1BAOA

The contribution of buried hydrogen bonds to protein stability: the crystal structures of two barnase mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINFTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 35
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1baoA00
1ZGXA 8RNTA 1BRIA 1I3IA 1RNTA 2SARA 1T2IA 3AHWA 3HOHA 1I2EA 5BIRA 1RN1A 1B2ZA 1LNIA 2F56A 1A2PA 1YGWA 1CH0A 3D4AA 1BNIA 1GOYA 2C4BA 3Q3FA 1RGKA 1B20A 2F5MA 1JBTA 1I70A 1MGWA 1FUSA 1BGSA 2KF4A 1BUJA 1RGLA 1YVSA 1AY7A 4J5KA 1TRPA 1B2XA 1SARA 1LRAA 1BRGA 4HAAA 1UCJA 5HOHA 1RGAA 3D5IA 1BNJA 1T2HA 4HOHA 1I0VA 2AADA 1BAOA 1BRKA 3D5GA 1X1YA 1R4YA 1RGHA 1RGEA 3BIRA 1JBSA 1BNFA 6RNTA 1RHLA 3WR2A 1FZUA 1G02A 1FYSA 1GMRA 1RMSA 1DE3A 1B21A 1AQZA 1BOXA 1BRNL 4BU4A 1BRJA 2F4YA 1RCKA 1TTOA 3A5EA 1BNGA 6GSPA 1RGCA 2ZA4A 3DH2A 1BANA 3WHOA 1BVIA 1BSEA 1X1XA 1RN4A 1BRSA 3URPA 1X1WA 1RSNA 1MGRA 2KAAA 1BNSA 1RCLA 1UCLA 4BIRA 1I3FA 1B2SA 1FUTA 2HOHA 1PYLA 1RGGA 1GMPA 1I8VA 1FW7A 1I2FA 1BNEA 1PY3A 1GOVA 1BSDA 1BSBA 3AHSA 1LOWA 7RNTA 1JBRA 5BU4A 1I0XA 7GSPA 1UCKA 9RNTA 1Q9EA 1BRHA 5RNTA 1B2UA 1RDSA 4GHOA 2F5WA 3SYUA 2KF6A 1BSAA 1BIRA 3KCHA 2GSPA 1BNRA 2KF5A 2RBIA 1UCIA 3BU4A 3DGYA 1GOUA 3RNTA 1B2MA 4J5GA 2KF3A 1BU4A 1B3SA 4RNTA 1LOYA 1RNBA 1HYFA 1DETA 2BU4A 1B27A 1YNVX 1TRQA 3GSPA 1C54A 1GSPA 1BSCA 4GSPA 1I2GA 2RNTA 1X1UA 1RTUA 2BIRA 1IYYA 1RGFA 3AGOA 1LOVA 5GSPA 1RLSA 2AAEA 3AGNA 1GMQA 1HZ1A
chains in the Genus database with same CATH superfamily
2GBXB 1T3BA 1Y4KA 1BRIA 2M7OA 1UDII 3UNLA 4BL3A 2SARA 2IMJA 1T2IA 1K9M4 4LZIA 3AHWA 1WMNA 4JF8A 2OTJ3 1STDA 1DYUA 2A15A 2FXTA 3PGBA 2Y74A 2CFWA 3U1WA 3MG3A 3H51A 3B4OA 2W03A 4OUQA 5LC7A 3U97A 2W6JH 2IYJA 2P09A 3Q3FA 1N8QA 2RGQA 1ZS7A 4BL2A 4R9LA 5IG4A 5AIFA 1GYBA 4EW5A 2P05A 4HJLB 1FUSA 1US1A 5JPUA 2H0GA 1Q40B 4KFFA 1AY7A 5KP3A 1TRPA 1B2XA 2J8XB 3EX9A 1LRAA 4PEJA 2E2UA 3ALAA 3FCSB 2OQEC 5DRVA 1JJ22 1BRGA 2K0MA 4HAAA 4CPKA 2BMQB 3CCM3 1LNHA 4FCJA 3OX9A 3KSED 4Q53A 1OHSA 3IJEB 3G4S3 1BNJA 1FA3A 2XGLA 5G1LA 4L7KA 1BAOA 4LEHA 2CK3H 3D5GA 5ELUA 1SPUA 1JZDA 1R4YA 1RGHA 2H0HA 3S67A 3B4PA 2R41A 2Z6BA 3EE1A 3HI7A 1GD4A 6RNTA 2BHMA 1FZUA 1G02A 2XFTA 5KP1A 2UX0A 1SQWA 1GMRA 2BMRB 2CG0A 2F98A 2LQVA 2QGUA 3MYTA 3MG1A 3NM7A 4AKZA 4NHFA 5CF2A 2ML6A 1B21A 2GU3A 1AQZA 3ZG5A 3E99A 3MWZA 4DKIA 2FGTA 1BRJA 1ROAA 3EHCA 1F8NA 1IVWA 3G0KA 4MJDA 2ZA4A 2IUJA 3DH2A 6GSPA 1A2VA 1W6YA 1RKYA 1BVIA 3DGLA 3G8ZA 3ZFZA 2O3OA 4HM3B 3KKGA 3AMOB 3WOEB 4L8PA 3CPW2 1MWRA 5BXQA 4TX4A 1A90A 1RCLA 2D42A 3KZTA 1G96A 1FUTA 5D82A 1PU4A 3T8UA 2XSOB 3S28A 1YHQ3 1NJI4 2CFGA 4HM2B 1W6GA 1JKGB 1CYVA 5FW5A 1YVBI 3CXC2 1GMPA 3WOFB 1I2FA 3G713 3CCQ3 1OHOA 1DMNA 1LOWA 7RNTA 1WMPA 4RZMA 1MWTA 1I0XA 1CEWI 4GB5A 4N6TA 1WTHA 2KRTA 1Q9EA 3HX8A 1IT8A 3QK9A 5IEOA 3RGRA 3KN4A 2ML5A 2RFRA 1RDSA 1Q824 4GHOA 1LXEA 4EXRA 2K54A 1O7HB 2PNCA 2JDIH 4ZM8A 3KFQC 1BNRA 1S5AA 1AR0A 1EEJA 3DUKA 3F8HA 4XBYA 2HMJB 4I5QA 1BU4A 1ROVA 2OQEA 3SEDA 3CCR3 1FGTA 1WQLB 1SIHA 2XR8B 3H3HA 5IG3A 3Q1CA 1W02A 4O2HA 3KIIA 3DY5A 3S29A 3PS8A 4R9KA 3KE7A 1IQXA 3BNBA 2XRXB 4LMIA 4FMAA 4N6LA 3SLUA 5IG5A 1FGRA 1OUNA 5GSPA 1RLSA 3LXUX 1JN5A 2CKFB 4ILFA 3M8CA 5IEPA 1GMQA 1NO3A 4STDA 8CHOA 1I3IA 1RNTA 4WYKB 2P0XA 1NNVA 1N9EA 3JUNA 3N9HA 4WP5A 1L5GB 4LGQA 1OHPA 4CDLA 3HOHA 2W56B 2WO0A 1RN1A 5BIRA 1K8A4 1VQP3 2INXA 5AIHA 2F56A 1K41A 2CC3A 2UGIA 3X3YA 1YJ93 4HM4B 1LOXA 3PCRA 3FSDA 2LYXA 3D4AA 3FF0A 1GOYA 3FG3A 1VQ83 1RGKA 3FKAA 5IW9A 3DGOA 4O8SA 1Q7Y4 1MGWA 1UW1A 1UUVB 1YJW3 3JUQA 2KF4A 1TP6A 2FNQA 4I4KA 1TIJA 4J5KA 1BUJA 4EYCA 1SARA 3DM8A 4G1MB 2Y73A 1Q864 1YIJ3 1N9JA 3K0ZA 3IMAB 3CCS3 3K9MC 1K28A 1RGAA 4CJNA 1VQL3 1QJGA 4MMYB 3LTDA 1IDPA 1X1YA 4L8OA 3WODG 3ZG0A 2RSXA 1RGEA 1M904 2YFJB 3K63A 1UUWB 3PYJA 3LYGA 2HMMB 2CH9A 1J2BA 1FYSA 3I563 1RMSA 1QVG2 3L0RA 2HMKB 3V99A 1QVF2 3GRDA 1UUGB 1BRNL 4N6UA 4BU4A 3J7Yd 2OCTA 1LVNA 1RCKA 4N6NB 3EBTA 4OK0A 4IT7A 5AIIA 1S723 1YI23 2XFSA 1ULIB 1QAFA 1IT7A 3NV0A 3EBYA 1SIIA 1RN4A 3I0YA 3Q2PA 3FZWA 3URPA 1NWWA 1KWIA 2WOHA 1RSNA 1MGRA 2KAAA 2Q07A 2F86B 1BNSA 3K5TA 3LZAA 3N54B 1UCLA 1GY7A 1AVLA 1O7NB 1NB3I 3NQZA 1A67A 1R4CA 2HOHA 3LTAA 3RGAA 4FR9A 4GL6A 3GAXA 3G16A 1GOVA 3OWYA 4H61A 2E2VA 4HBRA 1FGMA 4XBXA 3SX1A 3FG1A 4X2HA 3T0UA 5AYRB 1JZOA 2STDA 3HK4A 7GSPA 1E3VA 3F7SA 4HZBB 4BTXA 1LQMB 9RNTA 3Q90A 1KQS2 3V92A 1EA2A 1BRHA 4N6OB 1B2UA 4O3VA 5RNTA 3K7CA 2C10A 3SOAA 3NBBA 1IU7A 1BSAA 3X3XA 4ORLA 1BUQA 2GSPA 3F9SA 1OPYA 2BO9B 4J9AA 2RBIA 3FG4A 2ZL8A 5EQLA 2JQ5A 2F99A 3CCL3 2WGQA 1U5OA 1ULJB 1ZX2A 1NDOB 2B24B 2K3DA 1OCVA 4N6MA 1EKMA 3GZBA 4EV5A 1M9GA 1RNBA 1YGEA 2BU4A 4H3UA 5EEOA 5TGNA 1VQ63 1N8R4 1TRQA 2YX9A 5IG0A 2ZHXB 1GSPA 3GZRA 3MPHA 3PZWA 5CK6A 5STDA 1I2GA 3EJVA 1KSIA 1HU9A 3X41A 1GY6A 5I97A 1IYYA 4RBNA 3BLZA 1VQM3 2CX0A 2W04A 5EVHA 1TJDA 4HZ9B 1HZ1A 3CC73 3HIGA 5G2GA 1ZGXA 3UB1A 5JBSA 2CG1A 1OGZA 3QRDA 2IA7A 5G1KA 3X40A 4MMZB 1I2EA 3ER7A 1B2ZA 1LNIA 4LSOA 1QMAA 1VQO3 1YGWA 5BVBA 1BNIA 1OGXA 1E3RA 1B20A 3OW22 1I70A 4HM5B 1EUIC 2GU1A 4O02B 3EN8A 3NXJA 3NHXA 3NV0B 1FGOA 2P38A 2IY2A 1RRLA 2YFLB 1Q40A 3F14A 4BTWA 1VQN3 5HOHA 2Z77A 2MF7A 1O7PB 1DMMA 1RN7A 3A76A 5AI1A 3D5IA 6STDA 1T2HA 4FMDA 2GBWB 2AADA 1C7HA 2QA43 3DGNA 1W00A 3D9RA 2OTL3 1IK3A 4XBTA 1JBSA 3EC9A 5JPPA 1BNFA 5D81A 1IVVA 4EV2A 1VQ43 5IENA 4X2OA 3D3LA 3I553 1VQ73 1NB5I 1BOXA 4NREA 4WWUC 3CMA3 2B1XB 1LQGC 3A5EA 3JUOA 1QALA 1RGCA 2L1SA 3WHOA 5CF1A 1BSEA 1X1XA 3LT9A 3CNXA 1YJN3 3CD63 3VGNA 3PXMA 1VQQA 1Q814 1FUWA 3MHEA 3AMOA 2CIUA 1MNLA 4BIRA 1VZZA 1Q42A 2XEPA 1ZO2A 3F8XA 3OXAA 1PYLA 3CNMA 1MWUA 3CPOA 1IV9A 1YIT3 1Q7HA 3F40A 4R4KA 1I8VA 1FW7A 1PY3A 1IQYA 2HMLB 3SVAA 4N3VA 1JKGA 1U8CB 3MG2A 1EQKA 4MEIA 4WHAA 2XSHB 3DMCA 4HM6B 5FGOA 5AEUB 1VQK3 1TFOA 5BU4A 4KVHA 3MSOA 1UCKA 4FMCA 5M1AA 1N5HA 5DREA 1NU3A 1Z1SA 2W9PA 5CXOA 2BMOB 4K1UA 3WMDA 2F5WA 3SYUA 5IERA 3EN1B 2KF6A 3T8NA 3LTBA 1BIRA 1RJOA 3KCHA 4HM8B 2KF5A 3BU4A 3BB9A 1JNQA 2GXFA 3DGYA 1B2MA 2MC8A 3WA3A 2OOVC 3EQQB 1B3SA 1N5PA 2V1LA 3DXOA 4KT3B 4CCVA 1W2ZA 2RCDA 1RRHA 1UGHI 4KZ1A 2QEX3 2XH9A 3CC23 1JB2A 1PFPA 1YNVX 3FGYA 4IPBA 3GSPA 2E2TA 1VQ53 1C54A 2W0QA 1JRQA 4GSPA 5ELJA 2W9QA 1JN5B 1IVUA 2RNTA 2BIRA 1RTUA 3JUMA 4FCMA 1FGQA 3AGOA 1GY5A 1LOVA 3HZPA 3AGNA 1GS3A 3LMLA 4J8TA 3NUVA 1EG9B 1OH0A 1SJWA 8RNTA 1UI8A 4MMXB 2GEYA 2CWTA 4R80A 3NX0A 2CX1A 4WYKA 4BTYA 1TFKA 2BT3A 2BNGA 1DVCA 1ASKA 2L4VA 3OWUA 1M1XB 4KFEA 2W56A 3DGMA 3V98A 1CH0A 1V57A 4OVMA 2C4BA 3GZXB 4RNYA 1JV2B 3CC43 3B7CA 2F5MA 3UL5A 1JBTA 1O7MB 3ROBA 2H0IA 1BGSA 1OACA 2XF3A 4HKVB 1RGLA 1YVSA 3FLJA 4XDVA 1KD14 4HYZA 4HM0B 2R4IA 3S27A 1UCJA 3FH1A 3VF1A 4XB5A 3NQYA 4JRFA 4LYLB 3DZLA 1GD3A 1OF5A 2OWPA 4HM7B 3IPTA 1K734 4R1KA 4XDWA 3OWSA 2WOFA 3BNDA 4HOHA 1I0VA 3N8BA 1BRKA 2GEXA 2CFLA 2HMNB 3SOYA 3NBJA 1UGIA 3CCU3 4NPBA 3UL6A 3BIRA 4FMBA 1G0TA 3F7XA 2PZVA 1RHLA 3WR2A 2CFDA 3WA2X 3WDGB 1DE3A 4EC6A 4EBGA 3LOYA 1QAKA 3GWRA 2SBLA 3HIIA 2F4YA 1TTOA 5AEWB 1BNGA 3STDA 3UJMA 1BANA 2IUKA 4AEQA 2OOVA 1DVDA 3CCV3 4WFOA 2KCDA 1D6ZA 1W7CA 1BRSA 2YFIB 3CME3 1M1K4 1V58A 1WNHA 3G6E3 4HM1B 1X1WA 1UI7A 1JB4A 2C11A 5AIGA 1W5ZA 1D6YA 1I3FA 1B2SA 1JB5A 1HKXA 1TUHA 2CWVA 1AV4A 3BNEA 1E97A 1RGGA 3EF8A 4K1VA 3ECFA 5AYSC 1WMOA 5KP4A 4IIAA 3LT8A 1BNEA 5A0OB 1BSDA 1BSBA 2CFKA 3AHSA 1JBRA 2KXGA 2P0MA 3LH4A 1CQSA 2CHCA 2QIYA 3O8YA 4HVNA 3GZYB 5M19A 2HMOB 3S5CA 1W01A 1TU5A 2D1WA 3KSPA 2UUGC 3EB8A 5IF6A 1O7WB 1W4NA 3RDEA 5D83A 1W6CA 3X42A 5M18A 1W2B2 3OV4A 3CCJ3 5LC6A 3B8LA 1STFI 2O9UX 4K90B 1T5YA 2ZDJA 2XGNA 3D79A 3NM2A 4QWTA 2Z7AA 4AKYA 5CLKA 2Z76A 3LTCA 1UCIA 4RNZA 5HGRA 1GOUA 3RNTA 1CYUA 4K61A 1VQ93 4J5GA 4U13A 4XM4A 1KC84 2KF3A 3BNCA 1IQ8A 4RNTA 1MWSA 3X3ZA 3TDGA 1LOYA 7STDA 1HYFA 3JVCA 3SXXA 4FCZA 1DETA 1IVXA 2W2CA 1B27A 3CU3A 3CCE3 2CWUA 1IV7A 1AVKA 1BSCA 1MOLA 1DMQA 3MKIA 4KFDA 1ISKA 3VSYA 1V74A 1X1UA 1OF5B 1D6UA 2WGOA 3JUPA 1RGFA 3NBRA 2I9WA 1O7GB 2AAEA 3FF2A 4N6V0 3PCSA 1A2PA 1A2KA 2CW9A
chains in the Genus database with same CATH topology
1ZGXA 8RNTA 1BRIA 1I3IA 1RNTA 2SARA 1T2IA 3AHWA 3HOHA 1I2EA 5BIRA 1RN1A 1B2ZA 1LNIA 2F56A 1A2PA 1YGWA 1CH0A 3D4AA 1BNIA 1GOYA 2C4BA 3Q3FA 1RGKA 1B20A 2F5MA 1JBTA 1I70A 1MGWA 1FUSA 1BGSA 2KF4A 1BUJA 1RGLA 1YVSA 1AY7A 4J5KA 1TRPA 1B2XA 1SARA 1LRAA 1BRGA 4HAAA 1UCJA 5HOHA 1RGAA 3D5IA 1BNJA 1T2HA 4HOHA 1I0VA 2AADA 1BAOA 1BRKA 3D5GA 1X1YA 1R4YA 1RGHA 1RGEA 3BIRA 1JBSA 1BNFA 6RNTA 1RHLA 3WR2A 1FZUA 1G02A 1FYSA 1GMRA 1RMSA 1DE3A 1B21A 1AQZA 1BOXA 1BRNL 4BU4A 1BRJA 2F4YA 1RCKA 1TTOA 3A5EA 1BNGA 6GSPA 1RGCA 2ZA4A 3DH2A 1BANA 3WHOA 1BVIA 1BSEA 1X1XA 1RN4A 1BRSA 3URPA 1X1WA 1RSNA 1MGRA 2KAAA 1BNSA 1RCLA 1UCLA 4BIRA 1I3FA 1B2SA 1FUTA 2HOHA 1PYLA 1RGGA 1GMPA 1I8VA 1FW7A 1I2FA 1BNEA 1PY3A 1GOVA 1BSDA 1BSBA 3AHSA 1LOWA 7RNTA 1JBRA 5BU4A 1I0XA 7GSPA 1UCKA 9RNTA 1Q9EA 1BRHA 5RNTA 1B2UA 1RDSA 4GHOA 2F5WA 3SYUA 2KF6A 1BSAA 1BIRA 3KCHA 2GSPA 1BNRA 2KF5A 2RBIA 1UCIA 3BU4A 3DGYA 1GOUA 3RNTA 1B2MA 4J5GA 2KF3A 1BU4A 1B3SA 4RNTA 1LOYA 1RNBA 1HYFA 1DETA 2BU4A 1B27A 1YNVX 1TRQA 3GSPA 1C54A 1GSPA 1BSCA 4GSPA 1I2GA 2RNTA 1X1UA 1RTUA 2BIRA 1IYYA 1RGFA 3AGOA 1LOVA 5GSPA 1RLSA 2AAEA 3AGNA 1GMQA 1HZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGX A;  8RNT A;  1BRI A;  1I3I A;  1RNT A;  2SAR A;  1T2I A;  3AHW A;  3HOH A;  1I2E A;  5BIR A;  1RN1 A;  1B2Z A;  1LNI A;  2F56 A;  1A2P A;  1YGW A;  1CH0 A;  3D4A A;  1BNI A;  1GOY A;  2C4B A;  3Q3F A;  1RGK A;  1B20 A;  2F5M A;  1JBT A;  1I70 A;  1MGW A;  1FUS A;  1BGS A;  2KF4 A;  1BUJ A;  1RGL A;  1YVS A;  1AY7 A;  4J5K A;  1TRP A;  1B2X A;  1SAR A;  1LRA A;  1BRG A;  4HAA A;  1UCJ A;  5HOH A;  1RGA A;  3D5I A;  1BNJ A;  1T2H A;  4HOH A;  1I0V A;  2AAD A;  1BAO A;  1BRK A;  3D5G A;  1X1Y A;  1R4Y A;  1RGH A;  1RGE A;  3BIR A;  1JBS A;  1BNF A;  6RNT A;  1RHL A;  3WR2 A;  1FZU A;  1G02 A;  1FYS A;  1GMR A;  1RMS A;  1DE3 A;  1B21 A;  1AQZ A;  1BOX A;  1BRN L;  4BU4 A;  1BRJ A;  2F4Y A;  1RCK A;  1TTO A;  3A5E A;  1BNG A;  6GSP A;  1RGC A;  2ZA4 A;  3DH2 A;  1BAN A;  3WHO A;  1BVI A;  1BSE A;  1X1X A;  1RN4 A;  1BRS A;  3URP A;  1X1W A;  1RSN A;  1MGR A;  2KAA A;  1BNS A;  1RCL A;  1UCL A;  4BIR A;  1I3F A;  1B2S A;  1FUT A;  2HOH A;  1PYL A;  1RGG A;  1GMP A;  1I8V A;  1FW7 A;  1I2F A;  1BNE A;  1PY3 A;  1GOV A;  1BSD A;  1BSB A;  3AHS A;  1LOW A;  7RNT A;  1JBR A;  5BU4 A;  1I0X A;  7GSP A;  1UCK A;  9RNT A;  1Q9E A;  1BRH A;  5RNT A;  1B2U A;  1RDS A;  4GHO A;  2F5W A;  3SYU A;  2KF6 A;  1BSA A;  1BIR A;  3KCH A;  2GSP A;  1BNR A;  2KF5 A;  2RBI A;  1UCI A;  3BU4 A;  3DGY A;  1GOU A;  3RNT A;  1B2M A;  4J5G A;  2KF3 A;  1BU4 A;  1B3S A;  4RNT A;  1LOY A;  1RNB A;  1HYF A;  1DET A;  2BU4 A;  1B27 A;  1YNV X;  1TRQ A;  3GSP A;  1C54 A;  1GSP A;  1BSC A;  4GSP A;  1I2G A;  2RNT A;  1X1U A;  1RTU A;  2BIR A;  1IYY A;  1RGF A;  3AGO A;  1LOV A;  5GSP A;  1RLS A;  2AAE A;  3AGN A;  1GMQ A;  1HZ1 A; 
#chains in the Genus database with same CATH topology
 2GBX B;  1T3B A;  1Y4K A;  1BRI A;  2M7O A;  1UDI I;  3UNL A;  4BL3 A;  2SAR A;  2IMJ A;  1T2I A;  1K9M 4;  4LZI A;  3AHW A;  1WMN A;  4JF8 A;  2OTJ 3;  1STD A;  1DYU A;  2A15 A;  2FXT A;  3PGB A;  2Y74 A;  2CFW A;  3U1W A;  3MG3 A;  3H51 A;  3B4O A;  2W03 A;  4OUQ A;  5LC7 A;  3U97 A;  2W6J H;  2IYJ A;  2P09 A;  3Q3F A;  1N8Q A;  2RGQ A;  1ZS7 A;  4BL2 A;  4R9L A;  5IG4 A;  5AIF A;  1GYB A;  4EW5 A;  2P05 A;  4HJL B;  1FUS A;  1US1 A;  5JPU A;  2H0G A;  1Q40 B;  4KFF A;  1AY7 A;  5KP3 A;  1TRP A;  1B2X A;  2J8X B;  3EX9 A;  1LRA A;  4PEJ A;  2E2U A;  3ALA A;  3FCS B;  2OQE C;  5DRV A;  1JJ2 2;  1BRG A;  2K0M A;  4HAA A;  4CPK A;  2BMQ B;  3CCM 3;  1LNH A;  4FCJ A;  3OX9 A;  3KSE D;  4Q53 A;  1OHS A;  3IJE B;  3G4S 3;  1BNJ A;  1FA3 A;  2XGL A;  5G1L A;  4L7K A;  1BAO A;  4LEH A;  2CK3 H;  3D5G A;  5ELU A;  1SPU A;  1JZD A;  1R4Y A;  1RGH A;  2H0H A;  3S67 A;  3B4P A;  2R41 A;  2Z6B A;  3EE1 A;  3HI7 A;  1GD4 A;  6RNT A;  2BHM A;  1FZU A;  1G02 A;  2XFT A;  5KP1 A;  2UX0 A;  1SQW A;  1GMR A;  2BMR B;  2CG0 A;  2F98 A;  2LQV A;  2QGU A;  3MYT A;  3MG1 A;  3NM7 A;  4AKZ A;  4NHF A;  5CF2 A;  2ML6 A;  1B21 A;  2GU3 A;  1AQZ A;  3ZG5 A;  3E99 A;  3MWZ A;  4DKI A;  2FGT A;  1BRJ A;  1ROA A;  3EHC A;  1F8N A;  1IVW A;  3G0K A;  4MJD A;  2ZA4 A;  2IUJ A;  3DH2 A;  6GSP A;  1A2V A;  1W6Y A;  1RKY A;  1BVI A;  3DGL A;  3G8Z A;  3ZFZ A;  2O3O A;  4HM3 B;  3KKG A;  3AMO B;  3WOE B;  4L8P A;  3CPW 2;  1MWR A;  5BXQ A;  4TX4 A;  1A90 A;  1RCL A;  2D42 A;  3KZT A;  1G96 A;  1FUT A;  5D82 A;  1PU4 A;  3T8U A;  2XSO B;  3S28 A;  1YHQ 3;  1NJI 4;  2CFG A;  4HM2 B;  1W6G A;  1JKG B;  1CYV A;  5FW5 A;  1YVB I;  3CXC 2;  1GMP A;  3WOF B;  1I2F A;  3G71 3;  3CCQ 3;  1OHO A;  1DMN A;  1LOW A;  7RNT A;  1WMP A;  4RZM A;  1MWT A;  1I0X A;  1CEW I;  4GB5 A;  4N6T A;  1WTH A;  2KRT A;  1Q9E A;  3HX8 A;  1IT8 A;  3QK9 A;  5IEO A;  3RGR A;  3KN4 A;  2ML5 A;  2RFR A;  1RDS A;  1Q82 4;  4GHO A;  1LXE A;  4EXR A;  2K54 A;  1O7H B;  2PNC A;  2JDI H;  4ZM8 A;  3KFQ C;  1BNR A;  1S5A A;  1AR0 A;  1EEJ A;  3DUK A;  3F8H A;  4XBY A;  2HMJ B;  4I5Q A;  1BU4 A;  1ROV A;  2OQE A;  3SED A;  3CCR 3;  1FGT A;  1WQL B;  1SIH A;  2XR8 B;  3H3H A;  5IG3 A;  3Q1C A;  1W02 A;  4O2H A;  3KII A;  3DY5 A;  3S29 A;  3PS8 A;  4R9K A;  3KE7 A;  1IQX A;  3BNB A;  2XRX B;  4LMI A;  4FMA A;  4N6L A;  3SLU A;  5IG5 A;  1FGR A;  1OUN A;  5GSP A;  1RLS A;  3LXU X;  1JN5 A;  2CKF B;  4ILF A;  3M8C A;  5IEP A;  1GMQ A;  1NO3 A;  4STD A;  8CHO A;  1I3I A;  1RNT A;  4WYK B;  2P0X A;  1NNV A;  1N9E A;  3JUN A;  3N9H A;  4WP5 A;  1L5G B;  4LGQ A;  1OHP A;  4CDL A;  3HOH A;  2W56 B;  2WO0 A;  1RN1 A;  5BIR A;  1K8A 4;  1VQP 3;  2INX A;  5AIH A;  2F56 A;  1K41 A;  2CC3 A;  2UGI A;  3X3Y A;  1YJ9 3;  4HM4 B;  1LOX A;  3PCR A;  3FSD A;  2LYX A;  3D4A A;  3FF0 A;  1GOY A;  3FG3 A;  1VQ8 3;  1RGK A;  3FKA A;  5IW9 A;  3DGO A;  4O8S A;  1Q7Y 4;  1MGW A;  1UW1 A;  1UUV B;  1YJW 3;  3JUQ A;  2KF4 A;  1TP6 A;  2FNQ A;  4I4K A;  1TIJ A;  4J5K A;  1BUJ A;  4EYC A;  1SAR A;  3DM8 A;  4G1M B;  2Y73 A;  1Q86 4;  1YIJ 3;  1N9J A;  3K0Z A;  3IMA B;  3CCS 3;  3K9M C;  1K28 A;  1RGA A;  4CJN A;  1VQL 3;  1QJG A;  4MMY B;  3LTD A;  1IDP A;  1X1Y A;  4L8O A;  3WOD G;  3ZG0 A;  2RSX A;  1RGE A;  1M90 4;  2YFJ B;  3K63 A;  1UUW B;  3PYJ A;  3LYG A;  2HMM B;  2CH9 A;  1J2B A;  1FYS A;  3I56 3;  1RMS A;  1QVG 2;  3L0R A;  2HMK B;  3V99 A;  1QVF 2;  3GRD A;  1UUG B;  1BRN L;  4N6U A;  4BU4 A;  3J7Y d;  2OCT A;  1LVN A;  1RCK A;  4N6N B;  3EBT A;  4OK0 A;  4IT7 A;  5AII A;  1S72 3;  1YI2 3;  2XFS A;  1ULI B;  1QAF A;  1IT7 A;  3NV0 A;  3EBY A;  1SII A;  1RN4 A;  3I0Y A;  3Q2P A;  3FZW A;  3URP A;  1NWW A;  1KWI A;  2WOH A;  1RSN A;  1MGR A;  2KAA A;  2Q07 A;  2F86 B;  1BNS A;  3K5T A;  3LZA A;  3N54 B;  1UCL A;  1GY7 A;  1AVL A;  1O7N B;  1NB3 I;  3NQZ A;  1A67 A;  1R4C A;  2HOH A;  3LTA A;  3RGA A;  4FR9 A;  4GL6 A;  3GAX A;  3G16 A;  1GOV A;  3OWY A;  4H61 A;  2E2V A;  4HBR A;  1FGM A;  4XBX A;  3SX1 A;  3FG1 A;  4X2H A;  3T0U A;  5AYR B;  1JZO A;  2STD A;  3HK4 A;  7GSP A;  1E3V A;  3F7S A;  4HZB B;  4BTX A;  1LQM B;  9RNT A;  3Q90 A;  1KQS 2;  3V92 A;  1EA2 A;  1BRH A;  4N6O B;  1B2U A;  4O3V A;  5RNT A;  3K7C A;  2C10 A;  3SOA A;  3NBB A;  1IU7 A;  1BSA A;  3X3X A;  4ORL A;  1BUQ A;  2GSP A;  3F9S A;  1OPY A;  2BO9 B;  4J9A A;  2RBI A;  3FG4 A;  2ZL8 A;  5EQL A;  2JQ5 A;  2F99 A;  3CCL 3;  2WGQ A;  1U5O A;  1ULJ B;  1ZX2 A;  1NDO B;  2B24 B;  2K3D A;  1OCV A;  4N6M A;  1EKM A;  3GZB A;  4EV5 A;  1M9G A;  1RNB A;  1YGE A;  2BU4 A;  4H3U A;  5EEO A;  5TGN A;  1VQ6 3;  1N8R 4;  1TRQ A;  2YX9 A;  5IG0 A;  2ZHX B;  1GSP A;  3GZR A;  3MPH A;  3PZW A;  5CK6 A;  5STD A;  1I2G A;  3EJV A;  1KSI A;  1HU9 A;  3X41 A;  1GY6 A;  5I97 A;  1IYY A;  4RBN A;  3BLZ A;  1VQM 3;  2CX0 A;  2W04 A;  5EVH A;  1TJD A;  4HZ9 B;  1HZ1 A;  3CC7 3;  3HIG A;  5G2G A;  1ZGX A;  3UB1 A;  5JBS A;  2CG1 A;  1OGZ A;  3QRD A;  2IA7 A;  5G1K A;  3X40 A;  4MMZ B;  1I2E A;  3ER7 A;  1B2Z A;  1LNI A;  4LSO A;  1QMA A;  1VQO 3;  1YGW A;  5BVB A;  1BNI A;  1OGX A;  1E3R A;  1B20 A;  3OW2 2;  1I70 A;  4HM5 B;  1EUI C;  2GU1 A;  4O02 B;  3EN8 A;  3NXJ A;  3NHX A;  3NV0 B;  1FGO A;  2P38 A;  2IY2 A;  1RRL A;  2YFL B;  1Q40 A;  3F14 A;  4BTW A;  1VQN 3;  5HOH A;  2Z77 A;  2MF7 A;  1O7P B;  1DMM A;  1RN7 A;  3A76 A;  5AI1 A;  3D5I A;  6STD A;  1T2H A;  4FMD A;  2GBW B;  2AAD A;  1C7H A;  2QA4 3;  3DGN A;  1W00 A;  3D9R A;  2OTL 3;  1IK3 A;  4XBT A;  1JBS A;  3EC9 A;  5JPP A;  1BNF A;  5D81 A;  1IVV A;  4EV2 A;  1VQ4 3;  5IEN A;  4X2O A;  3D3L A;  3I55 3;  1VQ7 3;  1NB5 I;  1BOX A;  4NRE A;  4WWU C;  3CMA 3;  2B1X B;  1LQG C;  3A5E A;  3JUO A;  1QAL A;  1RGC A;  2L1S A;  3WHO A;  5CF1 A;  1BSE A;  1X1X A;  3LT9 A;  3CNX A;  1YJN 3;  3CD6 3;  3VGN A;  3PXM A;  1VQQ A;  1Q81 4;  1FUW A;  3MHE A;  3AMO A;  2CIU A;  1MNL A;  4BIR A;  1VZZ A;  1Q42 A;  2XEP A;  1ZO2 A;  3F8X A;  3OXA A;  1PYL A;  3CNM A;  1MWU A;  3CPO A;  1IV9 A;  1YIT 3;  1Q7H A;  3F40 A;  4R4K A;  1I8V A;  1FW7 A;  1PY3 A;  1IQY A;  2HML B;  3SVA A;  4N3V A;  1JKG A;  1U8C B;  3MG2 A;  1EQK A;  4MEI A;  4WHA A;  2XSH B;  3DMC A;  4HM6 B;  5FGO A;  5AEU B;  1VQK 3;  1TFO A;  5BU4 A;  4KVH A;  3MSO A;  1UCK A;  4FMC A;  5M1A A;  1N5H A;  5DRE A;  1NU3 A;  1Z1S A;  2W9P A;  5CXO A;  2BMO B;  4K1U A;  3WMD A;  2F5W A;  3SYU A;  5IER A;  3EN1 B;  2KF6 A;  3T8N A;  3LTB A;  1BIR A;  1RJO A;  3KCH A;  4HM8 B;  2KF5 A;  3BU4 A;  3BB9 A;  1JNQ A;  2GXF A;  3DGY A;  1B2M A;  2MC8 A;  3WA3 A;  2OOV C;  3EQQ B;  1B3S A;  1N5P A;  2V1L A;  3DXO A;  4KT3 B;  4CCV A;  1W2Z A;  2RCD A;  1RRH A;  1UGH I;  4KZ1 A;  2QEX 3;  2XH9 A;  3CC2 3;  1JB2 A;  1PFP A;  1YNV X;  3FGY A;  4IPB A;  3GSP A;  2E2T A;  1VQ5 3;  1C54 A;  2W0Q A;  1JRQ A;  4GSP A;  5ELJ A;  2W9Q A;  1JN5 B;  1IVU A;  2RNT A;  2BIR A;  1RTU A;  3JUM A;  4FCM A;  1FGQ A;  3AGO A;  1GY5 A;  1LOV A;  3HZP A;  3AGN A;  1GS3 A;  3LML A;  4J8T A;  3NUV A;  1EG9 B;  1OH0 A;  1SJW A;  8RNT A;  1UI8 A;  4MMX B;  2GEY A;  2CWT A;  4R80 A;  3NX0 A;  2CX1 A;  4WYK A;  4BTY A;  1TFK A;  2BT3 A;  2BNG A;  1DVC A;  1ASK A;  2L4V A;  3OWU A;  1M1X B;  4KFE A;  2W56 A;  3DGM A;  3V98 A;  1CH0 A;  1V57 A;  4OVM A;  2C4B A;  3GZX B;  4RNY A;  1JV2 B;  3CC4 3;  3B7C A;  2F5M A;  3UL5 A;  1JBT A;  1O7M B;  3ROB A;  2H0I A;  1BGS A;  1OAC A;  2XF3 A;  4HKV B;  1RGL A;  1YVS A;  3FLJ A;  4XDV A;  1KD1 4;  4HYZ A;  4HM0 B;  2R4I A;  3S27 A;  1UCJ A;  3FH1 A;  3VF1 A;  4XB5 A;  3NQY A;  4JRF A;  4LYL B;  3DZL A;  1GD3 A;  1OF5 A;  2OWP A;  4HM7 B;  3IPT A;  1K73 4;  4R1K A;  4XDW A;  3OWS A;  2WOF A;  3BND A;  4HOH A;  1I0V A;  3N8B A;  1BRK A;  2GEX A;  2CFL A;  2HMN B;  3SOY A;  3NBJ A;  1UGI A;  3CCU 3;  4NPB A;  3UL6 A;  3BIR A;  4FMB A;  1G0T A;  3F7X A;  2PZV A;  1RHL A;  3WR2 A;  2CFD A;  3WA2 X;  3WDG B;  1DE3 A;  4EC6 A;  4EBG A;  3LOY A;  1QAK A;  3GWR A;  2SBL A;  3HII A;  2F4Y A;  1TTO A;  5AEW B;  1BNG A;  3STD A;  3UJM A;  1BAN A;  2IUK A;  4AEQ A;  2OOV A;  1DVD A;  3CCV 3;  4WFO A;  2KCD A;  1D6Z A;  1W7C A;  1BRS A;  2YFI B;  3CME 3;  1M1K 4;  1V58 A;  1WNH A;  3G6E 3;  4HM1 B;  1X1W A;  1UI7 A;  1JB4 A;  2C11 A;  5AIG A;  1W5Z A;  1D6Y A;  1I3F A;  1B2S A;  1JB5 A;  1HKX A;  1TUH A;  2CWV A;  1AV4 A;  3BNE A;  1E97 A;  1RGG A;  3EF8 A;  4K1V A;  3ECF A;  5AYS C;  1WMO A;  5KP4 A;  4IIA A;  3LT8 A;  1BNE A;  5A0O B;  1BSD A;  1BSB A;  2CFK A;  3AHS A;  1JBR A;  2KXG A;  2P0M A;  3LH4 A;  1CQS A;  2CHC A;  2QIY A;  3O8Y A;  4HVN A;  3GZY B;  5M19 A;  2HMO B;  3S5C A;  1W01 A;  1TU5 A;  2D1W A;  3KSP A;  2UUG C;  3EB8 A;  5IF6 A;  1O7W B;  1W4N A;  3RDE A;  5D83 A;  1W6C A;  3X42 A;  5M18 A;  1W2B 2;  3OV4 A;  3CCJ 3;  5LC6 A;  3B8L A;  1STF I;  2O9U X;  4K90 B;  1T5Y A;  2ZDJ A;  2XGN A;  3D79 A;  3NM2 A;  4QWT A;  2Z7A A;  4AKY A;  5CLK A;  2Z76 A;  3LTC A;  1UCI A;  4RNZ A;  5HGR A;  1GOU A;  3RNT A;  1CYU A;  4K61 A;  1VQ9 3;  4J5G A;  4U13 A;  4XM4 A;  1KC8 4;  2KF3 A;  3BNC A;  1IQ8 A;  4RNT A;  1MWS A;  3X3Z A;  3TDG A;  1LOY A;  7STD A;  1HYF A;  3JVC A;  3SXX A;  4FCZ A;  1DET A;  1IVX A;  2W2C A;  1B27 A;  3CU3 A;  3CCE 3;  2CWU A;  1IV7 A;  1AVK A;  1BSC A;  1MOL A;  1DMQ A;  3MKI A;  4KFD A;  1ISK A;  3VSY A;  1V74 A;  1X1U A;  1OF5 B;  1D6U A;  2WGO A;  3JUP A;  1RGF A;  3NBR A;  2I9W A;  1O7G B;  2AAE A;  3FF2 A;  4N6V 0;  3PCS A;  1A2P A;  1A2K A;  2CW9 A; 
#chains in the Genus database with same CATH homology
 1ZGX A;  8RNT A;  1BRI A;  1I3I A;  1RNT A;  2SAR A;  1T2I A;  3AHW A;  3HOH A;  1I2E A;  5BIR A;  1RN1 A;  1B2Z A;  1LNI A;  2F56 A;  1A2P A;  1YGW A;  1CH0 A;  3D4A A;  1BNI A;  1GOY A;  2C4B A;  3Q3F A;  1RGK A;  1B20 A;  2F5M A;  1JBT A;  1I70 A;  1MGW A;  1FUS A;  1BGS A;  2KF4 A;  1BUJ A;  1RGL A;  1YVS A;  1AY7 A;  4J5K A;  1TRP A;  1B2X A;  1SAR A;  1LRA A;  1BRG A;  4HAA A;  1UCJ A;  5HOH A;  1RGA A;  3D5I A;  1BNJ A;  1T2H A;  4HOH A;  1I0V A;  2AAD A;  1BAO A;  1BRK A;  3D5G A;  1X1Y A;  1R4Y A;  1RGH A;  1RGE A;  3BIR A;  1JBS A;  1BNF A;  6RNT A;  1RHL A;  3WR2 A;  1FZU A;  1G02 A;  1FYS A;  1GMR A;  1RMS A;  1DE3 A;  1B21 A;  1AQZ A;  1BOX A;  1BRN L;  4BU4 A;  1BRJ A;  2F4Y A;  1RCK A;  1TTO A;  3A5E A;  1BNG A;  6GSP A;  1RGC A;  2ZA4 A;  3DH2 A;  1BAN A;  3WHO A;  1BVI A;  1BSE A;  1X1X A;  1RN4 A;  1BRS A;  3URP A;  1X1W A;  1RSN A;  1MGR A;  2KAA A;  1BNS A;  1RCL A;  1UCL A;  4BIR A;  1I3F A;  1B2S A;  1FUT A;  2HOH A;  1PYL A;  1RGG A;  1GMP A;  1I8V A;  1FW7 A;  1I2F A;  1BNE A;  1PY3 A;  1GOV A;  1BSD A;  1BSB A;  3AHS A;  1LOW A;  7RNT A;  1JBR A;  5BU4 A;  1I0X A;  7GSP A;  1UCK A;  9RNT A;  1Q9E A;  1BRH A;  5RNT A;  1B2U A;  1RDS A;  4GHO A;  2F5W A;  3SYU A;  2KF6 A;  1BSA A;  1BIR A;  3KCH A;  2GSP A;  1BNR A;  2KF5 A;  2RBI A;  1UCI A;  3BU4 A;  3DGY A;  1GOU A;  3RNT A;  1B2M A;  4J5G A;  2KF3 A;  1BU4 A;  1B3S A;  4RNT A;  1LOY A;  1RNB A;  1HYF A;  1DET A;  2BU4 A;  1B27 A;  1YNV X;  1TRQ A;  3GSP A;  1C54 A;  1GSP A;  1BSC A;  4GSP A;  1I2G A;  2RNT A;  1X1U A;  1RTU A;  2BIR A;  1IYY A;  1RGF A;  3AGO A;  1LOV A;  5GSP A;  1RLS A;  2AAE A;  3AGN A;  1GMQ A;  1HZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...