1BAOA

The contribution of buried hydrogen bonds to protein stability: the crystal structures of two barnase mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINFTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 35
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1baoA00
1BNIA 1RCLA 1BAOA 1RGAA 3BU4A 3DH2A 1BSEA 1RN1A 1RNTA 1X1YA 2ZA4A 2KF6A 3AHWA 1FYSA 1X1WA 5RNTA 2F4YA 1I2FA 4GSPA 1MGRA 5BIRA 1BU4A 1BRIA 1RGCA 1T2HA 1I2EA 1RLSA 1YGWA 1CH0A 3AGNA 1GOVA 3D5IA 1I3FA 1X1XA 1B27A 1BNFA 1R4YA 1JBTA 1BGSA 1B2SA 3D5GA 1A2PA 3WR2A 1BRJA 2HOHA 2RNTA 1RTUA 1BIRA 3D4AA 3DGYA 1RNBA 3Q3FA 1DETA 1SARA 4BIRA 3AGOA 1FUTA 4HAAA 1BRHA 1RGEA 1TRPA 3BIRA 1JBRA 6GSPA 1BRGA 1BNGA 3RNTA 1UCLA 1HYFA 1B3SA 1RGKA 1RGHA 1BNEA 1BNSA 1I70A 1YNVX 1DE3A 2F5WA 1LNIA 1LOYA 1B2UA 1BSDA 1TTOA 1RMSA 1HZ1A 1FUSA 2GSPA 1C54A 1I8VA 2SARA 1I0XA 1RHLA 1RGGA 5HOHA 2AADA 1BUJA 1B21A 1LOWA 1GOUA 2F5MA 1PYLA 1Q9EA 5GSPA 2KF4A 1I2GA 6RNTA 1RCKA 2BIRA 1LOVA 3WHOA 1AQZA 3GSPA 1MGWA 1X1UA 4GHOA 3HOHA 3AHSA 1GSPA 1ZGXA 7GSPA 1RGLA 3KCHA 1UCKA 1RSNA 2F56A 1JBSA 1GOYA 1BNJA 2C4BA 1G02A 3A5EA 1B20A 1BOXA 1RGFA 1GMPA 2AAEA 1B2MA 4HOHA 1RDSA 4BU4A 1TRQA 1BRKA 1B2XA 1BVIA 1GMQA 1FW7A 1LRAA 1BSCA 1BANA 1T2IA 1BSAA 1I3IA 1UCIA 8RNTA 2KF5A 1YVSA 1BRSA 1UCJA 2KAAA 4J5GA 1GMRA 1BNRA 1IYYA 2BU4A 5BU4A 2KF3A 1FZUA 1AY7A 1B2ZA 3SYUA 4J5KA 1PY3A 2RBIA 4RNTA 1RN4A 3URPA 7RNTA 9RNTA 1BRNL 1BSBA 1I0VA
chains in the Genus database with same CATH superfamily
1F8NA 2W9QA 4LSOA 1BAOA 2J8XB 3FZWA 3CNXA 2PZVA 1IVUA 3AMOA 4ILFA 1BSEA 1RNTA 3IMAB 1OHPA 1R4CA 2WGOA 3KSED 3NV0A 4FMAA 1UI8A 2XF3A 2F4YA 1DMQA 1MGRA 5AIIA 4AEQA 2H0GA 1T2HA 1I2EA 1YGWA 2FNQA 3D79A 3LMLA 5BVBA 8CHOA 3MG1A 1IT8A 1K9M4 2P0XA 1I3FA 1BUQA 4N6MA 4CPKA 1FGTA 3DGNA 2GEXA 5AI1A 3G0KA 3DM8A 1BGSA 4HM8B 1A2PA 3FSDA 2B1XB 3MSOA 2F98A 2HOHA 1RTUA 3F40A 3S28A 1D6ZA 1BIRA 3U1WA 3CC73 3D4AA 4XB5A 3CD63 1DETA 4HM0B 4XBTA 1QAFA 1SARA 3AGOA 1FUTA 5IG5A 1VQ63 3EQQB 3Q2PA 1RRLA 2GXFA 1V58A 1IK3A 1W6YA 5CK6A 1EUIC 2INXA 1PU4A 3BIRA 3WA3A 1JBRA 5FW5A 1BRGA 1QMAA 3RNTA 1MWTA 2IA7A 5A0OB 1A67A 2F5WA 2MF7A 1VQO3 1LOYA 1FA3A 1B2UA 4OUQA 1Q40B 1OCVA 4KFFA 1EG9B 5D83A 4O2HA 1HZ1A 3DGLA 4WYKB 1C54A 2CWTA 2GBWB 4JF8A 1FUWA 3LT9A 1OGZA 3CCM3 3N8BA 4ORLA 4XBYA 3I553 4PEJA 3STDA 3I563 1FGMA 2C11A 4LGQA 1Q9EA 5GSPA 3SEDA 1NJI4 2XRXB 3V92A 5STDA 3Q90A 1I2GA 1Q864 3SX1A 4HM1B 5CF2A 1LOVA 2XGNA 2L1SA 2L4VA 2W56A 3GSPA 2QEX3 1O7WB 4R1KA 1YJN3 4IIAA 1RJOA 1OHOA 4O02B 3B7CA 2OQEC 3B4PA 3RGAA 2BO9B 1VQ43 1RGLA 2ML6A 3KCHA 3KFQC 1S723 3FCSB 1RSNA 1ROAA 2UGIA 5IEOA 3GWRA 3DGMA 1NU3A 4HM7B 2C4BA 4J9AA 4GB5A 1YIJ3 4LMIA 4XDVA 6STDA 2AAEA 1AV4A 3FGYA 1JNQA 4HOHA 1RDSA 1GS3A 5AYRB 1UDII 1GMQA 2KRTA 3G4S3 3CCJ3 2CWUA 1BSCA 2Q07A 1JN5A 1V74A 8RNTA 1UCIA 1W4NA 3SVAA 4HM2B 3V99A 4KT3B 2R41A 4HZBB 1FGOA 3ER7A 4EV5A 5LC7A 3OW22 1TIJA 3DMCA 4AKYA 1FGRA 2E2UA 2CHCA 1UCJA 3X40A 1RN7A 3RGRA 3G713 4R4KA 4J5KA 2RBIA 1UI7A 2W9PA 3CCR3 1ISKA 7RNTA 9RNTA 3Q1CA 4HJLB 3S67A 1BSBA 1IU7A 1MWUA 1STFI 4N3VA 1RCLA 2XH9A 1OGXA 4TX4A 3UB1A 1GYBA 4IPBA 1JKGB 4FR9A 4N6NB 1E3VA 3DH2A 4EYCA 2QA43 1YI23 4X2HA 1VQN3 5IERA 1SPUA 1OUNA 5TGNA 1V57A 4MMZB 1N8R4 1LQMB 5BIRA 4GSPA 4KFDA 1BU4A 2CX0A 3NUVA 3FG4A 1JB2A 3AGNA 3TDGA 3O8YA 5KP3A 1TFOA 1W7CA 3V98A 1Q42A 3MYTA 1UUGB 1OF5A 1CYUA 2W2CA 3WA2X 3D5GA 4HKVB 2E2VA 1BRJA 3GZRA 5AIHA 4WWUC 2XSHB 5M1AA 3DGYA 3SOYA 1JRQA 4K1UA 4K90B 4CDLA 5IF6A 2YFLB 4I5QA 4N6UA 2Y73A 3F8XA 1US1A 1BRHA 2Z77A 4HM5B 4H3UA 3NHXA 1W2B2 1UUWB 3PGBA 2E2TA 3JVCA 1JZDA 4HZ9B 3OV4A 3EN8A 3MG2A 3CCL3 2ZHXB 1BNEA 2SBLA 5DRVA 1BNSA 1YNVX 3VF1A 3X42A 1W00A 1O7MB 1LXEA 2H0HA 5IEPA 3CMA3 3CCQ3 1DVCA 1IQYA 5EVHA 1BSDA 3UL6A 3NBJA 3CCU3 2WGQA 2XGLA 2W0QA 1FUSA 1C7HA 3GZYB 3N9HA 1I8VA 3PYJA 2CKFB 4MEIA 2AADA 4R9LA 1VQK3 3GAXA 4I4KA 2F5MA 3VGNA 1IV7A 4ZM8A 5M18A 2M7OA 1IVVA 2H0IA 3PXMA 2O3OA 4WHAA 2KF4A 3D3LA 4FCZA 2RFRA 1RCKA 1QAKA 2FXTA 3IPTA 3WHOA 4U13A 1E97A 4O8SA 3G6E3 1OHSA 2YFJB 1IQ8A 2F86B 1EEJA 1GSPA 1UGHI 3LT8A 1UUVB 5JBSA 4KVHA 1YHQ3 1D6YA 1RRHA 2IYJA 1BNJA 3FF0A 3ZFZA 1GY5A 1AR0A 3KIIA 2CFWA 4H61A 1Z1SA 4O3VA 4JRFA 3WMDA 3NXJA 5IG0A 2C10A 2CFGA 1B20A 4IT7A 3BNCA 1GMPA 1RGFA 3M8CA 1EQKA 4HM4B 3OWSA 1TRQA 3K9MC 1W02A 4N6TA 2BMQB 4CCVA 1LRAA 4HM6B 1W01A 2WOHA 1YVBI 4RBNA 1BSAA 4LZIA 1SIHA 2IUKA 5M19A 1A90A 2CFDA 5IG4A 3UL5A 1OPYA 4WP5A 3MKIA 2UX0A 3OWYA 3GZXB 3SOAA 1YJW3 1DMMA 3FG3A 1M1K4 2XEPA 5BU4A 2KF3A 3IJEB 4FMDA 1QVF2 3JUQA 1EA2A 1M1XB 3HK4A 4XM4A 2CFKA 2RCDA 2FGTA 2CK3H 4N6LA 3URPA 3RDEA 2I9WA 4HBRA 4NPBA 1WQLB 1I0VA 3HZPA 1OACA 5EQLA 4RNYA 1VQ73 4Q53A 3BU4A 1PFPA 2ZA4A 4G1MB 1N8QA 1CEWI 3FG1A 3WODG 3CCE3 2Z6BA 4J8TA 1X1WA 5RNTA 4EXRA 1I2FA 2V1LA 1RGCA 3LTAA 1IV9A 1RLSA 4WFOA 3DUKA 1N9EA 1MNLA 3D5IA 1GOVA 1JZOA 1YGEA 3GZBA 2CIUA 4OK0A 4EBGA 3K5TA 1KC84 5CXOA 2R4IA 3EC9A 3CCS3 3PCRA 1X1XA 2JDIH 1B27A 1BNFA 1M9GA 1ROVA 3NM7A 4R80A 1HU9A 1ZO2A 1B2SA 1AVKA 1N5PA 1Q40A 1W6CA 2GU3A 2F99A 2HMKB 3F8HA 3HIIA 2BMOB 2HMMB 3ALAA 4HYZA 5LC6A 3LH4A 4WYKA 2OOVA 4STDA 1RNBA 3AMOB 2CC3A 2OOVC 3FF2A 3FH1A 4L8PA 4BIRA 4HAAA 1Q7HA 3NV0B 4RNZA 3B8LA 5AEWB 1VQ93 1RGEA 3G8ZA 3LTDA 1VQQA 2LYXA 5G2GA 5D82A 2LQVA 1NDOB 3OWUA 1D6UA 4KZ1A 2Z76A 6GSPA 3NQYA 1BNGA 1ULIB 1JB5A 1UCLA 3WDGB 1B3SA 4BL2A 1CYVA 1RGKA 1RGHA 3EF8A 3S5CA 1I70A 1VQP3 2CG1A 3HX8A 1LNIA 2XSOB 1DYUA 3K7CA 4BL3A 1O7PB 4OVMA 1STDA 1U8CB 2W6JH 3PCSA 4X2OA 3SXXA 1RMSA 2RSXA 2K3DA 2CFLA 2PNCA 2GSPA 2YFIB 5KP1A 3DXOA 3BNEA 5HOHA 3MWZA 1BUJA 3OXAA 1LQGC 3QK9A 1GOUA 5D81A 1QVG2 3J7Yd 1PYLA 3DY5A 2RGQA 5IG3A 1NB5I 2K0MA 1ASKA 1E3RA 3NBRA 4BTYA 6RNTA 1LNHA 1TJDA 4K61A 3S27A 3H51A 1S5AA 1AQZA 1J2BA 1X1UA 4GHOA 3CU3A 1MWSA 3HOHA 2BT3A 2P05A 7GSPA 4HM3B 3QRDA 1Q824 3PS8A 3G16A 1UCKA 1W5ZA 2CH9A 5FGOA 5EEOA 1EKMA 1LVNA 5DREA 2B24B 1G02A 1L5GB 3A5EA 3UNLA 3FLJA 2HMNB 1KD14 3H3HA 4MMYB 4EV2A 2ZDJA 1K734 1NNVA 3X3ZA 4BU4A 4KFEA 1B2XA 1BVIA 3ECFA 1JKGA 5KP4A 4FCJA 1O7GB 5BXQA 3F14A 3X3YA 2CWVA 2UUGC 2W56B 1ZX2A 2JQ5A 2KF5A 3DGOA 3PZWA 1K28A 5JPPA 1K41A 5ELUA 2A15A 1Q7Y4 1SJWA 1YVSA 1YJ93 4MMXB 1BRSA 5AEUB 1VQ83 4J5GA 3T0UA 3D9RA 3CCV3 1GMRA 3T8UA 1BNRA 1IYYA 5I97A 3SYUA 1FZUA 1AY7A 3VSYA 2GEYA 1SIIA 1RN4A 3S29A 1BRNL 1WMPA 2P0MA 1CQSA 2OTJ3 1BNIA 4BTXA 1DVDA 1RGAA 2KXGA 2O9UX 3BLZA 3EBTA 3EJVA 1JN5B 3OX9A 1ULJB 3L0RA 1VQL3 1RN1A 1X1YA 2QIYA 1AVLA 2OCTA 2KF6A 4R9KA 2GBXB 3AHWA 1FYSA 1T5YA 3E99A 3N54B 1UW1A 2CW9A 3F9SA 5IENA 1BRIA 1GD4A 2Z7AA 1YIT3 3CPW2 1CH0A 3CC23 3JUNA 3MPHA 1VQ53 3EN1B 3LTBA 3X3XA 2Y74A 1U5OA 1IVXA 3GRDA 3LTCA 4FCMA 2P09A 4EC6A 1R4YA 3FKAA 1JBTA 2OTL3 2OWPA 3WR2A 4QWTA 1G0TA 2RNTA 3JUMA 3SLUA 2STDA 5IW9A 1JB4A 1QJGA 1WMNA 1MWRA 4EW5A 3Q3FA 1OH0A 3EBYA 5JPUA 2ML5A 4NREA 3JUPA 1Y4KA 1O7HB 3JUOA 3NM2A 4XBXA 3HI7A 3NBBA 2IUJA 2P38A 2QGUA 1TRPA 4L7KA 5ELJA 4HVNA 1HKXA 1ZS7A 2OQEA 2CX1A 1HYFA 3EB8A 3EX9A 5G1KA 1UGIA 3MG3A 4XDWA 1KWIA 2ZL8A 5CLKA 1IT7A 3CNMA 1DE3A 1OF5B 1IVWA 1NO3A 1VQM3 1LOXA 3BNBA 3CPOA 1N9JA 1T3BA 2IY2A 1MOLA 3U97A 5AYSC 2IMJA 1TTOA 4RZMA 3T8NA 3LYGA 4L8OA 2XFSA 2SARA 3UJMA 4LEHA 1I0XA 1RHLA 1RGGA 3K63A 3LZAA 4DKIA 1RKYA 4N6OB 1B21A 1NB3I 2KCDA 1LOWA 1W6GA 5AIFA 1TU5A 1SQWA 2BMRB 2HMJB 5AIGA 1IQXA 3EHCA 4GL6A 5CF1A 3WOFB 2MC8A 2HMLB 3CME3 1M904 1JJ22 3KSPA 1WMOA 3HIGA 1A2KA 1VZZA 2BIRA 3KE7A 3DZLA 1TFKA 4NHFA 4BTWA 2K54A 4FMCA 4K1VA 3KZTA 3CC43 1MGWA 2YX9A 3AHSA 1ZGXA 3F7SA 3KKGA 1A2VA 1K8A4 1G96A 2BNGA 2F56A 1QALA 2WOFA 7STDA 1GOYA 3EE1A 3X41A 1JBSA 1KQS2 3LXUX 4AKZA 2BHMA 1N5HA 4N6V0 1O7NB 1JV2B 3LOYA 3B4OA 2W04A 1BOXA 1WNHA 2WO0A 3A76A 1B2MA 1GD3A 3BNDA 1TP6A 1BRKA 3K0ZA 3KN4A 5G1LA 3NX0A 3WOEB 1FW7A 1BANA 1T2IA 2HMOB 3ROBA 2D42A 1WTHA 3NQZA 1I3IA 3I0YA 3ZG5A 1TUHA 3ZG0A 2XFTA 1GY6A 4FMBA 3BB9A 2XR8B 2GU1A 3F7XA 5HGRA 1Q814 1KSIA 2KAAA 2CG0A 2BU4A 3MHEA 1NWWA 1W2ZA 1B2ZA 1FGQA 1PY3A 1GY7A 4RNTA 4MJDA 2W03A 4LYLB 1IDPA 4CJNA 1DMNA 2D1WA 3CXC2
chains in the Genus database with same CATH topology
1BNIA 1RCLA 1BAOA 1RGAA 3BU4A 3DH2A 1BSEA 1RN1A 1RNTA 1X1YA 2ZA4A 2KF6A 3AHWA 1FYSA 1X1WA 5RNTA 2F4YA 1I2FA 4GSPA 1MGRA 5BIRA 1BU4A 1BRIA 1RGCA 1T2HA 1I2EA 1RLSA 1YGWA 1CH0A 3AGNA 1GOVA 3D5IA 1I3FA 1X1XA 1B27A 1BNFA 1R4YA 1JBTA 1BGSA 1B2SA 3D5GA 1A2PA 3WR2A 1BRJA 2HOHA 2RNTA 1RTUA 1BIRA 3D4AA 3DGYA 1RNBA 3Q3FA 1DETA 1SARA 4BIRA 3AGOA 1FUTA 4HAAA 1BRHA 1RGEA 1TRPA 3BIRA 1JBRA 6GSPA 1BRGA 1BNGA 3RNTA 1UCLA 1HYFA 1B3SA 1RGKA 1RGHA 1BNEA 1BNSA 1I70A 1YNVX 1DE3A 2F5WA 1LNIA 1LOYA 1B2UA 1BSDA 1TTOA 1RMSA 1HZ1A 1FUSA 2GSPA 1C54A 1I8VA 2SARA 1I0XA 1RHLA 1RGGA 5HOHA 2AADA 1BUJA 1B21A 1LOWA 1GOUA 2F5MA 1PYLA 1Q9EA 5GSPA 2KF4A 1I2GA 6RNTA 1RCKA 2BIRA 1LOVA 3WHOA 1AQZA 3GSPA 1MGWA 1X1UA 4GHOA 3HOHA 3AHSA 1GSPA 1ZGXA 7GSPA 1RGLA 3KCHA 1UCKA 1RSNA 2F56A 1JBSA 1GOYA 1BNJA 2C4BA 1G02A 3A5EA 1B20A 1BOXA 1RGFA 1GMPA 2AAEA 1B2MA 4HOHA 1RDSA 4BU4A 1TRQA 1BRKA 1B2XA 1BVIA 1GMQA 1FW7A 1LRAA 1BSCA 1BANA 1T2IA 1BSAA 1I3IA 1UCIA 8RNTA 2KF5A 1YVSA 1BRSA 1UCJA 2KAAA 4J5GA 1GMRA 1BNRA 1IYYA 2BU4A 5BU4A 2KF3A 1FZUA 1AY7A 1B2ZA 3SYUA 4J5KA 1PY3A 2RBIA 4RNTA 1RN4A 3URPA 7RNTA 9RNTA 1BRNL 1BSBA 1I0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNI A;  1RCL A;  1BAO A;  1RGA A;  3BU4 A;  3DH2 A;  1BSE A;  1RN1 A;  1RNT A;  1X1Y A;  2ZA4 A;  2KF6 A;  3AHW A;  1FYS A;  1X1W A;  5RNT A;  2F4Y A;  1I2F A;  4GSP A;  1MGR A;  5BIR A;  1BU4 A;  1BRI A;  1RGC A;  1T2H A;  1I2E A;  1RLS A;  1YGW A;  1CH0 A;  3AGN A;  1GOV A;  3D5I A;  1I3F A;  1X1X A;  1B27 A;  1BNF A;  1R4Y A;  1JBT A;  1BGS A;  1B2S A;  3D5G A;  1A2P A;  3WR2 A;  1BRJ A;  2HOH A;  2RNT A;  1RTU A;  1BIR A;  3D4A A;  3DGY A;  1RNB A;  3Q3F A;  1DET A;  1SAR A;  4BIR A;  3AGO A;  1FUT A;  4HAA A;  1BRH A;  1RGE A;  1TRP A;  3BIR A;  1JBR A;  6GSP A;  1BRG A;  1BNG A;  3RNT A;  1UCL A;  1HYF A;  1B3S A;  1RGK A;  1RGH A;  1BNE A;  1BNS A;  1I70 A;  1YNV X;  1DE3 A;  2F5W A;  1LNI A;  1LOY A;  1B2U A;  1BSD A;  1TTO A;  1RMS A;  1HZ1 A;  1FUS A;  2GSP A;  1C54 A;  1I8V A;  2SAR A;  1I0X A;  1RHL A;  1RGG A;  5HOH A;  2AAD A;  1BUJ A;  1B21 A;  1LOW A;  1GOU A;  2F5M A;  1PYL A;  1Q9E A;  5GSP A;  2KF4 A;  1I2G A;  6RNT A;  1RCK A;  2BIR A;  1LOV A;  3WHO A;  1AQZ A;  3GSP A;  1MGW A;  1X1U A;  4GHO A;  3HOH A;  3AHS A;  1GSP A;  1ZGX A;  7GSP A;  1RGL A;  3KCH A;  1UCK A;  1RSN A;  2F56 A;  1JBS A;  1GOY A;  1BNJ A;  2C4B A;  1G02 A;  3A5E A;  1B20 A;  1BOX A;  1RGF A;  1GMP A;  2AAE A;  1B2M A;  4HOH A;  1RDS A;  4BU4 A;  1TRQ A;  1BRK A;  1B2X A;  1BVI A;  1GMQ A;  1FW7 A;  1LRA A;  1BSC A;  1BAN A;  1T2I A;  1BSA A;  1I3I A;  1UCI A;  8RNT A;  2KF5 A;  1YVS A;  1BRS A;  1UCJ A;  2KAA A;  4J5G A;  1GMR A;  1BNR A;  1IYY A;  2BU4 A;  5BU4 A;  2KF3 A;  1FZU A;  1AY7 A;  1B2Z A;  3SYU A;  4J5K A;  1PY3 A;  2RBI A;  4RNT A;  1RN4 A;  3URP A;  7RNT A;  9RNT A;  1BRN L;  1BSB A;  1I0V A; 
#chains in the Genus database with same CATH topology
 1F8N A;  2W9Q A;  4LSO A;  1BAO A;  2J8X B;  3FZW A;  3CNX A;  2PZV A;  1IVU A;  3AMO A;  4ILF A;  1BSE A;  1RNT A;  3IMA B;  1OHP A;  1R4C A;  2WGO A;  3KSE D;  3NV0 A;  4FMA A;  1UI8 A;  2XF3 A;  2F4Y A;  1DMQ A;  1MGR A;  5AII A;  4AEQ A;  2H0G A;  1T2H A;  1I2E A;  1YGW A;  2FNQ A;  3D79 A;  3LML A;  5BVB A;  8CHO A;  3MG1 A;  1IT8 A;  1K9M 4;  2P0X A;  1I3F A;  1BUQ A;  4N6M A;  4CPK A;  1FGT A;  3DGN A;  2GEX A;  5AI1 A;  3G0K A;  3DM8 A;  1BGS A;  4HM8 B;  1A2P A;  3FSD A;  2B1X B;  3MSO A;  2F98 A;  2HOH A;  1RTU A;  3F40 A;  3S28 A;  1D6Z A;  1BIR A;  3U1W A;  3CC7 3;  3D4A A;  4XB5 A;  3CD6 3;  1DET A;  4HM0 B;  4XBT A;  1QAF A;  1SAR A;  3AGO A;  1FUT A;  5IG5 A;  1VQ6 3;  3EQQ B;  3Q2P A;  1RRL A;  2GXF A;  1V58 A;  1IK3 A;  1W6Y A;  5CK6 A;  1EUI C;  2INX A;  1PU4 A;  3BIR A;  3WA3 A;  1JBR A;  5FW5 A;  1BRG A;  1QMA A;  3RNT A;  1MWT A;  2IA7 A;  5A0O B;  1A67 A;  2F5W A;  2MF7 A;  1VQO 3;  1LOY A;  1FA3 A;  1B2U A;  4OUQ A;  1Q40 B;  1OCV A;  4KFF A;  1EG9 B;  5D83 A;  4O2H A;  1HZ1 A;  3DGL A;  4WYK B;  1C54 A;  2CWT A;  2GBW B;  4JF8 A;  1FUW A;  3LT9 A;  1OGZ A;  3CCM 3;  3N8B A;  4ORL A;  4XBY A;  3I55 3;  4PEJ A;  3STD A;  3I56 3;  1FGM A;  2C11 A;  4LGQ A;  1Q9E A;  5GSP A;  3SED A;  1NJI 4;  2XRX B;  3V92 A;  5STD A;  3Q90 A;  1I2G A;  1Q86 4;  3SX1 A;  4HM1 B;  5CF2 A;  1LOV A;  2XGN A;  2L1S A;  2L4V A;  2W56 A;  3GSP A;  2QEX 3;  1O7W B;  4R1K A;  1YJN 3;  4IIA A;  1RJO A;  1OHO A;  4O02 B;  3B7C A;  2OQE C;  3B4P A;  3RGA A;  2BO9 B;  1VQ4 3;  1RGL A;  2ML6 A;  3KCH A;  3KFQ C;  1S72 3;  3FCS B;  1RSN A;  1ROA A;  2UGI A;  5IEO A;  3GWR A;  3DGM A;  1NU3 A;  4HM7 B;  2C4B A;  4J9A A;  4GB5 A;  1YIJ 3;  4LMI A;  4XDV A;  6STD A;  2AAE A;  1AV4 A;  3FGY A;  1JNQ A;  4HOH A;  1RDS A;  1GS3 A;  5AYR B;  1UDI I;  1GMQ A;  2KRT A;  3G4S 3;  3CCJ 3;  2CWU A;  1BSC A;  2Q07 A;  1JN5 A;  1V74 A;  8RNT A;  1UCI A;  1W4N A;  3SVA A;  4HM2 B;  3V99 A;  4KT3 B;  2R41 A;  4HZB B;  1FGO A;  3ER7 A;  4EV5 A;  5LC7 A;  3OW2 2;  1TIJ A;  3DMC A;  4AKY A;  1FGR A;  2E2U A;  2CHC A;  1UCJ A;  3X40 A;  1RN7 A;  3RGR A;  3G71 3;  4R4K A;  4J5K A;  2RBI A;  1UI7 A;  2W9P A;  3CCR 3;  1ISK A;  7RNT A;  9RNT A;  3Q1C A;  4HJL B;  3S67 A;  1BSB A;  1IU7 A;  1MWU A;  1STF I;  4N3V A;  1RCL A;  2XH9 A;  1OGX A;  4TX4 A;  3UB1 A;  1GYB A;  4IPB A;  1JKG B;  4FR9 A;  4N6N B;  1E3V A;  3DH2 A;  4EYC A;  2QA4 3;  1YI2 3;  4X2H A;  1VQN 3;  5IER A;  1SPU A;  1OUN A;  5TGN A;  1V57 A;  4MMZ B;  1N8R 4;  1LQM B;  5BIR A;  4GSP A;  4KFD A;  1BU4 A;  2CX0 A;  3NUV A;  3FG4 A;  1JB2 A;  3AGN A;  3TDG A;  3O8Y A;  5KP3 A;  1TFO A;  1W7C A;  3V98 A;  1Q42 A;  3MYT A;  1UUG B;  1OF5 A;  1CYU A;  2W2C A;  3WA2 X;  3D5G A;  4HKV B;  2E2V A;  1BRJ A;  3GZR A;  5AIH A;  4WWU C;  2XSH B;  5M1A A;  3DGY A;  3SOY A;  1JRQ A;  4K1U A;  4K90 B;  4CDL A;  5IF6 A;  2YFL B;  4I5Q A;  4N6U A;  2Y73 A;  3F8X A;  1US1 A;  1BRH A;  2Z77 A;  4HM5 B;  4H3U A;  3NHX A;  1W2B 2;  1UUW B;  3PGB A;  2E2T A;  3JVC A;  1JZD A;  4HZ9 B;  3OV4 A;  3EN8 A;  3MG2 A;  3CCL 3;  2ZHX B;  1BNE A;  2SBL A;  5DRV A;  1BNS A;  1YNV X;  3VF1 A;  3X42 A;  1W00 A;  1O7M B;  1LXE A;  2H0H A;  5IEP A;  3CMA 3;  3CCQ 3;  1DVC A;  1IQY A;  5EVH A;  1BSD A;  3UL6 A;  3NBJ A;  3CCU 3;  2WGQ A;  2XGL A;  2W0Q A;  1FUS A;  1C7H A;  3GZY B;  3N9H A;  1I8V A;  3PYJ A;  2CKF B;  4MEI A;  2AAD A;  4R9L A;  1VQK 3;  3GAX A;  4I4K A;  2F5M A;  3VGN A;  1IV7 A;  4ZM8 A;  5M18 A;  2M7O A;  1IVV A;  2H0I A;  3PXM A;  2O3O A;  4WHA A;  2KF4 A;  3D3L A;  4FCZ A;  2RFR A;  1RCK A;  1QAK A;  2FXT A;  3IPT A;  3WHO A;  4U13 A;  1E97 A;  4O8S A;  3G6E 3;  1OHS A;  2YFJ B;  1IQ8 A;  2F86 B;  1EEJ A;  1GSP A;  1UGH I;  3LT8 A;  1UUV B;  5JBS A;  4KVH A;  1YHQ 3;  1D6Y A;  1RRH A;  2IYJ A;  1BNJ A;  3FF0 A;  3ZFZ A;  1GY5 A;  1AR0 A;  3KII A;  2CFW A;  4H61 A;  1Z1S A;  4O3V A;  4JRF A;  3WMD A;  3NXJ A;  5IG0 A;  2C10 A;  2CFG A;  1B20 A;  4IT7 A;  3BNC A;  1GMP A;  1RGF A;  3M8C A;  1EQK A;  4HM4 B;  3OWS A;  1TRQ A;  3K9M C;  1W02 A;  4N6T A;  2BMQ B;  4CCV A;  1LRA A;  4HM6 B;  1W01 A;  2WOH A;  1YVB I;  4RBN A;  1BSA A;  4LZI A;  1SIH A;  2IUK A;  5M19 A;  1A90 A;  2CFD A;  5IG4 A;  3UL5 A;  1OPY A;  4WP5 A;  3MKI A;  2UX0 A;  3OWY A;  3GZX B;  3SOA A;  1YJW 3;  1DMM A;  3FG3 A;  1M1K 4;  2XEP A;  5BU4 A;  2KF3 A;  3IJE B;  4FMD A;  1QVF 2;  3JUQ A;  1EA2 A;  1M1X B;  3HK4 A;  4XM4 A;  2CFK A;  2RCD A;  2FGT A;  2CK3 H;  4N6L A;  3URP A;  3RDE A;  2I9W A;  4HBR A;  4NPB A;  1WQL B;  1I0V A;  3HZP A;  1OAC A;  5EQL A;  4RNY A;  1VQ7 3;  4Q53 A;  3BU4 A;  1PFP A;  2ZA4 A;  4G1M B;  1N8Q A;  1CEW I;  3FG1 A;  3WOD G;  3CCE 3;  2Z6B A;  4J8T A;  1X1W A;  5RNT A;  4EXR A;  1I2F A;  2V1L A;  1RGC A;  3LTA A;  1IV9 A;  1RLS A;  4WFO A;  3DUK A;  1N9E A;  1MNL A;  3D5I A;  1GOV A;  1JZO A;  1YGE A;  3GZB A;  2CIU A;  4OK0 A;  4EBG A;  3K5T A;  1KC8 4;  5CXO A;  2R4I A;  3EC9 A;  3CCS 3;  3PCR A;  1X1X A;  2JDI H;  1B27 A;  1BNF A;  1M9G A;  1ROV A;  3NM7 A;  4R80 A;  1HU9 A;  1ZO2 A;  1B2S A;  1AVK A;  1N5P A;  1Q40 A;  1W6C A;  2GU3 A;  2F99 A;  2HMK B;  3F8H A;  3HII A;  2BMO B;  2HMM B;  3ALA A;  4HYZ A;  5LC6 A;  3LH4 A;  4WYK A;  2OOV A;  4STD A;  1RNB A;  3AMO B;  2CC3 A;  2OOV C;  3FF2 A;  3FH1 A;  4L8P A;  4BIR A;  4HAA A;  1Q7H A;  3NV0 B;  4RNZ A;  3B8L A;  5AEW B;  1VQ9 3;  1RGE A;  3G8Z A;  3LTD A;  1VQQ A;  2LYX A;  5G2G A;  5D82 A;  2LQV A;  1NDO B;  3OWU A;  1D6U A;  4KZ1 A;  2Z76 A;  6GSP A;  3NQY A;  1BNG A;  1ULI B;  1JB5 A;  1UCL A;  3WDG B;  1B3S A;  4BL2 A;  1CYV A;  1RGK A;  1RGH A;  3EF8 A;  3S5C A;  1I70 A;  1VQP 3;  2CG1 A;  3HX8 A;  1LNI A;  2XSO B;  1DYU A;  3K7C A;  4BL3 A;  1O7P B;  4OVM A;  1STD A;  1U8C B;  2W6J H;  3PCS A;  4X2O A;  3SXX A;  1RMS A;  2RSX A;  2K3D A;  2CFL A;  2PNC A;  2GSP A;  2YFI B;  5KP1 A;  3DXO A;  3BNE A;  5HOH A;  3MWZ A;  1BUJ A;  3OXA A;  1LQG C;  3QK9 A;  1GOU A;  5D81 A;  1QVG 2;  3J7Y d;  1PYL A;  3DY5 A;  2RGQ A;  5IG3 A;  1NB5 I;  2K0M A;  1ASK A;  1E3R A;  3NBR A;  4BTY A;  6RNT A;  1LNH A;  1TJD A;  4K61 A;  3S27 A;  3H51 A;  1S5A A;  1AQZ A;  1J2B A;  1X1U A;  4GHO A;  3CU3 A;  1MWS A;  3HOH A;  2BT3 A;  2P05 A;  7GSP A;  4HM3 B;  3QRD A;  1Q82 4;  3PS8 A;  3G16 A;  1UCK A;  1W5Z A;  2CH9 A;  5FGO A;  5EEO A;  1EKM A;  1LVN A;  5DRE A;  2B24 B;  1G02 A;  1L5G B;  3A5E A;  3UNL A;  3FLJ A;  2HMN B;  1KD1 4;  3H3H A;  4MMY B;  4EV2 A;  2ZDJ A;  1K73 4;  1NNV A;  3X3Z A;  4BU4 A;  4KFE A;  1B2X A;  1BVI A;  3ECF A;  1JKG A;  5KP4 A;  4FCJ A;  1O7G B;  5BXQ A;  3F14 A;  3X3Y A;  2CWV A;  2UUG C;  2W56 B;  1ZX2 A;  2JQ5 A;  2KF5 A;  3DGO A;  3PZW A;  1K28 A;  5JPP A;  1K41 A;  5ELU A;  2A15 A;  1Q7Y 4;  1SJW A;  1YVS A;  1YJ9 3;  4MMX B;  1BRS A;  5AEU B;  1VQ8 3;  4J5G A;  3T0U A;  3D9R A;  3CCV 3;  1GMR A;  3T8U A;  1BNR A;  1IYY A;  5I97 A;  3SYU A;  1FZU A;  1AY7 A;  3VSY A;  2GEY A;  1SII A;  1RN4 A;  3S29 A;  1BRN L;  1WMP A;  2P0M A;  1CQS A;  2OTJ 3;  1BNI A;  4BTX A;  1DVD A;  1RGA A;  2KXG A;  2O9U X;  3BLZ A;  3EBT A;  3EJV A;  1JN5 B;  3OX9 A;  1ULJ B;  3L0R A;  1VQL 3;  1RN1 A;  1X1Y A;  2QIY A;  1AVL A;  2OCT A;  2KF6 A;  4R9K A;  2GBX B;  3AHW A;  1FYS A;  1T5Y A;  3E99 A;  3N54 B;  1UW1 A;  2CW9 A;  3F9S A;  5IEN A;  1BRI A;  1GD4 A;  2Z7A A;  1YIT 3;  3CPW 2;  1CH0 A;  3CC2 3;  3JUN A;  3MPH A;  1VQ5 3;  3EN1 B;  3LTB A;  3X3X A;  2Y74 A;  1U5O A;  1IVX A;  3GRD A;  3LTC A;  4FCM A;  2P09 A;  4EC6 A;  1R4Y A;  3FKA A;  1JBT A;  2OTL 3;  2OWP A;  3WR2 A;  4QWT A;  1G0T A;  2RNT A;  3JUM A;  3SLU A;  2STD A;  5IW9 A;  1JB4 A;  1QJG A;  1WMN A;  1MWR A;  4EW5 A;  3Q3F A;  1OH0 A;  3EBY A;  5JPU A;  2ML5 A;  4NRE A;  3JUP A;  1Y4K A;  1O7H B;  3JUO A;  3NM2 A;  4XBX A;  3HI7 A;  3NBB A;  2IUJ A;  2P38 A;  2QGU A;  1TRP A;  4L7K A;  5ELJ A;  4HVN A;  1HKX A;  1ZS7 A;  2OQE A;  2CX1 A;  1HYF A;  3EB8 A;  3EX9 A;  5G1K A;  1UGI A;  3MG3 A;  4XDW A;  1KWI A;  2ZL8 A;  5CLK A;  1IT7 A;  3CNM A;  1DE3 A;  1OF5 B;  1IVW A;  1NO3 A;  1VQM 3;  1LOX A;  3BNB A;  3CPO A;  1N9J A;  1T3B A;  2IY2 A;  1MOL A;  3U97 A;  5AYS C;  2IMJ A;  1TTO A;  4RZM A;  3T8N A;  3LYG A;  4L8O A;  2XFS A;  2SAR A;  3UJM A;  4LEH A;  1I0X A;  1RHL A;  1RGG A;  3K63 A;  3LZA A;  4DKI A;  1RKY A;  4N6O B;  1B21 A;  1NB3 I;  2KCD A;  1LOW A;  1W6G A;  5AIF A;  1TU5 A;  1SQW A;  2BMR B;  2HMJ B;  5AIG A;  1IQX A;  3EHC A;  4GL6 A;  5CF1 A;  3WOF B;  2MC8 A;  2HML B;  3CME 3;  1M90 4;  1JJ2 2;  3KSP A;  1WMO A;  3HIG A;  1A2K A;  1VZZ A;  2BIR A;  3KE7 A;  3DZL A;  1TFK A;  4NHF A;  4BTW A;  2K54 A;  4FMC A;  4K1V A;  3KZT A;  3CC4 3;  1MGW A;  2YX9 A;  3AHS A;  1ZGX A;  3F7S A;  3KKG A;  1A2V A;  1K8A 4;  1G96 A;  2BNG A;  2F56 A;  1QAL A;  2WOF A;  7STD A;  1GOY A;  3EE1 A;  3X41 A;  1JBS A;  1KQS 2;  3LXU X;  4AKZ A;  2BHM A;  1N5H A;  4N6V 0;  1O7N B;  1JV2 B;  3LOY A;  3B4O A;  2W04 A;  1BOX A;  1WNH A;  2WO0 A;  3A76 A;  1B2M A;  1GD3 A;  3BND A;  1TP6 A;  1BRK A;  3K0Z A;  3KN4 A;  5G1L A;  3NX0 A;  3WOE B;  1FW7 A;  1BAN A;  1T2I A;  2HMO B;  3ROB A;  2D42 A;  1WTH A;  3NQZ A;  1I3I A;  3I0Y A;  3ZG5 A;  1TUH A;  3ZG0 A;  2XFT A;  1GY6 A;  4FMB A;  3BB9 A;  2XR8 B;  2GU1 A;  3F7X A;  5HGR A;  1Q81 4;  1KSI A;  2KAA A;  2CG0 A;  2BU4 A;  3MHE A;  1NWW A;  1W2Z A;  1B2Z A;  1FGQ A;  1PY3 A;  1GY7 A;  4RNT A;  4MJD A;  2W03 A;  4LYL B;  1IDP A;  4CJN A;  1DMN A;  2D1W A;  3CXC 2; 
#chains in the Genus database with same CATH homology
 1BNI A;  1RCL A;  1BAO A;  1RGA A;  3BU4 A;  3DH2 A;  1BSE A;  1RN1 A;  1RNT A;  1X1Y A;  2ZA4 A;  2KF6 A;  3AHW A;  1FYS A;  1X1W A;  5RNT A;  2F4Y A;  1I2F A;  4GSP A;  1MGR A;  5BIR A;  1BU4 A;  1BRI A;  1RGC A;  1T2H A;  1I2E A;  1RLS A;  1YGW A;  1CH0 A;  3AGN A;  1GOV A;  3D5I A;  1I3F A;  1X1X A;  1B27 A;  1BNF A;  1R4Y A;  1JBT A;  1BGS A;  1B2S A;  3D5G A;  1A2P A;  3WR2 A;  1BRJ A;  2HOH A;  2RNT A;  1RTU A;  1BIR A;  3D4A A;  3DGY A;  1RNB A;  3Q3F A;  1DET A;  1SAR A;  4BIR A;  3AGO A;  1FUT A;  4HAA A;  1BRH A;  1RGE A;  1TRP A;  3BIR A;  1JBR A;  6GSP A;  1BRG A;  1BNG A;  3RNT A;  1UCL A;  1HYF A;  1B3S A;  1RGK A;  1RGH A;  1BNE A;  1BNS A;  1I70 A;  1YNV X;  1DE3 A;  2F5W A;  1LNI A;  1LOY A;  1B2U A;  1BSD A;  1TTO A;  1RMS A;  1HZ1 A;  1FUS A;  2GSP A;  1C54 A;  1I8V A;  2SAR A;  1I0X A;  1RHL A;  1RGG A;  5HOH A;  2AAD A;  1BUJ A;  1B21 A;  1LOW A;  1GOU A;  2F5M A;  1PYL A;  1Q9E A;  5GSP A;  2KF4 A;  1I2G A;  6RNT A;  1RCK A;  2BIR A;  1LOV A;  3WHO A;  1AQZ A;  3GSP A;  1MGW A;  1X1U A;  4GHO A;  3HOH A;  3AHS A;  1GSP A;  1ZGX A;  7GSP A;  1RGL A;  3KCH A;  1UCK A;  1RSN A;  2F56 A;  1JBS A;  1GOY A;  1BNJ A;  2C4B A;  1G02 A;  3A5E A;  1B20 A;  1BOX A;  1RGF A;  1GMP A;  2AAE A;  1B2M A;  4HOH A;  1RDS A;  4BU4 A;  1TRQ A;  1BRK A;  1B2X A;  1BVI A;  1GMQ A;  1FW7 A;  1LRA A;  1BSC A;  1BAN A;  1T2I A;  1BSA A;  1I3I A;  1UCI A;  8RNT A;  2KF5 A;  1YVS A;  1BRS A;  1UCJ A;  2KAA A;  4J5G A;  1GMR A;  1BNR A;  1IYY A;  2BU4 A;  5BU4 A;  2KF3 A;  1FZU A;  1AY7 A;  1B2Z A;  3SYU A;  4J5K A;  1PY3 A;  2RBI A;  4RNT A;  1RN4 A;  3URP A;  7RNT A;  9RNT A;  1BRN L;  1BSB A;  1I0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...