1BAOA

The contribution of buried hydrogen bonds to protein stability: the crystal structures of two barnase mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINFTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 35
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1baoA00
1HYFA 1BNGA 1T2HA 5GSPA 1PY3A 2F5WA 2GSPA 1X1YA 3BU4A 4GSPA 1UCKA 1LOYA 2KAAA 3AHSA 3WR2A 1LRAA 3HOHA 5RNTA 2F4YA 1UCIA 1RSNA 3AHWA 1AQZA 2KF3A 1FYSA 6GSPA 1RN1A 1X1XA 2BIRA 1YVSA 1X1WA 2C4BA 4J5GA 1IYYA 3SYUA 1GMQA 6RNTA 2AAEA 4RNTA 4BIRA 1BSDA 2BU4A 1BNRA 1JBSA 5HOHA 1JBTA 1B21A 1BSCA 1BRJA 1UCJA 1RGLA 1RNBA 1BOXA 1BUJA 1G02A 1TRPA 4HOHA 1GMRA 4GHOA 1GMPA 1BRSA 1B27A 1YNVX 1B2XA 1BNSA 2F5MA 1BVIA 1RTUA 1RCLA 1BRIA 2SARA 2KF6A 1B2SA 1TRQA 1C54A 1BANA 1BSBA 1RLSA 1GSPA 1RCKA 3BIRA 1Q9EA 1B20A 2AADA 1RDSA 2F56A 1B2UA 1RGKA 5BIRA 1RGAA 1RNTA 1RGFA 2RNTA 1JBRA 1R4YA 1RHLA 1TTOA 3AGNA 3Q3FA 1BNJA 1BSEA 1CH0A 1MGWA 3D5GA 3DGYA 1BU4A 3GSPA 1UCLA 2HOHA 1BSAA 4HAAA 5BU4A 4J5KA 9RNTA 1FUSA 1I0VA 1BNFA 1I3IA 1RN4A 1FUTA 1RMSA 1B2ZA 8RNTA 1MGRA 4BU4A 3DH2A 1I2GA 1X1UA 3A5EA 1PYLA 3D4AA 3RNTA 1RGHA 1RGEA 1GOYA 1YGWA 7RNTA 1BAOA 1LOWA 1BRNL 1HZ1A 1SARA 1AY7A 1BIRA 1BRHA 1I0XA 3KCHA 3WHOA 1LNIA 1LOVA 1FZUA 2KF4A 1BNIA 7GSPA 1I70A 2RBIA 1BRKA 3D5IA 1BGSA 1BNEA 1GOVA 1B2MA 1I8VA 3URPA 2KF5A 1B3SA 1ZGXA 1A2PA 1RGGA 1I2EA 1FW7A 1BRGA 1RGCA 1DETA 1I2FA 1I3FA 3AGOA 1DE3A 1T2IA 2ZA4A 1GOUA
chains in the Genus database with same CATH superfamily
1HYFA 1O7NB 1BNGA 1T2HA 1GY7A 1JKGB 1OF5A 2WOHA 3EBTA 3OV4A 3VSYA 2L1SA 3NV0A 4CJNA 3FF0A 1IQ8A 2XF3A 1RRHA 4GSPA 1UCKA 1LOYA 5LC7A 3M8CA 2IYJA 3UJMA 2RCDA 4DKIA 4H61A 5KP4A 3A76A 2P09A 4FMCA 3CPOA 4HM7B 6GSPA 1JRQA 4I4KA 1ROVA 3HIGA 2BIRA 3OX9A 1QMAA 3S5CA 1DMMA 1QAFA 1YJ93 5JPPA 1Q7HA 1GMQA 6RNTA 1U8CB 1GD3A 1Y4KA 3T8UA 1WQLB 3NM2A 1W02A 2BU4A 2Y74A 1QALA 3OWSA 3JUNA 1F8NA 4RZMA 1NJI4 3MHEA 2CWVA 3CCE3 2K0MA 1BRJA 1EUIC 2ML6A 4HM6B 4EYCA 1NB5I 2CW9A 1OPYA 3ER7A 1OGZA 4ORLA 1T3BA 3DY5A 1BRSA 1PFPA 1YNVX 1CEWI 3BNEA 3ALAA 2BMQB 3SOYA 2WO0A 5BVBA 1WTHA 2RGQA 3GZYB 3GWRA 3T8NA 1VQN3 1AVKA 2INXA 3CCU3 3UNLA 3HZPA 3NV0B 1Q7Y4 1IV7A 1BSBA 1GSPA 2Z7AA 3LYGA 4XDVA 4XBTA 5IG3A 4XB5A 4KFEA 3NUVA 3DMCA 1S5AA 3LXUX 1B2UA 4ILFA 2H0IA 4AEQA 3MYTA 3LT9A 3LTDA 4N6NB 1CYUA 1OHPA 1JBRA 4AKZA 1DMQA 2RFRA 2QIYA 2XRXB 3SOAA 4FMDA 1J2BA 3NBJA 1WNHA 1S723 1JN5B 2PZVA 3GSPA 1IT7A 4HAAA 1N9JA 3HX8A 5AYRB 2W04A 3GZXB 4HM3B 4CPKA 1YIT3 4LZIA 5EVHA 9RNTA 1FUSA 2F98A 2L4VA 1TFOA 2WGQA 2XGLA 3DGMA 1B2ZA 2UX0A 3PXMA 1O7GB 1OHOA 2I9WA 2XEPA 1ZS7A 1NNVA 2IMJA 1RGHA 1V57A 3H3HA 4WHAA 3WOFB 2IA7A 3CU3A 4XBXA 3MKIA 2R4IA 1IQXA 4R9KA 3EN1B 3CXC2 1FGOA 1BRHA 3IPTA 2OQEC 4BTYA 1LNIA 5STDA 4J8TA 2KF4A 2STDA 1GD4A 1ZX2A 1BNIA 1TFKA 2W56B 2WOFA 3FG3A 3LT8A 3NBRA 2W0QA 3X40A 7GSPA 2JQ5A 2CHCA 2RBIA 1FGRA 3EQQB 4RNZA 1RRLA 4OK0A 1BGSA 3MG1A 2H0HA 1LVNA 3B7CA 5IEOA 4FMAA 2CFKA 3JUPA 1KWIA 1W5ZA 1HKXA 1I8VA 3D3LA 4J9AA 2GU1A 4KVHA 1W2ZA 4N6UA 4NHFA 4HZBB 1Z1SA 1I2EA 1WMOA 1Q40B 3FH1A 4IPBA 5I97A 1VQP3 4HZ9B 1GY5A 2OCTA 2XFTA 3JUQA 1E3VA 3RGRA 2BMRB 4XM4A 1T5YA 3X41A 4CCVA 2E2VA 5ELUA 5CF2A 1DE3A 1T2IA 1GOUA 4WWUC 5A0OB 2YX9A 1ASKA 2PNCA 3B8LA 2FGTA 2WGOA 4RBNA 2HMKB 2OQEA 1YHQ3 1LRAA 3L0RA 5RNTA 3GRDA 3LMLA 1VQ73 1RN1A 1UUWB 3MG3A 2OTJ3 4GL6A 4HM0B 5IENA 2XR8B 1OH0A 1YVSA 1X1WA 7STDA 4O02B 4X2OA 4BIRA 2ML5A 3OXAA 1JBSA 2CC3A 3CCR3 1B21A 4EV5A 1R4CA 3SXXA 1IVXA 3NX0A 3K5TA 4EC6A 1K734 3KFQC 3KIIA 3DGNA 1QVF2 3NBBA 3EHCA 4Q53A 5CK6A 4GHOA 3LH4A 5BXQA 2B24B 5JPUA 2BO9B 2CK3H 1RTUA 2HMMB 4K61A 3G4S3 5D83A 1RCLA 2P38A 5KP1A 3I553 1UUVB 2KF6A 3I0YA 2GEYA 2CWTA 1BANA 1RLSA 1KSIA 1LOXA 3G8ZA 3DGLA 3BIRA 1V58A 2CKFB 4R9LA 5CXOA 5CF1A 1IVWA 4EW5A 3X42A 3FG1A 3SVAA 1K28A 3QRDA 1RHLA 4HM1B 2Z77A 4EXRA 1AVLA 1BNJA 4FMBA 1SQWA 2GBXB 3G0KA 1GY6A 1MNLA 3DGYA 5JBSA 2W2CA 1ULIB 2HOHA 3BNDA 4BL3A 1YI23 5BU4A 1YIJ3 4EBGA 1MWTA 4IT7A 1A2KA 1I0VA 2C10A 3OWUA 1FUTA 3ZG0A 5G1KA 2H0GA 2XH9A 1MGRA 2CFGA 1W6GA 1OF5B 3RGAA 3BB9A 1ROAA 3DH2A 1NO3A 1X1UA 3DXOA 3E99A 4BU4A 4EV2A 4O8SA 1VQ43 3KSED 5D81A 3CMA3 4FCMA 3J7Yd 1RGEA 1YGWA 1BAOA 3HI7A 3RDEA 1N5PA 3CPW2 1HZ1A 3WOEB 1YJN3 1UDII 4NPBA 1DVDA 1AY7A 2CFLA 2P0MA 1A67A 1FZUA 2IUKA 2YFIB 8CHOA 1YJW3 2R41A 2O9UX 3LTCA 5FW5A 4GB5A 1OACA 3LZAA 2V1LA 1BRKA 3S28A 2LYXA 4K1UA 3F7SA 4HBRA 4LMIA 1BNEA 1CQSA 2KCDA 3CCJ3 2UGIA 2JDIH 3V92A 3KZTA 3WMDA 2BNGA 3CCV3 3CCL3 3X3XA 2ZDJA 1CYVA 2KF5A 3GAXA 3K7CA 3G713 2XSOB 1RGGA 4FCZA 1FUWA 2BMOB 1G96A 4KFDA 1D6ZA 4WYKA 2IY2A 4HVNA 5ELJA 3F14A 1I3FA 5EQLA 3AGOA 3IJEB 2BHMA 3Q1CA 4FR9A 2K3DA 5DREA 2ZA4A 1JB4A 1AR0A 1RN7A 2CG0A 1M9GA 2O3OA 3K9MC 2F5WA 1STDA 2GSPA 1DVCA 1X1YA 3BU4A 2OOVC 3QK9A 3B4PA 5FGOA 1Q864 4MMZB 3HK4A 2QA43 2F4YA 3WDGB 1WMNA 1IT8A 1OGXA 1UCIA 3EE1A 3NQYA 3AHWA 1NU3A 4L8PA 3PZWA 2QEX3 3CCM3 1DMNA 1W4NA 1FYSA 2KF3A 4HJLB 4CDLA 1X1XA 3EBYA 4LGQA 3CNMA 1VQL3 3VGNA 6STDA 5IERA 3SEDA 3BLZA 2KRTA 2BT3A 4G1MB 2CIUA 4J5GA 4K90B 3SYUA 4JRFA 3NM7A 1JZDA 3G16A 4RNTA 1VQ93 2CX0A 1ZO2A 1W00A 3EF8A 1EG9B 1JZOA 3MG2A 4K1VA 1TUHA 4MEIA 5HOHA 1JBTA 1BSCA 1MWRA 3IMAB 3S27A 3CC43 3CME3 1UCJA 1RGLA 3CNXA 3S29A 1W6CA 2C11A 4BTXA 2Z6BA 4HM5B 1RNBA 3V98A 5AIFA 2XFSA 4WYKB 1BUJA 3F8HA 3Q2PA 4HOHA 3MPHA 1IV9A 1O7HB 2F5MA 3NHXA 1B2XA 1BNSA 3GZBA 5AIGA 1BVIA 1NB3I 1SJWA 1UI8A 2FXTA 3WODG 1LXEA 2GEXA 1SPUA 3FG4A 5G2GA 2KXGA 1BRIA 2SARA 1ISKA 1BUQA 3SX1A 2OOVA 1B2SA 3BNCA 4I5QA 2CWUA 4R80A 5M18A 1C54A 2RSXA 2Q07A 3T0UA 1JJ22 1RCKA 2GXFA 4O3VA 4KZ1A 1VQO3 1IU7A 3PYJA 4R4KA 1RDSA 1RJOA 3I563 3CD63 5KP3A 1SIHA 1JKGA 2B1XB 3FZWA 1Q42A 1EA2A 1RGKA 3X3YA 1RGAA 5BIRA 1K9M4 1RGFA 1IVUA 3WA3A 5IG0A 2SBLA 1N5HA 1TTOA 3AGNA 1KC84 1BSEA 3BNBA 2HMLB 1MGWA 3D5GA 1VQM3 1BU4A 3EC9A 1UCLA 3CCQ3 4NREA 1FGMA 3DM8A 2HMOB 1L5GB 2E2TA 2YFJB 1G0TA 1V74A 2K54A 4J5KA 1RN4A 1I3IA 2Y73A 1JB2A 3K0ZA 4O2HA 4WP5A 1FA3A 2HMNB 3D4AA 3RNTA 1VQ53 4LEHA 1C7HA 3ZG5A 1IDPA 1BRNL 3ECFA 1AV4A 3GZRA 3DZLA 4HM4B 1U5OA 1EQKA 1BIRA 1I0XA 3KCHA 1IK3A 1LOVA 2QGUA 1A90A 1VQ83 4N6LA 3HIIA 3PCSA 4OUQA 5IW9A 1GYBA 2GBWB 1N9EA 3PCRA 4FCJA 1W01A 1VQ63 3Q90A 3DUKA 1QAKA 1GOVA 1N8R4 2W9QA 1B2MA 1YVBI 2CH9A 1FGTA 2J8XB 3STDA 1RKYA 3F9SA 1W2B2 2MC8A 1UGIA 1B3SA 5AEUB 1A2PA 3JVCA 5EEOA 1STFI 4X2HA 1SIIA 1LQGC 3EJVA 4WFOA 3UL5A 3X3ZA 1OUNA 1RGCA 3LTAA 1MWSA 1JN5A 3FSDA 2OTL3 4KFFA 2YFLB 5M1AA 1TIJA 5HGRA 3AMOA 2W6JH 5AI1A 1UUGB 2W9PA 3KE7A 5GSPA 1PY3A 1KQS2 4L8OA 3AHSA 2KAAA 3WR2A 2FNQA 2ZL8A 3HOHA 1EEJA 1RSNA 2ZHXB 3F8XA 4AKYA 1EKMA 4N6TA 1E3RA 1AQZA 1PU4A 2OWPA 3SLUA 3OWYA 4TX4A 3VF1A 4STDA 2C4BA 1GS3A 1IYYA 4JF8A 2AAEA 1BSDA 1UW1A 2W56A 3D79A 3JUMA 1KD14 1BNRA 2CX1A 1VQQA 5TGNA 3PS8A 4HM8B 3F40A 2GU3A 3KSPA 5AYSC 1N8QA 1BOXA 2D1WA 2E2UA 2Z76A 1VZZA 2D42A 2XSHB 1G02A 1TRPA 1DYUA 4MMXB 1GMRA 1M1XB 1GMPA 1TJDA 1B27A 3K63A 4QWTA 4XDWA 3JUOA 1JB5A 1Q40A 4N6OB 3AMOB 4LYLB 4OVMA 5IG4A 1FGQA 2IUJA 3KKGA 3F7XA 1TRQA 3EB8A 3CCS3 2CG1A 4MJDA 3CC23 1O7PB 3O8YA 1Q814 3FLJA 1Q9EA 1B20A 2AADA 2F56A 3DGOA 3EX9A 3NQZA 1QVG2 4KT3B 1QJGA 3N8BA 5IEPA 2P05A 1W7CA 3MWZA 1RNTA 4XBYA 3FGYA 3EN8A 2RNTA 1YGEA 1R4YA 3Q3FA 3OW22 1WMPA 3ROBA 1US1A 1CH0A 3V99A 2W03A 3G6E3 2A15A 1A2VA 3TDGA 4RNYA 1BSAA 2F99A 1MOLA 2CFDA 2P0XA 5AIIA 3B4OA 2HMJB 3FF2A 2CFWA 1BNFA 4MMYB 1LQMB 4L7KA 3WA2X 1RMSA 8RNTA 5IF6A 5DRVA 2LQVA 1I2GA 1ULJB 3A5EA 1O7MB 3KN4A 1PYLA 4LSOA 2F86B 2XGNA 5M19A 1GOYA 1UGHI 1K8A4 7RNTA 1LOWA 1HU9A 1M1K4 3LTBA 4HYZA 4HKVB 1E97A 1SARA 5AEWB 1VQK3 1O7WB 4H3UA 1OHSA 1LNHA 1TP6A 3WHOA 1JNQA 3N54B 5CLKA 4R1KA 3LOYA 5IG5A 1NWWA 1I70A 5G1LA 1UI7A 3D5IA 3U97A 1K41A 3FCSB 3H51A 1TU5A 3CC73 1D6UA 3N9HA 4IIAA 1M904 5LC6A 4N6MA 1IQYA 1NDOB 3MSOA 2M7OA 1MWUA 2MF7A 3URPA 3U1WA 4HM2B 3FKAA 5D82A 1OCVA 3D9RA 1ZGXA 4BL2A 1D6YA 1FW7A 3NXJA 1Q824 1BRGA 1W6YA 1JV2B 1DETA 1I2FA 3UL6A 3UB1A 4BTWA 4N3VA 3S67A 4PEJA 1IVVA 2UUGC 4ZM8A 4N6V0 3ZFZA 3PGBA 5AIHA 4U13A
chains in the Genus database with same CATH topology
1HYFA 1BNGA 1T2HA 5GSPA 1PY3A 2F5WA 2GSPA 1X1YA 3BU4A 4GSPA 1UCKA 1LOYA 2KAAA 3AHSA 3WR2A 1LRAA 3HOHA 5RNTA 2F4YA 1UCIA 1RSNA 3AHWA 1AQZA 2KF3A 1FYSA 6GSPA 1RN1A 1X1XA 2BIRA 1YVSA 1X1WA 2C4BA 4J5GA 1IYYA 3SYUA 1GMQA 6RNTA 2AAEA 4RNTA 4BIRA 1BSDA 2BU4A 1BNRA 1JBSA 5HOHA 1JBTA 1B21A 1BSCA 1BRJA 1UCJA 1RGLA 1RNBA 1BOXA 1BUJA 1G02A 1TRPA 4HOHA 1GMRA 4GHOA 1GMPA 1BRSA 1B27A 1YNVX 1B2XA 1BNSA 2F5MA 1BVIA 1RTUA 1RCLA 1BRIA 2SARA 2KF6A 1B2SA 1TRQA 1C54A 1BANA 1BSBA 1RLSA 1GSPA 1RCKA 3BIRA 1Q9EA 1B20A 2AADA 1RDSA 2F56A 1B2UA 1RGKA 5BIRA 1RGAA 1RNTA 1RGFA 2RNTA 1JBRA 1R4YA 1RHLA 1TTOA 3AGNA 3Q3FA 1BNJA 1BSEA 1CH0A 1MGWA 3D5GA 3DGYA 1BU4A 3GSPA 1UCLA 2HOHA 1BSAA 4HAAA 5BU4A 4J5KA 9RNTA 1FUSA 1I0VA 1BNFA 1I3IA 1RN4A 1FUTA 1RMSA 1B2ZA 8RNTA 1MGRA 4BU4A 3DH2A 1I2GA 1X1UA 3A5EA 1PYLA 3D4AA 3RNTA 1RGHA 1RGEA 1GOYA 1YGWA 7RNTA 1BAOA 1LOWA 1BRNL 1HZ1A 1SARA 1AY7A 1BIRA 1BRHA 1I0XA 3KCHA 3WHOA 1LNIA 1LOVA 1FZUA 2KF4A 1BNIA 7GSPA 1I70A 2RBIA 1BRKA 3D5IA 1BGSA 1BNEA 1GOVA 1B2MA 1I8VA 3URPA 2KF5A 1B3SA 1ZGXA 1A2PA 1RGGA 1I2EA 1FW7A 1BRGA 1RGCA 1DETA 1I2FA 1I3FA 3AGOA 1DE3A 1T2IA 2ZA4A 1GOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYF A;  1BNG A;  1T2H A;  5GSP A;  1PY3 A;  2F5W A;  2GSP A;  1X1Y A;  3BU4 A;  4GSP A;  1UCK A;  1LOY A;  2KAA A;  3AHS A;  3WR2 A;  1LRA A;  3HOH A;  5RNT A;  2F4Y A;  1UCI A;  1RSN A;  3AHW A;  1AQZ A;  2KF3 A;  1FYS A;  6GSP A;  1RN1 A;  1X1X A;  2BIR A;  1YVS A;  1X1W A;  2C4B A;  4J5G A;  1IYY A;  3SYU A;  1GMQ A;  6RNT A;  2AAE A;  4RNT A;  4BIR A;  1BSD A;  2BU4 A;  1BNR A;  1JBS A;  5HOH A;  1JBT A;  1B21 A;  1BSC A;  1BRJ A;  1UCJ A;  1RGL A;  1RNB A;  1BOX A;  1BUJ A;  1G02 A;  1TRP A;  4HOH A;  1GMR A;  4GHO A;  1GMP A;  1BRS A;  1B27 A;  1YNV X;  1B2X A;  1BNS A;  2F5M A;  1BVI A;  1RTU A;  1RCL A;  1BRI A;  2SAR A;  2KF6 A;  1B2S A;  1TRQ A;  1C54 A;  1BAN A;  1BSB A;  1RLS A;  1GSP A;  1RCK A;  3BIR A;  1Q9E A;  1B20 A;  2AAD A;  1RDS A;  2F56 A;  1B2U A;  1RGK A;  5BIR A;  1RGA A;  1RNT A;  1RGF A;  2RNT A;  1JBR A;  1R4Y A;  1RHL A;  1TTO A;  3AGN A;  3Q3F A;  1BNJ A;  1BSE A;  1CH0 A;  1MGW A;  3D5G A;  3DGY A;  1BU4 A;  3GSP A;  1UCL A;  2HOH A;  1BSA A;  4HAA A;  5BU4 A;  4J5K A;  9RNT A;  1FUS A;  1I0V A;  1BNF A;  1I3I A;  1RN4 A;  1FUT A;  1RMS A;  1B2Z A;  8RNT A;  1MGR A;  4BU4 A;  3DH2 A;  1I2G A;  1X1U A;  3A5E A;  1PYL A;  3D4A A;  3RNT A;  1RGH A;  1RGE A;  1GOY A;  1YGW A;  7RNT A;  1BAO A;  1LOW A;  1BRN L;  1HZ1 A;  1SAR A;  1AY7 A;  1BIR A;  1BRH A;  1I0X A;  3KCH A;  3WHO A;  1LNI A;  1LOV A;  1FZU A;  2KF4 A;  1BNI A;  7GSP A;  1I70 A;  2RBI A;  1BRK A;  3D5I A;  1BGS A;  1BNE A;  1GOV A;  1B2M A;  1I8V A;  3URP A;  2KF5 A;  1B3S A;  1ZGX A;  1A2P A;  1RGG A;  1I2E A;  1FW7 A;  1BRG A;  1RGC A;  1DET A;  1I2F A;  1I3F A;  3AGO A;  1DE3 A;  1T2I A;  2ZA4 A;  1GOU A; 
#chains in the Genus database with same CATH topology
 1HYF A;  1O7N B;  1BNG A;  1T2H A;  1GY7 A;  1JKG B;  1OF5 A;  2WOH A;  3EBT A;  3OV4 A;  3VSY A;  2L1S A;  3NV0 A;  4CJN A;  3FF0 A;  1IQ8 A;  2XF3 A;  1RRH A;  4GSP A;  1UCK A;  1LOY A;  5LC7 A;  3M8C A;  2IYJ A;  3UJM A;  2RCD A;  4DKI A;  4H61 A;  5KP4 A;  3A76 A;  2P09 A;  4FMC A;  3CPO A;  4HM7 B;  6GSP A;  1JRQ A;  4I4K A;  1ROV A;  3HIG A;  2BIR A;  3OX9 A;  1QMA A;  3S5C A;  1DMM A;  1QAF A;  1YJ9 3;  5JPP A;  1Q7H A;  1GMQ A;  6RNT A;  1U8C B;  1GD3 A;  1Y4K A;  3T8U A;  1WQL B;  3NM2 A;  1W02 A;  2BU4 A;  2Y74 A;  1QAL A;  3OWS A;  3JUN A;  1F8N A;  4RZM A;  1NJI 4;  3MHE A;  2CWV A;  3CCE 3;  2K0M A;  1BRJ A;  1EUI C;  2ML6 A;  4HM6 B;  4EYC A;  1NB5 I;  2CW9 A;  1OPY A;  3ER7 A;  1OGZ A;  4ORL A;  1T3B A;  3DY5 A;  1BRS A;  1PFP A;  1YNV X;  1CEW I;  3BNE A;  3ALA A;  2BMQ B;  3SOY A;  2WO0 A;  5BVB A;  1WTH A;  2RGQ A;  3GZY B;  3GWR A;  3T8N A;  1VQN 3;  1AVK A;  2INX A;  3CCU 3;  3UNL A;  3HZP A;  3NV0 B;  1Q7Y 4;  1IV7 A;  1BSB A;  1GSP A;  2Z7A A;  3LYG A;  4XDV A;  4XBT A;  5IG3 A;  4XB5 A;  4KFE A;  3NUV A;  3DMC A;  1S5A A;  3LXU X;  1B2U A;  4ILF A;  2H0I A;  4AEQ A;  3MYT A;  3LT9 A;  3LTD A;  4N6N B;  1CYU A;  1OHP A;  1JBR A;  4AKZ A;  1DMQ A;  2RFR A;  2QIY A;  2XRX B;  3SOA A;  4FMD A;  1J2B A;  3NBJ A;  1WNH A;  1S72 3;  1JN5 B;  2PZV A;  3GSP A;  1IT7 A;  4HAA A;  1N9J A;  3HX8 A;  5AYR B;  2W04 A;  3GZX B;  4HM3 B;  4CPK A;  1YIT 3;  4LZI A;  5EVH A;  9RNT A;  1FUS A;  2F98 A;  2L4V A;  1TFO A;  2WGQ A;  2XGL A;  3DGM A;  1B2Z A;  2UX0 A;  3PXM A;  1O7G B;  1OHO A;  2I9W A;  2XEP A;  1ZS7 A;  1NNV A;  2IMJ A;  1RGH A;  1V57 A;  3H3H A;  4WHA A;  3WOF B;  2IA7 A;  3CU3 A;  4XBX A;  3MKI A;  2R4I A;  1IQX A;  4R9K A;  3EN1 B;  3CXC 2;  1FGO A;  1BRH A;  3IPT A;  2OQE C;  4BTY A;  1LNI A;  5STD A;  4J8T A;  2KF4 A;  2STD A;  1GD4 A;  1ZX2 A;  1BNI A;  1TFK A;  2W56 B;  2WOF A;  3FG3 A;  3LT8 A;  3NBR A;  2W0Q A;  3X40 A;  7GSP A;  2JQ5 A;  2CHC A;  2RBI A;  1FGR A;  3EQQ B;  4RNZ A;  1RRL A;  4OK0 A;  1BGS A;  3MG1 A;  2H0H A;  1LVN A;  3B7C A;  5IEO A;  4FMA A;  2CFK A;  3JUP A;  1KWI A;  1W5Z A;  1HKX A;  1I8V A;  3D3L A;  4J9A A;  2GU1 A;  4KVH A;  1W2Z A;  4N6U A;  4NHF A;  4HZB B;  1Z1S A;  1I2E A;  1WMO A;  1Q40 B;  3FH1 A;  4IPB A;  5I97 A;  1VQP 3;  4HZ9 B;  1GY5 A;  2OCT A;  2XFT A;  3JUQ A;  1E3V A;  3RGR A;  2BMR B;  4XM4 A;  1T5Y A;  3X41 A;  4CCV A;  2E2V A;  5ELU A;  5CF2 A;  1DE3 A;  1T2I A;  1GOU A;  4WWU C;  5A0O B;  2YX9 A;  1ASK A;  2PNC A;  3B8L A;  2FGT A;  2WGO A;  4RBN A;  2HMK B;  2OQE A;  1YHQ 3;  1LRA A;  3L0R A;  5RNT A;  3GRD A;  3LML A;  1VQ7 3;  1RN1 A;  1UUW B;  3MG3 A;  2OTJ 3;  4GL6 A;  4HM0 B;  5IEN A;  2XR8 B;  1OH0 A;  1YVS A;  1X1W A;  7STD A;  4O02 B;  4X2O A;  4BIR A;  2ML5 A;  3OXA A;  1JBS A;  2CC3 A;  3CCR 3;  1B21 A;  4EV5 A;  1R4C A;  3SXX A;  1IVX A;  3NX0 A;  3K5T A;  4EC6 A;  1K73 4;  3KFQ C;  3KII A;  3DGN A;  1QVF 2;  3NBB A;  3EHC A;  4Q53 A;  5CK6 A;  4GHO A;  3LH4 A;  5BXQ A;  2B24 B;  5JPU A;  2BO9 B;  2CK3 H;  1RTU A;  2HMM B;  4K61 A;  3G4S 3;  5D83 A;  1RCL A;  2P38 A;  5KP1 A;  3I55 3;  1UUV B;  2KF6 A;  3I0Y A;  2GEY A;  2CWT A;  1BAN A;  1RLS A;  1KSI A;  1LOX A;  3G8Z A;  3DGL A;  3BIR A;  1V58 A;  2CKF B;  4R9L A;  5CXO A;  5CF1 A;  1IVW A;  4EW5 A;  3X42 A;  3FG1 A;  3SVA A;  1K28 A;  3QRD A;  1RHL A;  4HM1 B;  2Z77 A;  4EXR A;  1AVL A;  1BNJ A;  4FMB A;  1SQW A;  2GBX B;  3G0K A;  1GY6 A;  1MNL A;  3DGY A;  5JBS A;  2W2C A;  1ULI B;  2HOH A;  3BND A;  4BL3 A;  1YI2 3;  5BU4 A;  1YIJ 3;  4EBG A;  1MWT A;  4IT7 A;  1A2K A;  1I0V A;  2C10 A;  3OWU A;  1FUT A;  3ZG0 A;  5G1K A;  2H0G A;  2XH9 A;  1MGR A;  2CFG A;  1W6G A;  1OF5 B;  3RGA A;  3BB9 A;  1ROA A;  3DH2 A;  1NO3 A;  1X1U A;  3DXO A;  3E99 A;  4BU4 A;  4EV2 A;  4O8S A;  1VQ4 3;  3KSE D;  5D81 A;  3CMA 3;  4FCM A;  3J7Y d;  1RGE A;  1YGW A;  1BAO A;  3HI7 A;  3RDE A;  1N5P A;  3CPW 2;  1HZ1 A;  3WOE B;  1YJN 3;  1UDI I;  4NPB A;  1DVD A;  1AY7 A;  2CFL A;  2P0M A;  1A67 A;  1FZU A;  2IUK A;  2YFI B;  8CHO A;  1YJW 3;  2R41 A;  2O9U X;  3LTC A;  5FW5 A;  4GB5 A;  1OAC A;  3LZA A;  2V1L A;  1BRK A;  3S28 A;  2LYX A;  4K1U A;  3F7S A;  4HBR A;  4LMI A;  1BNE A;  1CQS A;  2KCD A;  3CCJ 3;  2UGI A;  2JDI H;  3V92 A;  3KZT A;  3WMD A;  2BNG A;  3CCV 3;  3CCL 3;  3X3X A;  2ZDJ A;  1CYV A;  2KF5 A;  3GAX A;  3K7C A;  3G71 3;  2XSO B;  1RGG A;  4FCZ A;  1FUW A;  2BMO B;  1G96 A;  4KFD A;  1D6Z A;  4WYK A;  2IY2 A;  4HVN A;  5ELJ A;  3F14 A;  1I3F A;  5EQL A;  3AGO A;  3IJE B;  2BHM A;  3Q1C A;  4FR9 A;  2K3D A;  5DRE A;  2ZA4 A;  1JB4 A;  1AR0 A;  1RN7 A;  2CG0 A;  1M9G A;  2O3O A;  3K9M C;  2F5W A;  1STD A;  2GSP A;  1DVC A;  1X1Y A;  3BU4 A;  2OOV C;  3QK9 A;  3B4P A;  5FGO A;  1Q86 4;  4MMZ B;  3HK4 A;  2QA4 3;  2F4Y A;  3WDG B;  1WMN A;  1IT8 A;  1OGX A;  1UCI A;  3EE1 A;  3NQY A;  3AHW A;  1NU3 A;  4L8P A;  3PZW A;  2QEX 3;  3CCM 3;  1DMN A;  1W4N A;  1FYS A;  2KF3 A;  4HJL B;  4CDL A;  1X1X A;  3EBY A;  4LGQ A;  3CNM A;  1VQL 3;  3VGN A;  6STD A;  5IER A;  3SED A;  3BLZ A;  2KRT A;  2BT3 A;  4G1M B;  2CIU A;  4J5G A;  4K90 B;  3SYU A;  4JRF A;  3NM7 A;  1JZD A;  3G16 A;  4RNT A;  1VQ9 3;  2CX0 A;  1ZO2 A;  1W00 A;  3EF8 A;  1EG9 B;  1JZO A;  3MG2 A;  4K1V A;  1TUH A;  4MEI A;  5HOH A;  1JBT A;  1BSC A;  1MWR A;  3IMA B;  3S27 A;  3CC4 3;  3CME 3;  1UCJ A;  1RGL A;  3CNX A;  3S29 A;  1W6C A;  2C11 A;  4BTX A;  2Z6B A;  4HM5 B;  1RNB A;  3V98 A;  5AIF A;  2XFS A;  4WYK B;  1BUJ A;  3F8H A;  3Q2P A;  4HOH A;  3MPH A;  1IV9 A;  1O7H B;  2F5M A;  3NHX A;  1B2X A;  1BNS A;  3GZB A;  5AIG A;  1BVI A;  1NB3 I;  1SJW A;  1UI8 A;  2FXT A;  3WOD G;  1LXE A;  2GEX A;  1SPU A;  3FG4 A;  5G2G A;  2KXG A;  1BRI A;  2SAR A;  1ISK A;  1BUQ A;  3SX1 A;  2OOV A;  1B2S A;  3BNC A;  4I5Q A;  2CWU A;  4R80 A;  5M18 A;  1C54 A;  2RSX A;  2Q07 A;  3T0U A;  1JJ2 2;  1RCK A;  2GXF A;  4O3V A;  4KZ1 A;  1VQO 3;  1IU7 A;  3PYJ A;  4R4K A;  1RDS A;  1RJO A;  3I56 3;  3CD6 3;  5KP3 A;  1SIH A;  1JKG A;  2B1X B;  3FZW A;  1Q42 A;  1EA2 A;  1RGK A;  3X3Y A;  1RGA A;  5BIR A;  1K9M 4;  1RGF A;  1IVU A;  3WA3 A;  5IG0 A;  2SBL A;  1N5H A;  1TTO A;  3AGN A;  1KC8 4;  1BSE A;  3BNB A;  2HML B;  1MGW A;  3D5G A;  1VQM 3;  1BU4 A;  3EC9 A;  1UCL A;  3CCQ 3;  4NRE A;  1FGM A;  3DM8 A;  2HMO B;  1L5G B;  2E2T A;  2YFJ B;  1G0T A;  1V74 A;  2K54 A;  4J5K A;  1RN4 A;  1I3I A;  2Y73 A;  1JB2 A;  3K0Z A;  4O2H A;  4WP5 A;  1FA3 A;  2HMN B;  3D4A A;  3RNT A;  1VQ5 3;  4LEH A;  1C7H A;  3ZG5 A;  1IDP A;  1BRN L;  3ECF A;  1AV4 A;  3GZR A;  3DZL A;  4HM4 B;  1U5O A;  1EQK A;  1BIR A;  1I0X A;  3KCH A;  1IK3 A;  1LOV A;  2QGU A;  1A90 A;  1VQ8 3;  4N6L A;  3HII A;  3PCS A;  4OUQ A;  5IW9 A;  1GYB A;  2GBW B;  1N9E A;  3PCR A;  4FCJ A;  1W01 A;  1VQ6 3;  3Q90 A;  3DUK A;  1QAK A;  1GOV A;  1N8R 4;  2W9Q A;  1B2M A;  1YVB I;  2CH9 A;  1FGT A;  2J8X B;  3STD A;  1RKY A;  3F9S A;  1W2B 2;  2MC8 A;  1UGI A;  1B3S A;  5AEU B;  1A2P A;  3JVC A;  5EEO A;  1STF I;  4X2H A;  1SII A;  1LQG C;  3EJV A;  4WFO A;  3UL5 A;  3X3Z A;  1OUN A;  1RGC A;  3LTA A;  1MWS A;  1JN5 A;  3FSD A;  2OTL 3;  4KFF A;  2YFL B;  5M1A A;  1TIJ A;  5HGR A;  3AMO A;  2W6J H;  5AI1 A;  1UUG B;  2W9P A;  3KE7 A;  5GSP A;  1PY3 A;  1KQS 2;  4L8O A;  3AHS A;  2KAA A;  3WR2 A;  2FNQ A;  2ZL8 A;  3HOH A;  1EEJ A;  1RSN A;  2ZHX B;  3F8X A;  4AKY A;  1EKM A;  4N6T A;  1E3R A;  1AQZ A;  1PU4 A;  2OWP A;  3SLU A;  3OWY A;  4TX4 A;  3VF1 A;  4STD A;  2C4B A;  1GS3 A;  1IYY A;  4JF8 A;  2AAE A;  1BSD A;  1UW1 A;  2W56 A;  3D79 A;  3JUM A;  1KD1 4;  1BNR A;  2CX1 A;  1VQQ A;  5TGN A;  3PS8 A;  4HM8 B;  3F40 A;  2GU3 A;  3KSP A;  5AYS C;  1N8Q A;  1BOX A;  2D1W A;  2E2U A;  2Z76 A;  1VZZ A;  2D42 A;  2XSH B;  1G02 A;  1TRP A;  1DYU A;  4MMX B;  1GMR A;  1M1X B;  1GMP A;  1TJD A;  1B27 A;  3K63 A;  4QWT A;  4XDW A;  3JUO A;  1JB5 A;  1Q40 A;  4N6O B;  3AMO B;  4LYL B;  4OVM A;  5IG4 A;  1FGQ A;  2IUJ A;  3KKG A;  3F7X A;  1TRQ A;  3EB8 A;  3CCS 3;  2CG1 A;  4MJD A;  3CC2 3;  1O7P B;  3O8Y A;  1Q81 4;  3FLJ A;  1Q9E A;  1B20 A;  2AAD A;  2F56 A;  3DGO A;  3EX9 A;  3NQZ A;  1QVG 2;  4KT3 B;  1QJG A;  3N8B A;  5IEP A;  2P05 A;  1W7C A;  3MWZ A;  1RNT A;  4XBY A;  3FGY A;  3EN8 A;  2RNT A;  1YGE A;  1R4Y A;  3Q3F A;  3OW2 2;  1WMP A;  3ROB A;  1US1 A;  1CH0 A;  3V99 A;  2W03 A;  3G6E 3;  2A15 A;  1A2V A;  3TDG A;  4RNY A;  1BSA A;  2F99 A;  1MOL A;  2CFD A;  2P0X A;  5AII A;  3B4O A;  2HMJ B;  3FF2 A;  2CFW A;  1BNF A;  4MMY B;  1LQM B;  4L7K A;  3WA2 X;  1RMS A;  8RNT A;  5IF6 A;  5DRV A;  2LQV A;  1I2G A;  1ULJ B;  3A5E A;  1O7M B;  3KN4 A;  1PYL A;  4LSO A;  2F86 B;  2XGN A;  5M19 A;  1GOY A;  1UGH I;  1K8A 4;  7RNT A;  1LOW A;  1HU9 A;  1M1K 4;  3LTB A;  4HYZ A;  4HKV B;  1E97 A;  1SAR A;  5AEW B;  1VQK 3;  1O7W B;  4H3U A;  1OHS A;  1LNH A;  1TP6 A;  3WHO A;  1JNQ A;  3N54 B;  5CLK A;  4R1K A;  3LOY A;  5IG5 A;  1NWW A;  1I70 A;  5G1L A;  1UI7 A;  3D5I A;  3U97 A;  1K41 A;  3FCS B;  3H51 A;  1TU5 A;  3CC7 3;  1D6U A;  3N9H A;  4IIA A;  1M90 4;  5LC6 A;  4N6M A;  1IQY A;  1NDO B;  3MSO A;  2M7O A;  1MWU A;  2MF7 A;  3URP A;  3U1W A;  4HM2 B;  3FKA A;  5D82 A;  1OCV A;  3D9R A;  1ZGX A;  4BL2 A;  1D6Y A;  1FW7 A;  3NXJ A;  1Q82 4;  1BRG A;  1W6Y A;  1JV2 B;  1DET A;  1I2F A;  3UL6 A;  3UB1 A;  4BTW A;  4N3V A;  3S67 A;  4PEJ A;  1IVV A;  2UUG C;  4ZM8 A;  4N6V 0;  3ZFZ A;  3PGB A;  5AIH A;  4U13 A; 
#chains in the Genus database with same CATH homology
 1HYF A;  1BNG A;  1T2H A;  5GSP A;  1PY3 A;  2F5W A;  2GSP A;  1X1Y A;  3BU4 A;  4GSP A;  1UCK A;  1LOY A;  2KAA A;  3AHS A;  3WR2 A;  1LRA A;  3HOH A;  5RNT A;  2F4Y A;  1UCI A;  1RSN A;  3AHW A;  1AQZ A;  2KF3 A;  1FYS A;  6GSP A;  1RN1 A;  1X1X A;  2BIR A;  1YVS A;  1X1W A;  2C4B A;  4J5G A;  1IYY A;  3SYU A;  1GMQ A;  6RNT A;  2AAE A;  4RNT A;  4BIR A;  1BSD A;  2BU4 A;  1BNR A;  1JBS A;  5HOH A;  1JBT A;  1B21 A;  1BSC A;  1BRJ A;  1UCJ A;  1RGL A;  1RNB A;  1BOX A;  1BUJ A;  1G02 A;  1TRP A;  4HOH A;  1GMR A;  4GHO A;  1GMP A;  1BRS A;  1B27 A;  1YNV X;  1B2X A;  1BNS A;  2F5M A;  1BVI A;  1RTU A;  1RCL A;  1BRI A;  2SAR A;  2KF6 A;  1B2S A;  1TRQ A;  1C54 A;  1BAN A;  1BSB A;  1RLS A;  1GSP A;  1RCK A;  3BIR A;  1Q9E A;  1B20 A;  2AAD A;  1RDS A;  2F56 A;  1B2U A;  1RGK A;  5BIR A;  1RGA A;  1RNT A;  1RGF A;  2RNT A;  1JBR A;  1R4Y A;  1RHL A;  1TTO A;  3AGN A;  3Q3F A;  1BNJ A;  1BSE A;  1CH0 A;  1MGW A;  3D5G A;  3DGY A;  1BU4 A;  3GSP A;  1UCL A;  2HOH A;  1BSA A;  4HAA A;  5BU4 A;  4J5K A;  9RNT A;  1FUS A;  1I0V A;  1BNF A;  1I3I A;  1RN4 A;  1FUT A;  1RMS A;  1B2Z A;  8RNT A;  1MGR A;  4BU4 A;  3DH2 A;  1I2G A;  1X1U A;  3A5E A;  1PYL A;  3D4A A;  3RNT A;  1RGH A;  1RGE A;  1GOY A;  1YGW A;  7RNT A;  1BAO A;  1LOW A;  1BRN L;  1HZ1 A;  1SAR A;  1AY7 A;  1BIR A;  1BRH A;  1I0X A;  3KCH A;  3WHO A;  1LNI A;  1LOV A;  1FZU A;  2KF4 A;  1BNI A;  7GSP A;  1I70 A;  2RBI A;  1BRK A;  3D5I A;  1BGS A;  1BNE A;  1GOV A;  1B2M A;  1I8V A;  3URP A;  2KF5 A;  1B3S A;  1ZGX A;  1A2P A;  1RGG A;  1I2E A;  1FW7 A;  1BRG A;  1RGC A;  1DET A;  1I2F A;  1I3F A;  3AGO A;  1DE3 A;  1T2I A;  2ZA4 A;  1GOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...