4HKVB

Naphthalene 1,2-dioxygenase bound to benzamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to benzamide
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 58
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hkvB00
2RGQA 3F8HA 5IEPA 5KP1A 3FLJA 2B24B 2JQ5A 4XBXA 1S5AA 2UX0A 4U13A 2GBWB 3FZWA 3EBYA 1ZX2A 4I4KA 3UNLA 1OPYA 3UJMA 2GBXB 5AEUB 3F7SA 4LMIA 5JPPA 2BMQB 1EA2A 1O7PB 4R1KA 3DM8A 1ULJB 2HMLB 1O7WB 1E3RA 3CPOA 4ORLA 4WYKA 3VGNA 3ECFA 5TGNA 2HMOB 4N3VA 1AR0A 1GS3A 3MHEA 5CF1A 4L8PA 3B8LA 3NV0B 3EHCA 4OVMA 4HM2B 5AIHA 2Z77A 1C7HA 4XB5A 4XBTA 3HX8A 3DXOA 1E97A 1QMAA 3DZLA 1UUVB 4FCMA 3NUVA 2BMRB 5IG0A 1Q40A 1GYBA 4KVHA 3F9SA 1HKXA 1Q40B 2XRXB 4OUQA 3MYTA 4HM4B 5DRVA 3JUQA 4GB5A 3HZPA 4XDWA 4FCJA 3OWSA 1OHPA 3H51A 1O7HB 1U5OA 3NHXA 1W6YA 1ISKA 3A76A 3OWUA 3G16A 1O7NB 3EX9A 4LGQA 5BXQA 3I0YA 2GXFA 1OGXA 2HMMB 2QGUA 2F86B 3DMCA 3RGAA 3B4OA 5AIFA 3FKAA 2XSOB 1OUNA 2STDA 5D83A 4HVNA 5AIIA 1W02A 3S5CA 3EBTA 3K7CA 3GZRA 4J9AA 1O7MB 5KP4A 3FGYA 1VZZA 1NDOB 1ASKA 5G2GA 5IG3A 1E3VA 3VSYA 1Q42A 3M8CA 3E99A 3F8XA 4HJLB 4HM1B 5D82A 3MG3A 5HGRA 4Q53A 3FSDA 1JN5A 5DREA 1CQSA 3Q90A 3OXAA 1DMMA 2OWPA 5IF6A 1JN5B 3NV0A 3OWYA 3JUMA 4HZ9B 3IPTA 1JB2A 4R9KA 2QIYA 5KP3A 4IIAA 5BVBA 4K1VA 2IMJA 3FH1A 5IENA 2BNGA 5EVHA 3D9RA 3EC9A 4PEJA 1UUWB 2K54A 3F14A 3RGRA 4HKVB 2R4IA 3DUKA 1SJWA 4HM0B 7STDA 2HMJB 1JB5A 4STDA 3NBRA 3STDA 4X2HA 2GEYA 4CDLA 5CXOA 3LZAA 2A15A 3JUPA 3EN8A 8CHOA 1K41A 2PZVA 1WQLB 2CHCA 4LEHA 1BUQA 3GZBA 3SOAA 2Z76A 2YFLB 2XSHB 1A2KA 3MSOA 3CNXA 5D81A 2F99A 4XBYA 5IG4A 1OF5A 3ER7A 3EN1B 5CK6A 3G0KA 4MJDA 3MG1A 3KE7A 1OF5B 1EG9B 3BB9A 4HM8B 4L7KA 1NWWA 1GY6A 1ULIB 2HMKB 3GWRA 2RCDA 2RFRA 2B1XB 1OCVA 2CKFB 3NXJA 1GY7A 2Z7AA 5IG5A 3EF8A 3FF2A 3BLZA 3EQQB 1DMQA 3T8NA 5AI1A 3NM2A 3OV4A 3G8ZA 3JUOA 4J8TA 4H3UA 1NU3A 5JPUA 4X2OA 5AEWB 3ROBA 3MG2A 2W2CA 5STDA 1OHOA 3B4PA 2YFIB 1O7GB 4HM5B 3KZTA 2YFJB 3F40A 4WYKB 4HM7B 1TP6A 3T8UA 3GZXB 2INXA 3CU3A 3MKIA 4HM6B 5FW5A 1DMNA 3GRDA 4K1UA 1GY5A 1JB4A 6STDA 1OH0A 2F98A 1IDPA 3FF0A 4WP5A 1OHSA 2I9WA 3KSPA 3K0ZA 1JKGA 5CLKA 3CNMA 1W00A 3JUNA 4HZBB 3EJVA 3H3HA 4HM3B 4RZMA 4XDVA 1STDA 2GEXA 4L8OA 1JKGB 2HMNB 3GZYB 1TUHA 1Z1SA 3HK4A 5AIGA 4XM4A 2BMOB 5IEOA 3WMDA 5CF2A 1QJGA 2XR8B 1W01A 1ZO2A 3KKGA 4R9LA 4WWUC 3F7XA 5IERA 3B7CA 3SEDA 3OX9A 3LYGA 1OGZA 3SOYA
chains in the Genus database with same CATH superfamily
2E2TA 3N9HA 3V99A 1A2VA 1BNIA 3GSPA 1VQM3 4N6V0 1T2HA 2RGQA 3F8HA 5IEPA 5KP1A 3CC73 1JNQA 3CMA3 1D6YA 1LQMB 2WO0A 1STFI 3FLJA 2B24B 2JQ5A 4KZ1A 3PCRA 2KCDA 4XBXA 1S5AA 2UX0A 1G02A 4U13A 1X1WA 2XH9A 1W6CA 2GBWB 4HOHA 3BU4A 2H0IA 3LMLA 5FGOA 3FZWA 1GOUA 4MEIA 3O8YA 3VF1A 1VQL3 5LC7A 3EBYA 1ZX2A 4I4KA 3UNLA 1OPYA 2KF3A 3UJMA 1VQN3 2GBXB 5AEUB 1YVSA 3AHWA 3UL5A 2YX9A 1LOYA 1N8QA 3F7SA 3KFQC 1QVF2 1TRPA 3GAXA 4LMIA 1RRHA 2IUKA 4KFEA 2IUJA 3PXMA 1RTUA 1SPUA 3AGNA 5JPPA 1B21A 2BMQB 1EA2A 1O7PB 3MPHA 4LYLB 3RNTA 3IJEB 1AVLA 2CFGA 1IV7A 4R1KA 3DM8A 1ULJB 2ZL8A 2HMLB 4HBRA 1BGSA 1O7WB 1GMPA 1WMOA 2LQVA 1E3RA 1I2EA 1MWRA 1LOXA 1MWSA 1VQQA 3CPOA 4ORLA 1KD14 2H0HA 5AYSC 4WYKA 2CK3H 3NX0A 3VGNA 1AV4A 1BSDA 3ECFA 1LOWA 1BANA 1LXEA 1QAFA 1T3BA 5BU4A 1KQS2 3CC23 2CX0A 1D6ZA 5TGNA 4EV2A 7GSPA 5M18A 2HMOB 1CH0A 3CD63 4N3VA 1TTOA 2CG1A 2IYJA 4AEQA 1B27A 1AR0A 1BRSA 1GS3A 2GU3A 3MHEA 3KN4A 1ZS7A 3RDEA 1FGQA 4EC6A 3KCHA 3BNDA 1S723 3DGYA 6RNTA 1BNGA 3DGLA 3WR2A 1JBRA 1BRIA 4EXRA 1UI8A 2P0XA 3QRDA 4K61A 4NPBA 5CF1A 1LRAA 2C10A 3Q2PA 4L8PA 2RBIA 3IMAB 4MMZB 3B8LA 3NV0B 3EHCA 4OVMA 3G713 3V92A 3CCL3 1BNEA 4HM2B 2H0GA 1YVBI 5AIHA 1IVWA 1R4YA 2W04A 1YJ93 2Z77A 3ZFZA 1C7HA 1US1A 2E2VA 1SIHA 1IV9A 4XB5A 4RNTA 4XBTA 1LOVA 1FUTA 3HX8A 5A0OB 3DXOA 1E97A 3PZWA 1BVIA 1PY3A 1QMAA 1UCJA 1BAOA 3DZLA 1UUVB 1W4NA 3I553 1FGOA 4FCMA 3NUVA 1IU7A 2BMRB 5IG0A 1FZUA 1Q40A 3SLUA 4HYZA 1GYBA 4KVHA 4ILFA 2UGIA 4FCZA 3S29A 1TRQA 3F9SA 4MMXB 3G6E3 1NNVA 4JRFA 4GSPA 1RGCA 1RN1A 1NB5I 1HKXA 1LNHA 3D5GA 3EB8A 1Q40B 1JZDA 1RMSA 2MF7A 4R80A 2XRXB 4OUQA 3MYTA 3OW22 1U8CB 4RNYA 1B2SA 3PGBA 4HM4B 1Y4KA 2W9QA 1K734 1GSPA 2P05A 5DRVA 1N9EA 2W03A 3JUQA 4GB5A 1W7CA 3HZPA 2K0MA 4XDWA 4FCJA 3OWSA 3BNEA 1RGAA 1OHPA 3H51A 1O7HB 1U5OA 1I3FA 1W6YA 1IQXA 3NHXA 3X3XA 2OTJ3 3DH2A 1ISKA 3A76A 2MC8A 3CCE3 5ELJA 1M9GA 3OWUA 3CXC2 4BTXA 1BRKA 4JF8A 1GOYA 4CCVA 2R41A 5EQLA 3G16A 1PFPA 1O7NB 3CPW2 3EX9A 4LGQA 2JDIH 5BXQA 1YIT3 4GL6A 2WOFA 3I0YA 2FNQA 3Q3FA 1BU4A 3QK9A 1RJOA 1M1K4 2GXFA 2XFSA 1OGXA 2Q07A 2HMMB 2QGUA 2F86B 3DMCA 4N6MA 1YJN3 3WODG 3X42A 3RGAA 3B4OA 1BNRA 5AIFA 2IY2A 3G4S3 3LXUX 5EEOA 3FKAA 1ROAA 1BRGA 3I563 2XSOB 5JBSA 1OUNA 1RDSA 1TIJA 2CFDA 2STDA 1IVXA 5D83A 1SIIA 2FGTA 4HVNA 2CW9A 2O3OA 5AIIA 2WOHA 1JZOA 2CFKA 1W02A 2ZHXB 3S5CA 1TFKA 3WOFB 4BL3A 2CH9A 1RCLA 3EBTA 3K7CA 1B3SA 3GZRA 4J9AA 1O7MB 5KP4A 1K8A4 1IVVA 3FGYA 1VZZA 1NDOB 4HAAA 1YGEA 2KF4A 1ASKA 2CG0A 5G2GA 2CX1A 4N6LA 4AKZA 4AKYA 2AADA 5IG3A 1E3VA 3LTBA 4N6TA 1X1XA 3VSYA 1Q42A 1RCKA 1NO3A 3M8CA 3ALAA 3E99A 1C54A 1YIJ3 1BOXA 1BRNL 5I97A 4TX4A 2WGQA 1BNJA 1BRHA 3F8XA 1RGLA 3FCSB 4HJLB 4HM1B 2BO9B 5D82A 3MG3A 5HGRA 1BNSA 2ML6A 4Q53A 2IA7A 3TDGA 3LH4A 3FSDA 1DVCA 1BRJA 1JN5A 3FG3A 1V58A 2OTL3 3LTCA 3WHOA 5DREA 1CQSA 3Q90A 1V57A 3OXAA 1ROVA 4N6OB 3CCR3 3J7Yd 1DMMA 2OWPA 5IF6A 1JN5B 3NV0A 3S27A 3Q1CA 1IK3A 3OWYA 4BU4A 1HU9A 3KSED 3JUMA 1X1YA 3D4AA 3LOYA 4KFDA 1K28A 4EBGA 1GMQA 2CFLA 2ZA4A 1F8NA 1MGWA 1JB2A 3IPTA 2QIYA 4HZ9B 4R9KA 5KP3A 4EW5A 2SARA 1B20A 1RGGA 2CWTA 1BNFA 1DETA 2Y73A 4IIAA 5BVBA 4K1VA 1OACA 2IMJA 5AYRB 1WMNA 6GSPA 1YNVX 1M904 5G1LA 1UGHI 3CCV3 1VQ93 1BIRA 3FH1A 3CCQ3 5IENA 3CCU3 1B2UA 4J5GA 2BNGA 4OK0A 5EVHA 3SXXA 3D9RA 4RNZA 4FMDA 2F56A 3EC9A 1NB3I 2KAAA 1VQ53 4PEJA 1DVDA 1I0VA 1V74A 1UUWB 1WMPA 2D1WA 3N54B 5HOHA 1RGEA 1JV2B 4WFOA 1UCIA 3UB1A 1VQ73 2K54A 1T2IA 3F14A 3N8BA 3RGRA 4HKVB 1ZGXA 2R4IA 3LTAA 3UL6A 1RLSA 1SARA 2HOHA 1EEJA 1G0TA 2BIRA 3DUKA 1IYYA 3FG1A 1SJWA 4HM0B 7STDA 1FGMA 3V98A 1IVUA 2HMJB 3AHSA 3BIRA 1JB5A 1HYFA 4STDA 1I70A 3NBRA 3STDA 3HI7A 4X2HA 3CME3 1VQ43 1WNHA 2GEYA 3PYJA 1RHLA 3PS8A 5CXOA 3S67A 4CDLA 3LZAA 3D3LA 1T5YA 1DYUA 2GU1A 5RNTA 2A15A 1X1UA 3AMOA 3JUPA 4IT7A 4J5KA 1RNBA 1LVNA 2Y74A 1G96A 1RN7A 4H61A 1D6UA 1B2MA 2OOVC 4R4KA 4IPBA 5GSPA 1UI7A 3EN8A 2L1SA 8CHOA 1K41A 2PZVA 1WQLB 2CHCA 4DKIA 4LEHA 3CCJ3 1FUWA 3AMOB 4O02B 3FG4A 1BUQA 2LYXA 3GZBA 3SOAA 2J8XB 2Z76A 2YFLB 2XSHB 1A2KA 8RNTA 2P09A 2QEX3 3MSOA 2Z6BA 3CNXA 3NM7A 4NREA 1VQO3 3KIIA 5D81A 3MWZA 1SQWA 1UCLA 2F99A 4K90B 3X3YA 1FUSA 4XBYA 5IG4A 1OF5A 2CIUA 3ER7A 3LT9A 3NQYA 3X41A 5ELUA 1I0XA 2SBLA 3HIGA 1QVG2 5BIRA 2RNTA 2PNCA 3EN1B 5CK6A 4GHOA 3G0KA 1IT8A 4MJDA 4LSOA 3SYUA 1UGIA 4RBNA 3MG1A 3KE7A 2KXGA 1OF5B 1EG9B 3BB9A 3A5EA 1IQYA 4BL2A 4CPKA 4HM8B 4L7KA 2P38A 4FMAA 1A2PA 3CCM3 2XEPA 3BNCA 1NWWA 1MNLA 2ZDJA 1GY6A 1ULIB 1LNIA 2HMKB 3GWRA 4G1MB 1VQ63 2RCDA 3HIIA 1KSIA 2RFRA 1OCVA 2B1XB 1Q7Y4 1UUGB 2CWUA 1W2B2 2D42A 1FGRA 3D5IA 5IW9A 2CKFB 2F4YA 1BUJA 3T0UA 3NXJA 1Q7HA 5M1AA 4MMYB 1A67A 1GY7A 1RRLA 2Z7AA 3NBBA 5IG5A 3EF8A 1AQZA 4I5QA 3FF2A 2XGNA 3BLZA 1IT7A 4O8SA 1VQ83 3CC43 3EQQB 4KT3B 1DMQA 3S28A 3T8NA 5AI1A 2OQEC 1Q814 1QAKA 3DGOA 2V1LA 4O2HA 3NM2A 3OV4A 3G8ZA 3JUOA 4J8TA 1YJW3 4FMCA 2P0MA 3D79A 1JBTA 1LQGC 4FR9A 1UW1A 3NBJA 4H3UA 3ZG0A 3AGOA 1NU3A 1TFOA 5LC6A 5JPUA 3K5TA 3BNBA 4X2OA 4NHFA 5AEWB 7RNTA 3ROBA 1BSAA 1R4CA 3MG2A 2W2CA 1AVKA 3X40A 1B2ZA 1EKMA 2CWVA 5STDA 1OHOA 4FMBA 2UUGC 1DE3A 3B4PA 1JRQA 4N6UA 3CCS3 1NJI4 2AAEA 2WGOA 1K9M4 2YFIB 4KFFA 1W6GA 3U97A 1W5ZA 1O7GB 9RNTA 1UDII 1B2XA 2W0QA 4HM5B 4LZIA 4CJNA 2RSXA 3DGNA 4O3VA 2K3DA 1BSCA 3KZTA 2XF3A 2YFJB 3F40A 1CEWI 1FGTA 1L5GB 2BHMA 1WTHA 4WYKB 4EYCA 3SVAA 2F5MA 1N5HA 4HM7B 1TP6A 3T8UA 1BSEA 3GZXB 4BTWA 2INXA 3CU3A 3JVCA 3MKIA 1RGFA 1GD3A 1GMRA 3ZG5A 4HM6B 1TJDA 5FW5A 2F5WA 1N8R4 2O9UX 1DMNA 2W6JH 3GRDA 1W2ZA 3K9MC 1I2FA 4K1UA 3WOEB 3K63A 1GD4A 5M19A 1GY5A 1MWTA 3WA3A 1JB4A 2KF5A 6STDA 2OOVA 3WA2X 1OH0A 2ML5A 1I3IA 1RNTA 1AY7A 2F98A 1JJ22 3PCSA 1IDPA 1VQP3 3FF0A 1IQ8A 1KWIA 1YI23 4EV5A 1KC84 3X3ZA 4WP5A 1OHSA 2W56A 2I9WA 3URPA 3KSPA 1PU4A 1FA3A 3K0ZA 1JKGA 5CLKA 5G1KA 1YGWA 3CNMA 1N5PA 1W00A 2BT3A 2XFTA 3JUNA 3EJVA 4HZBB 1VQK3 1Q864 2BU4A 3H3HA 4HM3B 4RZMA 1FW7A 4XDVA 1N9JA 1STDA 1EUIC 1UCKA 2GEXA 1QALA 2W56B 4L8OA 1RN4A 3LT8A 1JKGB 3EE1A 1M1XB 3L0RA 3HOHA 1MOLA 2HMNB 3GZYB 1TUHA 1A90A 2KRTA 1RGHA 1Z1SA 2C11A 1RSNA 3HK4A 2L4VA 2CFWA 5AIGA 2QA43 4XM4A 1Q9EA 3DGMA 1JBSA 3SX1A 4ZM8A 2BMOB 5IEOA 1RGKA 4QWTA 3WMDA 1MWUA 1I8VA 2CC3A 5CF2A 1QJGA 2XR8B 1EQKA 3LTDA 1HZ1A 2C4BA 3NQZA 1W01A 1ZO2A 1Q824 3KKGA 1FYSA 4R9LA 4WWUC 3F7XA 5IERA 1TU5A 1MGRA 4N6NB 1CYUA 3B7CA 3SEDA 4WHAA 4BIRA 2GSPA 2FXTA 1J2BA 1BSBA 1I2GA 3OX9A 1CYVA 2XGLA 2W9PA 3LYGA 1PYLA 3WDGB 1YHQ3 1OGZA 1GOVA 2KF6A 3DY5A 3U1WA 3SOYA 4BTYA 2OCTA 1RKYA 2OQEA 2E2UA 2M7OA
chains in the Genus database with same CATH topology
2E2TA 3N9HA 3V99A 1A2VA 1VQM3 4N6V0 2RGQA 3F8HA 5IEPA 5KP1A 3CC73 1JNQA 3CMA3 1D6YA 2WO0A 1STFI 3FLJA 2B24B 2JQ5A 4KZ1A 3PCRA 2KCDA 4XBXA 1S5AA 2UX0A 4U13A 2XH9A 1W6CA 2GBWB 3LMLA 5FGOA 3FZWA 4MEIA 3O8YA 3VF1A 1VQL3 5LC7A 3EBYA 1ZX2A 4I4KA 3UNLA 1OPYA 3UJMA 1VQN3 2GBXB 5AEUB 3UL5A 2YX9A 1N8QA 3F7SA 3KFQC 1QVF2 3GAXA 4LMIA 1RRHA 2IUKA 4KFEA 2IUJA 3PXMA 1SPUA 5JPPA 2BMQB 1EA2A 1O7PB 3MPHA 3IJEB 1AVLA 2CFGA 1IV7A 4R1KA 3DM8A 1ULJB 2ZL8A 2HMLB 4HBRA 1O7WB 1WMOA 2LQVA 1E3RA 1LOXA 3CPOA 4ORLA 1KD14 5AYSC 4WYKA 2CK3H 3NX0A 3VGNA 1AV4A 3ECFA 1KQS2 1LXEA 1QAFA 3CC23 5TGNA 1D6ZA 4EV2A 2HMOB 3CD63 4N3VA 2CG1A 4AEQA 1AR0A 1GS3A 2GU3A 3MHEA 3KN4A 3RDEA 1FGQA 4EC6A 3BNDA 1S723 3DGLA 4EXRA 1UI8A 2P0XA 3QRDA 4K61A 5CF1A 4L8PA 2C10A 3Q2PA 4MMZB 3IMAB 3B8LA 3NV0B 3EHCA 4OVMA 3G713 3V92A 3CCL3 4HM2B 1YVBI 5AIHA 1IVWA 2W04A 1YJ93 2Z77A 1C7HA 1US1A 2E2VA 1SIHA 1IV9A 4XB5A 4XBTA 5A0OB 3HX8A 3DXOA 1E97A 3PZWA 1QMAA 3DZLA 1UUVB 1W4NA 3I553 1FGOA 4FCMA 3NUVA 1IU7A 2BMRB 5IG0A 1Q40A 3SLUA 4HYZA 1GYBA 4KVHA 4FCZA 3S29A 3F9SA 4MMXB 3G6E3 4JRFA 1NB5I 1HKXA 1LNHA 3EB8A 1Q40B 2MF7A 4R80A 2XRXB 4OUQA 3MYTA 3OW22 1U8CB 4RNYA 3PGBA 4HM4B 1Y4KA 2W9QA 1K734 2P05A 5DRVA 1N9EA 2W03A 3JUQA 4GB5A 1W7CA 3HZPA 2K0MA 4XDWA 4FCJA 3OWSA 3BNEA 1OHPA 3H51A 1O7HB 1U5OA 3NHXA 1W6YA 1IQXA 3X3XA 2OTJ3 1ISKA 3A76A 2MC8A 3CCE3 5ELJA 1M9GA 3OWUA 3CXC2 4BTXA 4JF8A 4CCVA 5EQLA 3G16A 1PFPA 1O7NB 3CPW2 3EX9A 4LGQA 2JDIH 5BXQA 1YIT3 4GL6A 2WOFA 3I0YA 2FNQA 3QK9A 1RJOA 1M1K4 2GXFA 2XFSA 1OGXA 2Q07A 2HMMB 2QGUA 2F86B 3DMCA 4N6MA 1YJN3 3WODG 3X42A 3RGAA 3B4OA 5AIFA 3G4S3 3LXUX 5EEOA 3FKAA 1ROAA 3I563 2XSOB 5JBSA 1OUNA 2STDA 1TIJA 2CFDA 3CCU3 1IVXA 5D83A 1SIIA 2FGTA 4HVNA 2CW9A 2O3OA 5AIIA 2WOHA 2CFKA 1W02A 3S5CA 1TFKA 3WOFB 2CH9A 3EBTA 3K7CA 3GZRA 4J9AA 1O7MB 5KP4A 1K8A4 1IVVA 3FGYA 1VZZA 1NDOB 1YGEA 1ASKA 2CG0A 5G2GA 4N6LA 4AKZA 4AKYA 5IG3A 1E3VA 3LTBA 4N6TA 3VSYA 1Q42A 3M8CA 1NO3A 3ALAA 3E99A 1YIJ3 5I97A 4TX4A 2WGQA 3F8XA 3FCSB 4HJLB 4HM1B 2BO9B 5D82A 3MG3A 5HGRA 2ML6A 4Q53A 2IA7A 3TDGA 3LH4A 3FSDA 1DVCA 1JN5A 3FG3A 2OTL3 3LTCA 5DREA 1CQSA 3Q90A 3OXAA 1ROVA 4N6OB 3CCR3 3J7Yd 1DMMA 2OWPA 5IF6A 1JN5B 3NV0A 3S27A 3Q1CA 1IK3A 3OWYA 1HU9A 3KSED 3JUMA 3LOYA 4KFDA 1K28A 4EBGA 2CFLA 1F8NA 3IPTA 1JB2A 4HZ9B 2QIYA 4R9KA 5KP3A 4IIAA 2CWTA 2Y73A 5BVBA 4K1VA 1OACA 2IMJA 5AYRB 1WMNA 1M904 3CCV3 1VQ93 3FH1A 3CCQ3 5IENA 2BNGA 4OK0A 5EVHA 3SXXA 3D9RA 4RNZA 4FMDA 3EC9A 1NB3I 1VQ53 4PEJA 1DVDA 1V74A 1WMPA 1UUWB 2D1WA 3N54B 1JV2B 4WFOA 3UB1A 1VQ73 2K54A 3F14A 3N8BA 3RGRA 4HKVB 2R4IA 3LTAA 3UL6A 3DUKA 3FG1A 1SJWA 4HM0B 7STDA 1FGMA 3V98A 1IVUA 2HMJB 1JB5A 4STDA 3NBRA 3STDA 3HI7A 4X2HA 3CME3 1VQ43 1WNHA 2GEYA 3PYJA 3PS8A 5CXOA 3S67A 4CDLA 3LZAA 3D3LA 1T5YA 1DYUA 2GU1A 2A15A 3AMOA 3JUPA 4IT7A 1LVNA 2Y74A 1G96A 1RN7A 4H61A 1D6UA 2OOVC 4R4KA 4IPBA 1UI7A 3EN8A 8CHOA 1K41A 2PZVA 1WQLB 2CHCA 3CCJ3 4LEHA 1FUWA 3AMOB 4O02B 3FG4A 1BUQA 2LYXA 3GZBA 3SOAA 2Z76A 2YFLB 2XSHB 1A2KA 2P09A 2QEX3 3MSOA 2Z6BA 3CNXA 3NM7A 4NREA 1VQO3 3KIIA 5D81A 3MWZA 1SQWA 2F99A 4K90B 3X3YA 4XBYA 5IG4A 1OF5A 2CIUA 3ER7A 3LT9A 3NQYA 3X41A 5ELUA 2SBLA 3HIGA 1QVG2 2PNCA 3EN1B 5CK6A 3G0KA 1IT8A 4MJDA 4LSOA 4RBNA 3MG1A 3KE7A 2KXGA 1OF5B 1EG9B 3BB9A 1IQYA 4HM8B 4L7KA 2P38A 4FMAA 3CCM3 2XEPA 3BNCA 1NWWA 1MNLA 2ZDJA 1GY6A 1ULIB 2HMKB 3GWRA 4G1MB 1VQ63 2RCDA 3HIIA 1KSIA 2RFRA 1OCVA 2B1XB 1Q7Y4 2CWUA 1W2B2 2D42A 1FGRA 5IW9A 2CKFB 3T0UA 3NXJA 4MMYB 1A67A 1GY7A 1RRLA 2Z7AA 3NBBA 5IG5A 3EF8A 3FF2A 2XGNA 3BLZA 1IT7A 4O8SA 1VQ83 3CC43 3EQQB 1DMQA 3S28A 3T8NA 5AI1A 2OQEC 1Q814 1QAKA 3DGOA 2V1LA 4O2HA 3NM2A 3OV4A 3G8ZA 3JUOA 4J8TA 1YJW3 4FMCA 2P0MA 4FR9A 1UW1A 3NBJA 4H3UA 1NU3A 1TFOA 5LC6A 5JPUA 3K5TA 3BNBA 4X2OA 4NHFA 5AEWB 3ROBA 1R4CA 3MG2A 2W2CA 1AVKA 3X40A 1EKMA 2CWVA 5STDA 1OHOA 4FMBA 3B4PA 1JRQA 4N6UA 3CCS3 1NJI4 2WGOA 1K9M4 2YFIB 4KFFA 1W6GA 3U97A 1W5ZA 1O7GB 2W0QA 4HM5B 4LZIA 2RSXA 3DGNA 4O3VA 3KZTA 2XF3A 2YFJB 3F40A 1CEWI 1FGTA 1L5GB 2BHMA 1WTHA 4WYKB 4EYCA 3SVAA 1N5HA 4HM7B 1TP6A 3T8UA 4BTWA 3GZXB 2INXA 3CU3A 3JVCA 3MKIA 1GD3A 4HM6B 5FW5A 1N8R4 2O9UX 1DMNA 2W6JH 3GRDA 1W2ZA 3K9MC 4K1UA 3WOEB 3K63A 1GD4A 1GY5A 3WA3A 1JB4A 6STDA 2OOVA 3WA2X 1OH0A 2ML5A 2F98A 1JJ22 3PCSA 1IDPA 1VQP3 3FF0A 1IQ8A 1KWIA 1YI23 4EV5A 1KC84 3X3ZA 4WP5A 1OHSA 2W56A 2I9WA 3KSPA 1PU4A 1FA3A 3K0ZA 1JKGA 5CLKA 3CNMA 1N5PA 1W00A 2BT3A 2XFTA 3JUNA 3EJVA 4HZBB 1VQK3 1Q864 3H3HA 4HM3B 4RZMA 4XDVA 1N9JA 1STDA 2W56B 2GEXA 1QALA 4L8OA 3LT8A 1JKGB 3EE1A 1M1XB 3L0RA 1MOLA 2HMNB 3GZYB 1TUHA 1A90A 2KRTA 1Z1SA 2C11A 3HK4A 2L4VA 2CFWA 5AIGA 2QA43 4XM4A 3DGMA 3SX1A 4ZM8A 2BMOB 5IEOA 4QWTA 3WMDA 2CC3A 5CF2A 1QJGA 2XR8B 1EQKA 3LTDA 3NQZA 1W01A 1ZO2A 1Q824 3KKGA 4R9LA 4WWUC 3F7XA 5IERA 1TU5A 4N6NB 1CYUA 3B7CA 3SEDA 4WHAA 2FXTA 1J2BA 3OX9A 1CYVA 2XGLA 2W9PA 3LYGA 3WDGB 1YHQ3 1OGZA 3U1WA 3DY5A 3SOYA 4BTYA 2OCTA 1RKYA 2OQEA 2E2UA 2M7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGQ A;  3F8H A;  5IEP A;  5KP1 A;  3FLJ A;  2B24 B;  2JQ5 A;  4XBX A;  1S5A A;  2UX0 A;  4U13 A;  2GBW B;  3FZW A;  3EBY A;  1ZX2 A;  4I4K A;  3UNL A;  1OPY A;  3UJM A;  2GBX B;  5AEU B;  3F7S A;  4LMI A;  5JPP A;  2BMQ B;  1EA2 A;  1O7P B;  4R1K A;  3DM8 A;  1ULJ B;  2HML B;  1O7W B;  1E3R A;  3CPO A;  4ORL A;  4WYK A;  3VGN A;  3ECF A;  5TGN A;  2HMO B;  4N3V A;  1AR0 A;  1GS3 A;  3MHE A;  5CF1 A;  4L8P A;  3B8L A;  3NV0 B;  3EHC A;  4OVM A;  4HM2 B;  5AIH A;  2Z77 A;  1C7H A;  4XB5 A;  4XBT A;  3HX8 A;  3DXO A;  1E97 A;  1QMA A;  3DZL A;  1UUV B;  4FCM A;  3NUV A;  2BMR B;  5IG0 A;  1Q40 A;  1GYB A;  4KVH A;  3F9S A;  1HKX A;  1Q40 B;  2XRX B;  4OUQ A;  3MYT A;  4HM4 B;  5DRV A;  3JUQ A;  4GB5 A;  3HZP A;  4XDW A;  4FCJ A;  3OWS A;  1OHP A;  3H51 A;  1O7H B;  1U5O A;  3NHX A;  1W6Y A;  1ISK A;  3A76 A;  3OWU A;  3G16 A;  1O7N B;  3EX9 A;  4LGQ A;  5BXQ A;  3I0Y A;  2GXF A;  1OGX A;  2HMM B;  2QGU A;  2F86 B;  3DMC A;  3RGA A;  3B4O A;  5AIF A;  3FKA A;  2XSO B;  1OUN A;  2STD A;  5D83 A;  4HVN A;  5AII A;  1W02 A;  3S5C A;  3EBT A;  3K7C A;  3GZR A;  4J9A A;  1O7M B;  5KP4 A;  3FGY A;  1VZZ A;  1NDO B;  1ASK A;  5G2G A;  5IG3 A;  1E3V A;  3VSY A;  1Q42 A;  3M8C A;  3E99 A;  3F8X A;  4HJL B;  4HM1 B;  5D82 A;  3MG3 A;  5HGR A;  4Q53 A;  3FSD A;  1JN5 A;  5DRE A;  1CQS A;  3Q90 A;  3OXA A;  1DMM A;  2OWP A;  5IF6 A;  1JN5 B;  3NV0 A;  3OWY A;  3JUM A;  4HZ9 B;  3IPT A;  1JB2 A;  4R9K A;  2QIY A;  5KP3 A;  4IIA A;  5BVB A;  4K1V A;  2IMJ A;  3FH1 A;  5IEN A;  2BNG A;  5EVH A;  3D9R A;  3EC9 A;  4PEJ A;  1UUW B;  2K54 A;  3F14 A;  3RGR A;  4HKV B;  2R4I A;  3DUK A;  1SJW A;  4HM0 B;  7STD A;  2HMJ B;  1JB5 A;  4STD A;  3NBR A;  3STD A;  4X2H A;  2GEY A;  4CDL A;  5CXO A;  3LZA A;  2A15 A;  3JUP A;  3EN8 A;  8CHO A;  1K41 A;  2PZV A;  1WQL B;  2CHC A;  4LEH A;  1BUQ A;  3GZB A;  3SOA A;  2Z76 A;  2YFL B;  2XSH B;  1A2K A;  3MSO A;  3CNX A;  5D81 A;  2F99 A;  4XBY A;  5IG4 A;  1OF5 A;  3ER7 A;  3EN1 B;  5CK6 A;  3G0K A;  4MJD A;  3MG1 A;  3KE7 A;  1OF5 B;  1EG9 B;  3BB9 A;  4HM8 B;  4L7K A;  1NWW A;  1GY6 A;  1ULI B;  2HMK B;  3GWR A;  2RCD A;  2RFR A;  2B1X B;  1OCV A;  2CKF B;  3NXJ A;  1GY7 A;  2Z7A A;  5IG5 A;  3EF8 A;  3FF2 A;  3BLZ A;  3EQQ B;  1DMQ A;  3T8N A;  5AI1 A;  3NM2 A;  3OV4 A;  3G8Z A;  3JUO A;  4J8T A;  4H3U A;  1NU3 A;  5JPU A;  4X2O A;  5AEW B;  3ROB A;  3MG2 A;  2W2C A;  5STD A;  1OHO A;  3B4P A;  2YFI B;  1O7G B;  4HM5 B;  3KZT A;  2YFJ B;  3F40 A;  4WYK B;  4HM7 B;  1TP6 A;  3T8U A;  3GZX B;  2INX A;  3CU3 A;  3MKI A;  4HM6 B;  5FW5 A;  1DMN A;  3GRD A;  4K1U A;  1GY5 A;  1JB4 A;  6STD A;  1OH0 A;  2F98 A;  1IDP A;  3FF0 A;  4WP5 A;  1OHS A;  2I9W A;  3KSP A;  3K0Z A;  1JKG A;  5CLK A;  3CNM A;  1W00 A;  3JUN A;  4HZB B;  3EJV A;  3H3H A;  4HM3 B;  4RZM A;  4XDV A;  1STD A;  2GEX A;  4L8O A;  1JKG B;  2HMN B;  3GZY B;  1TUH A;  1Z1S A;  3HK4 A;  5AIG A;  4XM4 A;  2BMO B;  5IEO A;  3WMD A;  5CF2 A;  1QJG A;  2XR8 B;  1W01 A;  1ZO2 A;  3KKG A;  4R9L A;  4WWU C;  3F7X A;  5IER A;  3B7C A;  3SED A;  3OX9 A;  3LYG A;  1OGZ A;  3SOY A; 
#chains in the Genus database with same CATH topology
 2E2T A;  3N9H A;  3V99 A;  1A2V A;  1BNI A;  3GSP A;  1VQM 3;  4N6V 0;  1T2H A;  2RGQ A;  3F8H A;  5IEP A;  5KP1 A;  3CC7 3;  1JNQ A;  3CMA 3;  1D6Y A;  1LQM B;  2WO0 A;  1STF I;  3FLJ A;  2B24 B;  2JQ5 A;  4KZ1 A;  3PCR A;  2KCD A;  4XBX A;  1S5A A;  2UX0 A;  1G02 A;  4U13 A;  1X1W A;  2XH9 A;  1W6C A;  2GBW B;  4HOH A;  3BU4 A;  2H0I A;  3LML A;  5FGO A;  3FZW A;  1GOU A;  4MEI A;  3O8Y A;  3VF1 A;  1VQL 3;  5LC7 A;  3EBY A;  1ZX2 A;  4I4K A;  3UNL A;  1OPY A;  2KF3 A;  3UJM A;  1VQN 3;  2GBX B;  5AEU B;  1YVS A;  3AHW A;  3UL5 A;  2YX9 A;  1LOY A;  1N8Q A;  3F7S A;  3KFQ C;  1QVF 2;  1TRP A;  3GAX A;  4LMI A;  1RRH A;  2IUK A;  4KFE A;  2IUJ A;  3PXM A;  1RTU A;  1SPU A;  3AGN A;  5JPP A;  1B21 A;  2BMQ B;  1EA2 A;  1O7P B;  3MPH A;  4LYL B;  3RNT A;  3IJE B;  1AVL A;  2CFG A;  1IV7 A;  4R1K A;  3DM8 A;  1ULJ B;  2ZL8 A;  2HML B;  4HBR A;  1BGS A;  1O7W B;  1GMP A;  1WMO A;  2LQV A;  1E3R A;  1I2E A;  1MWR A;  1LOX A;  1MWS A;  1VQQ A;  3CPO A;  4ORL A;  1KD1 4;  2H0H A;  5AYS C;  4WYK A;  2CK3 H;  3NX0 A;  3VGN A;  1AV4 A;  1BSD A;  3ECF A;  1LOW A;  1BAN A;  1LXE A;  1QAF A;  1T3B A;  5BU4 A;  1KQS 2;  3CC2 3;  2CX0 A;  1D6Z A;  5TGN A;  4EV2 A;  7GSP A;  5M18 A;  2HMO B;  1CH0 A;  3CD6 3;  4N3V A;  1TTO A;  2CG1 A;  2IYJ A;  4AEQ A;  1B27 A;  1AR0 A;  1BRS A;  1GS3 A;  2GU3 A;  3MHE A;  3KN4 A;  1ZS7 A;  3RDE A;  1FGQ A;  4EC6 A;  3KCH A;  3BND A;  1S72 3;  3DGY A;  6RNT A;  1BNG A;  3DGL A;  3WR2 A;  1JBR A;  1BRI A;  4EXR A;  1UI8 A;  2P0X A;  3QRD A;  4K61 A;  4NPB A;  5CF1 A;  1LRA A;  2C10 A;  3Q2P A;  4L8P A;  2RBI A;  3IMA B;  4MMZ B;  3B8L A;  3NV0 B;  3EHC A;  4OVM A;  3G71 3;  3V92 A;  3CCL 3;  1BNE A;  4HM2 B;  2H0G A;  1YVB I;  5AIH A;  1IVW A;  1R4Y A;  2W04 A;  1YJ9 3;  2Z77 A;  3ZFZ A;  1C7H A;  1US1 A;  2E2V A;  1SIH A;  1IV9 A;  4XB5 A;  4RNT A;  4XBT A;  1LOV A;  1FUT A;  3HX8 A;  5A0O B;  3DXO A;  1E97 A;  3PZW A;  1BVI A;  1PY3 A;  1QMA A;  1UCJ A;  1BAO A;  3DZL A;  1UUV B;  1W4N A;  3I55 3;  1FGO A;  4FCM A;  3NUV A;  1IU7 A;  2BMR B;  5IG0 A;  1FZU A;  1Q40 A;  3SLU A;  4HYZ A;  1GYB A;  4KVH A;  4ILF A;  2UGI A;  4FCZ A;  3S29 A;  1TRQ A;  3F9S A;  4MMX B;  3G6E 3;  1NNV A;  4JRF A;  4GSP A;  1RGC A;  1RN1 A;  1NB5 I;  1HKX A;  1LNH A;  3D5G A;  3EB8 A;  1Q40 B;  1JZD A;  1RMS A;  2MF7 A;  4R80 A;  2XRX B;  4OUQ A;  3MYT A;  3OW2 2;  1U8C B;  4RNY A;  1B2S A;  3PGB A;  4HM4 B;  1Y4K A;  2W9Q A;  1K73 4;  1GSP A;  2P05 A;  5DRV A;  1N9E A;  2W03 A;  3JUQ A;  4GB5 A;  1W7C A;  3HZP A;  2K0M A;  4XDW A;  4FCJ A;  3OWS A;  3BNE A;  1RGA A;  1OHP A;  3H51 A;  1O7H B;  1U5O A;  1I3F A;  1W6Y A;  1IQX A;  3NHX A;  3X3X A;  2OTJ 3;  3DH2 A;  1ISK A;  3A76 A;  2MC8 A;  3CCE 3;  5ELJ A;  1M9G A;  3OWU A;  3CXC 2;  4BTX A;  1BRK A;  4JF8 A;  1GOY A;  4CCV A;  2R41 A;  5EQL A;  3G16 A;  1PFP A;  1O7N B;  3CPW 2;  3EX9 A;  4LGQ A;  2JDI H;  5BXQ A;  1YIT 3;  4GL6 A;  2WOF A;  3I0Y A;  2FNQ A;  3Q3F A;  1BU4 A;  3QK9 A;  1RJO A;  1M1K 4;  2GXF A;  2XFS A;  1OGX A;  2Q07 A;  2HMM B;  2QGU A;  2F86 B;  3DMC A;  4N6M A;  1YJN 3;  3WOD G;  3X42 A;  3RGA A;  3B4O A;  1BNR A;  5AIF A;  2IY2 A;  3G4S 3;  3LXU X;  5EEO A;  3FKA A;  1ROA A;  1BRG A;  3I56 3;  2XSO B;  5JBS A;  1OUN A;  1RDS A;  1TIJ A;  2CFD A;  2STD A;  1IVX A;  5D83 A;  1SII A;  2FGT A;  4HVN A;  2CW9 A;  2O3O A;  5AII A;  2WOH A;  1JZO A;  2CFK A;  1W02 A;  2ZHX B;  3S5C A;  1TFK A;  3WOF B;  4BL3 A;  2CH9 A;  1RCL A;  3EBT A;  3K7C A;  1B3S A;  3GZR A;  4J9A A;  1O7M B;  5KP4 A;  1K8A 4;  1IVV A;  3FGY A;  1VZZ A;  1NDO B;  4HAA A;  1YGE A;  2KF4 A;  1ASK A;  2CG0 A;  5G2G A;  2CX1 A;  4N6L A;  4AKZ A;  4AKY A;  2AAD A;  5IG3 A;  1E3V A;  3LTB A;  4N6T A;  1X1X A;  3VSY A;  1Q42 A;  1RCK A;  1NO3 A;  3M8C A;  3ALA A;  3E99 A;  1C54 A;  1YIJ 3;  1BOX A;  1BRN L;  5I97 A;  4TX4 A;  2WGQ A;  1BNJ A;  1BRH A;  3F8X A;  1RGL A;  3FCS B;  4HJL B;  4HM1 B;  2BO9 B;  5D82 A;  3MG3 A;  5HGR A;  1BNS A;  2ML6 A;  4Q53 A;  2IA7 A;  3TDG A;  3LH4 A;  3FSD A;  1DVC A;  1BRJ A;  1JN5 A;  3FG3 A;  1V58 A;  2OTL 3;  3LTC A;  3WHO A;  5DRE A;  1CQS A;  3Q90 A;  1V57 A;  3OXA A;  1ROV A;  4N6O B;  3CCR 3;  3J7Y d;  1DMM A;  2OWP A;  5IF6 A;  1JN5 B;  3NV0 A;  3S27 A;  3Q1C A;  1IK3 A;  3OWY A;  4BU4 A;  1HU9 A;  3KSE D;  3JUM A;  1X1Y A;  3D4A A;  3LOY A;  4KFD A;  1K28 A;  4EBG A;  1GMQ A;  2CFL A;  2ZA4 A;  1F8N A;  1MGW A;  1JB2 A;  3IPT A;  2QIY A;  4HZ9 B;  4R9K A;  5KP3 A;  4EW5 A;  2SAR A;  1B20 A;  1RGG A;  2CWT A;  1BNF A;  1DET A;  2Y73 A;  4IIA A;  5BVB A;  4K1V A;  1OAC A;  2IMJ A;  5AYR B;  1WMN A;  6GSP A;  1YNV X;  1M90 4;  5G1L A;  1UGH I;  3CCV 3;  1VQ9 3;  1BIR A;  3FH1 A;  3CCQ 3;  5IEN A;  3CCU 3;  1B2U A;  4J5G A;  2BNG A;  4OK0 A;  5EVH A;  3SXX A;  3D9R A;  4RNZ A;  4FMD A;  2F56 A;  3EC9 A;  1NB3 I;  2KAA A;  1VQ5 3;  4PEJ A;  1DVD A;  1I0V A;  1V74 A;  1UUW B;  1WMP A;  2D1W A;  3N54 B;  5HOH A;  1RGE A;  1JV2 B;  4WFO A;  1UCI A;  3UB1 A;  1VQ7 3;  2K54 A;  1T2I A;  3F14 A;  3N8B A;  3RGR A;  4HKV B;  1ZGX A;  2R4I A;  3LTA A;  3UL6 A;  1RLS A;  1SAR A;  2HOH A;  1EEJ A;  1G0T A;  2BIR A;  3DUK A;  1IYY A;  3FG1 A;  1SJW A;  4HM0 B;  7STD A;  1FGM A;  3V98 A;  1IVU A;  2HMJ B;  3AHS A;  3BIR A;  1JB5 A;  1HYF A;  4STD A;  1I70 A;  3NBR A;  3STD A;  3HI7 A;  4X2H A;  3CME 3;  1VQ4 3;  1WNH A;  2GEY A;  3PYJ A;  1RHL A;  3PS8 A;  5CXO A;  3S67 A;  4CDL A;  3LZA A;  3D3L A;  1T5Y A;  1DYU A;  2GU1 A;  5RNT A;  2A15 A;  1X1U A;  3AMO A;  3JUP A;  4IT7 A;  4J5K A;  1RNB A;  1LVN A;  2Y74 A;  1G96 A;  1RN7 A;  4H61 A;  1D6U A;  1B2M A;  2OOV C;  4R4K A;  4IPB A;  5GSP A;  1UI7 A;  3EN8 A;  2L1S A;  8CHO A;  1K41 A;  2PZV A;  1WQL B;  2CHC A;  4DKI A;  4LEH A;  3CCJ 3;  1FUW A;  3AMO B;  4O02 B;  3FG4 A;  1BUQ A;  2LYX A;  3GZB A;  3SOA A;  2J8X B;  2Z76 A;  2YFL B;  2XSH B;  1A2K A;  8RNT A;  2P09 A;  2QEX 3;  3MSO A;  2Z6B A;  3CNX A;  3NM7 A;  4NRE A;  1VQO 3;  3KII A;  5D81 A;  3MWZ A;  1SQW A;  1UCL A;  2F99 A;  4K90 B;  3X3Y A;  1FUS A;  4XBY A;  5IG4 A;  1OF5 A;  2CIU A;  3ER7 A;  3LT9 A;  3NQY A;  3X41 A;  5ELU A;  1I0X A;  2SBL A;  3HIG A;  1QVG 2;  5BIR A;  2RNT A;  2PNC A;  3EN1 B;  5CK6 A;  4GHO A;  3G0K A;  1IT8 A;  4MJD A;  4LSO A;  3SYU A;  1UGI A;  4RBN A;  3MG1 A;  3KE7 A;  2KXG A;  1OF5 B;  1EG9 B;  3BB9 A;  3A5E A;  1IQY A;  4BL2 A;  4CPK A;  4HM8 B;  4L7K A;  2P38 A;  4FMA A;  1A2P A;  3CCM 3;  2XEP A;  3BNC A;  1NWW A;  1MNL A;  2ZDJ A;  1GY6 A;  1ULI B;  1LNI A;  2HMK B;  3GWR A;  4G1M B;  1VQ6 3;  2RCD A;  3HII A;  1KSI A;  2RFR A;  1OCV A;  2B1X B;  1Q7Y 4;  1UUG B;  2CWU A;  1W2B 2;  2D42 A;  1FGR A;  3D5I A;  5IW9 A;  2CKF B;  2F4Y A;  1BUJ A;  3T0U A;  3NXJ A;  1Q7H A;  5M1A A;  4MMY B;  1A67 A;  1GY7 A;  1RRL A;  2Z7A A;  3NBB A;  5IG5 A;  3EF8 A;  1AQZ A;  4I5Q A;  3FF2 A;  2XGN A;  3BLZ A;  1IT7 A;  4O8S A;  1VQ8 3;  3CC4 3;  3EQQ B;  4KT3 B;  1DMQ A;  3S28 A;  3T8N A;  5AI1 A;  2OQE C;  1Q81 4;  1QAK A;  3DGO A;  2V1L A;  4O2H A;  3NM2 A;  3OV4 A;  3G8Z A;  3JUO A;  4J8T A;  1YJW 3;  4FMC A;  2P0M A;  3D79 A;  1JBT A;  1LQG C;  4FR9 A;  1UW1 A;  3NBJ A;  4H3U A;  3ZG0 A;  3AGO A;  1NU3 A;  1TFO A;  5LC6 A;  5JPU A;  3K5T A;  3BNB A;  4X2O A;  4NHF A;  5AEW B;  7RNT A;  3ROB A;  1BSA A;  1R4C A;  3MG2 A;  2W2C A;  1AVK A;  3X40 A;  1B2Z A;  1EKM A;  2CWV A;  5STD A;  1OHO A;  4FMB A;  2UUG C;  1DE3 A;  3B4P A;  1JRQ A;  4N6U A;  3CCS 3;  1NJI 4;  2AAE A;  2WGO A;  1K9M 4;  2YFI B;  4KFF A;  1W6G A;  3U97 A;  1W5Z A;  1O7G B;  9RNT A;  1UDI I;  1B2X A;  2W0Q A;  4HM5 B;  4LZI A;  4CJN A;  2RSX A;  3DGN A;  4O3V A;  2K3D A;  1BSC A;  3KZT A;  2XF3 A;  2YFJ B;  3F40 A;  1CEW I;  1FGT A;  1L5G B;  2BHM A;  1WTH A;  4WYK B;  4EYC A;  3SVA A;  2F5M A;  1N5H A;  4HM7 B;  1TP6 A;  3T8U A;  1BSE A;  3GZX B;  4BTW A;  2INX A;  3CU3 A;  3JVC A;  3MKI A;  1RGF A;  1GD3 A;  1GMR A;  3ZG5 A;  4HM6 B;  1TJD A;  5FW5 A;  2F5W A;  1N8R 4;  2O9U X;  1DMN A;  2W6J H;  3GRD A;  1W2Z A;  3K9M C;  1I2F A;  4K1U A;  3WOE B;  3K63 A;  1GD4 A;  5M19 A;  1GY5 A;  1MWT A;  3WA3 A;  1JB4 A;  2KF5 A;  6STD A;  2OOV A;  3WA2 X;  1OH0 A;  2ML5 A;  1I3I A;  1RNT A;  1AY7 A;  2F98 A;  1JJ2 2;  3PCS A;  1IDP A;  1VQP 3;  3FF0 A;  1IQ8 A;  1KWI A;  1YI2 3;  4EV5 A;  1KC8 4;  3X3Z A;  4WP5 A;  1OHS A;  2W56 A;  2I9W A;  3URP A;  3KSP A;  1PU4 A;  1FA3 A;  3K0Z A;  1JKG A;  5CLK A;  5G1K A;  1YGW A;  3CNM A;  1N5P A;  1W00 A;  2BT3 A;  2XFT A;  3JUN A;  3EJV A;  4HZB B;  1VQK 3;  1Q86 4;  2BU4 A;  3H3H A;  4HM3 B;  4RZM A;  1FW7 A;  4XDV A;  1N9J A;  1STD A;  1EUI C;  1UCK A;  2GEX A;  1QAL A;  2W56 B;  4L8O A;  1RN4 A;  3LT8 A;  1JKG B;  3EE1 A;  1M1X B;  3L0R A;  3HOH A;  1MOL A;  2HMN B;  3GZY B;  1TUH A;  1A90 A;  2KRT A;  1RGH A;  1Z1S A;  2C11 A;  1RSN A;  3HK4 A;  2L4V A;  2CFW A;  5AIG A;  2QA4 3;  4XM4 A;  1Q9E A;  3DGM A;  1JBS A;  3SX1 A;  4ZM8 A;  2BMO B;  5IEO A;  1RGK A;  4QWT A;  3WMD A;  1MWU A;  1I8V A;  2CC3 A;  5CF2 A;  1QJG A;  2XR8 B;  1EQK A;  3LTD A;  1HZ1 A;  2C4B A;  3NQZ A;  1W01 A;  1ZO2 A;  1Q82 4;  3KKG A;  1FYS A;  4R9L A;  4WWU C;  3F7X A;  5IER A;  1TU5 A;  1MGR A;  4N6N B;  1CYU A;  3B7C A;  3SED A;  4WHA A;  4BIR A;  2GSP A;  2FXT A;  1J2B A;  1BSB A;  1I2G A;  3OX9 A;  1CYV A;  2XGL A;  2W9P A;  3LYG A;  1PYL A;  3WDG B;  1YHQ 3;  1OGZ A;  1GOV A;  2KF6 A;  3DY5 A;  3U1W A;  3SOY A;  4BTY A;  2OCT A;  1RKY A;  2OQE A;  2E2U A;  2M7O A; 
#chains in the Genus database with same CATH homology
 2E2T A;  3N9H A;  3V99 A;  1A2V A;  1VQM 3;  4N6V 0;  2RGQ A;  3F8H A;  5IEP A;  5KP1 A;  3CC7 3;  1JNQ A;  3CMA 3;  1D6Y A;  2WO0 A;  1STF I;  3FLJ A;  2B24 B;  2JQ5 A;  4KZ1 A;  3PCR A;  2KCD A;  4XBX A;  1S5A A;  2UX0 A;  4U13 A;  2XH9 A;  1W6C A;  2GBW B;  3LML A;  5FGO A;  3FZW A;  4MEI A;  3O8Y A;  3VF1 A;  1VQL 3;  5LC7 A;  3EBY A;  1ZX2 A;  4I4K A;  3UNL A;  1OPY A;  3UJM A;  1VQN 3;  2GBX B;  5AEU B;  3UL5 A;  2YX9 A;  1N8Q A;  3F7S A;  3KFQ C;  1QVF 2;  3GAX A;  4LMI A;  1RRH A;  2IUK A;  4KFE A;  2IUJ A;  3PXM A;  1SPU A;  5JPP A;  2BMQ B;  1EA2 A;  1O7P B;  3MPH A;  3IJE B;  1AVL A;  2CFG A;  1IV7 A;  4R1K A;  3DM8 A;  1ULJ B;  2ZL8 A;  2HML B;  4HBR A;  1O7W B;  1WMO A;  2LQV A;  1E3R A;  1LOX A;  3CPO A;  4ORL A;  1KD1 4;  5AYS C;  4WYK A;  2CK3 H;  3NX0 A;  3VGN A;  1AV4 A;  3ECF A;  1KQS 2;  1LXE A;  1QAF A;  3CC2 3;  5TGN A;  1D6Z A;  4EV2 A;  2HMO B;  3CD6 3;  4N3V A;  2CG1 A;  4AEQ A;  1AR0 A;  1GS3 A;  2GU3 A;  3MHE A;  3KN4 A;  3RDE A;  1FGQ A;  4EC6 A;  3BND A;  1S72 3;  3DGL A;  4EXR A;  1UI8 A;  2P0X A;  3QRD A;  4K61 A;  5CF1 A;  4L8P A;  2C10 A;  3Q2P A;  4MMZ B;  3IMA B;  3B8L A;  3NV0 B;  3EHC A;  4OVM A;  3G71 3;  3V92 A;  3CCL 3;  4HM2 B;  1YVB I;  5AIH A;  1IVW A;  2W04 A;  1YJ9 3;  2Z77 A;  1C7H A;  1US1 A;  2E2V A;  1SIH A;  1IV9 A;  4XB5 A;  4XBT A;  5A0O B;  3HX8 A;  3DXO A;  1E97 A;  3PZW A;  1QMA A;  3DZL A;  1UUV B;  1W4N A;  3I55 3;  1FGO A;  4FCM A;  3NUV A;  1IU7 A;  2BMR B;  5IG0 A;  1Q40 A;  3SLU A;  4HYZ A;  1GYB A;  4KVH A;  4FCZ A;  3S29 A;  3F9S A;  4MMX B;  3G6E 3;  4JRF A;  1NB5 I;  1HKX A;  1LNH A;  3EB8 A;  1Q40 B;  2MF7 A;  4R80 A;  2XRX B;  4OUQ A;  3MYT A;  3OW2 2;  1U8C B;  4RNY A;  3PGB A;  4HM4 B;  1Y4K A;  2W9Q A;  1K73 4;  2P05 A;  5DRV A;  1N9E A;  2W03 A;  3JUQ A;  4GB5 A;  1W7C A;  3HZP A;  2K0M A;  4XDW A;  4FCJ A;  3OWS A;  3BNE A;  1OHP A;  3H51 A;  1O7H B;  1U5O A;  3NHX A;  1W6Y A;  1IQX A;  3X3X A;  2OTJ 3;  1ISK A;  3A76 A;  2MC8 A;  3CCE 3;  5ELJ A;  1M9G A;  3OWU A;  3CXC 2;  4BTX A;  4JF8 A;  4CCV A;  5EQL A;  3G16 A;  1PFP A;  1O7N B;  3CPW 2;  3EX9 A;  4LGQ A;  2JDI H;  5BXQ A;  1YIT 3;  4GL6 A;  2WOF A;  3I0Y A;  2FNQ A;  3QK9 A;  1RJO A;  1M1K 4;  2GXF A;  2XFS A;  1OGX A;  2Q07 A;  2HMM B;  2QGU A;  2F86 B;  3DMC A;  4N6M A;  1YJN 3;  3WOD G;  3X42 A;  3RGA A;  3B4O A;  5AIF A;  3G4S 3;  3LXU X;  5EEO A;  3FKA A;  1ROA A;  3I56 3;  2XSO B;  5JBS A;  1OUN A;  2STD A;  1TIJ A;  2CFD A;  3CCU 3;  1IVX A;  5D83 A;  1SII A;  2FGT A;  4HVN A;  2CW9 A;  2O3O A;  5AII A;  2WOH A;  2CFK A;  1W02 A;  3S5C A;  1TFK A;  3WOF B;  2CH9 A;  3EBT A;  3K7C A;  3GZR A;  4J9A A;  1O7M B;  5KP4 A;  1K8A 4;  1IVV A;  3FGY A;  1VZZ A;  1NDO B;  1YGE A;  1ASK A;  2CG0 A;  5G2G A;  4N6L A;  4AKZ A;  4AKY A;  5IG3 A;  1E3V A;  3LTB A;  4N6T A;  3VSY A;  1Q42 A;  3M8C A;  1NO3 A;  3ALA A;  3E99 A;  1YIJ 3;  5I97 A;  4TX4 A;  2WGQ A;  3F8X A;  3FCS B;  4HJL B;  4HM1 B;  2BO9 B;  5D82 A;  3MG3 A;  5HGR A;  2ML6 A;  4Q53 A;  2IA7 A;  3TDG A;  3LH4 A;  3FSD A;  1DVC A;  1JN5 A;  3FG3 A;  2OTL 3;  3LTC A;  5DRE A;  1CQS A;  3Q90 A;  3OXA A;  1ROV A;  4N6O B;  3CCR 3;  3J7Y d;  1DMM A;  2OWP A;  5IF6 A;  1JN5 B;  3NV0 A;  3S27 A;  3Q1C A;  1IK3 A;  3OWY A;  1HU9 A;  3KSE D;  3JUM A;  3LOY A;  4KFD A;  1K28 A;  4EBG A;  2CFL A;  1F8N A;  3IPT A;  1JB2 A;  4HZ9 B;  2QIY A;  4R9K A;  5KP3 A;  4IIA A;  2CWT A;  2Y73 A;  5BVB A;  4K1V A;  1OAC A;  2IMJ A;  5AYR B;  1WMN A;  1M90 4;  3CCV 3;  1VQ9 3;  3FH1 A;  3CCQ 3;  5IEN A;  2BNG A;  4OK0 A;  5EVH A;  3SXX A;  3D9R A;  4RNZ A;  4FMD A;  3EC9 A;  1NB3 I;  1VQ5 3;  4PEJ A;  1DVD A;  1V74 A;  1WMP A;  1UUW B;  2D1W A;  3N54 B;  1JV2 B;  4WFO A;  3UB1 A;  1VQ7 3;  2K54 A;  3F14 A;  3N8B A;  3RGR A;  4HKV B;  2R4I A;  3LTA A;  3UL6 A;  3DUK A;  3FG1 A;  1SJW A;  4HM0 B;  7STD A;  1FGM A;  3V98 A;  1IVU A;  2HMJ B;  1JB5 A;  4STD A;  3NBR A;  3STD A;  3HI7 A;  4X2H A;  3CME 3;  1VQ4 3;  1WNH A;  2GEY A;  3PYJ A;  3PS8 A;  5CXO A;  3S67 A;  4CDL A;  3LZA A;  3D3L A;  1T5Y A;  1DYU A;  2GU1 A;  2A15 A;  3AMO A;  3JUP A;  4IT7 A;  1LVN A;  2Y74 A;  1G96 A;  1RN7 A;  4H61 A;  1D6U A;  2OOV C;  4R4K A;  4IPB A;  1UI7 A;  3EN8 A;  8CHO A;  1K41 A;  2PZV A;  1WQL B;  2CHC A;  3CCJ 3;  4LEH A;  1FUW A;  3AMO B;  4O02 B;  3FG4 A;  1BUQ A;  2LYX A;  3GZB A;  3SOA A;  2Z76 A;  2YFL B;  2XSH B;  1A2K A;  2P09 A;  2QEX 3;  3MSO A;  2Z6B A;  3CNX A;  3NM7 A;  4NRE A;  1VQO 3;  3KII A;  5D81 A;  3MWZ A;  1SQW A;  2F99 A;  4K90 B;  3X3Y A;  4XBY A;  5IG4 A;  1OF5 A;  2CIU A;  3ER7 A;  3LT9 A;  3NQY A;  3X41 A;  5ELU A;  2SBL A;  3HIG A;  1QVG 2;  2PNC A;  3EN1 B;  5CK6 A;  3G0K A;  1IT8 A;  4MJD A;  4LSO A;  4RBN A;  3MG1 A;  3KE7 A;  2KXG A;  1OF5 B;  1EG9 B;  3BB9 A;  1IQY A;  4HM8 B;  4L7K A;  2P38 A;  4FMA A;  3CCM 3;  2XEP A;  3BNC A;  1NWW A;  1MNL A;  2ZDJ A;  1GY6 A;  1ULI B;  2HMK B;  3GWR A;  4G1M B;  1VQ6 3;  2RCD A;  3HII A;  1KSI A;  2RFR A;  1OCV A;  2B1X B;  1Q7Y 4;  2CWU A;  1W2B 2;  2D42 A;  1FGR A;  5IW9 A;  2CKF B;  3T0U A;  3NXJ A;  4MMY B;  1A67 A;  1GY7 A;  1RRL A;  2Z7A A;  3NBB A;  5IG5 A;  3EF8 A;  3FF2 A;  2XGN A;  3BLZ A;  1IT7 A;  4O8S A;  1VQ8 3;  3CC4 3;  3EQQ B;  1DMQ A;  3S28 A;  3T8N A;  5AI1 A;  2OQE C;  1Q81 4;  1QAK A;  3DGO A;  2V1L A;  4O2H A;  3NM2 A;  3OV4 A;  3G8Z A;  3JUO A;  4J8T A;  1YJW 3;  4FMC A;  2P0M A;  4FR9 A;  1UW1 A;  3NBJ A;  4H3U A;  1NU3 A;  1TFO A;  5LC6 A;  5JPU A;  3K5T A;  3BNB A;  4X2O A;  4NHF A;  5AEW B;  3ROB A;  1R4C A;  3MG2 A;  2W2C A;  1AVK A;  3X40 A;  1EKM A;  2CWV A;  5STD A;  1OHO A;  4FMB A;  3B4P A;  1JRQ A;  4N6U A;  3CCS 3;  1NJI 4;  2WGO A;  1K9M 4;  2YFI B;  4KFF A;  1W6G A;  3U97 A;  1W5Z A;  1O7G B;  2W0Q A;  4HM5 B;  4LZI A;  2RSX A;  3DGN A;  4O3V A;  3KZT A;  2XF3 A;  2YFJ B;  3F40 A;  1CEW I;  1FGT A;  1L5G B;  2BHM A;  1WTH A;  4WYK B;  4EYC A;  3SVA A;  1N5H A;  4HM7 B;  1TP6 A;  3T8U A;  4BTW A;  3GZX B;  2INX A;  3CU3 A;  3JVC A;  3MKI A;  1GD3 A;  4HM6 B;  5FW5 A;  1N8R 4;  2O9U X;  1DMN A;  2W6J H;  3GRD A;  1W2Z A;  3K9M C;  4K1U A;  3WOE B;  3K63 A;  1GD4 A;  1GY5 A;  3WA3 A;  1JB4 A;  6STD A;  2OOV A;  3WA2 X;  1OH0 A;  2ML5 A;  2F98 A;  1JJ2 2;  3PCS A;  1IDP A;  1VQP 3;  3FF0 A;  1IQ8 A;  1KWI A;  1YI2 3;  4EV5 A;  1KC8 4;  3X3Z A;  4WP5 A;  1OHS A;  2W56 A;  2I9W A;  3KSP A;  1PU4 A;  1FA3 A;  3K0Z A;  1JKG A;  5CLK A;  3CNM A;  1N5P A;  1W00 A;  2BT3 A;  2XFT A;  3JUN A;  3EJV A;  4HZB B;  1VQK 3;  1Q86 4;  3H3H A;  4HM3 B;  4RZM A;  4XDV A;  1N9J A;  1STD A;  2W56 B;  2GEX A;  1QAL A;  4L8O A;  3LT8 A;  1JKG B;  3EE1 A;  1M1X B;  3L0R A;  1MOL A;  2HMN B;  3GZY B;  1TUH A;  1A90 A;  2KRT A;  1Z1S A;  2C11 A;  3HK4 A;  2L4V A;  2CFW A;  5AIG A;  2QA4 3;  4XM4 A;  3DGM A;  3SX1 A;  4ZM8 A;  2BMO B;  5IEO A;  4QWT A;  3WMD A;  2CC3 A;  5CF2 A;  1QJG A;  2XR8 B;  1EQK A;  3LTD A;  3NQZ A;  1W01 A;  1ZO2 A;  1Q82 4;  3KKG A;  4R9L A;  4WWU C;  3F7X A;  5IER A;  1TU5 A;  4N6N B;  1CYU A;  3B7C A;  3SED A;  4WHA A;  2FXT A;  1J2B A;  3OX9 A;  1CYV A;  2XGL A;  2W9P A;  3LYG A;  3WDG B;  1YHQ 3;  1OGZ A;  3U1W A;  3DY5 A;  3SOY A;  4BTY A;  2OCT A;  1RKY A;  2OQE A;  2E2U A;  2M7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...