4HKVB

Naphthalene 1,2-dioxygenase bound to benzamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Naphthalene 1,2-dioxygenase subunit alpha
publication title Naphthalene 1,2-Dioxygenase bound to benzamide
rcsb
source organism Pseudomonas sp. c18
total genus 58
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hkvB00
3F8XA 4LGQA 4CDLA 4XBXA 1HKXA 5CLKA 4OVMA 5IG3A 4HM4B 3K0ZA 5AEWB 4XB5A 3BLZA 5IEPA 5D82A 2XR8B 3FLJA 3SEDA 4HJLB 1JB4A 3MG2A 2BMQB 3JUOA 4IIAA 3KSPA 2HMKB 3EBYA 3EN8A 2INXA 1O7NB 2RCDA 3F7XA 4WWUC 3HZPA 3JUNA 3GZYB 1ULIB 1ZO2A 4Q53A 2Z77A 3CU3A 1W6YA 3F8HA 2QIYA 1UUVB 3OV4A 4KVHA 1STDA 5DREA 3E99A 5IG5A 4L8OA 4HM3B 5CF1A 3KE7A 1DMNA 2GEYA 3MG1A 3NUVA 3G8ZA 2OWPA 3IPTA 3EC9A 2GEXA 3EBTA 2R4IA 3CNXA 3EX9A 3OWYA 1SJWA 5CK6A 5IF6A 2F86B 3STDA 4LEHA 3F9SA 2GBXB 3MKIA 1NWWA 3GZRA 1ULJB 1OCVA 1VZZA 4FCMA 3DUKA 1GY5A 4K1UA 4XM4A 1UUWB 3SOYA 1NU3A 2YFIB 3D9RA 1CQSA 4WYKA 3H51A 3RGAA 1JB2A 1WQLB 2I9WA 4L8PA 3KZTA 4WP5A 3GZXB 1DMQA 3NXJA 3NV0A 2GXFA 3M8CA 1OHPA 1Q42A 2W2CA 1IDPA 4X2OA 3DM8A 1O7GB 4J8TA 5AIFA 5AI1A 2Z7AA 4HVNA 1OH0A 5IENA 3DMCA 3B4OA 3WMDA 5BXQA 4ORLA 3DXOA 5FW5A 5STDA 1Q40A 3JUQA 4HM1B 4HM6B 1GYBA 3B7CA 5AIGA 4STDA 5AEUB 1E3RA 2B1XB 2XSHB 4LMIA 3LYGA 3T8UA 3GRDA 2QGUA 3GZBA 5CXOA 3HX8A 2F98A 1GY6A 4XDVA 7STDA 5IG4A 4HZBB 5D83A 2XSOB 1OGZA 3CNMA 3SOAA 5JPPA 3FZWA 1E97A 2RFRA 3H3HA 2A15A 3EN1B 1EG9B 1ISKA 1O7HB 2CHCA 4HM7B 3CPOA 5BVBA 3Q90A 4HM2B 4R9LA 2UX0A 3ECFA 4I4KA 6STDA 5HGRA 1QJGA 1JB5A 1A2KA 3FKAA 4H3UA 3MHEA 1QMAA 1BUQA 1ASKA 4WYKB 2YFJB 1JN5B 1OPYA 3EQQB 5D81A 4X2HA 2CKFB 3MYTA 1JKGB 5IERA 3HK4A 2STDA 4N3VA 1NDOB 3I0YA 2HMLB 2JQ5A 2HMJB 3RGRA 2BMRB 1U5OA 3S5CA 2K54A 3EHCA 3UJMA 2BMOB 2HMNB 1C7HA 3VSYA 3KKGA 3FSDA 1Z1SA 1OF5A 3G16A 4PEJA 3ER7A 3G0KA 3JUPA 3NM2A 4RZMA 2PZVA 3EJVA 1K41A 3JUMA 3OXAA 2F99A 5JPUA 1EA2A 2GBWB 3NHXA 4OUQA 3NBRA 4HM0B 4HM8B 1GS3A 5EVHA 3T8NA 3EF8A 3FGYA 2HMMB 4HZ9B 3F40A 4MJDA 3VGNA 4XBYA 3BB9A 2XRXB 3K7CA 3ROBA 4K1VA 4FCJA 5AIIA 4J9AA 5DRVA 1OHSA 4GB5A 4U13A 1O7PB 1O7WB 3FF2A 1TP6A 1S5AA 3UNLA 4L7KA 5CF2A 2YFLB 3F7SA 4XDWA 4R1KA 1ZX2A 4HKVB 1OGXA 4HM5B 5IEOA 5KP1A 1AR0A 2Z76A 3LZAA 5KP4A 5IG0A 3DZLA 3OWUA 2B24B 3OWSA 3MG3A 3NV0B 3F14A 1TUHA 1E3VA 1O7MB 3OX9A 3FH1A 3GWRA 2HMOB 3FF0A 3MSOA 1DMMA 5KP3A 1OUNA 4R9KA 5TGNA 8CHOA 1W00A 3A76A 1JN5A 1Q40B 1W01A 4XBTA 2BNGA 1OF5B 1W02A 5AIHA 2RGQA 1OHOA 2IMJA 1GY7A 5G2GA 1JKGA 3B8LA 3B4PA
chains in the Genus database with same CATH superfamily
2L1SA 3AMOB 3AGNA 1VQ53 4EW5A 2H0HA 1K9M4 3X3ZA 1MGWA 3F8XA 4LGQA 4BTYA 4CDLA 1RCKA 4XBXA 1IT8A 1FW7A 3X3YA 1TRPA 4WHAA 1DETA 1HKXA 4OVMA 5CLKA 3CMA3 3X42A 5IG3A 1BRNL 4HM4B 1N5HA 3K0ZA 1KC84 5AEWB 4XB5A 4N6LA 3BLZA 1WMOA 3CME3 1LOXA 1IVUA 3DGYA 5IEPA 5D82A 1IQ8A 2XR8B 4RNYA 1PY3A 3D5IA 3FLJA 3SEDA 1UGHI 4HJLB 3K9MC 1B27A 1RCLA 1BNSA 3N9HA 2OQEA 4BTXA 1JB4A 1NNVA 2CWVA 1QAFA 3CCJ3 3AHWA 1YGWA 3MG2A 1WNHA 4BU4A 4RNZA 8RNTA 2BMQB 3JUOA 1A90A 1SIHA 1T2HA 1F8NA 1VQP3 1GOVA 1RMSA 4IIAA 3KSPA 2HMKB 1FYSA 2UUGC 2INXA 3EBYA 3EN8A 3HIIA 9RNTA 1LQGC 1O7NB 1KQS2 2XH9A 2RCDA 3F7XA 2W9PA 4KFFA 4WWUC 3HZPA 2QEX3 3JUNA 3GZYB 1RNBA 1ULIB 2PNCA 2W04A 2CFGA 4CPKA 1ZO2A 4Q53A 3LTCA 2JDIH 2Z77A 2MC8A 1BNRA 2GSPA 1RNTA 1W6YA 1RGCA 3CU3A 2QIYA 3F8HA 4FCZA 4FMCA 1UUVB 3OV4A 4KVHA 1STDA 4LSOA 2CWUA 5DREA 2WOFA 3E99A 3PS8A 5IG5A 1R4YA 1VQQA 2P0MA 2XF3A 4HYZA 2BT3A 1RRLA 1NJI4 1M1XB 1MWTA 1EKMA 4L8OA 2KXGA 4BIRA 1BSEA 2F4YA 4HM3B 5CF1A 3KE7A 4NHFA 1DMNA 2GEYA 3FG4A 4ZM8A 1NB5I 1FGTA 2OTL3 1KWIA 3MG1A 1IQYA 3FG3A 3X41A 3WHOA 3NUVA 1W4NA 4ILFA 4TX4A 3G8ZA 2OWPA 2P05A 4JF8A 5GSPA 3BNCA 2IYJA 3CCR3 3IPTA 3V99A 1PYLA 1TFKA 1X1WA 2W56B 3S28A 3V92A 1YI23 3LT8A 3EC9A 3UL6A 1FGMA 2GEXA 3EBTA 3SVAA 2R4IA 2SARA 3CNXA 5M1AA 1VQ63 1LOVA 2Y74A 3GSPA 3EX9A 3LTAA 2GU3A 3OWYA 1VQO3 1ROAA 1SJWA 1W6GA 5CK6A 5IF6A 2OOVC 1QVG2 2F86B 3DGLA 1RGLA 3STDA 4LEHA 3F9SA 3I563 2GBXB 1B3SA 3MKIA 1NWWA 4JRFA 3GZRA 2OQEC 1ULJB 3CC43 3MPHA 2C11A 2YX9A 1CEWI 7GSPA 5JBSA 1OCVA 2LYXA 3UB1A 3WDGB 1GMPA 1VZZA 4FCMA 1BRIA 1B2UA 3DUKA 4O8SA 4K61A 1GY5A 4IT7A 3WOEB 1JBSA 4K1UA 1BRHA 5LC6A 4XM4A 3LTDA 2FNQA 1IVWA 4HOHA 3I553 3UL5A 5ELUA 3S67A 1HZ1A 1UUWB 1NU3A 3ALAA 3SOYA 1US1A 2YFIB 1Q9EA 3IJEB 3HIGA 4RBNA 3D9RA 1CQSA 2XFTA 1ZGXA 3NBJA 1I2FA 1N5PA 1W7CA 4WYKA 3H51A 1UCLA 3RGAA 5M18A 3Q2PA 1JB2A 3PGBA 3NX0A 1WQLB 2I9WA 4L8PA 3KZTA 4WP5A 4N6MA 1MGRA 3AGOA 1LVNA 4N6OB 3GZXB 1RN4A 1L5GB 1DMQA 2XEPA 2AADA 1Y4KA 3NXJA 4NREA 2CG1A 1V57A 3NV0A 3D4AA 2GXFA 3M8CA 1OHPA 1Q42A 2W2CA 1VQL3 1GSPA 1I2GA 1IDPA 4X2OA 1W6CA 1OACA 1BSAA 3DH2A 3DM8A 1BNFA 2ZL8A 1O7GB 4J8TA 1YJW3 1RN7A 3QRDA 3D5GA 5AI1A 5AIFA 2Z7AA 1I3IA 5RNTA 1MOLA 3KSED 2FXTA 1DVCA 4HVNA 1OH0A 5IENA 3DMCA 3B4OA 3WMDA 2CW9A 5BXQA 1BIRA 3NBBA 3DXOA 4ORLA 3TDGA 5FW5A 5STDA 1HU9A 1Q40A 1ZS7A 2CX0A 3JUQA 4HM1B 4HM6B 1RLSA 4BL3A 1PU4A 1JJ22 1GYBA 3B7CA 4GSPA 1GMQA 4KT3B 4EBGA 3RDEA 5AIGA 1MNLA 4STDA 5AEUB 5I97A 1E3RA 2B1XB 2XSHB 4LMIA 3LYGA 1YJN3 3T8UA 3NQYA 1IT7A 3GRDA 1BANA 4H61A 3ZFZA 1Q814 1QAKA 1RKYA 2QGUA 5A0OB 1FA3A 2K3DA 4AEQA 1YGEA 1AVKA 3GZBA 5CXOA 1KD14 1IK3A 3PCSA 3HX8A 2F98A 1GY6A 1FGOA 2V1LA 1YHQ3 3OW22 1UGIA 1ROVA 2W0QA 4MEIA 3S29A 4XDVA 1UCJA 3SYUA 1B20A 2BHMA 7STDA 2O9UX 4EXRA 4IPBA 5IG4A 4HZBB 3RNTA 3G6E3 5D83A 2XSOB 1I0XA 2CIUA 4AKZA 3T0UA 2F56A 4MMZB 1BOXA 2CC3A 1OGZA 1YVSA 4EYCA 1M9GA 3CNMA 1BNGA 4CJNA 3SOAA 5JPPA 1Q7HA 4HBRA 1HYFA 2BIRA 3FZWA 4N6UA 4AKYA 1E97A 2RFRA 4DKIA 1IYYA 3FCSB 3H3HA 2H0GA 2A15A 3LXUX 1VQN3 3EN1B 2WOHA 4EV5A 2RBIA 1EG9B 1RSNA 1VQK3 3DGNA 1D6ZA 1ISKA 1O7HB 2C10A 1BSBA 1JZDA 2CHCA 4HM7B 1BNIA 1GOYA 1RGGA 3K63A 3CPOA 2FGTA 4O2HA 3Q3FA 3VF1A 1S723 1BAOA 2BO9B 2ZHXB 4J5GA 1IQXA 3CCU3 5BVBA 1B21A 3Q90A 3WR2A 4HM2B 4R9LA 2UX0A 1M904 1CYUA 1RGHA 2CK3H 2RSXA 3ECFA 4I4KA 2CX1A 6STDA 2CH9A 3LOYA 3NQZA 1QALA 5HGRA 1X1XA 2D42A 1QJGA 1VQ93 1LQMB 4LYLB 2BU4A 3D3LA 1K734 3BNDA 1JB5A 1MWUA 4FMBA 4KZ1A 2W9QA 4LZIA 4G1MB 2ZDJA 1A2KA 1UUGB 3FKAA 4H3UA 4MMXB 1GD3A 1X1UA 3K5TA 3MHEA 4K90B 2W03A 4RNTA 3U1WA 3WODG 4HAAA 5HOHA 2P0XA 1QMAA 1RDSA 1D6UA 3MWZA 4O02B 5FGOA 1BUQA 1ASKA 4WYKB 1BRKA 2YFJB 1JN5B 1OPYA 3CCS3 3EQQB 1B2XA 5D81A 5BU4A 1BRJA 4R80A 3WOFB 3CCQ3 1VQ83 1A2PA 1WMPA 2CFKA 2ML5A 3WA3A 4X2HA 1W2ZA 1YIT3 2CKFB 2KRTA 1RTUA 3MYTA 1JKGB 5IERA 2KAAA 1K28A 1FZUA 1T2IA 1TFOA 1WMNA 2KF3A 3LMLA 1JRQA 2STDA 3BU4A 3HK4A 1RGKA 4N3VA 1NDOB 1IU7A 3JVCA 3SXXA 3Q1CA 3I0YA 1IVXA 1UCKA 1R4CA 3CCM3 2HMLB 2JQ5A 3L0RA 3BNEA 3FG1A 1TRQA 2HMJB 3RGRA 1BVIA 2BMRB 2MF7A 1T5YA 3N8BA 1I8VA 5IW9A 3KCHA 3KN4A 1D6YA 3PYJA 1W5ZA 2UGIA 3LT9A 5G1LA 1G0TA 2WGQA 1U5OA 3G713 2IY2A 4QWTA 3S5CA 3PZWA 1BNJA 1UDII 1UI7A 3V98A 2L4VA 1BSDA 1YNVX 2XGNA 3KIIA 2K54A 1STFI 3EHCA 3UJMA 2BMOB 1RGFA 2HMNB 5M19A 1UCIA 2KF6A 4FMDA 4N6V0 1KSIA 3U97A 3WA2X 1C7HA 1YVBI 1W2B2 3S27A 3VSYA 3KKGA 1RGAA 3O8YA 3FSDA 1LNHA 1OF5A 1Z1SA 3G16A 1G96A 4PEJA 2D1WA 5AYRB 3ER7A 3X40A 2KCDA 2ML6A 1LXEA 4KFEA 1RHLA 4R4KA 1AY7A 1TIJA 2E2UA 2AAEA 3G0KA 3JUPA 3NM2A 4RZMA 2PZVA 2OCTA 1B2ZA 3URPA 3EJVA 2SBLA 3SLUA 1K41A 1I0VA 1IV9A 1SIIA 3JUMA 3OXAA 3HOHA 1YIJ3 1VQ43 2C4BA 2F5MA 2F99A 2P09A 1UI8A 1CH0A 2XGLA 3AMOA 5JPUA 1EA2A 3KFQC 2OOVA 2IA7A 4NPBA 2WGOA 3G4S3 7RNTA 1CYVA 3X3XA 4EC6A 3CC73 1EEJA 1IVVA 1U8CB 2GBWB 3ZG0A 3NHXA 3CCV3 1JV2B 3GAXA 4OUQA 4GHOA 1N8QA 1G02A 3AHSA 3NBRA 4HM0B 2CFLA 2Y73A 4HM8B 5EQLA 2E2VA 1GS3A 1K8A4 5EVHA 3T8NA 1BNEA 1GD4A 1FUWA 1RJOA 3EF8A 3FGYA 2HMMB 4HZ9B 3F40A 4MJDA 3VGNA 4XBYA 2KF5A 3BNBA 1FUTA 4GL6A 1I2EA 1FGQA 3A5EA 3BB9A 2XRXB 3K7CA 3ROBA 3LH4A 4K1VA 1NB3I 2F5WA 5ELJA 4OK0A 2IUJA 4FCJA 5AIIA 1Q7Y4 4J9AA 5DRVA 1OHSA 4GB5A 5BIRA 4U13A 1O7PB 1X1YA 1O7WB 2E2TA 6RNTA 3FF2A 1TP6A 1S5AA 3IMAB 1N8R4 1IV7A 4N6TA 3UNLA 4L7KA 5CF2A 3DY5A 2YFLB 3F7SA 1M1K4 1TU5A 4XDWA 1AVLA 4FMAA 1LRAA 1UW1A 4R1KA 3CCL3 1V74A 4KFDA 1PFPA 6GSPA 2LQVA 1EUIC 1ZX2A 2ZA4A 1LOYA 2CG0A 1Q864 1A2VA 4WFOA 1LNIA 4HKVB 1DYUA 4EV2A 1EQKA 1OGXA 2CFWA 1A67A 1JZOA 1LOWA 1B2MA 4FR9A 4HM5B 5IEOA 1I3FA 3DGOA 4BL2A 5KP1A 1DE3A 1MWRA 2M7OA 1RGEA 1AR0A 1Q824 1SARA 1MWSA 2Z76A 1N9JA 2WO0A 1C54A 2GU1A 5AYSC 1SPUA 3LZAA 3CD63 3SX1A 5KP4A 1T3BA 1DVDA 3ZG5A 2OTJ3 3EB8A 2J8XB 1TJDA 5IG0A 4BTWA 3PXMA 1QVF2 1TTOA 2CWTA 1JNQA 2W56A 1BRGA 1RN1A 3DZLA 2Z6BA 2RNTA 3OWUA 2QA43 1NO3A 1V58A 2B24B 3MG3A 3NV0B 3OWSA 3F14A 1TUHA 1JBTA 1E3VA 3N54B 2KF4A 1O7MB 3OX9A 1N9EA 1BSCA 3FH1A 3D79A 2O3OA 4MMYB 3BIRA 3LTBA 3GWRA 4I5QA 2HMOB 3FF0A 3MSOA 3CC23 1DMMA 3J7Yd 3EE1A 4N6NB 5KP3A 2IUKA 1OUNA 3NM7A 1FUSA 4R9KA 1GMRA 5TGNA 3DGMA 2XFSA 1VQM3 4CCVA 2H0IA 3QK9A 3CXC2 8CHOA 1BUJA 1W00A 1FGRA 1B2SA 3A76A 5G1KA 1JN5A 1Q40B 2R41A 1W01A 1YJ93 1RRHA 4XBTA 5LC7A 2HOHA 2K0MA 2BNGA 1OF5B 1W02A 2CFDA 2RGQA 5AIHA 1WTHA 5EEOA 2P38A 1J2BA 1OHOA 2IMJA 1GY7A 4J5KA 5G2GA 1JKGA 1JBRA 1GOUA 4O3VA 1AQZA 1BU4A 1I70A 3B8LA 3B4PA 1VQ73 1BGSA 2Q07A 3HI7A 1AV4A 1SQWA 3CPW2 2W6JH 3CCE3 1BRSA 3PCRA
chains in the Genus database with same CATH topology
3AMOB 1VQ53 1K9M4 3X3ZA 3F8XA 4BTYA 4LGQA 4CDLA 4XBXA 1IT8A 3X3YA 4WHAA 1HKXA 5CLKA 4OVMA 3CMA3 3X42A 5IG3A 4HM4B 1N5HA 3K0ZA 5AEWB 4XB5A 4N6LA 3BLZA 1WMOA 3CME3 1LOXA 1IVUA 5IEPA 5D82A 1IQ8A 2XR8B 4RNYA 3FLJA 3SEDA 4HJLB 3K9MC 3N9HA 2OQEA 4BTXA 1JB4A 2CWVA 1QAFA 3CCJ3 3MG2A 1WNHA 4RNZA 2BMQB 3JUOA 1A90A 1SIHA 1F8NA 1VQP3 4IIAA 3KSPA 2HMKB 3EBYA 3EN8A 2INXA 3HIIA 1KQS2 1O7NB 2XH9A 2RCDA 3F7XA 2W9PA 4KFFA 4WWUC 3HZPA 2QEX3 3JUNA 3GZYB 1ULIB 2PNCA 2W04A 2CFGA 1ZO2A 4Q53A 3LTCA 2JDIH 2Z77A 2MC8A 3CU3A 1W6YA 3F8HA 2QIYA 4FCZA 4FMCA 1UUVB 3OV4A 4KVHA 1STDA 4LSOA 2CWUA 5DREA 2WOFA 3E99A 3PS8A 5IG5A 2P0MA 2XF3A 4HYZA 2BT3A 1RRLA 1NJI4 1M1XB 1EKMA 4L8OA 2KXGA 4HM3B 5CF1A 3KE7A 4NHFA 1DMNA 2GEYA 3FG4A 4ZM8A 1NB5I 1FGTA 2OTL3 1KWIA 3MG1A 1IQYA 3FG3A 3X41A 3NUVA 1W4NA 4TX4A 3G8ZA 2OWPA 2P05A 4JF8A 3BNCA 3CCR3 3IPTA 3V99A 1TFKA 3S28A 3V92A 2W56B 1YI23 3LT8A 3EC9A 3UL6A 1FGMA 2GEXA 3EBTA 3SVAA 2R4IA 3CNXA 1VQ63 2Y74A 3EX9A 3LTAA 2GU3A 3OWYA 1VQO3 1ROAA 1SJWA 1W6GA 5CK6A 5IF6A 2OOVC 1QVG2 2F86B 3DGLA 3STDA 4LEHA 3F9SA 3I563 2GBXB 3MKIA 1NWWA 4JRFA 3GZRA 2OQEC 1ULJB 3CC43 3MPHA 2C11A 2YX9A 1CEWI 5JBSA 1OCVA 2LYXA 3UB1A 3WDGB 1VZZA 4FCMA 3DUKA 4O8SA 4K61A 1GY5A 4IT7A 3WOEB 4K1UA 5LC6A 4XM4A 3LTDA 2FNQA 1IVWA 3I553 3UL5A 5ELUA 3S67A 1UUWB 3ALAA 1NU3A 3SOYA 1US1A 2YFIB 4RBNA 3IJEB 3HIGA 3D9RA 1CQSA 2XFTA 3NBJA 1N5PA 1W7CA 4WYKA 3H51A 3RGAA 3Q2PA 1JB2A 3PGBA 3NX0A 1WQLB 2I9WA 4L8PA 3KZTA 4WP5A 4N6MA 1LVNA 4N6OB 3GZXB 1L5GB 1DMQA 2XEPA 1Y4KA 3NXJA 4NREA 2CG1A 3NV0A 2GXFA 3M8CA 1OHPA 1Q42A 2W2CA 1VQL3 1IDPA 4X2OA 1W6CA 1OACA 3DM8A 2ZL8A 1O7GB 4J8TA 1YJW3 1RN7A 3QRDA 5AI1A 5AIFA 2Z7AA 1MOLA 3KSED 2FXTA 1DVCA 4HVNA 1OH0A 5IENA 3DMCA 3B4OA 3WMDA 2CW9A 5BXQA 4ORLA 3NBBA 3DXOA 3TDGA 1KC84 5FW5A 5STDA 1HU9A 1Q40A 3JUQA 4HM1B 4HM6B 1PU4A 1JJ22 1GYBA 3B7CA 4EBGA 3RDEA 5AIGA 1MNLA 4STDA 5AEUB 5I97A 1E3RA 2B1XB 2XSHB 4LMIA 3LYGA 1YJN3 3T8UA 3NQYA 1IT7A 3GRDA 4H61A 1Q814 1QAKA 1RKYA 2QGUA 5A0OB 1FA3A 4AEQA 1YGEA 1AVKA 3GZBA 5CXOA 1KD14 1IK3A 3PCSA 3HX8A 2F98A 1GY6A 1FGOA 2V1LA 1YHQ3 3OW22 1ROVA 2W0QA 4MEIA 3S29A 4XDVA 2BHMA 7STDA 2O9UX 4EXRA 4IPBA 5IG4A 4HZBB 3G6E3 5D83A 2XSOB 2CIUA 4AKZA 3T0UA 4MMZB 2CC3A 1OGZA 4EYCA 1M9GA 3CNMA 3SOAA 5JPPA 4HBRA 3FZWA 4N6UA 4AKYA 1E97A 2RFRA 3FCSB 3H3HA 3LXUX 2A15A 1VQN3 3EN1B 2WOHA 4EV5A 1EG9B 1VQK3 3DGNA 1D6ZA 1ISKA 1O7HB 2C10A 2CHCA 4HM7B 3K63A 3CPOA 2FGTA 4O2HA 3VF1A 1S723 2BO9B 1IQXA 3CCU3 5BVBA 3Q90A 4HM2B 4R9LA 2UX0A 1M904 1CYUA 2CK3H 2RSXA 3ECFA 4I4KA 6STDA 2CH9A 3LOYA 3NQZA 1QALA 5HGRA 2D42A 1QJGA 1VQ93 3D3LA 1K734 3BNDA 1JB5A 4FMBA 4KZ1A 2W9QA 4LZIA 4G1MB 2ZDJA 1A2KA 3FKAA 4H3UA 4MMXB 1GD3A 3K5TA 3MHEA 4K90B 2W03A 3U1WA 3WODG 2P0XA 1QMAA 1D6UA 3MWZA 4O02B 5FGOA 1BUQA 1ASKA 4WYKB 2YFJB 1JN5B 1OPYA 3CCS3 3EQQB 5D81A 4R80A 3WOFB 3CCQ3 1VQ83 1WMPA 2CFKA 2ML5A 3WA3A 4X2HA 1W2ZA 1YIT3 2CKFB 2KRTA 3MYTA 1JKGB 5IERA 1K28A 1TFOA 1WMNA 3LMLA 1JRQA 2STDA 3HK4A 4N3VA 1NDOB 1IU7A 3JVCA 3SXXA 3Q1CA 3I0YA 1IVXA 1R4CA 3CCM3 2HMLB 2JQ5A 3L0RA 3BNEA 3FG1A 2HMJB 3RGRA 2BMRB 2MF7A 1T5YA 3N8BA 5IW9A 3KN4A 1D6YA 3PYJA 1W5ZA 3LT9A 2WGQA 1U5OA 3G713 4QWTA 3S5CA 3PZWA 1UI7A 3V98A 2L4VA 3KIIA 2XGNA 2K54A 1STFI 3EHCA 3UJMA 2BMOB 2HMNB 4N6V0 4FMDA 1KSIA 3U97A 3WA2X 1C7HA 1YVBI 1W2B2 3S27A 3VSYA 3KKGA 3O8YA 3FSDA 1LNHA 1OF5A 1Z1SA 3G16A 1G96A 4PEJA 2D1WA 5AYRB 3ER7A 3X40A 2KCDA 2ML6A 1LXEA 4KFEA 4R4KA 1TIJA 2E2UA 3G0KA 3JUPA 3NM2A 4RZMA 2PZVA 2OCTA 3EJVA 2SBLA 3SLUA 1K41A 3JUMA 1IV9A 1SIIA 3OXAA 1YIJ3 1VQ43 2F99A 2P09A 1UI8A 2XGLA 3AMOA 5JPUA 1EA2A 3KFQC 2OOVA 2IA7A 2WGOA 3G4S3 1CYVA 3X3XA 4EC6A 3CC73 1IVVA 1U8CB 2GBWB 3CCV3 3NHXA 1JV2B 3GAXA 4OUQA 1N8QA 3NBRA 4HM0B 2CFLA 2Y73A 4HM8B 5EQLA 2E2VA 1GS3A 1K8A4 5EVHA 3T8NA 1GD4A 1FUWA 1RJOA 3EF8A 3FGYA 2HMMB 4HZ9B 3F40A 4MJDA 3VGNA 4XBYA 3BNBA 4GL6A 1FGQA 3BB9A 2XRXB 3K7CA 3ROBA 3LH4A 4K1VA 1NB3I 5ELJA 4OK0A 2IUJA 4FCJA 5AIIA 1Q7Y4 4J9AA 5DRVA 1OHSA 4GB5A 4U13A 1O7PB 2E2TA 1O7WB 3FF2A 1TP6A 1S5AA 3IMAB 1N8R4 1IV7A 4N6TA 3UNLA 4L7KA 5CF2A 3DY5A 2YFLB 3F7SA 1M1K4 1TU5A 4XDWA 1AVLA 4FMAA 1UW1A 4R1KA 3CCL3 1V74A 4KFDA 1PFPA 2LQVA 1ZX2A 2CG0A 1Q864 1A2VA 4WFOA 4HKVB 4EV2A 1DYUA 1EQKA 1OGXA 2CFWA 1A67A 4FR9A 4HM5B 5IEOA 3DGOA 5KP1A 2M7OA 1AR0A 1Q824 2Z76A 1N9JA 2WO0A 2GU1A 5AYSC 1SPUA 3LZAA 3CD63 3SX1A 5KP4A 1DVDA 2OTJ3 3EB8A 4BTWA 5IG0A 3PXMA 1QVF2 2CWTA 1JNQA 2W56A 3DZLA 2Z6BA 3OWUA 2QA43 1NO3A 2B24B 3OWSA 3MG3A 3NV0B 3F14A 1TUHA 1E3VA 3N54B 1O7MB 3OX9A 1N9EA 3FH1A 4MMYB 2O3OA 3LTBA 3GWRA 2HMOB 3FF0A 3MSOA 3CC23 1DMMA 3J7Yd 3EE1A 4N6NB 5KP3A 2IUKA 1OUNA 3NM7A 4R9KA 5TGNA 3DGMA 2XFSA 1VQM3 4CCVA 3CXC2 3QK9A 8CHOA 1W00A 1FGRA 3A76A 1JN5A 1Q40B 1W01A 1YJ93 1RRHA 4XBTA 5LC7A 2K0MA 2BNGA 1OF5B 1W02A 2CFDA 2RGQA 5AIHA 1WTHA 5EEOA 2P38A 1J2BA 1OHOA 2IMJA 1GY7A 5G2GA 1JKGA 4O3VA 3B8LA 3B4PA 1VQ73 2Q07A 3HI7A 3CPW2 1AV4A 1SQWA 3CCE3 2W6JH 3PCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8X A;  4LGQ A;  4CDL A;  4XBX A;  1HKX A;  5CLK A;  4OVM A;  5IG3 A;  4HM4 B;  3K0Z A;  5AEW B;  4XB5 A;  3BLZ A;  5IEP A;  5D82 A;  2XR8 B;  3FLJ A;  3SED A;  4HJL B;  1JB4 A;  3MG2 A;  2BMQ B;  3JUO A;  4IIA A;  3KSP A;  2HMK B;  3EBY A;  3EN8 A;  2INX A;  1O7N B;  2RCD A;  3F7X A;  4WWU C;  3HZP A;  3JUN A;  3GZY B;  1ULI B;  1ZO2 A;  4Q53 A;  2Z77 A;  3CU3 A;  1W6Y A;  3F8H A;  2QIY A;  1UUV B;  3OV4 A;  4KVH A;  1STD A;  5DRE A;  3E99 A;  5IG5 A;  4L8O A;  4HM3 B;  5CF1 A;  3KE7 A;  1DMN A;  2GEY A;  3MG1 A;  3NUV A;  3G8Z A;  2OWP A;  3IPT A;  3EC9 A;  2GEX A;  3EBT A;  2R4I A;  3CNX A;  3EX9 A;  3OWY A;  1SJW A;  5CK6 A;  5IF6 A;  2F86 B;  3STD A;  4LEH A;  3F9S A;  2GBX B;  3MKI A;  1NWW A;  3GZR A;  1ULJ B;  1OCV A;  1VZZ A;  4FCM A;  3DUK A;  1GY5 A;  4K1U A;  4XM4 A;  1UUW B;  3SOY A;  1NU3 A;  2YFI B;  3D9R A;  1CQS A;  4WYK A;  3H51 A;  3RGA A;  1JB2 A;  1WQL B;  2I9W A;  4L8P A;  3KZT A;  4WP5 A;  3GZX B;  1DMQ A;  3NXJ A;  3NV0 A;  2GXF A;  3M8C A;  1OHP A;  1Q42 A;  2W2C A;  1IDP A;  4X2O A;  3DM8 A;  1O7G B;  4J8T A;  5AIF A;  5AI1 A;  2Z7A A;  4HVN A;  1OH0 A;  5IEN A;  3DMC A;  3B4O A;  3WMD A;  5BXQ A;  4ORL A;  3DXO A;  5FW5 A;  5STD A;  1Q40 A;  3JUQ A;  4HM1 B;  4HM6 B;  1GYB A;  3B7C A;  5AIG A;  4STD A;  5AEU B;  1E3R A;  2B1X B;  2XSH B;  4LMI A;  3LYG A;  3T8U A;  3GRD A;  2QGU A;  3GZB A;  5CXO A;  3HX8 A;  2F98 A;  1GY6 A;  4XDV A;  7STD A;  5IG4 A;  4HZB B;  5D83 A;  2XSO B;  1OGZ A;  3CNM A;  3SOA A;  5JPP A;  3FZW A;  1E97 A;  2RFR A;  3H3H A;  2A15 A;  3EN1 B;  1EG9 B;  1ISK A;  1O7H B;  2CHC A;  4HM7 B;  3CPO A;  5BVB A;  3Q90 A;  4HM2 B;  4R9L A;  2UX0 A;  3ECF A;  4I4K A;  6STD A;  5HGR A;  1QJG A;  1JB5 A;  1A2K A;  3FKA A;  4H3U A;  3MHE A;  1QMA A;  1BUQ A;  1ASK A;  4WYK B;  2YFJ B;  1JN5 B;  1OPY A;  3EQQ B;  5D81 A;  4X2H A;  2CKF B;  3MYT A;  1JKG B;  5IER A;  3HK4 A;  2STD A;  4N3V A;  1NDO B;  3I0Y A;  2HML B;  2JQ5 A;  2HMJ B;  3RGR A;  2BMR B;  1U5O A;  3S5C A;  2K54 A;  3EHC A;  3UJM A;  2BMO B;  2HMN B;  1C7H A;  3VSY A;  3KKG A;  3FSD A;  1Z1S A;  1OF5 A;  3G16 A;  4PEJ A;  3ER7 A;  3G0K A;  3JUP A;  3NM2 A;  4RZM A;  2PZV A;  3EJV A;  1K41 A;  3JUM A;  3OXA A;  2F99 A;  5JPU A;  1EA2 A;  2GBW B;  3NHX A;  4OUQ A;  3NBR A;  4HM0 B;  4HM8 B;  1GS3 A;  5EVH A;  3T8N A;  3EF8 A;  3FGY A;  2HMM B;  4HZ9 B;  3F40 A;  4MJD A;  3VGN A;  4XBY A;  3BB9 A;  2XRX B;  3K7C A;  3ROB A;  4K1V A;  4FCJ A;  5AII A;  4J9A A;  5DRV A;  1OHS A;  4GB5 A;  4U13 A;  1O7P B;  1O7W B;  3FF2 A;  1TP6 A;  1S5A A;  3UNL A;  4L7K A;  5CF2 A;  2YFL B;  3F7S A;  4XDW A;  4R1K A;  1ZX2 A;  4HKV B;  1OGX A;  4HM5 B;  5IEO A;  5KP1 A;  1AR0 A;  2Z76 A;  3LZA A;  5KP4 A;  5IG0 A;  3DZL A;  3OWU A;  2B24 B;  3OWS A;  3MG3 A;  3NV0 B;  3F14 A;  1TUH A;  1E3V A;  1O7M B;  3OX9 A;  3FH1 A;  3GWR A;  2HMO B;  3FF0 A;  3MSO A;  1DMM A;  5KP3 A;  1OUN A;  4R9K A;  5TGN A;  8CHO A;  1W00 A;  3A76 A;  1JN5 A;  1Q40 B;  1W01 A;  4XBT A;  2BNG A;  1OF5 B;  1W02 A;  5AIH A;  2RGQ A;  1OHO A;  2IMJ A;  1GY7 A;  5G2G A;  1JKG A;  3B8L A;  3B4P A; 
#chains in the Genus database with same CATH topology
 2L1S A;  3AMO B;  3AGN A;  1VQ5 3;  4EW5 A;  2H0H A;  1K9M 4;  3X3Z A;  1MGW A;  3F8X A;  4LGQ A;  4BTY A;  4CDL A;  1RCK A;  4XBX A;  1IT8 A;  1FW7 A;  3X3Y A;  1TRP A;  4WHA A;  1DET A;  1HKX A;  4OVM A;  5CLK A;  3CMA 3;  3X42 A;  5IG3 A;  1BRN L;  4HM4 B;  1N5H A;  3K0Z A;  1KC8 4;  5AEW B;  4XB5 A;  4N6L A;  3BLZ A;  1WMO A;  3CME 3;  1LOX A;  1IVU A;  3DGY A;  5IEP A;  5D82 A;  1IQ8 A;  2XR8 B;  4RNY A;  1PY3 A;  3D5I A;  3FLJ A;  3SED A;  1UGH I;  4HJL B;  3K9M C;  1B27 A;  1RCL A;  1BNS A;  3N9H A;  2OQE A;  4BTX A;  1JB4 A;  1NNV A;  2CWV A;  1QAF A;  3CCJ 3;  3AHW A;  1YGW A;  3MG2 A;  1WNH A;  4BU4 A;  4RNZ A;  8RNT A;  2BMQ B;  3JUO A;  1A90 A;  1SIH A;  1T2H A;  1F8N A;  1VQP 3;  1GOV A;  1RMS A;  4IIA A;  3KSP A;  2HMK B;  1FYS A;  2UUG C;  2INX A;  3EBY A;  3EN8 A;  3HII A;  9RNT A;  1LQG C;  1O7N B;  1KQS 2;  2XH9 A;  2RCD A;  3F7X A;  2W9P A;  4KFF A;  4WWU C;  3HZP A;  2QEX 3;  3JUN A;  3GZY B;  1RNB A;  1ULI B;  2PNC A;  2W04 A;  2CFG A;  4CPK A;  1ZO2 A;  4Q53 A;  3LTC A;  2JDI H;  2Z77 A;  2MC8 A;  1BNR A;  2GSP A;  1RNT A;  1W6Y A;  1RGC A;  3CU3 A;  2QIY A;  3F8H A;  4FCZ A;  4FMC A;  1UUV B;  3OV4 A;  4KVH A;  1STD A;  4LSO A;  2CWU A;  5DRE A;  2WOF A;  3E99 A;  3PS8 A;  5IG5 A;  1R4Y A;  1VQQ A;  2P0M A;  2XF3 A;  4HYZ A;  2BT3 A;  1RRL A;  1NJI 4;  1M1X B;  1MWT A;  1EKM A;  4L8O A;  2KXG A;  4BIR A;  1BSE A;  2F4Y A;  4HM3 B;  5CF1 A;  3KE7 A;  4NHF A;  1DMN A;  2GEY A;  3FG4 A;  4ZM8 A;  1NB5 I;  1FGT A;  2OTL 3;  1KWI A;  3MG1 A;  1IQY A;  3FG3 A;  3X41 A;  3WHO A;  3NUV A;  1W4N A;  4ILF A;  4TX4 A;  3G8Z A;  2OWP A;  2P05 A;  4JF8 A;  5GSP A;  3BNC A;  2IYJ A;  3CCR 3;  3IPT A;  3V99 A;  1PYL A;  1TFK A;  1X1W A;  2W56 B;  3S28 A;  3V92 A;  1YI2 3;  3LT8 A;  3EC9 A;  3UL6 A;  1FGM A;  2GEX A;  3EBT A;  3SVA A;  2R4I A;  2SAR A;  3CNX A;  5M1A A;  1VQ6 3;  1LOV A;  2Y74 A;  3GSP A;  3EX9 A;  3LTA A;  2GU3 A;  3OWY A;  1VQO 3;  1ROA A;  1SJW A;  1W6G A;  5CK6 A;  5IF6 A;  2OOV C;  1QVG 2;  2F86 B;  3DGL A;  1RGL A;  3STD A;  4LEH A;  3F9S A;  3I56 3;  2GBX B;  1B3S A;  3MKI A;  1NWW A;  4JRF A;  3GZR A;  2OQE C;  1ULJ B;  3CC4 3;  3MPH A;  2C11 A;  2YX9 A;  1CEW I;  7GSP A;  5JBS A;  1OCV A;  2LYX A;  3UB1 A;  3WDG B;  1GMP A;  1VZZ A;  4FCM A;  1BRI A;  1B2U A;  3DUK A;  4O8S A;  4K61 A;  1GY5 A;  4IT7 A;  3WOE B;  1JBS A;  4K1U A;  1BRH A;  5LC6 A;  4XM4 A;  3LTD A;  2FNQ A;  1IVW A;  4HOH A;  3I55 3;  3UL5 A;  5ELU A;  3S67 A;  1HZ1 A;  1UUW B;  1NU3 A;  3ALA A;  3SOY A;  1US1 A;  2YFI B;  1Q9E A;  3IJE B;  3HIG A;  4RBN A;  3D9R A;  1CQS A;  2XFT A;  1ZGX A;  3NBJ A;  1I2F A;  1N5P A;  1W7C A;  4WYK A;  3H51 A;  1UCL A;  3RGA A;  5M18 A;  3Q2P A;  1JB2 A;  3PGB A;  3NX0 A;  1WQL B;  2I9W A;  4L8P A;  3KZT A;  4WP5 A;  4N6M A;  1MGR A;  3AGO A;  1LVN A;  4N6O B;  3GZX B;  1RN4 A;  1L5G B;  1DMQ A;  2XEP A;  2AAD A;  1Y4K A;  3NXJ A;  4NRE A;  2CG1 A;  1V57 A;  3NV0 A;  3D4A A;  2GXF A;  3M8C A;  1OHP A;  1Q42 A;  2W2C A;  1VQL 3;  1GSP A;  1I2G A;  1IDP A;  4X2O A;  1W6C A;  1OAC A;  1BSA A;  3DH2 A;  3DM8 A;  1BNF A;  2ZL8 A;  1O7G B;  4J8T A;  1YJW 3;  1RN7 A;  3QRD A;  3D5G A;  5AI1 A;  5AIF A;  2Z7A A;  1I3I A;  5RNT A;  1MOL A;  3KSE D;  2FXT A;  1DVC A;  4HVN A;  1OH0 A;  5IEN A;  3DMC A;  3B4O A;  3WMD A;  2CW9 A;  5BXQ A;  1BIR A;  3NBB A;  3DXO A;  4ORL A;  3TDG A;  5FW5 A;  5STD A;  1HU9 A;  1Q40 A;  1ZS7 A;  2CX0 A;  3JUQ A;  4HM1 B;  4HM6 B;  1RLS A;  4BL3 A;  1PU4 A;  1JJ2 2;  1GYB A;  3B7C A;  4GSP A;  1GMQ A;  4KT3 B;  4EBG A;  3RDE A;  5AIG A;  1MNL A;  4STD A;  5AEU B;  5I97 A;  1E3R A;  2B1X B;  2XSH B;  4LMI A;  3LYG A;  1YJN 3;  3T8U A;  3NQY A;  1IT7 A;  3GRD A;  1BAN A;  4H61 A;  3ZFZ A;  1Q81 4;  1QAK A;  1RKY A;  2QGU A;  5A0O B;  1FA3 A;  2K3D A;  4AEQ A;  1YGE A;  1AVK A;  3GZB A;  5CXO A;  1KD1 4;  1IK3 A;  3PCS A;  3HX8 A;  2F98 A;  1GY6 A;  1FGO A;  2V1L A;  1YHQ 3;  3OW2 2;  1UGI A;  1ROV A;  2W0Q A;  4MEI A;  3S29 A;  4XDV A;  1UCJ A;  3SYU A;  1B20 A;  2BHM A;  7STD A;  2O9U X;  4EXR A;  4IPB A;  5IG4 A;  4HZB B;  3RNT A;  3G6E 3;  5D83 A;  2XSO B;  1I0X A;  2CIU A;  4AKZ A;  3T0U A;  2F56 A;  4MMZ B;  1BOX A;  2CC3 A;  1OGZ A;  1YVS A;  4EYC A;  1M9G A;  3CNM A;  1BNG A;  4CJN A;  3SOA A;  5JPP A;  1Q7H A;  4HBR A;  1HYF A;  2BIR A;  3FZW A;  4N6U A;  4AKY A;  1E97 A;  2RFR A;  4DKI A;  1IYY A;  3FCS B;  3H3H A;  2H0G A;  2A15 A;  3LXU X;  1VQN 3;  3EN1 B;  2WOH A;  4EV5 A;  2RBI A;  1EG9 B;  1RSN A;  1VQK 3;  3DGN A;  1D6Z A;  1ISK A;  1O7H B;  2C10 A;  1BSB A;  1JZD A;  2CHC A;  4HM7 B;  1BNI A;  1GOY A;  1RGG A;  3K63 A;  3CPO A;  2FGT A;  4O2H A;  3Q3F A;  3VF1 A;  1S72 3;  1BAO A;  2BO9 B;  2ZHX B;  4J5G A;  1IQX A;  3CCU 3;  5BVB A;  1B21 A;  3Q90 A;  3WR2 A;  4HM2 B;  4R9L A;  2UX0 A;  1M90 4;  1CYU A;  1RGH A;  2CK3 H;  2RSX A;  3ECF A;  4I4K A;  2CX1 A;  6STD A;  2CH9 A;  3LOY A;  3NQZ A;  1QAL A;  5HGR A;  1X1X A;  2D42 A;  1QJG A;  1VQ9 3;  1LQM B;  4LYL B;  2BU4 A;  3D3L A;  1K73 4;  3BND A;  1JB5 A;  1MWU A;  4FMB A;  4KZ1 A;  2W9Q A;  4LZI A;  4G1M B;  2ZDJ A;  1A2K A;  1UUG B;  3FKA A;  4H3U A;  4MMX B;  1GD3 A;  1X1U A;  3K5T A;  3MHE A;  4K90 B;  2W03 A;  4RNT A;  3U1W A;  3WOD G;  4HAA A;  5HOH A;  2P0X A;  1QMA A;  1RDS A;  1D6U A;  3MWZ A;  4O02 B;  5FGO A;  1BUQ A;  1ASK A;  4WYK B;  1BRK A;  2YFJ B;  1JN5 B;  1OPY A;  3CCS 3;  3EQQ B;  1B2X A;  5D81 A;  5BU4 A;  1BRJ A;  4R80 A;  3WOF B;  3CCQ 3;  1VQ8 3;  1A2P A;  1WMP A;  2CFK A;  2ML5 A;  3WA3 A;  4X2H A;  1W2Z A;  1YIT 3;  2CKF B;  2KRT A;  1RTU A;  3MYT A;  1JKG B;  5IER A;  2KAA A;  1K28 A;  1FZU A;  1T2I A;  1TFO A;  1WMN A;  2KF3 A;  3LML A;  1JRQ A;  2STD A;  3BU4 A;  3HK4 A;  1RGK A;  4N3V A;  1NDO B;  1IU7 A;  3JVC A;  3SXX A;  3Q1C A;  3I0Y A;  1IVX A;  1UCK A;  1R4C A;  3CCM 3;  2HML B;  2JQ5 A;  3L0R A;  3BNE A;  3FG1 A;  1TRQ A;  2HMJ B;  3RGR A;  1BVI A;  2BMR B;  2MF7 A;  1T5Y A;  3N8B A;  1I8V A;  5IW9 A;  3KCH A;  3KN4 A;  1D6Y A;  3PYJ A;  1W5Z A;  2UGI A;  3LT9 A;  5G1L A;  1G0T A;  2WGQ A;  1U5O A;  3G71 3;  2IY2 A;  4QWT A;  3S5C A;  3PZW A;  1BNJ A;  1UDI I;  1UI7 A;  3V98 A;  2L4V A;  1BSD A;  1YNV X;  2XGN A;  3KII A;  2K54 A;  1STF I;  3EHC A;  3UJM A;  2BMO B;  1RGF A;  2HMN B;  5M19 A;  1UCI A;  2KF6 A;  4FMD A;  4N6V 0;  1KSI A;  3U97 A;  3WA2 X;  1C7H A;  1YVB I;  1W2B 2;  3S27 A;  3VSY A;  3KKG A;  1RGA A;  3O8Y A;  3FSD A;  1LNH A;  1OF5 A;  1Z1S A;  3G16 A;  1G96 A;  4PEJ A;  2D1W A;  5AYR B;  3ER7 A;  3X40 A;  2KCD A;  2ML6 A;  1LXE A;  4KFE A;  1RHL A;  4R4K A;  1AY7 A;  1TIJ A;  2E2U A;  2AAE A;  3G0K A;  3JUP A;  3NM2 A;  4RZM A;  2PZV A;  2OCT A;  1B2Z A;  3URP A;  3EJV A;  2SBL A;  3SLU A;  1K41 A;  1I0V A;  1IV9 A;  1SII A;  3JUM A;  3OXA A;  3HOH A;  1YIJ 3;  1VQ4 3;  2C4B A;  2F5M A;  2F99 A;  2P09 A;  1UI8 A;  1CH0 A;  2XGL A;  3AMO A;  5JPU A;  1EA2 A;  3KFQ C;  2OOV A;  2IA7 A;  4NPB A;  2WGO A;  3G4S 3;  7RNT A;  1CYV A;  3X3X A;  4EC6 A;  3CC7 3;  1EEJ A;  1IVV A;  1U8C B;  2GBW B;  3ZG0 A;  3NHX A;  3CCV 3;  1JV2 B;  3GAX A;  4OUQ A;  4GHO A;  1N8Q A;  1G02 A;  3AHS A;  3NBR A;  4HM0 B;  2CFL A;  2Y73 A;  4HM8 B;  5EQL A;  2E2V A;  1GS3 A;  1K8A 4;  5EVH A;  3T8N A;  1BNE A;  1GD4 A;  1FUW A;  1RJO A;  3EF8 A;  3FGY A;  2HMM B;  4HZ9 B;  3F40 A;  4MJD A;  3VGN A;  4XBY A;  2KF5 A;  3BNB A;  1FUT A;  4GL6 A;  1I2E A;  1FGQ A;  3A5E A;  3BB9 A;  2XRX B;  3K7C A;  3ROB A;  3LH4 A;  4K1V A;  1NB3 I;  2F5W A;  5ELJ A;  4OK0 A;  2IUJ A;  4FCJ A;  5AII A;  1Q7Y 4;  4J9A A;  5DRV A;  1OHS A;  4GB5 A;  5BIR A;  4U13 A;  1O7P B;  1X1Y A;  1O7W B;  2E2T A;  6RNT A;  3FF2 A;  1TP6 A;  1S5A A;  3IMA B;  1N8R 4;  1IV7 A;  4N6T A;  3UNL A;  4L7K A;  5CF2 A;  3DY5 A;  2YFL B;  3F7S A;  1M1K 4;  1TU5 A;  4XDW A;  1AVL A;  4FMA A;  1LRA A;  1UW1 A;  4R1K A;  3CCL 3;  1V74 A;  4KFD A;  1PFP A;  6GSP A;  2LQV A;  1EUI C;  1ZX2 A;  2ZA4 A;  1LOY A;  2CG0 A;  1Q86 4;  1A2V A;  4WFO A;  1LNI A;  4HKV B;  1DYU A;  4EV2 A;  1EQK A;  1OGX A;  2CFW A;  1A67 A;  1JZO A;  1LOW A;  1B2M A;  4FR9 A;  4HM5 B;  5IEO A;  1I3F A;  3DGO A;  4BL2 A;  5KP1 A;  1DE3 A;  1MWR A;  2M7O A;  1RGE A;  1AR0 A;  1Q82 4;  1SAR A;  1MWS A;  2Z76 A;  1N9J A;  2WO0 A;  1C54 A;  2GU1 A;  5AYS C;  1SPU A;  3LZA A;  3CD6 3;  3SX1 A;  5KP4 A;  1T3B A;  1DVD A;  3ZG5 A;  2OTJ 3;  3EB8 A;  2J8X B;  1TJD A;  5IG0 A;  4BTW A;  3PXM A;  1QVF 2;  1TTO A;  2CWT A;  1JNQ A;  2W56 A;  1BRG A;  1RN1 A;  3DZL A;  2Z6B A;  2RNT A;  3OWU A;  2QA4 3;  1NO3 A;  1V58 A;  2B24 B;  3MG3 A;  3NV0 B;  3OWS A;  3F14 A;  1TUH A;  1JBT A;  1E3V A;  3N54 B;  2KF4 A;  1O7M B;  3OX9 A;  1N9E A;  1BSC A;  3FH1 A;  3D79 A;  2O3O A;  4MMY B;  3BIR A;  3LTB A;  3GWR A;  4I5Q A;  2HMO B;  3FF0 A;  3MSO A;  3CC2 3;  1DMM A;  3J7Y d;  3EE1 A;  4N6N B;  5KP3 A;  2IUK A;  1OUN A;  3NM7 A;  1FUS A;  4R9K A;  1GMR A;  5TGN A;  3DGM A;  2XFS A;  1VQM 3;  4CCV A;  2H0I A;  3QK9 A;  3CXC 2;  8CHO A;  1BUJ A;  1W00 A;  1FGR A;  1B2S A;  3A76 A;  5G1K A;  1JN5 A;  1Q40 B;  2R41 A;  1W01 A;  1YJ9 3;  1RRH A;  4XBT A;  5LC7 A;  2HOH A;  2K0M A;  2BNG A;  1OF5 B;  1W02 A;  2CFD A;  2RGQ A;  5AIH A;  1WTH A;  5EEO A;  2P38 A;  1J2B A;  1OHO A;  2IMJ A;  1GY7 A;  4J5K A;  5G2G A;  1JKG A;  1JBR A;  1GOU A;  4O3V A;  1AQZ A;  1BU4 A;  1I70 A;  3B8L A;  3B4P A;  1VQ7 3;  1BGS A;  2Q07 A;  3HI7 A;  1AV4 A;  1SQW A;  3CPW 2;  2W6J H;  3CCE 3;  1BRS A;  3PCR A; 
#chains in the Genus database with same CATH homology
 3AMO B;  1VQ5 3;  1K9M 4;  3X3Z A;  3F8X A;  4BTY A;  4LGQ A;  4CDL A;  4XBX A;  1IT8 A;  3X3Y A;  4WHA A;  1HKX A;  5CLK A;  4OVM A;  3CMA 3;  3X42 A;  5IG3 A;  4HM4 B;  1N5H A;  3K0Z A;  5AEW B;  4XB5 A;  4N6L A;  3BLZ A;  1WMO A;  3CME 3;  1LOX A;  1IVU A;  5IEP A;  5D82 A;  1IQ8 A;  2XR8 B;  4RNY A;  3FLJ A;  3SED A;  4HJL B;  3K9M C;  3N9H A;  2OQE A;  4BTX A;  1JB4 A;  2CWV A;  1QAF A;  3CCJ 3;  3MG2 A;  1WNH A;  4RNZ A;  2BMQ B;  3JUO A;  1A90 A;  1SIH A;  1F8N A;  1VQP 3;  4IIA A;  3KSP A;  2HMK B;  3EBY A;  3EN8 A;  2INX A;  3HII A;  1KQS 2;  1O7N B;  2XH9 A;  2RCD A;  3F7X A;  2W9P A;  4KFF A;  4WWU C;  3HZP A;  2QEX 3;  3JUN A;  3GZY B;  1ULI B;  2PNC A;  2W04 A;  2CFG A;  1ZO2 A;  4Q53 A;  3LTC A;  2JDI H;  2Z77 A;  2MC8 A;  3CU3 A;  1W6Y A;  3F8H A;  2QIY A;  4FCZ A;  4FMC A;  1UUV B;  3OV4 A;  4KVH A;  1STD A;  4LSO A;  2CWU A;  5DRE A;  2WOF A;  3E99 A;  3PS8 A;  5IG5 A;  2P0M A;  2XF3 A;  4HYZ A;  2BT3 A;  1RRL A;  1NJI 4;  1M1X B;  1EKM A;  4L8O A;  2KXG A;  4HM3 B;  5CF1 A;  3KE7 A;  4NHF A;  1DMN A;  2GEY A;  3FG4 A;  4ZM8 A;  1NB5 I;  1FGT A;  2OTL 3;  1KWI A;  3MG1 A;  1IQY A;  3FG3 A;  3X41 A;  3NUV A;  1W4N A;  4TX4 A;  3G8Z A;  2OWP A;  2P05 A;  4JF8 A;  3BNC A;  3CCR 3;  3IPT A;  3V99 A;  1TFK A;  3S28 A;  3V92 A;  2W56 B;  1YI2 3;  3LT8 A;  3EC9 A;  3UL6 A;  1FGM A;  2GEX A;  3EBT A;  3SVA A;  2R4I A;  3CNX A;  1VQ6 3;  2Y74 A;  3EX9 A;  3LTA A;  2GU3 A;  3OWY A;  1VQO 3;  1ROA A;  1SJW A;  1W6G A;  5CK6 A;  5IF6 A;  2OOV C;  1QVG 2;  2F86 B;  3DGL A;  3STD A;  4LEH A;  3F9S A;  3I56 3;  2GBX B;  3MKI A;  1NWW A;  4JRF A;  3GZR A;  2OQE C;  1ULJ B;  3CC4 3;  3MPH A;  2C11 A;  2YX9 A;  1CEW I;  5JBS A;  1OCV A;  2LYX A;  3UB1 A;  3WDG B;  1VZZ A;  4FCM A;  3DUK A;  4O8S A;  4K61 A;  1GY5 A;  4IT7 A;  3WOE B;  4K1U A;  5LC6 A;  4XM4 A;  3LTD A;  2FNQ A;  1IVW A;  3I55 3;  3UL5 A;  5ELU A;  3S67 A;  1UUW B;  3ALA A;  1NU3 A;  3SOY A;  1US1 A;  2YFI B;  4RBN A;  3IJE B;  3HIG A;  3D9R A;  1CQS A;  2XFT A;  3NBJ A;  1N5P A;  1W7C A;  4WYK A;  3H51 A;  3RGA A;  3Q2P A;  1JB2 A;  3PGB A;  3NX0 A;  1WQL B;  2I9W A;  4L8P A;  3KZT A;  4WP5 A;  4N6M A;  1LVN A;  4N6O B;  3GZX B;  1L5G B;  1DMQ A;  2XEP A;  1Y4K A;  3NXJ A;  4NRE A;  2CG1 A;  3NV0 A;  2GXF A;  3M8C A;  1OHP A;  1Q42 A;  2W2C A;  1VQL 3;  1IDP A;  4X2O A;  1W6C A;  1OAC A;  3DM8 A;  2ZL8 A;  1O7G B;  4J8T A;  1YJW 3;  1RN7 A;  3QRD A;  5AI1 A;  5AIF A;  2Z7A A;  1MOL A;  3KSE D;  2FXT A;  1DVC A;  4HVN A;  1OH0 A;  5IEN A;  3DMC A;  3B4O A;  3WMD A;  2CW9 A;  5BXQ A;  4ORL A;  3NBB A;  3DXO A;  3TDG A;  1KC8 4;  5FW5 A;  5STD A;  1HU9 A;  1Q40 A;  3JUQ A;  4HM1 B;  4HM6 B;  1PU4 A;  1JJ2 2;  1GYB A;  3B7C A;  4EBG A;  3RDE A;  5AIG A;  1MNL A;  4STD A;  5AEU B;  5I97 A;  1E3R A;  2B1X B;  2XSH B;  4LMI A;  3LYG A;  1YJN 3;  3T8U A;  3NQY A;  1IT7 A;  3GRD A;  4H61 A;  1Q81 4;  1QAK A;  1RKY A;  2QGU A;  5A0O B;  1FA3 A;  4AEQ A;  1YGE A;  1AVK A;  3GZB A;  5CXO A;  1KD1 4;  1IK3 A;  3PCS A;  3HX8 A;  2F98 A;  1GY6 A;  1FGO A;  2V1L A;  1YHQ 3;  3OW2 2;  1ROV A;  2W0Q A;  4MEI A;  3S29 A;  4XDV A;  2BHM A;  7STD A;  2O9U X;  4EXR A;  4IPB A;  5IG4 A;  4HZB B;  3G6E 3;  5D83 A;  2XSO B;  2CIU A;  4AKZ A;  3T0U A;  4MMZ B;  2CC3 A;  1OGZ A;  4EYC A;  1M9G A;  3CNM A;  3SOA A;  5JPP A;  4HBR A;  3FZW A;  4N6U A;  4AKY A;  1E97 A;  2RFR A;  3FCS B;  3H3H A;  3LXU X;  2A15 A;  1VQN 3;  3EN1 B;  2WOH A;  4EV5 A;  1EG9 B;  1VQK 3;  3DGN A;  1D6Z A;  1ISK A;  1O7H B;  2C10 A;  2CHC A;  4HM7 B;  3K63 A;  3CPO A;  2FGT A;  4O2H A;  3VF1 A;  1S72 3;  2BO9 B;  1IQX A;  3CCU 3;  5BVB A;  3Q90 A;  4HM2 B;  4R9L A;  2UX0 A;  1M90 4;  1CYU A;  2CK3 H;  2RSX A;  3ECF A;  4I4K A;  6STD A;  2CH9 A;  3LOY A;  3NQZ A;  1QAL A;  5HGR A;  2D42 A;  1QJG A;  1VQ9 3;  3D3L A;  1K73 4;  3BND A;  1JB5 A;  4FMB A;  4KZ1 A;  2W9Q A;  4LZI A;  4G1M B;  2ZDJ A;  1A2K A;  3FKA A;  4H3U A;  4MMX B;  1GD3 A;  3K5T A;  3MHE A;  4K90 B;  2W03 A;  3U1W A;  3WOD G;  2P0X A;  1QMA A;  1D6U A;  3MWZ A;  4O02 B;  5FGO A;  1BUQ A;  1ASK A;  4WYK B;  2YFJ B;  1JN5 B;  1OPY A;  3CCS 3;  3EQQ B;  5D81 A;  4R80 A;  3WOF B;  3CCQ 3;  1VQ8 3;  1WMP A;  2CFK A;  2ML5 A;  3WA3 A;  4X2H A;  1W2Z A;  1YIT 3;  2CKF B;  2KRT A;  3MYT A;  1JKG B;  5IER A;  1K28 A;  1TFO A;  1WMN A;  3LML A;  1JRQ A;  2STD A;  3HK4 A;  4N3V A;  1NDO B;  1IU7 A;  3JVC A;  3SXX A;  3Q1C A;  3I0Y A;  1IVX A;  1R4C A;  3CCM 3;  2HML B;  2JQ5 A;  3L0R A;  3BNE A;  3FG1 A;  2HMJ B;  3RGR A;  2BMR B;  2MF7 A;  1T5Y A;  3N8B A;  5IW9 A;  3KN4 A;  1D6Y A;  3PYJ A;  1W5Z A;  3LT9 A;  2WGQ A;  1U5O A;  3G71 3;  4QWT A;  3S5C A;  3PZW A;  1UI7 A;  3V98 A;  2L4V A;  3KII A;  2XGN A;  2K54 A;  1STF I;  3EHC A;  3UJM A;  2BMO B;  2HMN B;  4N6V 0;  4FMD A;  1KSI A;  3U97 A;  3WA2 X;  1C7H A;  1YVB I;  1W2B 2;  3S27 A;  3VSY A;  3KKG A;  3O8Y A;  3FSD A;  1LNH A;  1OF5 A;  1Z1S A;  3G16 A;  1G96 A;  4PEJ A;  2D1W A;  5AYR B;  3ER7 A;  3X40 A;  2KCD A;  2ML6 A;  1LXE A;  4KFE A;  4R4K A;  1TIJ A;  2E2U A;  3G0K A;  3JUP A;  3NM2 A;  4RZM A;  2PZV A;  2OCT A;  3EJV A;  2SBL A;  3SLU A;  1K41 A;  3JUM A;  1IV9 A;  1SII A;  3OXA A;  1YIJ 3;  1VQ4 3;  2F99 A;  2P09 A;  1UI8 A;  2XGL A;  3AMO A;  5JPU A;  1EA2 A;  3KFQ C;  2OOV A;  2IA7 A;  2WGO A;  3G4S 3;  1CYV A;  3X3X A;  4EC6 A;  3CC7 3;  1IVV A;  1U8C B;  2GBW B;  3CCV 3;  3NHX A;  1JV2 B;  3GAX A;  4OUQ A;  1N8Q A;  3NBR A;  4HM0 B;  2CFL A;  2Y73 A;  4HM8 B;  5EQL A;  2E2V A;  1GS3 A;  1K8A 4;  5EVH A;  3T8N A;  1GD4 A;  1FUW A;  1RJO A;  3EF8 A;  3FGY A;  2HMM B;  4HZ9 B;  3F40 A;  4MJD A;  3VGN A;  4XBY A;  3BNB A;  4GL6 A;  1FGQ A;  3BB9 A;  2XRX B;  3K7C A;  3ROB A;  3LH4 A;  4K1V A;  1NB3 I;  5ELJ A;  4OK0 A;  2IUJ A;  4FCJ A;  5AII A;  1Q7Y 4;  4J9A A;  5DRV A;  1OHS A;  4GB5 A;  4U13 A;  1O7P B;  2E2T A;  1O7W B;  3FF2 A;  1TP6 A;  1S5A A;  3IMA B;  1N8R 4;  1IV7 A;  4N6T A;  3UNL A;  4L7K A;  5CF2 A;  3DY5 A;  2YFL B;  3F7S A;  1M1K 4;  1TU5 A;  4XDW A;  1AVL A;  4FMA A;  1UW1 A;  4R1K A;  3CCL 3;  1V74 A;  4KFD A;  1PFP A;  2LQV A;  1ZX2 A;  2CG0 A;  1Q86 4;  1A2V A;  4WFO A;  4HKV B;  4EV2 A;  1DYU A;  1EQK A;  1OGX A;  2CFW A;  1A67 A;  4FR9 A;  4HM5 B;  5IEO A;  3DGO A;  5KP1 A;  2M7O A;  1AR0 A;  1Q82 4;  2Z76 A;  1N9J A;  2WO0 A;  2GU1 A;  5AYS C;  1SPU A;  3LZA A;  3CD6 3;  3SX1 A;  5KP4 A;  1DVD A;  2OTJ 3;  3EB8 A;  4BTW A;  5IG0 A;  3PXM A;  1QVF 2;  2CWT A;  1JNQ A;  2W56 A;  3DZL A;  2Z6B A;  3OWU A;  2QA4 3;  1NO3 A;  2B24 B;  3OWS A;  3MG3 A;  3NV0 B;  3F14 A;  1TUH A;  1E3V A;  3N54 B;  1O7M B;  3OX9 A;  1N9E A;  3FH1 A;  4MMY B;  2O3O A;  3LTB A;  3GWR A;  2HMO B;  3FF0 A;  3MSO A;  3CC2 3;  1DMM A;  3J7Y d;  3EE1 A;  4N6N B;  5KP3 A;  2IUK A;  1OUN A;  3NM7 A;  4R9K A;  5TGN A;  3DGM A;  2XFS A;  1VQM 3;  4CCV A;  3CXC 2;  3QK9 A;  8CHO A;  1W00 A;  1FGR A;  3A76 A;  1JN5 A;  1Q40 B;  1W01 A;  1YJ9 3;  1RRH A;  4XBT A;  5LC7 A;  2K0M A;  2BNG A;  1OF5 B;  1W02 A;  2CFD A;  2RGQ A;  5AIH A;  1WTH A;  5EEO A;  2P38 A;  1J2B A;  1OHO A;  2IMJ A;  1GY7 A;  5G2G A;  1JKG A;  4O3V A;  3B8L A;  3B4P A;  1VQ7 3;  2Q07 A;  3HI7 A;  3CPW 2;  1AV4 A;  1SQW A;  3CCE 3;  2W6J H;  3PCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...