIH 2W2CA 4IPBA 4MMZB 3GZXB 1TFOA 4FMDA 1L5GB 5IG5A 1TP6A 3HX8A 1E3VA 1YJ93 1VQ73 4GB5A 4O2HA 1N8QA 1VQ83 2E2VA 2Z6BA 1W4NA 5IENA 2W04A 3X41A 3NX0A 3CNMA 4KFDA 2KCDA 2ML6A 3CNXA 5D81A 4CCVA 3S67A 3K7CA 3G16A 1DYUA 2OCTA 4EC6A 3IMAB 5IW9A 3EB8A 2M7OA 5EVHA 3D3LA 3DM8A 3PXMA 1VZZA 1OHOA 4HM2B 1FA3A 3EJVA 3HK4A 2O9UX 2Q07A 3STDA 3HIGA 1YJW3 1RN7A 3GRDA 2W03A 4JF8A 3CCR3 2V1LA 1OUNA 1IQ8A 3F8HA 4OK0A 4LGQA 2C11A 2GU1A 1OHSA 4AKZA 1VQL3 5LC6A 1Q864 4R1KA 2B1XB 3NQZA 2CIUA 2K54A 2HMLB 1SIHA 2WOHA 3X40A 2CKFB 2OTJ3 4KFFA 2GXFA 4JRFA 3OWUA 1YI23 1QVF2 1JN5B 3CC23 5KP1A 1VQ93 2FGTA 2YX9A 3BNDA 3X3ZA 7STDA 1NO3A 2KXGA 1WTHA 3WMDA 2ML5A 5CLKA 3JUMA 4MEIA 1W7CA 2HMJB 3AMOA 1YGEA 4ORLA 3DGMA 2STDA 3SVAA 1IQYA 2GBWB 3WA3A 1ULJB 2CFLA 3L0RA 4XBYA 2INXA 1RRLA 1CQSA 3F8XA 5FGOA 1AVLA 3OXAA 3G6E3 5ELUA 1W2B2 3WOFB 1FGQA 3EX9A 5BXQA 5AEWB 1YHQ3 1A90A 2W56A 1TUHA 2BMRB 3D9RA 2W6JH 3EQQB 5TGNA 1U5OA 3K5TA 1HU9A 3H3HA 1K734 3BB9A 1U8CB 1G96A 3KN4A 3JUQA 4LMIA 3LYGA 2P0XA 1QJGA 1AV4A 1VQM3 1O7HB 4K61A 3I553 4XDWA 2HMKB 3CCV3 1KC84 2CFGA 1VQ63 4O3VA 1IV9A 2QGUA 5D82A 3HZPA 4G1MB 3EHCA 2XEPA 3MG2A 2OOVA 3GWRA 3V92A 2IA7A 1W02A 1PFPA 2CW9A 5KP3A 3CCE3 1QALA 3FF2A 1IK3A 2OOVC 3I0YA 5IG0A 1UI7A 3NXJA 1OF5B 1DMNA 3OV4A 1OHPA 3M8CA 2IUKA 4O02B 3ROBA 3T0UA 1ZO2A 2L4VA 3F7SA 3I563 3JUPA 1QAFA 3QRDA 5JPUA 3DGLA 1EKMA 1Q814 3PGBA 1QAKA 1FGMA 5HGRA 4XBTA 4OVMA 4K1VA 5DRVA 2XH9A 2RFRA 4H3UA 3BNEA 3EC9A 3NUVA 1WMPA 3SX1A 4HYZA 3F14A 4HM6B 4HM4B 3EN8A 1HKXA 3FCSB 4RNZA 1O7MB 3S5CA 1J2BA 2E2UA 1FGOA 4LSOA 3SOAA 5AEUB 3GZBA 3Q2PA 1NDOB 1Q40B 5AIHA 3GAXA 3FF0A 4HBRA 4FCJA 1ASKA 1RJOA 5IF6A 2K0MA 1JRQA 2B24B 1C7HA 3OWSA 1LNHA 2IMJA 1FUWA 2XFSA 3KIIA 2HMNB 1VQP3 1D6YA 2XGNA 2Y74A 3FZWA 3ALAA 3KZTA 1W5ZA 1UI8A 1W6CA 2OTL3 2KRTA 1K28A 5JPPA 4PEJA 3LTDA 2LQVA 3U97A 3Q1CA 4R80A 3CCQ3 3JUOA 2WO0A 2BT3A 1JNQA 4LZIA 4NHFA 1N9EA 1N5HA 1LXEA 5AIIA 2E2TA 3NV0A 2RCDA 3OX9A 2OQEA 2A15A 2Z7AA 1S5AA 4BTXA 3MG3A 1K9M4 3IPTA 1GS3A 3CMA3 1ROVA 2FNQA 2MC8A 3LOYA 4WYKA 2OQEC 1Q824 4HM8B 2LYXA 3EN1B 3LZAA 2CFWA 4N6MA 1NU3A 1NWWA 3B4OA 3NHXA 5DREA 2PNCA 1GY7A 5IG3A 1W00A 3DGOA 1IV7A 1SQWA 4L8OA 4OUQA 1N5PA 3G8ZA 3KFQC 1NJI4 2C10A 3S28A 1YIT3 1JN5A 3PS8A 4H61A 1VQN3 5FW5A 3CME3 2CHCA 3S27A 1QMAA 3NQYA 2YFJB 1ULIB 1VQO3 3X3YA 3G713 1O7WB 3LTCA 1MOLA 3UB1A 2BMQB 3A76A 3AMOB 1FGTA 4L8PA 2XGLA 3NM2A 4KFEA 2XSOB 3JUNA 2CWVA 4X2OA 1Y4KA 5EQLA 3U1WA 3CPW2 4XBXA 3FG4A 1KQS2 3RGRA 1N8R4 3N8BA 1SPUA 3V99A 1YJN3 2W56B 3VF1A 4EXRA 1EA2A 3EE1A 3ER7A 1E3RA 4LEHA 3WA2X 3G4S3 1A67A 1O7NB 3CCJ3 2CFDA 1W01A 1YVBI 1K8A4 4Q53A 4FMBA 4GL6A 1AR0A 2W9PA 3FGYA 2QEX3 2YFIB 3CD63 4EYCA 3KKGA 2I9WA 3F9SA 2P0MA 2GBXB 1RKYA 1JB2A 4K1UA 3B7CA 1IVVA 1EQKA 2F86B 3CCS3 1GD4A 5AYRB 4AKYA 3KE7A 2BO9B 1JKGA 3EF8A 1R4CA 4NREA 4U13A 4ZM8A 3LT8A 1A2VA 2XF3A 2O3OA 3DUKA 5IERA 1YIJ3 4XDVA 5EEOA 3K9MC 2ZL8A 4HZBB 5D83A 4HVNA 1US1A 2JQ5A 3MSOA 1IVWA 2BMOB 1OACA 2CFKA 3MG1A 3DZLA 3F40A 1JV2B 3LXUX 4HZ9B 3OWYA 2CWUA 1NB3I 5STDA 3QK9A 1QVG2 4HM7B 3FG3A 4FR9A 5IEOA 1IDPA 3FG1A 1S723 4J9AA 4XB5A 1AVKA 3BNCA 3N9HA 2Y73A 3MHEA 4EV2A 3SXXA 3K0ZA 1WMOA 3NBRA 3SEDA 1SJWA 1TIJA 2FXTA 3OW22 2CK3H 1BUQA 2P38A 2ZDJA 1GD3A 3EBYA 4WWUC 3CCL3 2RGQA 2BHMA 4R9LA 1KWIA 5AI1A 1GY5A 2MF7A 5A0OB 1GYBA 4N6V0 3WODG 1F8NA 2WGQA 4TX4A 1JJ22 1O7PB 2CG1A 2CG0A 4AEQA 1Q40A 4J8TA 2P05A 4MMXB 4XM4A 5AIFA 1ZX2A 3F7XA 2GEYA 1OH0A 2BNGA 3CU3A 2CC3A 2WGOA 3DMCA 4RZMA 1IVUA 1JB4A 1Q42A 1STDA 1DMQA 2WOFA 4HM3B 4QWTA 3S29A 3E99A 2SBLA 1GY6A 1PU4A 1D6UA 5JBSA 5IEPA 2CH9A 4R9KA 1JB5A 3H51A 3B8LA 3NM7A 1OGXA 2D42A 3EBTA 1ISKA 3NV0B 1VQ53 5CXOA 3WOEB 3WDGB 1N9JA 3BNBA 4CDLA 3X42A 1DVDA 4N6NB 3X3XA 4HKVB 3PZWA 5ELJA 3G0KA 3PYJA 1M9GA 4WYKB 3CPOA 3ECFA 1IT7A 1Q7Y4 1LOXA 1WQLB 4KZ1A 5CF1A 1CYVA 4X2HA 1EG9B 4N6UA 2HMOB 3UL5A 1OPYA 1UUWB 3MPHA 4IIAA 1OGZA 3FSDA 3CXC2 4FCZA 1IQXA 3FH1A 4HM0B 4K90B 3KSED 1OCVA 1RRHA 2QIYA 1O7GB 3UL6A 1E97A 1KSIA 2F98A 1ROAA 3N54B 4N3VA 4STDA 3CC43 3CCM3 1CYUA 1M904 3LT9A 4HM1B 4WFOA 3TDGA 1M1XB 3VSYA 2OWPA 2F99A 1STFI 4FCMA 2GEXA 5CF2A 3CC73 2UX0A 1W6GA 3LH4A 2XRXB 4KVHA 4HJLB 2GU3A 3MWZA 1Z1SA 5KP4A 1NB5I 4RNYA 1K41A 2R4IA 3V98A 1LVNA 2XR8B 1WMNA 3DXOA 3JVCA 4N6LA 5IG4A 3DY5A 4I4KA 3KSPA 3B4PA 2PZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKI A;  3T8U A;  3Q90 A;  4WP5 A;  3SOY A;  3T8N A;  3GZR A;  1JKG B;  6STD A;  1OF5 A;  3BLZ A;  1W6Y A;  5AIG A;  1A2K A;  3UNL A;  3VGN A;  4MJD A;  1DMM A;  2Z76 A;  3RGA A;  8CHO A;  5G2G A;  5CK6 A;  3UJM A;  2HMM B;  3MYT A;  2XSH B;  1UUV B;  3FKA A;  2YFL B;  3FLJ A;  3GZY B;  4L7K A;  5BVB A;  4HM5 B;  2W2C A;  5IG5 A;  3GZX B;  1TP6 A;  3HX8 A;  1E3V A;  4GB5 A;  5IEN A;  3CNM A;  3CNX A;  5D81 A;  3K7C A;  3G16 A;  5EVH A;  3DM8 A;  1VZZ A;  1OHO A;  4HM2 B;  3EJV A;  3HK4 A;  3STD A;  3GRD A;  1OUN A;  3F8H A;  4LGQ A;  1OHS A;  4R1K A;  2B1X B;  2K54 A;  2HML B;  2CKF B;  2GXF A;  3OWU A;  1JN5 B;  5KP1 A;  7STD A;  3WMD A;  5CLK A;  3JUM A;  2HMJ B;  4ORL A;  2STD A;  2GBW B;  1ULJ B;  4XBY A;  2INX A;  3F8X A;  1CQS A;  3OXA A;  3EX9 A;  5BXQ A;  5AEW B;  1TUH A;  2BMR B;  3D9R A;  3EQQ B;  5TGN A;  1U5O A;  3H3H A;  3BB9 A;  3JUQ A;  4LMI A;  3LYG A;  1QJG A;  1O7H B;  4XDW A;  2HMK B;  2QGU A;  5D82 A;  3HZP A;  3EHC A;  3MG2 A;  3GWR A;  1W02 A;  5KP3 A;  3FF2 A;  3I0Y A;  5IG0 A;  3NXJ A;  1OF5 B;  1DMN A;  3OV4 A;  1OHP A;  3M8C A;  3ROB A;  1ZO2 A;  3F7S A;  3JUP A;  5JPU A;  5HGR A;  4XBT A;  4OVM A;  4K1V A;  5DRV A;  2RFR A;  4H3U A;  3EC9 A;  3NUV A;  3F14 A;  4HM6 B;  4HM4 B;  3EN8 A;  1HKX A;  1O7M B;  3S5C A;  3SOA A;  5AEU B;  3GZB A;  1NDO B;  1Q40 B;  5AIH A;  3FF0 A;  4FCJ A;  1ASK A;  5IF6 A;  2B24 B;  1C7H A;  3OWS A;  2IMJ A;  2HMN B;  3KZT A;  3FZW A;  5JPP A;  4PEJ A;  3JUO A;  5AII A;  3NV0 A;  2RCD A;  3OX9 A;  2A15 A;  2Z7A A;  1S5A A;  3MG3 A;  3IPT A;  1GS3 A;  4WYK A;  4HM8 B;  3EN1 B;  3LZA A;  1NU3 A;  2PZV A;  1NWW A;  3B4O A;  3NHX A;  5DRE A;  1GY7 A;  5IG3 A;  1W00 A;  4L8O A;  4OUQ A;  3G8Z A;  1JN5 A;  5FW5 A;  2CHC A;  1QMA A;  2YFJ B;  1ULI B;  1O7W B;  2BMQ B;  3A76 A;  4L8P A;  3NM2 A;  2XSO B;  3JUN A;  4X2O A;  4XBX A;  3RGR A;  1EA2 A;  3ER7 A;  1E3R A;  4LEH A;  1O7N B;  1W01 A;  4Q53 A;  1AR0 A;  3FGY A;  2YFI B;  3KKG A;  2I9W A;  3F9S A;  2GBX B;  1JB2 A;  4K1U A;  3B7C A;  2F86 B;  3KE7 A;  1JKG A;  3EF8 A;  4U13 A;  3DUK A;  5IER A;  4XDV A;  4HZB B;  5D83 A;  4HVN A;  2JQ5 A;  3MSO A;  2BMO B;  3MG1 A;  3DZL A;  3F40 A;  4HZ9 B;  3OWY A;  5STD A;  4HM7 B;  5IEO A;  1IDP A;  4J9A A;  4XB5 A;  3MHE A;  3K0Z A;  3NBR A;  3SED A;  1SJW A;  1BUQ A;  3EBY A;  4WWU C;  2RGQ A;  4R9L A;  5AI1 A;  1GY5 A;  1GYB A;  1O7P B;  1Q40 A;  4J8T A;  4XM4 A;  5AIF A;  1ZX2 A;  3F7X A;  2GEY A;  1OH0 A;  2BNG A;  3CU3 A;  3DMC A;  4RZM A;  1JB4 A;  1Q42 A;  1STD A;  1DMQ A;  4HM3 B;  3E99 A;  1GY6 A;  5IEP A;  4R9K A;  1JB5 A;  3H51 A;  3B8L A;  1OGX A;  3EBT A;  1ISK A;  3NV0 B;  5CXO A;  4CDL A;  4HKV B;  3G0K A;  4WYK B;  3CPO A;  3ECF A;  1WQL B;  5CF1 A;  4X2H A;  1EG9 B;  2HMO B;  1OPY A;  1UUW B;  4IIA A;  1OGZ A;  3FSD A;  3FH1 A;  4HM0 B;  1OCV A;  2QIY A;  1O7G B;  1E97 A;  2F98 A;  4N3V A;  4STD A;  4HM1 B;  3VSY A;  2OWP A;  2F99 A;  4FCM A;  2GEX A;  5CF2 A;  2UX0 A;  2XRX B;  4KVH A;  4HJL B;  1Z1S A;  5KP4 A;  1K41 A;  2R4I A;  2XR8 B;  3DXO A;  5IG4 A;  4I4K A;  3KSP A;  3B4P A;  2Z77 A; 
#chains in the Genus database with same CATH topology
 4BTY A;  3MKI A;  1IU7 A;  1FGR A;  3O8Y A;  3SLU A;  1Q7H A;  3T8U A;  2HOH A;  3Q90 A;  4WP5 A;  3J7Y d;  3NBJ A;  2XFT A;  4EBG A;  3SOY A;  1TRQ A;  1FUT A;  3LML A;  3T8N A;  1VQ4 3;  1MWT A;  1V74 A;  1JKG B;  3GZR A;  6STD A;  2F56 A;  2QA4 3;  4N6T A;  1OF5 A;  1TFK A;  4N6O B;  3LTA A;  1VQK 3;  1IT8 A;  3DGN A;  5I97 A;  5LC7 A;  1Q9E A;  3BLZ A;  1DVC A;  2ZA4 A;  4RBN A;  2Z77 A;  1IVX A;  1W6Y A;  5AIG A;  1KD1 4;  5AYS C;  4BTW A;  5G1K A;  1D6Z A;  1A2K A;  1RGK A;  3UNL A;  3VGN A;  5BIR A;  1W2Z A;  2RSX A;  3LTB A;  1UW1 A;  4MJD A;  1DMM A;  2Z76 A;  1UCJ A;  2F5M A;  2W0Q A;  3RGA A;  4MMY B;  1SII A;  2D1W A;  1B3S A;  1DE3 A;  1TU5 A;  3HII A;  1UCI A;  4O8S A;  2KAA A;  8CHO A;  2P09 A;  3PCS A;  1BNR A;  5G2G A;  1MNL A;  4EV5 A;  2KF5 A;  5CK6 A;  1B27 A;  1GSP A;  1M1K 4;  3PCR A;  3DGY A;  3CCU 3;  1WNH A;  3UJM A;  3RDE A;  2CWT A;  2HMM B;  1RGG A;  3MYT A;  4IT7 A;  3NBB A;  2XSH B;  3IJE B;  1T5Y A;  4FMC A;  1TJD A;  1UUV B;  3FKA A;  4WHA A;  2YFL B;  4FMA A;  3GSP A;  4R4K A;  3K63 A;  3HI7 A;  2W9Q A;  3FLJ A;  2IUJ A;  3GZY B;  1I3F A;  4L7K A;  5BVB A;  2R41 A;  1CEW I;  3AHS A;  2JDI H;  2W2C A;  4HM5 B;  4IPB A;  3GZX B;  1TFO A;  4FMD A;  4MMZ B;  5IG5 A;  1TP6 A;  3HX8 A;  4CPK A;  1BU4 A;  1E3V A;  1YJ9 3;  1VQ7 3;  4GB5 A;  4O2H A;  1N8Q A;  1VQ8 3;  2E2V A;  2Z6B A;  1W4N A;  5IEN A;  2W04 A;  1BIR A;  3X41 A;  3NX0 A;  1CH0 A;  3CNM A;  4KFD A;  2KCD A;  2ML6 A;  3CNX A;  5D81 A;  4CCV A;  3S67 A;  3K7C A;  3G16 A;  1DYU A;  2OCT A;  1UUG B;  4EC6 A;  3IMA B;  1RHL A;  5IW9 A;  3EB8 A;  2M7O A;  5EVH A;  3D3L A;  3DM8 A;  3PXM A;  1B2Z A;  1VZZ A;  1OHO A;  4HM2 B;  1FA3 A;  3EJV A;  3HK4 A;  2O9U X;  2Q07 A;  3STD A;  3HIG A;  1YJW 3;  1RN7 A;  3GRD A;  2W03 A;  3AGN A;  4JF8 A;  1BNE A;  2V1L A;  3CCR 3;  1OUN A;  1GOV A;  1IQ8 A;  3F8H A;  4OK0 A;  2BU4 A;  4LGQ A;  2C11 A;  2GU1 A;  1OHS A;  3DH2 A;  4AKZ A;  5RNT A;  1VQL 3;  5LC6 A;  3HOH A;  1Q86 4;  1AY7 A;  4R1K A;  2ZHX B;  2B1X B;  3NQZ A;  2CIU A;  2K54 A;  2HML B;  1SIH A;  2WOH A;  3X40 A;  2CKF B;  2OTJ 3;  4KFF A;  2GXF A;  4JRF A;  3OWU A;  1YI2 3;  4DKI A;  1QVF 2;  1JN5 B;  2IYJ A;  3CC2 3;  5KP1 A;  1VQ9 3;  2FGT A;  2YX9 A;  3BND A;  3X3Z A;  3ZG5 A;  7STD A;  1NO3 A;  1FYS A;  2KXG A;  1WTH A;  1UDI I;  3WMD A;  2ML5 A;  5CLK A;  3JUM A;  4MEI A;  2H0H A;  1W7C A;  2HMJ B;  3AMO A;  4I5Q A;  1YGE A;  4ORL A;  1EUI C;  3DGM A;  2STD A;  4ILF A;  3AHW A;  3SVA A;  1IQY A;  2GBW B;  3WA3 A;  1ULJ B;  2CFL A;  3L0R A;  4XBY A;  1BUJ A;  2INX A;  1RRL A;  1CQS A;  3F8X A;  1RN1 A;  5FGO A;  1TTO A;  1AVL A;  3OXA A;  3G6E 3;  5ELU A;  1RSN A;  5BU4 A;  1W2B 2;  3WOF B;  1FGQ A;  3EX9 A;  5BXQ A;  4EW5 A;  5AEW B;  1YHQ 3;  1A90 A;  2W56 A;  1TUH A;  2BMR B;  3D9R A;  1FW7 A;  5G1L A;  2W6J H;  3EQQ B;  1BGS A;  5TGN A;  1U5O A;  3K5T A;  1HU9 A;  1BNF A;  3H3H A;  1K73 4;  3BB9 A;  1U8C B;  1G96 A;  3KN4 A;  3JUQ A;  4LMI A;  3LYG A;  5M19 A;  1RLS A;  5M1A A;  2SAR A;  2P0X A;  2RBI A;  1QJG A;  1AV4 A;  1VQM 3;  1O7H B;  4K61 A;  3I55 3;  4XDW A;  2HMK B;  3CCV 3;  1KC8 4;  1B2S A;  2CFG A;  4GHO A;  1VQ6 3;  4O3V A;  1IV9 A;  8RNT A;  2QGU A;  1RCL A;  4LYL B;  3HZP A;  4G1M B;  5D82 A;  3EHC A;  2XEP A;  3MG2 A;  2OOV A;  1V57 A;  3GWR A;  3V92 A;  2IA7 A;  1W02 A;  1PFP A;  1FZU A;  2CW9 A;  1X1X A;  5KP3 A;  1R4Y A;  3CCE 3;  1JBT A;  1I0X A;  1B20 A;  1QAL A;  3FF2 A;  1IK3 A;  1G02 A;  2OOV C;  1DET A;  4BU4 A;  3I0Y A;  5IG0 A;  1UI7 A;  3NXJ A;  1OF5 B;  1DMN A;  1BNG A;  1BSE A;  1OHP A;  2IUK A;  3M8C A;  3OV4 A;  4O02 B;  1LOW A;  3ROB A;  1RGA A;  1ZO2 A;  3Q3F A;  3T0U A;  2L4V A;  3F7S A;  1RGH A;  3I56 3;  1AQZ A;  1QAF A;  3JUP A;  3QRD A;  5JPU A;  3DGL A;  1EKM A;  1BVI A;  1Q81 4;  1BSD A;  3PGB A;  1QAK A;  1YVS A;  1FGM A;  3ZFZ A;  3URP A;  5HGR A;  1BRN L;  4XBT A;  4J5K A;  4OVM A;  2J8X B;  1B2U A;  4K1V A;  5DRV A;  1BRJ A;  2XH9 A;  2RFR A;  4H3U A;  3BNE A;  3EC9 A;  4BL3 A;  3NUV A;  7RNT A;  1WMP A;  3SX1 A;  4HYZ A;  3ZG0 A;  3F14 A;  4HM6 B;  4HM4 B;  1B2M A;  3EN8 A;  2UUG C;  1RGE A;  1HKX A;  3FCS B;  4RNZ A;  1GMP A;  1O7M B;  6GSP A;  3S5C A;  1J2B A;  2E2U A;  1FGO A;  4LSO A;  3SOA A;  5AEU B;  3GZB A;  1G0T A;  3Q2P A;  1NDO B;  4HOH A;  1Q40 B;  5AIH A;  3GAX A;  3FF0 A;  4HBR A;  4FCJ A;  1ASK A;  5HOH A;  1RJO A;  1UGI A;  5IF6 A;  1JRQ A;  2K0M A;  2B24 B;  1C7H A;  3OWS A;  1LNH A;  2IMJ A;  1FUW A;  2XFS A;  3SYU A;  3KII A;  1EEJ A;  2HMN B;  1VQP 3;  1D6Y A;  2XGN A;  2Y74 A;  3FZW A;  1RGF A;  3ALA A;  3KZT A;  1W5Z A;  1UI8 A;  1W6C A;  1T2H A;  1JZD A;  2H0G A;  2KRT A;  1BNS A;  1K28 A;  1PY3 A;  4PEJ A;  5JPP A;  2OTL 3;  3LTD A;  2LQV A;  1V58 A;  3U97 A;  3Q1C A;  4R80 A;  3CCQ 3;  3JUO A;  1I8V A;  2WO0 A;  2BT3 A;  1JNQ A;  4LZI A;  1HYF A;  4NHF A;  1N9E A;  4BIR A;  4BL2 A;  1N5H A;  1LXE A;  5AII A;  2E2T A;  3NV0 A;  2RCD A;  3OX9 A;  2OQE A;  2A15 A;  2Z7A A;  1GMR A;  5GSP A;  1S5A A;  4BTX A;  3MG3 A;  1K9M 4;  2F4Y A;  3IPT A;  2C4B A;  1GS3 A;  3CMA 3;  1ROV A;  1L5G B;  2FNQ A;  1HZ1 A;  2MC8 A;  3LOY A;  4WYK A;  2OQE C;  3A5E A;  4NPB A;  1Q82 4;  1GMQ A;  1UGH I;  1LQM B;  1T2I A;  2LYX A;  3EN1 B;  2CFW A;  3LZA A;  1NU3 A;  4HM8 B;  1NWW A;  4N6M A;  3B4O A;  3NHX A;  5DRE A;  1BOX A;  2PNC A;  1GY7 A;  5IG3 A;  1BAN A;  1RMS A;  1W00 A;  3DGO A;  1IV7 A;  1SQW A;  4L8O A;  4OUQ A;  1N5P A;  3G8Z A;  3KFQ C;  6RNT A;  1NJI 4;  2C10 A;  3S28 A;  1YIT 3;  1X1U A;  1JN5 A;  1B21 A;  3PS8 A;  2BIR A;  4H61 A;  1VQN 3;  3D4A A;  3RNT A;  5FW5 A;  3CME 3;  2CHC A;  3S27 A;  1QMA A;  3NQY A;  2YFJ B;  1JZO A;  1ULI B;  1VQO 3;  2KF3 A;  1TRP A;  1YNV X;  2L1S A;  3X3Y A;  1O7W B;  3LTC A;  1MOL A;  3UB1 A;  2BMQ B;  3A76 A;  3AMO B;  1FGT A;  4L8P A;  2XGL A;  3NM2 A;  3G71 3;  4KFE A;  2XSO B;  3D5G A;  2CWV A;  3JUN A;  1Y4K A;  4X2O A;  5EQL A;  3U1W A;  4XBX A;  3FG4 A;  3CPW 2;  1KQS 2;  3RGR A;  1N8R 4;  3N8B A;  1SPU A;  1GOY A;  1MWS A;  3V99 A;  1YJN 3;  2W56 B;  3VF1 A;  4EXR A;  1EA2 A;  3EE1 A;  2UGI A;  1E3R A;  3ER7 A;  4LEH A;  3WA2 X;  3G4S 3;  1O7N B;  3CCJ 3;  1JBS A;  1A67 A;  2CFD A;  1W01 A;  1YVB I;  1K8A 4;  1RCK A;  4Q53 A;  3D79 A;  1LOY A;  1AR0 A;  4FMB A;  4GL6 A;  2W9P A;  3FGY A;  2QEX 3;  2YFI B;  3CD6 3;  3WHO A;  4EYC A;  3KKG A;  2I9W A;  3F9S A;  2P0M A;  2GBX B;  1RKY A;  1JB2 A;  4K1U A;  5M18 A;  7GSP A;  3B7C A;  1IVV A;  1RNT A;  1EQK A;  2F86 B;  3CCS 3;  1GD4 A;  1UCL A;  3AGO A;  3BU4 A;  3KE7 A;  5AYR B;  4AKY A;  2BO9 B;  1JKG A;  2CX1 A;  1C54 A;  3EF8 A;  1R4C A;  4NRE A;  4U13 A;  4ZM8 A;  3LT8 A;  4KT3 B;  1A2V A;  1PYL A;  2XF3 A;  2O3O A;  3DUK A;  5IER A;  1YIJ 3;  4XDV A;  5EEO A;  3K9M C;  2ZL8 A;  1RGL A;  1RGC A;  4HZB B;  5D83 A;  4HVN A;  1US1 A;  1BSB A;  2JQ5 A;  3MSO A;  1IVW A;  1BNI A;  1OAC A;  2BMO B;  2CFK A;  3MG1 A;  3DZL A;  1X1W A;  3F40 A;  1JV2 B;  3LXU X;  4HZ9 B;  3OWY A;  1SAR A;  2CWU A;  1RN4 A;  1NB3 I;  5STD A;  3QK9 A;  1QVG 2;  4HM7 B;  3FG3 A;  4FR9 A;  5IEO A;  1IDP A;  3FG1 A;  1S72 3;  4J9A A;  4XB5 A;  1AVK A;  3BNC A;  3N9H A;  2Y73 A;  3MHE A;  4EV2 A;  1BRI A;  3SXX A;  3K0Z A;  1WMO A;  3NBR A;  1BSA A;  1SJW A;  1TIJ A;  3SED A;  2RNT A;  2FXT A;  3OW2 2;  1BSC A;  2CK3 H;  2AAD A;  1BUQ A;  2P38 A;  1I2E A;  2ZDJ A;  1GD3 A;  3EBY A;  1VQQ A;  1BAO A;  1X1Y A;  4WWU C;  3CCL 3;  1MWU A;  2RGQ A;  2BHM A;  1T3B A;  4R9L A;  1KWI A;  5AI1 A;  1LRA A;  1MWR A;  1GY5 A;  2MF7 A;  5A0O B;  1BRH A;  1GYB A;  4N6V 0;  3WOD G;  1F8N A;  1LQG C;  2WGQ A;  4TX4 A;  1I2G A;  1O7P B;  2CG1 A;  1JJ2 2;  2CG0 A;  4AEQ A;  1Q40 A;  1BRK A;  3D5I A;  4J8T A;  2P05 A;  3WR2 A;  4MMX B;  4XM4 A;  5AIF A;  1ZX2 A;  1BNJ A;  2GEY A;  3F7X A;  3BIR A;  1OH0 A;  2BNG A;  3CU3 A;  2CC3 A;  2WGO A;  3DMC A;  4RZM A;  1IVU A;  1JB4 A;  1Q42 A;  1RDS A;  1STD A;  1UCK A;  1DMQ A;  4CJN A;  1B2X A;  1LOV A;  2WOF A;  4HAA A;  4HM3 B;  2KF6 A;  4QWT A;  3S29 A;  3E99 A;  2SBL A;  1GOU A;  1GY6 A;  1YGW A;  1PU4 A;  1D6U A;  5JBS A;  5IEP A;  2CH9 A;  4RNT A;  4R9K A;  1JB5 A;  3H51 A;  3B8L A;  2CX0 A;  3NM7 A;  1OGX A;  2D42 A;  3EBT A;  1ISK A;  3NV0 B;  1VQ5 3;  5CXO A;  3WOE B;  3WDG B;  1N9J A;  3BNB A;  4CDL A;  3X42 A;  1DVD A;  4N6N B;  3X3X A;  4HKV B;  1BRG A;  3PZW A;  5ELJ A;  3G0K A;  3PYJ A;  1M9G A;  4WYK B;  1IYY A;  3CPO A;  1NNV A;  3ECF A;  1IT7 A;  4J5G A;  1LOX A;  1WQL B;  1Q7Y 4;  4KZ1 A;  5CF1 A;  1CYV A;  2K3D A;  4X2H A;  1EG9 B;  4N6U A;  2HMO B;  3UL5 A;  1BRS A;  1OPY A;  1UUW B;  1JBR A;  3MPH A;  4IIA A;  1OGZ A;  3FSD A;  3CXC 2;  4GSP A;  1I0V A;  4FCZ A;  1IQX A;  3FH1 A;  4HM0 B;  4K90 B;  3KSE D;  1OCV A;  1RRH A;  2QIY A;  1O7G B;  3UL6 A;  1E97 A;  2KF4 A;  1KSI A;  1ZS7 A;  2F98 A;  1ROA A;  3N54 B;  4N3V A;  4STD A;  3CC4 3;  3CCM 3;  1CYU A;  1M90 4;  1RNB A;  1I70 A;  1ZGX A;  3LT9 A;  4HM1 B;  4WFO A;  2AAE A;  2GSP A;  1MGW A;  1M1X B;  1MGR A;  3TDG A;  2OWP A;  3VSY A;  3KCH A;  2F99 A;  1I3I A;  1RTU A;  1STF I;  4FCM A;  2F5W A;  2GEX A;  5CF2 A;  3CC7 3;  1I2F A;  2UX0 A;  1W6G A;  3LH4 A;  2XRX B;  2IY2 A;  4KVH A;  2H0I A;  4HJL B;  1A2P A;  1LNI A;  1Z1S A;  2GU3 A;  3MWZ A;  5KP4 A;  1NB5 I;  4RNY A;  1FUS A;  1K41 A;  2R4I A;  3V98 A;  1LVN A;  9RNT A;  2XR8 B;  1WMN A;  3DXO A;  3JVC A;  4N6L A;  5IG4 A;  3DY5 A;  4I4K A;  3KSP A;  3B4P A;  2PZV A; 
#chains in the Genus database with same CATH homology
 4BTY A;  3MKI A;  1IU7 A;  1FGR A;  3O8Y A;  3SLU A;  3T8U A;  3Q90 A;  4WP5 A;  3J7Y d;  3NBJ A;  2XFT A;  4EBG A;  3SOY A;  3LML A;  3T8N A;  1VQ4 3;  1V74 A;  1JKG B;  3GZR A;  6STD A;  2QA4 3;  4N6T A;  1OF5 A;  1TFK A;  4N6O B;  3LTA A;  1VQK 3;  1IT8 A;  3DGN A;  5I97 A;  5LC7 A;  3BLZ A;  1DVC A;  4RBN A;  2Z77 A;  1IVX A;  1W6Y A;  5AIG A;  1KD1 4;  5AYS C;  4BTW A;  1D6Z A;  1A2K A;  3UNL A;  3VGN A;  1W2Z A;  2RSX A;  3LTB A;  1UW1 A;  4MJD A;  1DMM A;  2Z76 A;  2W0Q A;  3RGA A;  4MMY B;  1SII A;  2D1W A;  1TU5 A;  3HII A;  4O8S A;  8CHO A;  2P09 A;  3PCS A;  5G2G A;  1MNL A;  4EV5 A;  5CK6 A;  1M1K 4;  3PCR A;  3CCU 3;  1WNH A;  3UJM A;  3RDE A;  2CWT A;  2HMM B;  3MYT A;  4IT7 A;  3NBB A;  2XSH B;  3IJE B;  1T5Y A;  4FMC A;  1UUV B;  3FKA A;  4WHA A;  2YFL B;  4FMA A;  4R4K A;  3K63 A;  3HI7 A;  2W9Q A;  3FLJ A;  2IUJ A;  3GZY B;  4L7K A;  5BVB A;  1CEW I;  4HM5 B;  2JDI H;  2W2C A;  4IPB A;  4MMZ B;  3GZX B;  1TFO A;  4FMD A;  1L5G B;  5IG5 A;  1TP6 A;  3HX8 A;  1E3V A;  1YJ9 3;  1VQ7 3;  4GB5 A;  4O2H A;  1N8Q A;  1VQ8 3;  2E2V A;  2Z6B A;  1W4N A;  5IEN A;  2W04 A;  3X41 A;  3NX0 A;  3CNM A;  4KFD A;  2KCD A;  2ML6 A;  3CNX A;  5D81 A;  4CCV A;  3S67 A;  3K7C A;  3G16 A;  1DYU A;  2OCT A;  4EC6 A;  3IMA B;  5IW9 A;  3EB8 A;  2M7O A;  5EVH A;  3D3L A;  3DM8 A;  3PXM A;  1VZZ A;  1OHO A;  4HM2 B;  1FA3 A;  3EJV A;  3HK4 A;  2O9U X;  2Q07 A;  3STD A;  3HIG A;  1YJW 3;  1RN7 A;  3GRD A;  2W03 A;  4JF8 A;  3CCR 3;  2V1L A;  1OUN A;  1IQ8 A;  3F8H A;  4OK0 A;  4LGQ A;  2C11 A;  2GU1 A;  1OHS A;  4AKZ A;  1VQL 3;  5LC6 A;  1Q86 4;  4R1K A;  2B1X B;  3NQZ A;  2CIU A;  2K54 A;  2HML B;  1SIH A;  2WOH A;  3X40 A;  2CKF B;  2OTJ 3;  4KFF A;  2GXF A;  4JRF A;  3OWU A;  1YI2 3;  1QVF 2;  1JN5 B;  3CC2 3;  5KP1 A;  1VQ9 3;  2FGT A;  2YX9 A;  3BND A;  3X3Z A;  7STD A;  1NO3 A;  2KXG A;  1WTH A;  3WMD A;  2ML5 A;  5CLK A;  3JUM A;  4MEI A;  1W7C A;  2HMJ B;  3AMO A;  1YGE A;  4ORL A;  3DGM A;  2STD A;  3SVA A;  1IQY A;  2GBW B;  3WA3 A;  1ULJ B;  2CFL A;  3L0R A;  4XBY A;  2INX A;  1RRL A;  1CQS A;  3F8X A;  5FGO A;  1AVL A;  3OXA A;  3G6E 3;  5ELU A;  1W2B 2;  3WOF B;  1FGQ A;  3EX9 A;  5BXQ A;  5AEW B;  1YHQ 3;  1A90 A;  2W56 A;  1TUH A;  2BMR B;  3D9R A;  2W6J H;  3EQQ B;  5TGN A;  1U5O A;  3K5T A;  1HU9 A;  3H3H A;  1K73 4;  3BB9 A;  1U8C B;  1G96 A;  3KN4 A;  3JUQ A;  4LMI A;  3LYG A;  2P0X A;  1QJG A;  1AV4 A;  1VQM 3;  1O7H B;  4K61 A;  3I55 3;  4XDW A;  2HMK B;  3CCV 3;  1KC8 4;  2CFG A;  1VQ6 3;  4O3V A;  1IV9 A;  2QGU A;  5D82 A;  3HZP A;  4G1M B;  3EHC A;  2XEP A;  3MG2 A;  2OOV A;  3GWR A;  3V92 A;  2IA7 A;  1W02 A;  1PFP A;  2CW9 A;  5KP3 A;  3CCE 3;  1QAL A;  3FF2 A;  1IK3 A;  2OOV C;  3I0Y A;  5IG0 A;  1UI7 A;  3NXJ A;  1OF5 B;  1DMN A;  3OV4 A;  1OHP A;  3M8C A;  2IUK A;  4O02 B;  3ROB A;  3T0U A;  1ZO2 A;  2L4V A;  3F7S A;  3I56 3;  3JUP A;  1QAF A;  3QRD A;  5JPU A;  3DGL A;  1EKM A;  1Q81 4;  3PGB A;  1QAK A;  1FGM A;  5HGR A;  4XBT A;  4OVM A;  4K1V A;  5DRV A;  2XH9 A;  2RFR A;  4H3U A;  3BNE A;  3EC9 A;  3NUV A;  1WMP A;  3SX1 A;  4HYZ A;  3F14 A;  4HM6 B;  4HM4 B;  3EN8 A;  1HKX A;  3FCS B;  4RNZ A;  1O7M B;  3S5C A;  1J2B A;  2E2U A;  1FGO A;  4LSO A;  3SOA A;  5AEU B;  3GZB A;  3Q2P A;  1NDO B;  1Q40 B;  5AIH A;  3GAX A;  3FF0 A;  4HBR A;  4FCJ A;  1ASK A;  1RJO A;  5IF6 A;  2K0M A;  1JRQ A;  2B24 B;  1C7H A;  3OWS A;  1LNH A;  2IMJ A;  1FUW A;  2XFS A;  3KII A;  2HMN B;  1VQP 3;  1D6Y A;  2XGN A;  2Y74 A;  3FZW A;  3ALA A;  3KZT A;  1W5Z A;  1UI8 A;  1W6C A;  2OTL 3;  2KRT A;  1K28 A;  5JPP A;  4PEJ A;  3LTD A;  2LQV A;  3U97 A;  3Q1C A;  4R80 A;  3CCQ 3;  3JUO A;  2WO0 A;  2BT3 A;  1JNQ A;  4LZI A;  4NHF A;  1N9E A;  1N5H A;  1LXE A;  5AII A;  2E2T A;  3NV0 A;  2RCD A;  3OX9 A;  2OQE A;  2A15 A;  2Z7A A;  1S5A A;  4BTX A;  3MG3 A;  1K9M 4;  3IPT A;  1GS3 A;  3CMA 3;  1ROV A;  2FNQ A;  2MC8 A;  3LOY A;  4WYK A;  2OQE C;  1Q82 4;  4HM8 B;  2LYX A;  3EN1 B;  3LZA A;  2CFW A;  4N6M A;  1NU3 A;  1NWW A;  3B4O A;  3NHX A;  5DRE A;  2PNC A;  1GY7 A;  5IG3 A;  1W00 A;  3DGO A;  1IV7 A;  1SQW A;  4L8O A;  4OUQ A;  1N5P A;  3G8Z A;  3KFQ C;  1NJI 4;  2C10 A;  3S28 A;  1YIT 3;  1JN5 A;  3PS8 A;  4H61 A;  1VQN 3;  5FW5 A;  3CME 3;  2CHC A;  3S27 A;  1QMA A;  3NQY A;  2YFJ B;  1ULI B;  1VQO 3;  3X3Y A;  3G71 3;  1O7W B;  3LTC A;  1MOL A;  3UB1 A;  2BMQ B;  3A76 A;  3AMO B;  1FGT A;  4L8P A;  2XGL A;  3NM2 A;  4KFE A;  2XSO B;  3JUN A;  2CWV A;  4X2O A;  1Y4K A;  5EQL A;  3U1W A;  3CPW 2;  4XBX A;  3FG4 A;  1KQS 2;  3RGR A;  1N8R 4;  3N8B A;  1SPU A;  3V99 A;  1YJN 3;  2W56 B;  3VF1 A;  4EXR A;  1EA2 A;  3EE1 A;  3ER7 A;  1E3R A;  4LEH A;  3WA2 X;  3G4S 3;  1A67 A;  1O7N B;  3CCJ 3;  2CFD A;  1W01 A;  1YVB I;  1K8A 4;  4Q53 A;  4FMB A;  4GL6 A;  1AR0 A;  2W9P A;  3FGY A;  2QEX 3;  2YFI B;  3CD6 3;  4EYC A;  3KKG A;  2I9W A;  3F9S A;  2P0M A;  2GBX B;  1RKY A;  1JB2 A;  4K1U A;  3B7C A;  1IVV A;  1EQK A;  2F86 B;  3CCS 3;  1GD4 A;  5AYR B;  4AKY A;  3KE7 A;  2BO9 B;  1JKG A;  3EF8 A;  1R4C A;  4NRE A;  4U13 A;  4ZM8 A;  3LT8 A;  1A2V A;  2XF3 A;  2O3O A;  3DUK A;  5IER A;  1YIJ 3;  4XDV A;  5EEO A;  3K9M C;  2ZL8 A;  4HZB B;  5D83 A;  4HVN A;  1US1 A;  2JQ5 A;  3MSO A;  1IVW A;  2BMO B;  1OAC A;  2CFK A;  3MG1 A;  3DZL A;  3F40 A;  1JV2 B;  3LXU X;  4HZ9 B;  3OWY A;  2CWU A;  1NB3 I;  5STD A;  3QK9 A;  1QVG 2;  4HM7 B;  3FG3 A;  4FR9 A;  5IEO A;  1IDP A;  3FG1 A;  1S72 3;  4J9A A;  4XB5 A;  1AVK A;  3BNC A;  3N9H A;  2Y73 A;  3MHE A;  4EV2 A;  3SXX A;  3K0Z A;  1WMO A;  3NBR A;  3SED A;  1SJW A;  1TIJ A;  2FXT A;  3OW2 2;  2CK3 H;  1BUQ A;  2P38 A;  2ZDJ A;  1GD3 A;  3EBY A;  4WWU C;  3CCL 3;  2RGQ A;  2BHM A;  4R9L A;  1KWI A;  5AI1 A;  1GY5 A;  2MF7 A;  5A0O B;  1GYB A;  4N6V 0;  3WOD G;  1F8N A;  2WGQ A;  4TX4 A;  1JJ2 2;  1O7P B;  2CG1 A;  2CG0 A;  4AEQ A;  1Q40 A;  4J8T A;  2P05 A;  4MMX B;  4XM4 A;  5AIF A;  1ZX2 A;  3F7X A;  2GEY A;  1OH0 A;  2BNG A;  3CU3 A;  2CC3 A;  2WGO A;  3DMC A;  4RZM A;  1IVU A;  1JB4 A;  1Q42 A;  1STD A;  1DMQ A;  2WOF A;  4HM3 B;  4QWT A;  3S29 A;  3E99 A;  2SBL A;  1GY6 A;  1PU4 A;  1D6U A;  5JBS A;  5IEP A;  2CH9 A;  4R9K A;  1JB5 A;  3H51 A;  3B8L A;  3NM7 A;  1OGX A;  2D42 A;  3EBT A;  1ISK A;  3NV0 B;  1VQ5 3;  5CXO A;  3WOE B;  3WDG B;  1N9J A;  3BNB A;  4CDL A;  3X42 A;  1DVD A;  4N6N B;  3X3X A;  4HKV B;  3PZW A;  5ELJ A;  3G0K A;  3PYJ A;  1M9G A;  4WYK B;  3CPO A;  3ECF A;  1IT7 A;  1Q7Y 4;  1LOX A;  1WQL B;  4KZ1 A;  5CF1 A;  1CYV A;  4X2H A;  1EG9 B;  4N6U A;  2HMO B;  3UL5 A;  1OPY A;  1UUW B;  3MPH A;  4IIA A;  1OGZ A;  3FSD A;  3CXC 2;  4FCZ A;  1IQX A;  3FH1 A;  4HM0 B;  4K90 B;  3KSE D;  1OCV A;  1RRH A;  2QIY A;  1O7G B;  3UL6 A;  1E97 A;  1KSI A;  2F98 A;  1ROA A;  3N54 B;  4N3V A;  4STD A;  3CC4 3;  3CCM 3;  1CYU A;  1M90 4;  3LT9 A;  4HM1 B;  4WFO A;  3TDG A;  1M1X B;  3VSY A;  2OWP A;  2F99 A;  1STF I;  4FCM A;  2GEX A;  5CF2 A;  3CC7 3;  2UX0 A;  1W6G A;  3LH4 A;  2XRX B;  4KVH A;  4HJL B;  2GU3 A;  3MWZ A;  1Z1S A;  5KP4 A;  1NB5 I;  4RNY A;  1K41 A;  2R4I A;  3V98 A;  1LVN A;  2XR8 B;  1WMN A;  3DXO A;  3JVC A;  4N6L A;  5IG4 A;  3DY5 A;  4I4K A;  3KSP A;  3B4P A;  2PZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...