4HKVB

Naphthalene 1,2-dioxygenase bound to benzamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Naphthalene 1,2-Dioxygenase bound to benzamide
rcsb
source organism Pseudomonas sp. c18
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
total genus 58
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hkvB00
2QGUA 5HGRA 4MJDA 6STDA 3GZXB 1E97A 5DREA 1ULJB 1W02A 4WP5A 3NV0A 4XBYA 3CNXA 3NXJA 1E3RA 3F8HA 4WYKA 3EBYA 4HM5B 3JUQA 1OGXA 4RZMA 5AEWB 3FH1A 1AR0A 2GEYA 3M8CA 4HKVB 5D83A 4XDVA 3SOYA 7STDA 2HMOB 3HK4A 3T8NA 1DMMA 2GXFA 4WWUC 2RGQA 3KE7A 3HX8A 1Q40B 3FF0A 1DMNA 3NM2A 3GZRA 8CHOA 5JPUA 3EC9A 2HMMB 2YFLB 2RFRA 1W01A 5IEPA 4X2OA 1UUWB 2BMRB 3EN1B 1OPYA 2YFJB 4L8PA 3B4OA 3S5CA 1EG9B 4WYKB 3DMCA 2HMKB 5AIIA 3JUPA 2CKFB 3DUKA 5AIHA 1OHPA 5IG4A 4STDA 1SJWA 5AI1A 1GS3A 1O7GB 3GZBA 2PZVA 3EQQB 3F40A 3EF8A 3GWRA 4HJLB 3F7SA 1O7WB 3RGRA 1JN5A 1QJGA 3UNLA 3I0YA 3EN8A 3DZLA 1OHOA 3K0ZA 3FF2A 2XSOB 1E3VA 1JKGA 2CHCA 3FKAA 3OWUA 1CQSA 1OUNA 4OVMA 3NUVA 4PEJA 1O7NB 5IG3A 2HMNB 3CU3A 3ER7A 1Z1SA 3E99A 3NV0B 4HM2B 4HM4B 4I4KA 4LEHA 4U13A 4XM4A 1UUVB 4L7KA 2K54A 4KVHA 3ECFA 3MG1A 3MHEA 4HM6B 3OV4A 4LMIA 5FW5A 5IENA 3G8ZA 1DMQA 2Z76A 4HVNA 2JQ5A 3MG2A 4FCJA 3Q90A 5AIGA 5DRVA 1BUQA 2R4IA 5D81A 5AEUB 3B4PA 3MKIA 5CF2A 4XBXA 5BVBA 2B24B 1GY6A 2I9WA 2UX0A 3MSOA 3STDA 1ISKA 1OHSA 1S5AA 3BB9A 3IPTA 3KZTA 1IDPA 3SOAA 1JB4A 3CNMA 3EBTA 3HZPA 2XSHB 2Z77A 5CLKA 3KKGA 2BMOB 2B1XB 3F14A 2Z7AA 3MG3A 4HM1B 1K41A 1NDOB 1Q40A 1GYBA 4K1VA 5KP4A 3UJMA 4LGQA 1GY5A 2A15A 4HZ9B 5G2GA 1OF5B 2RCDA 4XBTA 5JPPA 2BNGA 3OWYA 1GY7A 2HMLB 3F9SA 3FSDA 2GBWB 1O7MB 4XB5A 1O7HB 3SEDA 3F7XA 5EVHA 3ROBA 3LZAA 1ZO2A 3CPOA 1JB2A 3EX9A 5STDA 1A2KA 1U5OA 1JN5B 2HMJB 4X2HA 4HM8B 3VGNA 4R9KA 4K1UA 1NWWA 2W2CA 1JKGB 1OF5A 2GEXA 2IMJA 3G0KA 3JUNA 4R9LA 5KP3A 3MYTA 4Q53A 2F86B 3D9RA 5CF1A 3GZYB 4GB5A 3OWSA 1STDA 4FCMA 1OCVA 3B7CA 3OXAA 4L8OA 3FZWA 3T8UA 1HKXA 1TUHA 3DXOA 1ZX2A 2INXA 3FLJA 1JB5A 2YFIB 3B8LA 3BLZA 3LYGA 1OGZA 5IEOA 2XRXB 5IERA 3NBRA 4J9AA 3H51A 4N3VA 3NHXA 2XR8B 4HM3B 1TP6A 5IG0A 2GBXB 1ASKA 4H3UA 5IG5A 1C7HA 1Q42A 1W00A 3FGYA 4IIAA 2F99A 4XDWA 5BXQA 3EHCA 3EJVA 3OX9A 3K7CA 3JUMA 1W6YA 4HM7B 4J8TA 4HM0B 4HZBB 2F98A 3DM8A 5IF6A 4OUQA 3GRDA 2OWPA 3F8XA 3JUOA 3KSPA 3WMDA 1ULIB 3G16A 3RGAA 1NU3A 1O7PB 1WQLB 4ORLA 1OH0A 1QMAA 5TGNA 2BMQB 1VZZA 3H3HA 5D82A 5CK6A 3VSYA 5CXOA 4CDLA 2STDA 5KP1A 2QIYA 4R1KA 3A76A 5AIFA 1EA2A
chains in the Genus database with same CATH superfamily
1YHQ3 2QGUA 3PXMA 5HGRA 1EEJA 3NX0A 3GZXB 1W2B2 1E97A 5DREA 2GSPA 3AHWA 1Q7Y4 2CWVA 1X1WA 4O3VA 1FGTA 1K28A 1BUJA 1IYYA 4WYKA 3JUQA 1K9M4 2CK3H 1JBTA 3FH1A 1VQ53 1QVG2 7STDA 1SIHA 4CPKA 1VQ93 3SLUA 1LVNA 5LC7A 8CHOA 3CC43 3FG1A 2HMMB 1W01A 1UUWB 2BMRB 3ALAA 3LT8A 3LT9A 3CCM3 4O2HA 1NB3I 4IPBA 4N6V0 2OQEA 1W5ZA 3B4OA 3HIGA 3X41A 3QRDA 4IT7A 5FGOA 2C10A 1OHPA 3J7Yd 1SJWA 1GS3A 3F40A 1NNVA 1RGCA 3GWRA 3F7SA 1JN5A 3UNLA 1HYFA 3EN8A 1SPUA 1E3VA 1OUNA 2WGOA 2CH9A 2IUJA 3NQZA 1Z1SA 1B27A 1SIIA 3IJEB 2UUGC 3WODG 4EC6A 4LEHA 2OTJ3 1UUVB 3EE1A 4L7KA 1BSCA 1BSEA 1RGLA 4LMIA 3S29A 3V92A 4BTWA 5IENA 1DMQA 3WA3A 3WR2A 1DE3A 3MG2A 3Q90A 1JRQA 1BUQA 1AQZA 2CFDA 5CF2A 3QK9A 1N9EA 1UI8A 4XBXA 1ISKA 1BNEA 3STDA 3SXXA 1RGEA 1IDPA 1JZOA 1JB4A 1BSBA 3Q2PA 1VQL3 4KFDA 2F5WA 1X1YA 2BMOB 2B1XB 3F14A 3GAXA 2P0MA 3MG3A 4HM1B 4J5KA 1BANA 1GYBA 2JDIH 4BIRA 4LGQA 1OF5B 2RCDA 2D42A 4R80A 1MWSA 3LH4A 4N6TA 3MPHA 2RSXA 1O7HB 1DVDA 3CCR3 1VQO3 1WTHA 5EVHA 1ZS7A 1FGOA 1ZO2A 2V1LA 4FR9A 1IT8A 1I2GA 1A2KA 2XH9A 2BT3A 2KCDA 1LRAA 2QA43 1FUTA 4K1UA 1BNFA 1U8CB 1NWWA 2IMJA 3G0KA 5G1LA 3X42A 1EUIC 2W9QA 1VQ83 1W6GA 1G0TA 1STDA 4FCMA 3OXAA 1L5GB 3T8UA 1A2VA 1W7CA 1F8NA 1HKXA 3X3XA 2CC3A 3DXOA 1QAKA 1JB5A 2AAEA 1B21A 1GD3A 4FMBA 3N9HA 3LYGA 1JJ22 2W6JH 3H51A 4MMZB 1W2ZA 2XR8B 1N8QA 4HM3B 3LTAA 5IG5A 3LTCA 1C7HA 3FGYA 1YVBI 1IVXA 1FUSA 5BXQA 4AEQA 1DYUA 3KN4A 1BRNL 4J8TA 1RN1A 3NQYA 4KFFA 4OUQA 5ELJA 1AVKA 1CEWI 3DGNA 3KSPA 3CCU3 1ULIB 1WQLB 1OH0A 5TGNA 1D6ZA 2BMQB 1V57A 3H3HA 4JF8A 1Q814 1W4NA 4CDLA 4FCZA 2STDA 1RCLA 2RNTA 3NV0A 1MWTA 2K54A 2KF6A 2C11A 1G02A 1SARA 1LXEA 2WO0A 4FMDA 4MJDA 1RN7A 1UCKA 1C54A 6GSPA 3AMOA 3D5IA 1ULJB 4WP5A 1B2MA 2H0GA 3UB1A 3Q1CA 2W04A 3LOYA 1LQMB 3EBYA 1RTUA 1OGXA 2K3DA 4HM5B 1IVVA 3M8CA 1OACA 3KIIA 4HKVB 2HOHA 2HMOB 2IY2A 1BNGA 3KE7A 3HX8A 2F4YA 3FF0A 1CYUA 3NM2A 5JPUA 3EC9A 2YFLB 1MOLA 2WOHA 5IEPA 3X3ZA 1K734 2J8XB 4N6NB 1RNTA 1OPYA 2WOFA 4WYKB 5AIIA 1R4CA 3DMCA 1RDSA 3SYUA 1IU7A 1BRGA 5AI1A 1GOUA 1Q824 3PGBA 3EF8A 1LOWA 1IK3A 4NPBA 3ZG0A 4BU4A 3I0YA 1PY3A 1OHOA 1AVLA 1Y4KA 5CF1A 1S723 3OWUA 4HAAA 4PEJA 1T5YA 4EW5A 4HBRA 1CYVA 2HMNB 3N8BA 3GSPA 1UI7A 3A5EA 3E99A 3ER7A 4HM4B 2CW9A 3I563 5G1KA 4I4KA 4XM4A 1YIJ3 1WNHA 1GMRA 3MHEA 4HM6B 1B2ZA 3OV4A 5FW5A 3HI7A 2JQ5A 3DY5A 2BU4A 2R4IA 3AHSA 3DH2A 3MKIA 5D81A 5AEUB 1YJW3 5BVBA 2I9WA 2XFTA 2UX0A 3Q3FA 1BGSA 1IVUA 3BB9A 4LZIA 3KZTA 4LYLB 2W9PA 1BU4A 3CNMA 1JNQA 1A2PA 1PYLA 3EBTA 1HZ1A 3EB8A 3KKGA 4N6OB 5AYRB 3WOFB 3ZFZA 2L4VA 1RGHA 1FA3A 2BO9B 4TX4A 3UL5A 1K41A 1IQYA 1TFKA 3UJMA 4EV5A 2A15A 1T3BA 4HZ9B 4MMXB 2ML6A 1D6UA 2HMLB 1MNLA 3T0UA 1IQXA 1VQ43 2KF4A 5EEOA 5STDA 1JB2A 2CWUA 1LOXA 4KFEA 1JN5B 4X2HA 1VQM3 1I3IA 1KC84 1OF5A 2CG0A 3MYTA 4CCVA 2F86B 1W6CA 1X1XA 3CD63 3KFQC 1G96A 1I2EA 1WMPA 1WMNA 4L8OA 5AYSC 2BIRA 1ZX2A 2INXA 2K0MA 4KT3B 1MGWA 1OGZA 3FCSB 5IERA 3NBRA 1TTOA 1RHLA 3NHXA 3CC23 2LQVA 5IG0A 1ASKA 1BRSA 3LTBA 3I553 2CWTA 1UGHI 1Q42A 2Q07A 5M18A 4IIAA 3NM7A 2F99A 4N6UA 2E2UA 3IMAB 3EHCA 1I3FA 5ELUA 3EJVA 1T2IA 3RDEA 3D5GA 3V99A 1IVWA 4HM7B 4HM0B 2F98A 1TU5A 1KQS2 3PZWA 5M19A 6RNTA 3F8XA 3JUOA 3WMDA 4BL2A 4O8SA 3BIRA 1NU3A 1QMAA 1JV2B 1VZZA 3S67A 2OOVC 5CK6A 4JRFA 1GD4A 1LNIA 1M904 2O3OA 4KVHA 5AIFA 1EA2A 1PU4A 1DETA 2KAAA 2IUKA 6STDA 3K5TA 2F5MA 1VQ63 3LTDA 4EXRA 1RNBA 4ILFA 3D79A 1DVCA 1YIT3 1W02A 1BSDA 4KZ1A 2MC8A 1V58A 2CFKA 4RNTA 3CNXA 1E3RA 1Q864 2H0IA 3KSED 1RRLA 4RZMA 4GSPA 4HYZA 4XDVA 4BTXA 4QWTA 1YGWA 1B20A 1RJOA 2GXFA 2IA7A 3LMLA 4WWUC 1Q40B 3RNTA 4ZM8A 1VQP3 1DMNA 3AMOB 1UCIA 4BL3A 4GL6A 4N6MA 4X2OA 1V74A 4H61A 4L8PA 5AIHA 1N5PA 2HMKB 2IYJA 3DUKA 5IG4A 1VQ73 4STDA 4FMAA 3AGNA 1O7GB 3GZBA 4HJLB 9RNTA 3K9MC 2W56B 3PYJA 3G4S3 1A90A 3DZLA 1KWIA 2L1SA 1JKGA 1NO3A 3CCS3 1CQSA 2WGQA 1O7NB 2CX0A 1QALA 1NJI4 5I97A 1UDII 3NV0B 1QAFA 4U13A 2P0XA 2XEPA 2M7OA 1RCKA 3ECFA 1FZUA 2C4BA 1RGFA 1RGKA 2AADA 4FCJA 5DRVA 1T2HA 5AIGA 4AKYA 3B4PA 2B24B 1GY6A 3MSOA 1OHSA 1S5AA 2SBLA 1A67A 1GOYA 1GSPA 3S27A 1YVSA 1YGEA 3O8YA 4NREA 3G6E3 2CIUA 5KP4A 3CC73 3TDGA 1GY5A 1GMQA 4XBTA 1BNSA 2GBWB 2OQEC 1RSNA 2Z6BA 4EV2A 1VQK3 1TRQA 1EKMA 8RNTA 3BU4A 1YNVX 1B2SA 1STFI 3EX9A 3L0RA 1LOYA 3LXUX 3CCE3 4R9KA 7RNTA 1TJDA 4R4KA 1FYSA 4RBNA 1BOXA 1JKGB 2GEXA 3JUNA 1BNIA 4AKZA 1BVIA 3MWZA 4RNZA 2FNQA 3GZYB 4GB5A 1IV9A 1BRHA 2ML5A 1X1UA 1I8VA 3K63A 3U1WA 1OCVA 3B7CA 3PS8A 3V98A 1BNRA 1TUHA 3WA2X 5IW9A 1TIJA 1ROVA 4MEIA 2SARA 3T8NA 2YFIB 1IT7A 3HIIA 2OCTA 2P38A 2Y73A 2FGTA 1RMSA 2XRXB 1BIRA 2XFSA 1QVF2 1I70A 2GBXB 2E2VA 3DGOA 1W00A 3X40A 1YJ93 1B2XA 1LQGC 1YJN3 1BAOA 2W0QA 3BNEA 3CCJ3 3K7CA 1M1XB 1W6YA 2KXGA 2E2TA 3BNDA 4FMCA 4J5GA 3CCQ3 1B3SA 3OW22 1MWUA 2CFWA 1TRPA 3U97A 2ZA4A 3JVCA 1AV4A 3D3LA 4K90B 2ZHXB 3AGOA 3VSYA 2UGIA 1SQWA 5KP1A 2QIYA 3CPOA 4R1KA 3A76A 2KF3A 4DKIA 5M1AA 2CFGA 1Q9EA 1FUWA 5JBSA 2ZDJA 4HOHA 4OK0A 1FGMA 4XBYA 3NXJA 1R4YA 3F8HA 1K8A4 2KF5A 5AEWB 1BSAA 3HOHA 1AR0A 2GEYA 5D83A 1HU9A 3SOYA 3HK4A 1DMMA 1UCJA 2RGQA 1RN4A 4EBGA 3GZRA 2ZL8A 2P05A 3UL6A 2RFRA 3EN1B 2OTL3 2YFJB 3S5CA 1EG9B 1Q7HA 1RLSA 3JUPA 2CKFB 2QEX3 3KCHA 2PZVA 3EQQB 3CME3 2O9UX 1O7WB 3RGRA 1AY7A 1JZDA 1QJGA 5A0OB 3CMA3 1ZGXA 1FGRA 3URPA 3K0ZA 1FW7A 3FF2A 2XSOB 2YX9A 2CHCA 3FKAA 4OVMA 3NUVA 4WHAA 5IG3A 1TFOA 3BNCA 3CU3A 7GSPA 3CCL3 4GHOA 4HM2B 1FGQA 4G1MB 5JPPA 3MG1A 2KRTA 2W56A 2W03A 2R41A 3G8ZA 3N54B 2Z76A 1N9JA 4K61A 4LSOA 4HVNA 4WFOA 1IQ8A 3ZG5A 5GSPA 1JBRA 1PFPA 1VQN3 1KSIA 1UUGB 2CX1A 2GU1A 2PNCA 3NBBA 3IPTA 3PCSA 1BRIA 3SOAA 3PCRA 3HZPA 2XSHB 1B2UA 2Z77A 3FG3A 4NHFA 5CLKA 4BTYA 2XGNA 3CXC2 2Z7AA 3G713 1NDOB 2XF3A 3WOEB 1Q40A 1VQQA 2D1WA 4K1VA 3BNBA 4CJNA 3DGMA 5EQLA 5G2GA 1CH0A 2XGLA 2BNGA 3OWYA 1GY7A 1I0XA 1M9GA 3F9SA 3FSDA 4I5QA 1KD14 1O7MB 1RGGA 1GOVA 4MMYB 4XB5A 3SEDA 3F7XA 5BU4A 3D4AA 3SX1A 3ROBA 3LZAA 1NB5I 5RNTA 1U5OA 2HMJB 1BRJA 4HM8B 3VGNA 1RRHA 3X3YA 2W2CA 5KP3A 4R9LA 1ROAA 2BHMA 4N6LA 4Q53A 1D6YA 3D9RA 3OWSA 1BRKA 1MWRA 3CPW2 3FZWA 1J2BA 2F56A 3DGYA 1LOVA 1RGAA 3FLJA 1MGRA 2GU3A 3B8LA 1M1K4 1UW1A 3BLZA 5IEOA 5LC6A 1GMPA 4EYCA 1UGIA 4J9AA 4N3VA 1N8R4 2P09A 1LNHA 1TP6A 3FG4A 3CCV3 4H3UA 1JBSA 1UCLA 2FXTA 3SVAA 1BNJA 1IV7A 4XDWA 1WMOA 3OX9A 2LYXA 3WHOA 3JUMA 1YI23 4HZBB 3DM8A 3NBJA 3VF1A 5IF6A 1US1A 2H0HA 2OWPA 2Y74A 3GRDA 4O02B 3G16A 1RKYA 3RGAA 1O7PB 1N5HA 2RBIA 4ORLA 3DGLA 2CG1A 5BIRA 5D82A 4RNYA 1I0VA 1I2FA 3WDGB 2CFLA 5CXOA 2OOVA 5HOHA 1EQKA 2MF7A 3S28A
chains in the Genus database with same CATH topology
1YHQ3 2QGUA 3PXMA 5HGRA 3NX0A 3GZXB 1W2B2 1E97A 5DREA 1Q7Y4 2CWVA 4O3VA 1FGTA 1K28A 4WYKA 3JUQA 1K9M4 2CK3H 3FH1A 1VQ53 1QVG2 7STDA 1SIHA 1VQ93 3SLUA 1LVNA 5LC7A 8CHOA 3CC43 3FG1A 2HMMB 1W01A 1UUWB 2BMRB 3ALAA 3LT8A 3LT9A 3CCM3 4O2HA 1NB3I 4IPBA 4N6V0 2OQEA 1W5ZA 3B4OA 3HIGA 3X41A 3QRDA 4IT7A 5FGOA 2C10A 1OHPA 3J7Yd 1SJWA 1GS3A 3F40A 3GWRA 3F7SA 1JN5A 3UNLA 3EN8A 1SPUA 1E3VA 1OUNA 2WGOA 2CH9A 2IUJA 3NQZA 1Z1SA 3IJEB 1SIIA 4EC6A 2OTJ3 3WODG 4LEHA 1UUVB 3EE1A 4L7KA 4BTWA 4LMIA 3S29A 3V92A 5IENA 1DMQA 3WA3A 3MG2A 3Q90A 1JRQA 1BUQA 2CFDA 5CF2A 3QK9A 1N9EA 1UI8A 4XBXA 1ISKA 3STDA 3SXXA 1IDPA 1JB4A 3Q2PA 1VQL3 4KFDA 2BMOB 2B1XB 3F14A 3GAXA 2P0MA 3MG3A 4HM1B 1GYBA 2JDIH 4LGQA 1OF5B 2RCDA 2D42A 4R80A 3LH4A 4N6TA 3MPHA 2RSXA 1O7HB 1DVDA 3CCR3 1VQO3 1WTHA 5EVHA 1FGOA 1ZO2A 2V1LA 4FR9A 1IT8A 2XH9A 1A2KA 2BT3A 2KCDA 2QA43 4K1UA 1U8CB 1NWWA 2IMJA 3G0KA 3X42A 2W9QA 1VQ83 1W6GA 1STDA 4FCMA 1L5GB 3OXAA 3T8UA 3X3XA 1A2VA 1W7CA 1F8NA 1HKXA 2CC3A 3DXOA 1QAKA 1JB5A 1GD3A 4FMBA 3N9HA 3LYGA 1JJ22 2W6JH 3H51A 4MMZB 1W2ZA 2XR8B 1N8QA 4HM3B 3LTAA 5IG5A 3LTCA 1C7HA 3FGYA 1YVBI 1IVXA 5BXQA 4AEQA 1DYUA 3KN4A 4J8TA 3NQYA 4KFFA 4OUQA 5ELJA 1AVKA 1CEWI 3DGNA 3KSPA 3CCU3 1ULIB 1WQLB 1OH0A 5TGNA 1D6ZA 2BMQB 4JF8A 3H3HA 1Q814 1W4NA 4CDLA 4FCZA 2STDA 3NV0A 2K54A 2C11A 1LXEA 2WO0A 4FMDA 4MJDA 1RN7A 3AMOA 1ULJB 4WP5A 3UB1A 3Q1CA 2W04A 3LOYA 3EBYA 4HM5B 1OGXA 1IVVA 3M8CA 1OACA 3KIIA 4HKVB 2HMOB 3KE7A 3HX8A 3FF0A 1CYUA 3NM2A 5JPUA 3EC9A 2YFLB 1MOLA 2WOHA 5IEPA 3X3ZA 1K734 4N6NB 1OPYA 2WOFA 4WYKB 5AIIA 1R4CA 3DMCA 1IU7A 5AI1A 1Q824 3PGBA 3EF8A 1IK3A 3I0YA 1OHOA 1AVLA 1Y4KA 5CF1A 1S723 3OWUA 4PEJA 1T5YA 1CYVA 2HMNB 3N8BA 1UI7A 3ER7A 3E99A 4HM4B 3I563 2CW9A 4I4KA 4XM4A 1YIJ3 1WNHA 4HM6B 3MHEA 5FW5A 3OV4A 3HI7A 2JQ5A 3DY5A 2R4IA 5D81A 5AEUB 3MKIA 1YJW3 5BVBA 2I9WA 2XFTA 2UX0A 1IVUA 3BB9A 4LZIA 3KZTA 2W9PA 3CNMA 4HBRA 1JNQA 3EBTA 5AYRB 3WOFB 3EB8A 3KKGA 4N6OB 2L4VA 1FA3A 2BO9B 4TX4A 3UL5A 1K41A 1IQYA 1TFKA 3UJMA 4EV5A 2A15A 4HZ9B 4MMXB 2ML6A 1D6UA 2HMLB 1MNLA 3T0UA 1IQXA 1VQ43 5EEOA 5STDA 1JB2A 2CWUA 1LOXA 4KFEA 1JN5B 4X2HA 1VQM3 1KC84 1OF5A 2CG0A 3MYTA 4CCVA 2F86B 1W6CA 3CD63 3KFQC 1G96A 1WMPA 1WMNA 4L8OA 5AYSC 1ZX2A 2INXA 2K0MA 1OGZA 3FCSB 5IERA 3NBRA 3NHXA 3CC23 2LQVA 5IG0A 1ASKA 3LTBA 3I553 2CWTA 1Q42A 2Q07A 4IIAA 3NM7A 2F99A 4N6UA 2E2UA 3IMAB 3EHCA 5ELUA 3EJVA 3RDEA 3V99A 1IVWA 4HM7B 4HM0B 2F98A 1TU5A 1KQS2 3PZWA 3F8XA 3JUOA 3WMDA 4O8SA 1NU3A 1QMAA 1JV2B 1VZZA 3S67A 2OOVC 5CK6A 4JRFA 1GD4A 1M904 2O3OA 4KVHA 5AIFA 1EA2A 1PU4A 2IUKA 6STDA 3K5TA 1VQ63 3LTDA 4EXRA 1DVCA 1YIT3 1W02A 4KZ1A 2MC8A 2CFKA 3CNXA 1E3RA 1Q864 3KSED 1RRLA 4RZMA 4HYZA 4XDVA 4BTXA 4QWTA 3T8NA 1RJOA 2GXFA 2IA7A 3LMLA 4WWUC 4ZM8A 1Q40B 1VQP3 1DMNA 3AMOB 4GL6A 4N6MA 4X2OA 1V74A 4H61A 4L8PA 5AIHA 1N5PA 2HMKB 3DUKA 5IG4A 1VQ73 4STDA 4FMAA 3GZBA 1O7GB 4HJLB 3K9MC 2W56B 3PYJA 3G4S3 1A90A 3DZLA 1KWIA 1JKGA 1NO3A 3CCS3 1CQSA 2WGQA 1O7NB 1QALA 1NJI4 5I97A 3NV0B 1QAFA 4U13A 2P0XA 2XEPA 2M7OA 3ECFA 4FCJA 5DRVA 5AIGA 4AKYA 3B4PA 2B24B 1GY6A 3MSOA 1OHSA 1S5AA 2SBLA 1A67A 3S27A 1YGEA 3O8YA 4NREA 3G6E3 2CIUA 5KP4A 3CC73 3TDGA 1GY5A 4XBTA 2GBWB 2OQEC 2Z6BA 4EV2A 1VQK3 1EKMA 3EX9A 3L0RA 1STFI 3LXUX 3CCE3 4R9KA 4R4KA 4RBNA 1JKGB 2GEXA 3JUNA 4AKZA 3MWZA 4RNZA 2FNQA 3GZYB 4GB5A 1IV9A 2ML5A 3K63A 3U1WA 1OCVA 3B7CA 3PS8A 3V98A 1TUHA 3WA2X 5IW9A 1TIJA 1ROVA 4MEIA 2YFIB 1IT7A 3HIIA 2OCTA 2P38A 2Y73A 2FGTA 2XRXB 2XFSA 1QVF2 2GBXB 3DGOA 2E2VA 1W00A 3X40A 1YJ93 1YJN3 2W0QA 3BNEA 3CCJ3 3K7CA 1M1XB 1W6YA 2KXGA 2E2TA 3BNDA 4FMCA 3CCQ3 3OW22 2CFWA 3U97A 3JVCA 1AV4A 3D3LA 4K90B 3VSYA 1SQWA 5KP1A 3CPOA 2QIYA 4R1KA 3A76A 2CFGA 1FUWA 5JBSA 2ZDJA 4OK0A 1FGMA 4XBYA 3NXJA 3F8HA 1K8A4 5AEWB 1AR0A 2GEYA 5D83A 1HU9A 3SOYA 3HK4A 1DMMA 2RGQA 4EBGA 3GZRA 2ZL8A 2P05A 3UL6A 2RFRA 3EN1B 2OTL3 2YFJB 3S5CA 1EG9B 3JUPA 2CKFB 2QEX3 2PZVA 3EQQB 3CME3 2O9UX 1O7WB 3RGRA 3CMA3 1QJGA 5A0OB 1FGRA 3K0ZA 3FF2A 2XSOB 2YX9A 2CHCA 3FKAA 4OVMA 3NUVA 4WHAA 5IG3A 1TFOA 3BNCA 3CU3A 3CCL3 4HM2B 1FGQA 4G1MB 5JPPA 3MG1A 2KRTA 2W56A 2W03A 3G8ZA 3N54B 4K61A 2Z76A 1N9JA 4LSOA 4WFOA 4HVNA 1IQ8A 1PFPA 1VQN3 1KSIA 2GU1A 2PNCA 3NBBA 3IPTA 3PCSA 3SOAA 3PCRA 3HZPA 2XSHB 2Z77A 5CLKA 3FG3A 4NHFA 4BTYA 3CXC2 2XGNA 2Z7AA 3G713 1NDOB 2XF3A 3WOEB 1Q40A 2D1WA 4K1VA 3BNBA 3DGMA 5EQLA 5G2GA 2XGLA 2BNGA 3OWYA 1GY7A 1M9GA 1KD14 3F9SA 3FSDA 1O7MB 4MMYB 4XB5A 3SEDA 3F7XA 3SX1A 3ROBA 3LZAA 1NB5I 1U5OA 2HMJB 4HM8B 3VGNA 1RRHA 3X3YA 2W2CA 5KP3A 4R9LA 1ROAA 2BHMA 4N6LA 4Q53A 1D6YA 3D9RA 3OWSA 3CPW2 3FZWA 1J2BA 3FLJA 2GU3A 3B8LA 1M1K4 1UW1A 3BLZA 5IEOA 5LC6A 4EYCA 4J9AA 4N3VA 1N8R4 2P09A 1LNHA 1TP6A 3FG4A 3CCV3 4H3UA 2FXTA 3SVAA 1IV7A 4XDWA 1WMOA 3OX9A 2LYXA 3JUMA 1YI23 4HZBB 3DM8A 3NBJA 3VF1A 5IF6A 1US1A 3GRDA 2OWPA 2Y74A 4O02B 3G16A 1RKYA 3RGAA 1O7PB 1N5HA 4ORLA 3DGLA 2CG1A 5D82A 4RNYA 1EQKA 3WDGB 2CFLA 5CXOA 2OOVA 2MF7A 3S28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGU A;  5HGR A;  4MJD A;  6STD A;  3GZX B;  1E97 A;  5DRE A;  1ULJ B;  1W02 A;  4WP5 A;  3NV0 A;  4XBY A;  3CNX A;  3NXJ A;  1E3R A;  3F8H A;  4WYK A;  3EBY A;  4HM5 B;  3JUQ A;  1OGX A;  4RZM A;  5AEW B;  3FH1 A;  1AR0 A;  2GEY A;  3M8C A;  4HKV B;  5D83 A;  4XDV A;  3SOY A;  7STD A;  2HMO B;  3HK4 A;  3T8N A;  1DMM A;  2GXF A;  4WWU C;  2RGQ A;  3KE7 A;  3HX8 A;  1Q40 B;  3FF0 A;  1DMN A;  3NM2 A;  3GZR A;  8CHO A;  5JPU A;  3EC9 A;  2HMM B;  2YFL B;  2RFR A;  1W01 A;  5IEP A;  4X2O A;  1UUW B;  2BMR B;  3EN1 B;  1OPY A;  2YFJ B;  4L8P A;  3B4O A;  3S5C A;  1EG9 B;  4WYK B;  3DMC A;  2HMK B;  5AII A;  3JUP A;  2CKF B;  3DUK A;  5AIH A;  1OHP A;  5IG4 A;  4STD A;  1SJW A;  5AI1 A;  1GS3 A;  1O7G B;  3GZB A;  2PZV A;  3EQQ B;  3F40 A;  3EF8 A;  3GWR A;  4HJL B;  3F7S A;  1O7W B;  3RGR A;  1JN5 A;  1QJG A;  3UNL A;  3I0Y A;  3EN8 A;  3DZL A;  1OHO A;  3K0Z A;  3FF2 A;  2XSO B;  1E3V A;  1JKG A;  2CHC A;  3FKA A;  3OWU A;  1CQS A;  1OUN A;  4OVM A;  3NUV A;  4PEJ A;  1O7N B;  5IG3 A;  2HMN B;  3CU3 A;  3ER7 A;  1Z1S A;  3E99 A;  3NV0 B;  4HM2 B;  4HM4 B;  4I4K A;  4LEH A;  4U13 A;  4XM4 A;  1UUV B;  4L7K A;  2K54 A;  4KVH A;  3ECF A;  3MG1 A;  3MHE A;  4HM6 B;  3OV4 A;  4LMI A;  5FW5 A;  5IEN A;  3G8Z A;  1DMQ A;  2Z76 A;  4HVN A;  2JQ5 A;  3MG2 A;  4FCJ A;  3Q90 A;  5AIG A;  5DRV A;  1BUQ A;  2R4I A;  5D81 A;  5AEU B;  3B4P A;  3MKI A;  5CF2 A;  4XBX A;  5BVB A;  2B24 B;  1GY6 A;  2I9W A;  2UX0 A;  3MSO A;  3STD A;  1ISK A;  1OHS A;  1S5A A;  3BB9 A;  3IPT A;  3KZT A;  1IDP A;  3SOA A;  1JB4 A;  3CNM A;  3EBT A;  3HZP A;  2XSH B;  2Z77 A;  5CLK A;  3KKG A;  2BMO B;  2B1X B;  3F14 A;  2Z7A A;  3MG3 A;  4HM1 B;  1K41 A;  1NDO B;  1Q40 A;  1GYB A;  4K1V A;  5KP4 A;  3UJM A;  4LGQ A;  1GY5 A;  2A15 A;  4HZ9 B;  5G2G A;  1OF5 B;  2RCD A;  4XBT A;  5JPP A;  2BNG A;  3OWY A;  1GY7 A;  2HML B;  3F9S A;  3FSD A;  2GBW B;  1O7M B;  4XB5 A;  1O7H B;  3SED A;  3F7X A;  5EVH A;  3ROB A;  3LZA A;  1ZO2 A;  3CPO A;  1JB2 A;  3EX9 A;  5STD A;  1A2K A;  1U5O A;  1JN5 B;  2HMJ B;  4X2H A;  4HM8 B;  3VGN A;  4R9K A;  4K1U A;  1NWW A;  2W2C A;  1JKG B;  1OF5 A;  2GEX A;  2IMJ A;  3G0K A;  3JUN A;  4R9L A;  5KP3 A;  3MYT A;  4Q53 A;  2F86 B;  3D9R A;  5CF1 A;  3GZY B;  4GB5 A;  3OWS A;  1STD A;  4FCM A;  1OCV A;  3B7C A;  3OXA A;  4L8O A;  3FZW A;  3T8U A;  1HKX A;  1TUH A;  3DXO A;  1ZX2 A;  2INX A;  3FLJ A;  1JB5 A;  2YFI B;  3B8L A;  3BLZ A;  3LYG A;  1OGZ A;  5IEO A;  2XRX B;  5IER A;  3NBR A;  4J9A A;  3H51 A;  4N3V A;  3NHX A;  2XR8 B;  4HM3 B;  1TP6 A;  5IG0 A;  2GBX B;  1ASK A;  4H3U A;  5IG5 A;  1C7H A;  1Q42 A;  1W00 A;  3FGY A;  4IIA A;  2F99 A;  4XDW A;  5BXQ A;  3EHC A;  3EJV A;  3OX9 A;  3K7C A;  3JUM A;  1W6Y A;  4HM7 B;  4J8T A;  4HM0 B;  4HZB B;  2F98 A;  3DM8 A;  5IF6 A;  4OUQ A;  3GRD A;  2OWP A;  3F8X A;  3JUO A;  3KSP A;  3WMD A;  1ULI B;  3G16 A;  3RGA A;  1NU3 A;  1O7P B;  1WQL B;  4ORL A;  1OH0 A;  1QMA A;  5TGN A;  2BMQ B;  1VZZ A;  3H3H A;  5D82 A;  5CK6 A;  3VSY A;  5CXO A;  4CDL A;  2STD A;  5KP1 A;  2QIY A;  4R1K A;  3A76 A;  5AIF A;  1EA2 A; 
#chains in the Genus database with same CATH topology
 1YHQ 3;  2QGU A;  3PXM A;  5HGR A;  1EEJ A;  3NX0 A;  3GZX B;  1W2B 2;  1E97 A;  5DRE A;  2GSP A;  3AHW A;  1Q7Y 4;  2CWV A;  1X1W A;  4O3V A;  1FGT A;  1K28 A;  1BUJ A;  1IYY A;  4WYK A;  3JUQ A;  1K9M 4;  2CK3 H;  1JBT A;  3FH1 A;  1VQ5 3;  1QVG 2;  7STD A;  1SIH A;  4CPK A;  1VQ9 3;  3SLU A;  1LVN A;  5LC7 A;  8CHO A;  3CC4 3;  3FG1 A;  2HMM B;  1W01 A;  1UUW B;  2BMR B;  3ALA A;  3LT8 A;  3LT9 A;  3CCM 3;  4O2H A;  1NB3 I;  4IPB A;  4N6V 0;  2OQE A;  1W5Z A;  3B4O A;  3HIG A;  3X41 A;  3QRD A;  4IT7 A;  5FGO A;  2C10 A;  1OHP A;  3J7Y d;  1SJW A;  1GS3 A;  3F40 A;  1NNV A;  1RGC A;  3GWR A;  3F7S A;  1JN5 A;  3UNL A;  1HYF A;  3EN8 A;  1SPU A;  1E3V A;  1OUN A;  2WGO A;  2CH9 A;  2IUJ A;  3NQZ A;  1Z1S A;  1B27 A;  1SII A;  3IJE B;  2UUG C;  3WOD G;  4EC6 A;  4LEH A;  2OTJ 3;  1UUV B;  3EE1 A;  4L7K A;  1BSC A;  1BSE A;  1RGL A;  4LMI A;  3S29 A;  3V92 A;  4BTW A;  5IEN A;  1DMQ A;  3WA3 A;  3WR2 A;  1DE3 A;  3MG2 A;  3Q90 A;  1JRQ A;  1BUQ A;  1AQZ A;  2CFD A;  5CF2 A;  3QK9 A;  1N9E A;  1UI8 A;  4XBX A;  1ISK A;  1BNE A;  3STD A;  3SXX A;  1RGE A;  1IDP A;  1JZO A;  1JB4 A;  1BSB A;  3Q2P A;  1VQL 3;  4KFD A;  2F5W A;  1X1Y A;  2BMO B;  2B1X B;  3F14 A;  3GAX A;  2P0M A;  3MG3 A;  4HM1 B;  4J5K A;  1BAN A;  1GYB A;  2JDI H;  4BIR A;  4LGQ A;  1OF5 B;  2RCD A;  2D42 A;  4R80 A;  1MWS A;  3LH4 A;  4N6T A;  3MPH A;  2RSX A;  1O7H B;  1DVD A;  3CCR 3;  1VQO 3;  1WTH A;  5EVH A;  1ZS7 A;  1FGO A;  1ZO2 A;  2V1L A;  4FR9 A;  1IT8 A;  1I2G A;  1A2K A;  2XH9 A;  2BT3 A;  2KCD A;  1LRA A;  2QA4 3;  1FUT A;  4K1U A;  1BNF A;  1U8C B;  1NWW A;  2IMJ A;  3G0K A;  5G1L A;  3X42 A;  1EUI C;  2W9Q A;  1VQ8 3;  1W6G A;  1G0T A;  1STD A;  4FCM A;  3OXA A;  1L5G B;  3T8U A;  1A2V A;  1W7C A;  1F8N A;  1HKX A;  3X3X A;  2CC3 A;  3DXO A;  1QAK A;  1JB5 A;  2AAE A;  1B21 A;  1GD3 A;  4FMB A;  3N9H A;  3LYG A;  1JJ2 2;  2W6J H;  3H51 A;  4MMZ B;  1W2Z A;  2XR8 B;  1N8Q A;  4HM3 B;  3LTA A;  5IG5 A;  3LTC A;  1C7H A;  3FGY A;  1YVB I;  1IVX A;  1FUS A;  5BXQ A;  4AEQ A;  1DYU A;  3KN4 A;  1BRN L;  4J8T A;  1RN1 A;  3NQY A;  4KFF A;  4OUQ A;  5ELJ A;  1AVK A;  1CEW I;  3DGN A;  3KSP A;  3CCU 3;  1ULI B;  1WQL B;  1OH0 A;  5TGN A;  1D6Z A;  2BMQ B;  1V57 A;  3H3H A;  4JF8 A;  1Q81 4;  1W4N A;  4CDL A;  4FCZ A;  2STD A;  1RCL A;  2RNT A;  3NV0 A;  1MWT A;  2K54 A;  2KF6 A;  2C11 A;  1G02 A;  1SAR A;  1LXE A;  2WO0 A;  4FMD A;  4MJD A;  1RN7 A;  1UCK A;  1C54 A;  6GSP A;  3AMO A;  3D5I A;  1ULJ B;  4WP5 A;  1B2M A;  2H0G A;  3UB1 A;  3Q1C A;  2W04 A;  3LOY A;  1LQM B;  3EBY A;  1RTU A;  1OGX A;  2K3D A;  4HM5 B;  1IVV A;  3M8C A;  1OAC A;  3KII A;  4HKV B;  2HOH A;  2HMO B;  2IY2 A;  1BNG A;  3KE7 A;  3HX8 A;  2F4Y A;  3FF0 A;  1CYU A;  3NM2 A;  5JPU A;  3EC9 A;  2YFL B;  1MOL A;  2WOH A;  5IEP A;  3X3Z A;  1K73 4;  2J8X B;  4N6N B;  1RNT A;  1OPY A;  2WOF A;  4WYK B;  5AII A;  1R4C A;  3DMC A;  1RDS A;  3SYU A;  1IU7 A;  1BRG A;  5AI1 A;  1GOU A;  1Q82 4;  3PGB A;  3EF8 A;  1LOW A;  1IK3 A;  4NPB A;  3ZG0 A;  4BU4 A;  3I0Y A;  1PY3 A;  1OHO A;  1AVL A;  1Y4K A;  5CF1 A;  1S72 3;  3OWU A;  4HAA A;  4PEJ A;  1T5Y A;  4EW5 A;  4HBR A;  1CYV A;  2HMN B;  3N8B A;  3GSP A;  1UI7 A;  3A5E A;  3E99 A;  3ER7 A;  4HM4 B;  2CW9 A;  3I56 3;  5G1K A;  4I4K A;  4XM4 A;  1YIJ 3;  1WNH A;  1GMR A;  3MHE A;  4HM6 B;  1B2Z A;  3OV4 A;  5FW5 A;  3HI7 A;  2JQ5 A;  3DY5 A;  2BU4 A;  2R4I A;  3AHS A;  3DH2 A;  3MKI A;  5D81 A;  5AEU B;  1YJW 3;  5BVB A;  2I9W A;  2XFT A;  2UX0 A;  3Q3F A;  1BGS A;  1IVU A;  3BB9 A;  4LZI A;  3KZT A;  4LYL B;  2W9P A;  1BU4 A;  3CNM A;  1JNQ A;  1A2P A;  1PYL A;  3EBT A;  1HZ1 A;  3EB8 A;  3KKG A;  4N6O B;  5AYR B;  3WOF B;  3ZFZ A;  2L4V A;  1RGH A;  1FA3 A;  2BO9 B;  4TX4 A;  3UL5 A;  1K41 A;  1IQY A;  1TFK A;  3UJM A;  4EV5 A;  2A15 A;  1T3B A;  4HZ9 B;  4MMX B;  2ML6 A;  1D6U A;  2HML B;  1MNL A;  3T0U A;  1IQX A;  1VQ4 3;  2KF4 A;  5EEO A;  5STD A;  1JB2 A;  2CWU A;  1LOX A;  4KFE A;  1JN5 B;  4X2H A;  1VQM 3;  1I3I A;  1KC8 4;  1OF5 A;  2CG0 A;  3MYT A;  4CCV A;  2F86 B;  1W6C A;  1X1X A;  3CD6 3;  3KFQ C;  1G96 A;  1I2E A;  1WMP A;  1WMN A;  4L8O A;  5AYS C;  2BIR A;  1ZX2 A;  2INX A;  2K0M A;  4KT3 B;  1MGW A;  1OGZ A;  3FCS B;  5IER A;  3NBR A;  1TTO A;  1RHL A;  3NHX A;  3CC2 3;  2LQV A;  5IG0 A;  1ASK A;  1BRS A;  3LTB A;  3I55 3;  2CWT A;  1UGH I;  1Q42 A;  2Q07 A;  5M18 A;  4IIA A;  3NM7 A;  2F99 A;  4N6U A;  2E2U A;  3IMA B;  3EHC A;  1I3F A;  5ELU A;  3EJV A;  1T2I A;  3RDE A;  3D5G A;  3V99 A;  1IVW A;  4HM7 B;  4HM0 B;  2F98 A;  1TU5 A;  1KQS 2;  3PZW A;  5M19 A;  6RNT A;  3F8X A;  3JUO A;  3WMD A;  4BL2 A;  4O8S A;  3BIR A;  1NU3 A;  1QMA A;  1JV2 B;  1VZZ A;  3S67 A;  2OOV C;  5CK6 A;  4JRF A;  1GD4 A;  1LNI A;  1M90 4;  2O3O A;  4KVH A;  5AIF A;  1EA2 A;  1PU4 A;  1DET A;  2KAA A;  2IUK A;  6STD A;  3K5T A;  2F5M A;  1VQ6 3;  3LTD A;  4EXR A;  1RNB A;  4ILF A;  3D79 A;  1DVC A;  1YIT 3;  1W02 A;  1BSD A;  4KZ1 A;  2MC8 A;  1V58 A;  2CFK A;  4RNT A;  3CNX A;  1E3R A;  1Q86 4;  2H0I A;  3KSE D;  1RRL A;  4RZM A;  4GSP A;  4HYZ A;  4XDV A;  4BTX A;  4QWT A;  1YGW A;  1B20 A;  1RJO A;  2GXF A;  2IA7 A;  3LML A;  4WWU C;  1Q40 B;  3RNT A;  4ZM8 A;  1VQP 3;  1DMN A;  3AMO B;  1UCI A;  4BL3 A;  4GL6 A;  4N6M A;  4X2O A;  1V74 A;  4H61 A;  4L8P A;  5AIH A;  1N5P A;  2HMK B;  2IYJ A;  3DUK A;  5IG4 A;  1VQ7 3;  4STD A;  4FMA A;  3AGN A;  1O7G B;  3GZB A;  4HJL B;  9RNT A;  3K9M C;  2W56 B;  3PYJ A;  3G4S 3;  1A90 A;  3DZL A;  1KWI A;  2L1S A;  1JKG A;  1NO3 A;  3CCS 3;  1CQS A;  2WGQ A;  1O7N B;  2CX0 A;  1QAL A;  1NJI 4;  5I97 A;  1UDI I;  3NV0 B;  1QAF A;  4U13 A;  2P0X A;  2XEP A;  2M7O A;  1RCK A;  3ECF A;  1FZU A;  2C4B A;  1RGF A;  1RGK A;  2AAD A;  4FCJ A;  5DRV A;  1T2H A;  5AIG A;  4AKY A;  3B4P A;  2B24 B;  1GY6 A;  3MSO A;  1OHS A;  1S5A A;  2SBL A;  1A67 A;  1GOY A;  1GSP A;  3S27 A;  1YVS A;  1YGE A;  3O8Y A;  4NRE A;  3G6E 3;  2CIU A;  5KP4 A;  3CC7 3;  3TDG A;  1GY5 A;  1GMQ A;  4XBT A;  1BNS A;  2GBW B;  2OQE C;  1RSN A;  2Z6B A;  4EV2 A;  1VQK 3;  1TRQ A;  1EKM A;  8RNT A;  3BU4 A;  1YNV X;  1B2S A;  1STF I;  3EX9 A;  3L0R A;  1LOY A;  3LXU X;  3CCE 3;  4R9K A;  7RNT A;  1TJD A;  4R4K A;  1FYS A;  4RBN A;  1BOX A;  1JKG B;  2GEX A;  3JUN A;  1BNI A;  4AKZ A;  1BVI A;  3MWZ A;  4RNZ A;  2FNQ A;  3GZY B;  4GB5 A;  1IV9 A;  1BRH A;  2ML5 A;  1X1U A;  1I8V A;  3K63 A;  3U1W A;  1OCV A;  3B7C A;  3PS8 A;  3V98 A;  1BNR A;  1TUH A;  3WA2 X;  5IW9 A;  1TIJ A;  1ROV A;  4MEI A;  2SAR A;  3T8N A;  2YFI B;  1IT7 A;  3HII A;  2OCT A;  2P38 A;  2Y73 A;  2FGT A;  1RMS A;  2XRX B;  1BIR A;  2XFS A;  1QVF 2;  1I70 A;  2GBX B;  2E2V A;  3DGO A;  1W00 A;  3X40 A;  1YJ9 3;  1B2X A;  1LQG C;  1YJN 3;  1BAO A;  2W0Q A;  3BNE A;  3CCJ 3;  3K7C A;  1M1X B;  1W6Y A;  2KXG A;  2E2T A;  3BND A;  4FMC A;  4J5G A;  3CCQ 3;  1B3S A;  3OW2 2;  1MWU A;  2CFW A;  1TRP A;  3U97 A;  2ZA4 A;  3JVC A;  1AV4 A;  3D3L A;  4K90 B;  2ZHX B;  3AGO A;  3VSY A;  2UGI A;  1SQW A;  5KP1 A;  2QIY A;  3CPO A;  4R1K A;  3A76 A;  2KF3 A;  4DKI A;  5M1A A;  2CFG A;  1Q9E A;  1FUW A;  5JBS A;  2ZDJ A;  4HOH A;  4OK0 A;  1FGM A;  4XBY A;  3NXJ A;  1R4Y A;  3F8H A;  1K8A 4;  2KF5 A;  5AEW B;  1BSA A;  3HOH A;  1AR0 A;  2GEY A;  5D83 A;  1HU9 A;  3SOY A;  3HK4 A;  1DMM A;  1UCJ A;  2RGQ A;  1RN4 A;  4EBG A;  3GZR A;  2ZL8 A;  2P05 A;  3UL6 A;  2RFR A;  3EN1 B;  2OTL 3;  2YFJ B;  3S5C A;  1EG9 B;  1Q7H A;  1RLS A;  3JUP A;  2CKF B;  2QEX 3;  3KCH A;  2PZV A;  3EQQ B;  3CME 3;  2O9U X;  1O7W B;  3RGR A;  1AY7 A;  1JZD A;  1QJG A;  5A0O B;  3CMA 3;  1ZGX A;  1FGR A;  3URP A;  3K0Z A;  1FW7 A;  3FF2 A;  2XSO B;  2YX9 A;  2CHC A;  3FKA A;  4OVM A;  3NUV A;  4WHA A;  5IG3 A;  1TFO A;  3BNC A;  3CU3 A;  7GSP A;  3CCL 3;  4GHO A;  4HM2 B;  1FGQ A;  4G1M B;  5JPP A;  3MG1 A;  2KRT A;  2W56 A;  2W03 A;  2R41 A;  3G8Z A;  3N54 B;  2Z76 A;  1N9J A;  4K61 A;  4LSO A;  4HVN A;  4WFO A;  1IQ8 A;  3ZG5 A;  5GSP A;  1JBR A;  1PFP A;  1VQN 3;  1KSI A;  1UUG B;  2CX1 A;  2GU1 A;  2PNC A;  3NBB A;  3IPT A;  3PCS A;  1BRI A;  3SOA A;  3PCR A;  3HZP A;  2XSH B;  1B2U A;  2Z77 A;  3FG3 A;  4NHF A;  5CLK A;  4BTY A;  2XGN A;  3CXC 2;  2Z7A A;  3G71 3;  1NDO B;  2XF3 A;  3WOE B;  1Q40 A;  1VQQ A;  2D1W A;  4K1V A;  3BNB A;  4CJN A;  3DGM A;  5EQL A;  5G2G A;  1CH0 A;  2XGL A;  2BNG A;  3OWY A;  1GY7 A;  1I0X A;  1M9G A;  3F9S A;  3FSD A;  4I5Q A;  1KD1 4;  1O7M B;  1RGG A;  1GOV A;  4MMY B;  4XB5 A;  3SED A;  3F7X A;  5BU4 A;  3D4A A;  3SX1 A;  3ROB A;  3LZA A;  1NB5 I;  5RNT A;  1U5O A;  2HMJ B;  1BRJ A;  4HM8 B;  3VGN A;  1RRH A;  3X3Y A;  2W2C A;  5KP3 A;  4R9L A;  1ROA A;  2BHM A;  4N6L A;  4Q53 A;  1D6Y A;  3D9R A;  3OWS A;  1BRK A;  1MWR A;  3CPW 2;  3FZW A;  1J2B A;  2F56 A;  3DGY A;  1LOV A;  1RGA A;  3FLJ A;  1MGR A;  2GU3 A;  3B8L A;  1M1K 4;  1UW1 A;  3BLZ A;  5IEO A;  5LC6 A;  1GMP A;  4EYC A;  1UGI A;  4J9A A;  4N3V A;  1N8R 4;  2P09 A;  1LNH A;  1TP6 A;  3FG4 A;  3CCV 3;  4H3U A;  1JBS A;  1UCL A;  2FXT A;  3SVA A;  1BNJ A;  1IV7 A;  4XDW A;  1WMO A;  3OX9 A;  2LYX A;  3WHO A;  3JUM A;  1YI2 3;  4HZB B;  3DM8 A;  3NBJ A;  3VF1 A;  5IF6 A;  1US1 A;  2H0H A;  2OWP A;  2Y74 A;  3GRD A;  4O02 B;  3G16 A;  1RKY A;  3RGA A;  1O7P B;  1N5H A;  2RBI A;  4ORL A;  3DGL A;  2CG1 A;  5BIR A;  5D82 A;  4RNY A;  1I0V A;  1I2F A;  3WDG B;  2CFL A;  5CXO A;  2OOV A;  5HOH A;  1EQK A;  2MF7 A;  3S28 A; 
#chains in the Genus database with same CATH homology
 1YHQ 3;  2QGU A;  3PXM A;  5HGR A;  3NX0 A;  3GZX B;  1W2B 2;  1E97 A;  5DRE A;  1Q7Y 4;  2CWV A;  4O3V A;  1FGT A;  1K28 A;  4WYK A;  3JUQ A;  1K9M 4;  2CK3 H;  3FH1 A;  1VQ5 3;  1QVG 2;  7STD A;  1SIH A;  1VQ9 3;  3SLU A;  1LVN A;  5LC7 A;  8CHO A;  3CC4 3;  3FG1 A;  2HMM B;  1W01 A;  1UUW B;  2BMR B;  3ALA A;  3LT8 A;  3LT9 A;  3CCM 3;  4O2H A;  1NB3 I;  4IPB A;  4N6V 0;  2OQE A;  1W5Z A;  3B4O A;  3HIG A;  3X41 A;  3QRD A;  4IT7 A;  5FGO A;  2C10 A;  1OHP A;  3J7Y d;  1SJW A;  1GS3 A;  3F40 A;  3GWR A;  3F7S A;  1JN5 A;  3UNL A;  3EN8 A;  1SPU A;  1E3V A;  1OUN A;  2WGO A;  2CH9 A;  2IUJ A;  3NQZ A;  1Z1S A;  3IJE B;  1SII A;  4EC6 A;  2OTJ 3;  3WOD G;  4LEH A;  1UUV B;  3EE1 A;  4L7K A;  4BTW A;  4LMI A;  3S29 A;  3V92 A;  5IEN A;  1DMQ A;  3WA3 A;  3MG2 A;  3Q90 A;  1JRQ A;  1BUQ A;  2CFD A;  5CF2 A;  3QK9 A;  1N9E A;  1UI8 A;  4XBX A;  1ISK A;  3STD A;  3SXX A;  1IDP A;  1JB4 A;  3Q2P A;  1VQL 3;  4KFD A;  2BMO B;  2B1X B;  3F14 A;  3GAX A;  2P0M A;  3MG3 A;  4HM1 B;  1GYB A;  2JDI H;  4LGQ A;  1OF5 B;  2RCD A;  2D42 A;  4R80 A;  3LH4 A;  4N6T A;  3MPH A;  2RSX A;  1O7H B;  1DVD A;  3CCR 3;  1VQO 3;  1WTH A;  5EVH A;  1FGO A;  1ZO2 A;  2V1L A;  4FR9 A;  1IT8 A;  2XH9 A;  1A2K A;  2BT3 A;  2KCD A;  2QA4 3;  4K1U A;  1U8C B;  1NWW A;  2IMJ A;  3G0K A;  3X42 A;  2W9Q A;  1VQ8 3;  1W6G A;  1STD A;  4FCM A;  1L5G B;  3OXA A;  3T8U A;  3X3X A;  1A2V A;  1W7C A;  1F8N A;  1HKX A;  2CC3 A;  3DXO A;  1QAK A;  1JB5 A;  1GD3 A;  4FMB A;  3N9H A;  3LYG A;  1JJ2 2;  2W6J H;  3H51 A;  4MMZ B;  1W2Z A;  2XR8 B;  1N8Q A;  4HM3 B;  3LTA A;  5IG5 A;  3LTC A;  1C7H A;  3FGY A;  1YVB I;  1IVX A;  5BXQ A;  4AEQ A;  1DYU A;  3KN4 A;  4J8T A;  3NQY A;  4KFF A;  4OUQ A;  5ELJ A;  1AVK A;  1CEW I;  3DGN A;  3KSP A;  3CCU 3;  1ULI B;  1WQL B;  1OH0 A;  5TGN A;  1D6Z A;  2BMQ B;  4JF8 A;  3H3H A;  1Q81 4;  1W4N A;  4CDL A;  4FCZ A;  2STD A;  3NV0 A;  2K54 A;  2C11 A;  1LXE A;  2WO0 A;  4FMD A;  4MJD A;  1RN7 A;  3AMO A;  1ULJ B;  4WP5 A;  3UB1 A;  3Q1C A;  2W04 A;  3LOY A;  3EBY A;  4HM5 B;  1OGX A;  1IVV A;  3M8C A;  1OAC A;  3KII A;  4HKV B;  2HMO B;  3KE7 A;  3HX8 A;  3FF0 A;  1CYU A;  3NM2 A;  5JPU A;  3EC9 A;  2YFL B;  1MOL A;  2WOH A;  5IEP A;  3X3Z A;  1K73 4;  4N6N B;  1OPY A;  2WOF A;  4WYK B;  5AII A;  1R4C A;  3DMC A;  1IU7 A;  5AI1 A;  1Q82 4;  3PGB A;  3EF8 A;  1IK3 A;  3I0Y A;  1OHO A;  1AVL A;  1Y4K A;  5CF1 A;  1S72 3;  3OWU A;  4PEJ A;  1T5Y A;  1CYV A;  2HMN B;  3N8B A;  1UI7 A;  3ER7 A;  3E99 A;  4HM4 B;  3I56 3;  2CW9 A;  4I4K A;  4XM4 A;  1YIJ 3;  1WNH A;  4HM6 B;  3MHE A;  5FW5 A;  3OV4 A;  3HI7 A;  2JQ5 A;  3DY5 A;  2R4I A;  5D81 A;  5AEU B;  3MKI A;  1YJW 3;  5BVB A;  2I9W A;  2XFT A;  2UX0 A;  1IVU A;  3BB9 A;  4LZI A;  3KZT A;  2W9P A;  3CNM A;  4HBR A;  1JNQ A;  3EBT A;  5AYR B;  3WOF B;  3EB8 A;  3KKG A;  4N6O B;  2L4V A;  1FA3 A;  2BO9 B;  4TX4 A;  3UL5 A;  1K41 A;  1IQY A;  1TFK A;  3UJM A;  4EV5 A;  2A15 A;  4HZ9 B;  4MMX B;  2ML6 A;  1D6U A;  2HML B;  1MNL A;  3T0U A;  1IQX A;  1VQ4 3;  5EEO A;  5STD A;  1JB2 A;  2CWU A;  1LOX A;  4KFE A;  1JN5 B;  4X2H A;  1VQM 3;  1KC8 4;  1OF5 A;  2CG0 A;  3MYT A;  4CCV A;  2F86 B;  1W6C A;  3CD6 3;  3KFQ C;  1G96 A;  1WMP A;  1WMN A;  4L8O A;  5AYS C;  1ZX2 A;  2INX A;  2K0M A;  1OGZ A;  3FCS B;  5IER A;  3NBR A;  3NHX A;  3CC2 3;  2LQV A;  5IG0 A;  1ASK A;  3LTB A;  3I55 3;  2CWT A;  1Q42 A;  2Q07 A;  4IIA A;  3NM7 A;  2F99 A;  4N6U A;  2E2U A;  3IMA B;  3EHC A;  5ELU A;  3EJV A;  3RDE A;  3V99 A;  1IVW A;  4HM7 B;  4HM0 B;  2F98 A;  1TU5 A;  1KQS 2;  3PZW A;  3F8X A;  3JUO A;  3WMD A;  4O8S A;  1NU3 A;  1QMA A;  1JV2 B;  1VZZ A;  3S67 A;  2OOV C;  5CK6 A;  4JRF A;  1GD4 A;  1M90 4;  2O3O A;  4KVH A;  5AIF A;  1EA2 A;  1PU4 A;  2IUK A;  6STD A;  3K5T A;  1VQ6 3;  3LTD A;  4EXR A;  1DVC A;  1YIT 3;  1W02 A;  4KZ1 A;  2MC8 A;  2CFK A;  3CNX A;  1E3R A;  1Q86 4;  3KSE D;  1RRL A;  4RZM A;  4HYZ A;  4XDV A;  4BTX A;  4QWT A;  3T8N A;  1RJO A;  2GXF A;  2IA7 A;  3LML A;  4WWU C;  4ZM8 A;  1Q40 B;  1VQP 3;  1DMN A;  3AMO B;  4GL6 A;  4N6M A;  4X2O A;  1V74 A;  4H61 A;  4L8P A;  5AIH A;  1N5P A;  2HMK B;  3DUK A;  5IG4 A;  1VQ7 3;  4STD A;  4FMA A;  3GZB A;  1O7G B;  4HJL B;  3K9M C;  2W56 B;  3PYJ A;  3G4S 3;  1A90 A;  3DZL A;  1KWI A;  1JKG A;  1NO3 A;  3CCS 3;  1CQS A;  2WGQ A;  1O7N B;  1QAL A;  1NJI 4;  5I97 A;  3NV0 B;  1QAF A;  4U13 A;  2P0X A;  2XEP A;  2M7O A;  3ECF A;  4FCJ A;  5DRV A;  5AIG A;  4AKY A;  3B4P A;  2B24 B;  1GY6 A;  3MSO A;  1OHS A;  1S5A A;  2SBL A;  1A67 A;  3S27 A;  1YGE A;  3O8Y A;  4NRE A;  3G6E 3;  2CIU A;  5KP4 A;  3CC7 3;  3TDG A;  1GY5 A;  4XBT A;  2GBW B;  2OQE C;  2Z6B A;  4EV2 A;  1VQK 3;  1EKM A;  3EX9 A;  3L0R A;  1STF I;  3LXU X;  3CCE 3;  4R9K A;  4R4K A;  4RBN A;  1JKG B;  2GEX A;  3JUN A;  4AKZ A;  3MWZ A;  4RNZ A;  2FNQ A;  3GZY B;  4GB5 A;  1IV9 A;  2ML5 A;  3K63 A;  3U1W A;  1OCV A;  3B7C A;  3PS8 A;  3V98 A;  1TUH A;  3WA2 X;  5IW9 A;  1TIJ A;  1ROV A;  4MEI A;  2YFI B;  1IT7 A;  3HII A;  2OCT A;  2P38 A;  2Y73 A;  2FGT A;  2XRX B;  2XFS A;  1QVF 2;  2GBX B;  3DGO A;  2E2V A;  1W00 A;  3X40 A;  1YJ9 3;  1YJN 3;  2W0Q A;  3BNE A;  3CCJ 3;  3K7C A;  1M1X B;  1W6Y A;  2KXG A;  2E2T A;  3BND A;  4FMC A;  3CCQ 3;  3OW2 2;  2CFW A;  3U97 A;  3JVC A;  1AV4 A;  3D3L A;  4K90 B;  3VSY A;  1SQW A;  5KP1 A;  3CPO A;  2QIY A;  4R1K A;  3A76 A;  2CFG A;  1FUW A;  5JBS A;  2ZDJ A;  4OK0 A;  1FGM A;  4XBY A;  3NXJ A;  3F8H A;  1K8A 4;  5AEW B;  1AR0 A;  2GEY A;  5D83 A;  1HU9 A;  3SOY A;  3HK4 A;  1DMM A;  2RGQ A;  4EBG A;  3GZR A;  2ZL8 A;  2P05 A;  3UL6 A;  2RFR A;  3EN1 B;  2OTL 3;  2YFJ B;  3S5C A;  1EG9 B;  3JUP A;  2CKF B;  2QEX 3;  2PZV A;  3EQQ B;  3CME 3;  2O9U X;  1O7W B;  3RGR A;  3CMA 3;  1QJG A;  5A0O B;  1FGR A;  3K0Z A;  3FF2 A;  2XSO B;  2YX9 A;  2CHC A;  3FKA A;  4OVM A;  3NUV A;  4WHA A;  5IG3 A;  1TFO A;  3BNC A;  3CU3 A;  3CCL 3;  4HM2 B;  1FGQ A;  4G1M B;  5JPP A;  3MG1 A;  2KRT A;  2W56 A;  2W03 A;  3G8Z A;  3N54 B;  4K61 A;  2Z76 A;  1N9J A;  4LSO A;  4WFO A;  4HVN A;  1IQ8 A;  1PFP A;  1VQN 3;  1KSI A;  2GU1 A;  2PNC A;  3NBB A;  3IPT A;  3PCS A;  3SOA A;  3PCR A;  3HZP A;  2XSH B;  2Z77 A;  5CLK A;  3FG3 A;  4NHF A;  4BTY A;  3CXC 2;  2XGN A;  2Z7A A;  3G71 3;  1NDO B;  2XF3 A;  3WOE B;  1Q40 A;  2D1W A;  4K1V A;  3BNB A;  3DGM A;  5EQL A;  5G2G A;  2XGL A;  2BNG A;  3OWY A;  1GY7 A;  1M9G A;  1KD1 4;  3F9S A;  3FSD A;  1O7M B;  4MMY B;  4XB5 A;  3SED A;  3F7X A;  3SX1 A;  3ROB A;  3LZA A;  1NB5 I;  1U5O A;  2HMJ B;  4HM8 B;  3VGN A;  1RRH A;  3X3Y A;  2W2C A;  5KP3 A;  4R9L A;  1ROA A;  2BHM A;  4N6L A;  4Q53 A;  1D6Y A;  3D9R A;  3OWS A;  3CPW 2;  3FZW A;  1J2B A;  3FLJ A;  2GU3 A;  3B8L A;  1M1K 4;  1UW1 A;  3BLZ A;  5IEO A;  5LC6 A;  4EYC A;  4J9A A;  4N3V A;  1N8R 4;  2P09 A;  1LNH A;  1TP6 A;  3FG4 A;  3CCV 3;  4H3U A;  2FXT A;  3SVA A;  1IV7 A;  4XDW A;  1WMO A;  3OX9 A;  2LYX A;  3JUM A;  1YI2 3;  4HZB B;  3DM8 A;  3NBJ A;  3VF1 A;  5IF6 A;  1US1 A;  3GRD A;  2OWP A;  2Y74 A;  4O02 B;  3G16 A;  1RKY A;  3RGA A;  1O7P B;  1N5H A;  4ORL A;  3DGL A;  2CG1 A;  5D82 A;  4RNY A;  1EQK A;  3WDG B;  2CFL A;  5CXO A;  2OOV A;  2MF7 A;  3S28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...