1B2XA

Barnase wildtype structure at ph 7.5 from a cryo_cooled crystal at 100k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
b'VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2xA00
4RNTA 1I3FA 1AQZA 3URPA 1TRPA 1RTUA 2RBIA 1IYYA 1YNVX 1BRHA 1ZGXA 2F4YA 1JBRA 1RGCA 1BSBA 1B21A 1LNIA 8RNTA 1GMPA 3DGYA 1YVSA 3DH2A 5BU4A 1GMQA 3SYUA 7GSPA 2AADA 1BNEA 3AGNA 4HOHA 2KF5A 2F56A 3KCHA 1BVIA 1LOYA 1UCJA 1HYFA 3BU4A 1RNBA 1B27A 1C54A 1UCLA 3WR2A 1BANA 1UCIA 1MGRA 3RNTA 1BSDA 4HAAA 3D4AA 1B3SA 2BIRA 1BNRA 1LOWA 4BIRA 1RGGA 2KF4A 4GHOA 1I8VA 6GSPA 4BU4A 1B20A 5GSPA 1RCKA 1RN1A 6RNTA 5HOHA 9RNTA 3WHOA 1BSEA 3BIRA 1GOYA 1X1WA 1YGWA 1BRNL 1BNJA 7RNTA 1B2UA 1FYSA 1FUTA 1BU4A 1TRQA 1BNIA 1I0XA 1RGAA 1RNTA 1JBSA 1LRAA 3AGOA 1RMSA 1BOXA 1UCKA 1I0VA 1GMRA 1SARA 1TTOA 1B2MA 1RGEA 1GOVA 1BUJA 4J5GA 1GOUA 1CH0A 3D5GA 1B2ZA 1G02A 1BRKA 1FZUA 1JBTA 1Q9EA 1B2XA 2C4BA 2BU4A 4J5KA 2RNTA 1I70A 1BRGA 3A5EA 1BRIA 1B2SA 1PY3A 1T2HA 3Q3FA 1A2PA 1PYLA 1RN4A 2KF6A 1BGSA 1DE3A 1BSCA 2SARA 1GSPA 2F5WA 1I2GA 1BIRA 2KAAA 1RDSA 5RNTA 1I3IA 3AHSA 1RGKA 1RGHA 4GSPA 1BSAA 1R4YA 1BRJA 1I2FA 1BNSA 1RCLA 1BAOA 1RGLA 1X1YA 1T2IA 5BIRA 3GSPA 1I2EA 1MGWA 3AHWA 3D5IA 1X1XA 2KF3A 2ZA4A 1HZ1A 1RGFA 1FW7A 1RHLA 1BNFA 1DETA 1FUSA 1BNGA 2AAEA 1RSNA 2F5MA 1RLSA 2GSPA 1BRSA 1AY7A 1X1UA 1LOVA 3HOHA 2HOHA
chains in the Genus database with same CATH superfamily
2WOHA 1DVDA 2HMOB 3ALAA 3KSED 2MC8A 3URPA 2GXFA 4CDLA 1LNHA 3EN1B 4HVNA 2CFDA 4JRFA 5G1KA 2XSHB 1ZGXA 1O7WB 2W0QA 2WGQA 1ROVA 1QVG2 1W4NA 4LGQA 1JB5A 2OOVC 1W5ZA 1QVF2 1J2BA 5D83A 5AYSC 4O02B 1QJGA 3NXJA 5BU4A 3DXOA 5AEWB 3FF0A 4H61A 1IVXA 2FNQA 2AADA 1BNEA 3DUKA 5CXOA 1M904 2F86B 2F99A 3PS8A 3LTDA 3F9SA 1IVVA 1LOYA 1TFOA 1UCJA 3KE7A 4XBXA 3V98A 2QEX3 1HYFA 1E3RA 3GZBA 3NHXA 1DMMA 1N8QA 1B27A 1WMOA 1E3VA 1UCLA 3WR2A 1Q7Y4 4CPKA 5JPUA 2GBXB 1W2ZA 2K3DA 3D4AA 4HAAA 1W7CA 2P0MA 1LOWA 1QALA 4FMDA 3LTBA 2GU1A 2E2UA 5IEPA 2JDIH 1FGQA 2XGNA 4R9LA 1OPYA 2QGUA 3BIRA 1YGWA 3FCSB 4BTWA 1BRNL 1BNJA 1MOLA 3T8UA 2ML5A 3F8XA 4GB5A 3CC23 3GZYB 1VQP3 1YJN3 1YHQ3 1BNIA 1OH0A 2W9QA 3MG1A 1U5OA 4R80A 1CEWI 3HIIA 2RFRA 5D82A 3LZAA 4RBNA 1LRAA 4LZIA 3GWRA 1PFPA 1NNVA 1BOXA 1FGTA 3B7CA 1SARA 4XDVA 5FW5A 1RGEA 3OX9A 4X2HA 4J5GA 3WOEB 1MWRA 4AKYA 3LTAA 1VZZA 1ZS7A 3D5GA 4KFDA 2O3OA 4KVHA 1G0TA 2D1WA 3F7XA 3X3XA 5JPPA 1Q9EA 4HJLB 3EQQB 5G1LA 1B2XA 1O7GB 5IW9A 1AVLA 4J5KA 1LQGC 1I70A 3A5EA 1LVNA 2CC3A 1IVWA 8CHOA 2PZVA 3OXAA 3ZG0A 2HMNB 1RN4A 3OV4A 3DM8A 4N6V0 3DGLA 4N6TA 2CWUA 4XDWA 5KP3A 2WO0A 5DRVA 2XSOB 3QK9A 4N6OB 1Q40B 2KAAA 3ER7A 1EQKA 4LMIA 2J8XB 2CK3H 1JV2B 1RGKA 4L8OA 3OWUA 4WFOA 3FGYA 1D6ZA 5CLKA 3EC9A 1BSAA 2Z7AA 1R4YA 4NREA 1RCLA 1HKXA 5HGRA 1JKGB 1X1YA 1UDII 2R41A 3X40A 1Q824 3DGOA 3SVAA 1TU5A 3CCL3 2GBWB 1JRQA 4WYKB 1W6YA 4FMAA 1NO3A 1DMNA 2W56B 1HZ1A 1RGFA 1FW7A 2BT3A 3OWSA 1DETA 1BNGA 4KFEA 1FGRA 1D6UA 2LQVA 4MMZB 3EB8A 1HU9A 1IQYA 4EBGA 1VQ93 1YJW3 2MF7A 3IPTA 1SIIA 1TIJA 3G16A 6STDA 2HMMB 2CG1A 4EW5A 1UGIA 1ISKA 1I3FA 1FGMA 3NQZA 1G96A 1IYYA 2RBIA 3SOAA 3IMAB 3FSDA 3K7CA 3JUOA 3G4S3 2P0XA 1RGCA 3G0KA 2W6JH 3MG2A 3TDGA 2CFWA 2K54A 3CNMA 1GMPA 3HI7A 3N8BA 3G713 2P09A 1KQS2 1ZO2A 4MJDA 2BMQB 2ZL8A 4GL6A 1VQM3 5M19A 3BLZA 2C11A 1IU7A 3B8LA 2IUKA 3DGNA 3KKGA 3HK4A 2ML6A 1F8NA 1OF5A 3AGNA 4HM7B 2F56A 5IG4A 2OQEA 2JQ5A 4ZM8A 4EC6A 2L4VA 2W9PA 4HKVB 5D81A 2UGIA 2W56A 2WOFA 2CFKA 2Y74A 3WA3A 4HYZA 3X41A 3BU4A 5CF1A 4N6LA 5AIFA 3SX1A 3OW22 1C54A 3GRDA 2FXTA 4L8PA 1NU3A 1VQ43 1IDPA 1MGRA 5AIGA 1WQLB 4EYCA 1VQ73 4BIRA 1RGGA 5IF6A 3WODG 2KXGA 2PNCA 1CQSA 4NPBA 1W01A 4WP5A 1L5GB 3AMOB 1RCKA 4O3VA 2XF3A 3N9HA 6RNTA 1A90A 4FMCA 3WHOA 4EV5A 3GZXB 3FF2A 1UI7A 7RNTA 2C10A 3K0ZA 1TFKA 1FUTA 1WNHA 1AR0A 1IV7A 1TUHA 2IA7A 3I0YA 3KZTA 3EHCA 1I0XA 1W2B2 1RGAA 3X42A 2OTL3 3GAXA 2BNGA 2K0MA 2CIUA 1W02A 4HM0B 3CD63 3CPOA 3FG3A 4K61A 3T8NA 1I0VA 1LOXA 2XGLA 1B2MA 1O7MB 1A2KA 1EEJA 2XFTA 3BNEA 1JJ22 2ZDJA 1QAKA 3DMCA 2Y73A 3EF8A 3CCQ3 1G02A 4HM5B 3LYGA 2OCTA 3Q90A 3LT9A 1IK3A 3EE1A 4OK0A 1VQ53 3G6E3 1M9GA 4RNZA 1BRGA 3UJMA 1N5HA 1NB3I 2BHMA 3SOYA 3X3ZA 2QA43 1Q42A 2E2TA 3JUNA 3L0RA 2P38A 1EKMA 2YFIB 3Q3FA 1W6GA 4ILFA 4HBRA 1GD3A 1OGXA 1LXEA 3O8YA 1ULIB 3S67A 1BGSA 1DE3A 1BSCA 4HM1B 1JNQA 4R1KA 2H0HA 1O7HB 1MWUA 1VQ63 3JUPA 5RNTA 1RDSA 3FG4A 1I3IA 2BMRB 3AHSA 5M18A 3JUMA 1IV9A 1OHOA 2P05A 1YIT3 5LC7A 5BXQA 2R4IA 2CX1A 3KFQC 3FH1A 4K1VA 1WMNA 1VQK3 1QMAA 1BRJA 3BB9A 1BAOA 3SXXA 3CMA3 1MGWA 1FGOA 2W03A 4ORLA 1N8R4 3RGRA 2CG0A 1EA2A 1GY7A 5CK6A 1KSIA 1MWSA 2KF3A 2OQEC 3PXMA 4N6NB 4G1MB 3NV0B 3ZG5A 4O8SA 2HMKB 5IERA 2KCDA 1JZOA 1RSNA 2F5MA 1RLSA 1K41A 4XM4A 4LSOA 2GSPA 1RJOA 2I9WA 5AEUB 3IJEB 1AY7A 1X1UA 1LOVA 3OWYA 2IY2A 3CCJ3 1AQZA 1E97A 3JUQA 3CXC2 1V74A 1TRPA 1RTUA 4DKIA 4XBTA 2GEXA 2F4YA 3V99A 1LQMB 5AI1A 2Z6BA 2GU3A 3NX0A 2BO9B 1W00A 1YJ93 4N3VA 3NM7A 2BMOB 2RSXA 3DZLA 4HM4B 3WMDA 2OWPA 1YVSA 3PCRA 1AVKA 2W2CA 1IQ8A 1QAFA 3LXUX 4IIAA 5LC6A 4HM3B 5FGOA 5CF2A 5M1AA 5DREA 7GSPA 1Q814 4BL3A 4Q53A 4X2OA 3ZFZA 3FLJA 4STDA 2KF5A 1VQL3 4MMYB 4O2HA 1BVIA 2Z76A 1NB5I 1YVBI 5A0OB 1US1A 2KRTA 3MKIA 1CYVA 2XFSA 3K63A 3F40A 3H3HA 1RNBA 2Q07A 1JB4A 3E99A 1BANA 2CKFB 2YFJB 3KSPA 1UCIA 2LYXA 1OGZA 4I5QA 3RNTA 2BIRA 2CFGA 1BNRA 1V58A 2D42A 3D9RA 2KF4A 4FCJA 3S5CA 1Q40A 4BTYA 4FMBA 6GSPA 3CCM3 4BU4A 2GEYA 1FA3A 5GSPA 1UI8A 1FUWA 3S29A 4H3UA 9RNTA 1BSEA 2XRXB 1GOYA 3MHEA 4I4KA 1TP6A 1B2UA 3K5TA 1BU4A 5AYRB 1JKGA 1K28A 4FCZA 1TRQA 4L7KA 3F7SA 4HM2B 4AEQA 1NJI4 4AKZA 1RNTA 1SPUA 1VQ83 1OUNA 2B24B 3MPHA 4WYKA 1V57A 1JBTA 3CC73 1A67A 1U8CB 1NDOB 3NBJA 1GMRA 3VF1A 3U97A 1STFI 4BL2A 1BUJA 3U1WA 1N9JA 1OCVA 1CH0A 5EEOA 3VSYA 1O7NB 1SIHA 1BRKA 2QIYA 3G8ZA 4FR9A 3SEDA 1MNLA 1DVCA 3MG3A 3CCS3 1VQO3 1MWTA 2BU4A 2H0IA 3FG1A 1WMPA 3LTCA 1GD4A 1BRIA 1B2SA 4K90B 3EN8A 1UW1A 1T3BA 4TX4A 3KN4A 5IG0A 1PYLA 5KP4A 1EUIC 1N9EA 4JF8A 4LEHA 3ECFA 1RKYA 3BNDA 2E2VA 1Y4KA 1K8A4 3J7Yd 5ELUA 2F5WA 1N5PA 1BIRA 2UX0A 3SLUA 3CC43 2F98A 3M8CA 1RGHA 1AV4A 2ZHXB 5EQLA 3UB1A 1SQWA 2B1XB 1OACA 1BNSA 3B4PA 3DGMA 1UGHI 1T2IA 5BIRA 1IQXA 3GSPA 1I2EA 4WWUC 3D5IA 3ROBA 1K9M4 3HIGA 3NBRA 1KWIA 4CJNA 3GZRA 1YIJ3 1VQQA 1FUSA 2AAEA 1KD14 3AMOA 4RZMA 1D6YA 3HZPA 2YX9A 2SBLA 3S27A 3NQYA 1BRSA 2UUGC 3H51A 3HOHA 4FCMA 5IG3A 4RNTA 1S5AA 1PU4A 1DMQA 1RRHA 3V92A 1YNVX 1BRHA 3EBYA 1JBRA 1ASKA 3CU3A 3MYTA 1BSBA 2WGOA 7STDA 1B21A 4XB5A 1LNIA 8RNTA 2OTJ3 3CNXA 3DGYA 4KFFA 2XR8B 2HMLB 2RGQA 1UUVB 5AIIA 2A15A 3K9MC 3DH2A 4OUQA 1Q864 2CX0A 5TGNA 1JN5B 1GMQA 2CWVA 3N54B 3SYUA 1IT7A 1JB2A 2IMJA 3T0UA 1C7HA 2W04A 4HOHA 4HZBB 3WDGB 1W6CA 5BVBA 3I563 3KCHA 3CCE3 4J9AA 3A76A 3QRDA 4KT3B 3RDEA 3RGAA 3LOYA 3HX8A 4N6MA 3UL5A 4CCVA 1S723 2V1LA 5JBSA 1BSDA 1GY5A 5IENA 4HM6B 1OHSA 1RN7A 2RCDA 3FKAA 2O9UX 2INXA 3LT8A 3STDA 3UNLA 3KIIA 4K1UA 4GHOA 5EVHA 2IUJA 1I8VA 3CME3 2FGTA 1YI23 1B20A 1O7PB 4RNYA 3PCSA 1RN1A 2H0GA 5HOHA 1X1WA 1JZDA 4LYLB 2OOVA 3D3LA 3WA2X 1YGEA 5IG5A 4R9KA 1FYSA 4HZ9B 1M1XB 3NBBA 1Q7HA 5AIHA 4IT7A 5STDA 1JBSA 1JN5A 2YFLB 1GY6A 3AGOA 1EG9B 3X3YA 1RMSA 1ROAA 2STDA 1UCKA 4NHFA 3NV0A 1TTOA 1GOVA 1STDA 3LH4A 3S28A 4N6UA 1K734 1GOUA 1NWWA 3F14A 1ZX2A 1B2ZA 2HMJB 3EBTA 3BNBA 1FZUA 1A2VA 2L1SA 1OF5B 3MWZA 3Q1CA 3PYJA 4MMXB 4WHAA 2Z77A 1GYBA 2C4BA 3CPW2 3EX9A 3CCR3 1WTHA 2RNTA 3CCU3 1UUGB 1UUWB 3I553 3B4OA 4KZ1A 3MSOA 1PY3A 5IEOA 1ULJB 2XH9A 1T2HA 2CFLA 1A2PA 3JVCA 2CH9A 3UL6A 3VGNA 1GS3A 5KP1A 4HM8B 2KF6A 3WOFB 2CHCA 2CWTA 4QWTA 4U13A 1T5YA 1BUQA 2SARA 1GSPA 1I2GA 3F8HA 3NUVA 4BTXA 1M1K4 1R4CA 3BNCA 3FZWA 1DYUA 1VQN3 4GSPA 5ELJA 3CCV3 2XEPA 4R4KA 3Q2PA 1Z1SA 1KC84 1I2FA 1CYUA 2IYJA 3D79A 4XBYA 1RGLA 1RRLA 3PZWA 3AHWA 1IVUA 3NM2A 1X1XA 2CW9A 4J8TA 4PEJA 1TJDA 4EV2A 2ZA4A 1RHLA 3PGBA 1BNFA 5G2GA 4MEIA 4OVMA 3DY5A 4IPBA 1IT8A 1SJWA 1OHPA 3LMLA 3EJVA 4EXRA 1B3SA 2M7OA 5I97A 2HOHA
chains in the Genus database with same CATH topology
4RNTA 1I3FA 1AQZA 3URPA 1TRPA 1RTUA 2RBIA 1IYYA 1YNVX 1BRHA 1ZGXA 2F4YA 1JBRA 1RGCA 1BSBA 1B21A 1LNIA 8RNTA 1GMPA 3DGYA 1YVSA 3DH2A 5BU4A 1GMQA 3SYUA 7GSPA 2AADA 1BNEA 3AGNA 4HOHA 2KF5A 2F56A 3KCHA 1BVIA 1LOYA 1UCJA 1HYFA 3BU4A 1RNBA 1B27A 1C54A 1UCLA 3WR2A 1BANA 1UCIA 1MGRA 3RNTA 1BSDA 4HAAA 3D4AA 1B3SA 2BIRA 1BNRA 1LOWA 4BIRA 1RGGA 2KF4A 4GHOA 1I8VA 6GSPA 4BU4A 1B20A 5GSPA 1RCKA 1RN1A 6RNTA 5HOHA 9RNTA 3WHOA 1BSEA 3BIRA 1GOYA 1X1WA 1YGWA 1BRNL 1BNJA 7RNTA 1B2UA 1FYSA 1FUTA 1BU4A 1TRQA 1BNIA 1I0XA 1RGAA 1RNTA 1JBSA 1LRAA 3AGOA 1RMSA 1BOXA 1UCKA 1I0VA 1GMRA 1SARA 1TTOA 1B2MA 1RGEA 1GOVA 1BUJA 4J5GA 1GOUA 1CH0A 3D5GA 1B2ZA 1G02A 1BRKA 1FZUA 1JBTA 1Q9EA 1B2XA 2C4BA 2BU4A 4J5KA 2RNTA 1I70A 1BRGA 3A5EA 1BRIA 1B2SA 1PY3A 1T2HA 3Q3FA 1A2PA 1PYLA 1RN4A 2KF6A 1BGSA 1DE3A 1BSCA 2SARA 1GSPA 2F5WA 1I2GA 1BIRA 2KAAA 1RDSA 5RNTA 1I3IA 3AHSA 1RGKA 1RGHA 4GSPA 1BSAA 1R4YA 1BRJA 1I2FA 1BNSA 1RCLA 1BAOA 1RGLA 1X1YA 1T2IA 5BIRA 3GSPA 1I2EA 1MGWA 3AHWA 3D5IA 1X1XA 2KF3A 2ZA4A 1HZ1A 1RGFA 1FW7A 1RHLA 1BNFA 1DETA 1FUSA 1BNGA 2AAEA 1RSNA 2F5MA 1RLSA 2GSPA 1BRSA 1AY7A 1X1UA 1LOVA 3HOHA 2HOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RNT A;  1I3F A;  1AQZ A;  3URP A;  1TRP A;  1RTU A;  2RBI A;  1IYY A;  1YNV X;  1BRH A;  1ZGX A;  2F4Y A;  1JBR A;  1RGC A;  1BSB A;  1B21 A;  1LNI A;  8RNT A;  1GMP A;  3DGY A;  1YVS A;  3DH2 A;  5BU4 A;  1GMQ A;  3SYU A;  7GSP A;  2AAD A;  1BNE A;  3AGN A;  4HOH A;  2KF5 A;  2F56 A;  3KCH A;  1BVI A;  1LOY A;  1UCJ A;  1HYF A;  3BU4 A;  1RNB A;  1B27 A;  1C54 A;  1UCL A;  3WR2 A;  1BAN A;  1UCI A;  1MGR A;  3RNT A;  1BSD A;  4HAA A;  3D4A A;  1B3S A;  2BIR A;  1BNR A;  1LOW A;  4BIR A;  1RGG A;  2KF4 A;  4GHO A;  1I8V A;  6GSP A;  4BU4 A;  1B20 A;  5GSP A;  1RCK A;  1RN1 A;  6RNT A;  5HOH A;  9RNT A;  3WHO A;  1BSE A;  3BIR A;  1GOY A;  1X1W A;  1YGW A;  1BRN L;  1BNJ A;  7RNT A;  1B2U A;  1FYS A;  1FUT A;  1BU4 A;  1TRQ A;  1BNI A;  1I0X A;  1RGA A;  1RNT A;  1JBS A;  1LRA A;  3AGO A;  1RMS A;  1BOX A;  1UCK A;  1I0V A;  1GMR A;  1SAR A;  1TTO A;  1B2M A;  1RGE A;  1GOV A;  1BUJ A;  4J5G A;  1GOU A;  1CH0 A;  3D5G A;  1B2Z A;  1G02 A;  1BRK A;  1FZU A;  1JBT A;  1Q9E A;  1B2X A;  2C4B A;  2BU4 A;  4J5K A;  2RNT A;  1I70 A;  1BRG A;  3A5E A;  1BRI A;  1B2S A;  1PY3 A;  1T2H A;  3Q3F A;  1A2P A;  1PYL A;  1RN4 A;  2KF6 A;  1BGS A;  1DE3 A;  1BSC A;  2SAR A;  1GSP A;  2F5W A;  1I2G A;  1BIR A;  2KAA A;  1RDS A;  5RNT A;  1I3I A;  3AHS A;  1RGK A;  1RGH A;  4GSP A;  1BSA A;  1R4Y A;  1BRJ A;  1I2F A;  1BNS A;  1RCL A;  1BAO A;  1RGL A;  1X1Y A;  1T2I A;  5BIR A;  3GSP A;  1I2E A;  1MGW A;  3AHW A;  3D5I A;  1X1X A;  2KF3 A;  2ZA4 A;  1HZ1 A;  1RGF A;  1FW7 A;  1RHL A;  1BNF A;  1DET A;  1FUS A;  1BNG A;  2AAE A;  1RSN A;  2F5M A;  1RLS A;  2GSP A;  1BRS A;  1AY7 A;  1X1U A;  1LOV A;  3HOH A;  2HOH A; 
#chains in the Genus database with same CATH topology
 2WOH A;  1DVD A;  2HMO B;  3ALA A;  3KSE D;  2MC8 A;  3URP A;  2GXF A;  4CDL A;  1LNH A;  3EN1 B;  4HVN A;  2CFD A;  4JRF A;  5G1K A;  2XSH B;  1ZGX A;  1O7W B;  2W0Q A;  2WGQ A;  1ROV A;  1QVG 2;  1W4N A;  4LGQ A;  1JB5 A;  2OOV C;  1W5Z A;  1QVF 2;  1J2B A;  5D83 A;  5AYS C;  4O02 B;  1QJG A;  3NXJ A;  5BU4 A;  3DXO A;  5AEW B;  3FF0 A;  4H61 A;  1IVX A;  2FNQ A;  2AAD A;  1BNE A;  3DUK A;  5CXO A;  1M90 4;  2F86 B;  2F99 A;  3PS8 A;  3LTD A;  3F9S A;  1IVV A;  1LOY A;  1TFO A;  1UCJ A;  3KE7 A;  4XBX A;  3V98 A;  2QEX 3;  1HYF A;  1E3R A;  3GZB A;  3NHX A;  1DMM A;  1N8Q A;  1B27 A;  1WMO A;  1E3V A;  1UCL A;  3WR2 A;  1Q7Y 4;  4CPK A;  5JPU A;  2GBX B;  1W2Z A;  2K3D A;  3D4A A;  4HAA A;  1W7C A;  2P0M A;  1LOW A;  1QAL A;  4FMD A;  3LTB A;  2GU1 A;  2E2U A;  5IEP A;  2JDI H;  1FGQ A;  2XGN A;  4R9L A;  1OPY A;  2QGU A;  3BIR A;  1YGW A;  3FCS B;  4BTW A;  1BRN L;  1BNJ A;  1MOL A;  3T8U A;  2ML5 A;  3F8X A;  4GB5 A;  3CC2 3;  3GZY B;  1VQP 3;  1YJN 3;  1YHQ 3;  1BNI A;  1OH0 A;  2W9Q A;  3MG1 A;  1U5O A;  4R80 A;  1CEW I;  3HII A;  2RFR A;  5D82 A;  3LZA A;  4RBN A;  1LRA A;  4LZI A;  3GWR A;  1PFP A;  1NNV A;  1BOX A;  1FGT A;  3B7C A;  1SAR A;  4XDV A;  5FW5 A;  1RGE A;  3OX9 A;  4X2H A;  4J5G A;  3WOE B;  1MWR A;  4AKY A;  3LTA A;  1VZZ A;  1ZS7 A;  3D5G A;  4KFD A;  2O3O A;  4KVH A;  1G0T A;  2D1W A;  3F7X A;  3X3X A;  5JPP A;  1Q9E A;  4HJL B;  3EQQ B;  5G1L A;  1B2X A;  1O7G B;  5IW9 A;  1AVL A;  4J5K A;  1LQG C;  1I70 A;  3A5E A;  1LVN A;  2CC3 A;  1IVW A;  8CHO A;  2PZV A;  3OXA A;  3ZG0 A;  2HMN B;  1RN4 A;  3OV4 A;  3DM8 A;  4N6V 0;  3DGL A;  4N6T A;  2CWU A;  4XDW A;  5KP3 A;  2WO0 A;  5DRV A;  2XSO B;  3QK9 A;  4N6O B;  1Q40 B;  2KAA A;  3ER7 A;  1EQK A;  4LMI A;  2J8X B;  2CK3 H;  1JV2 B;  1RGK A;  4L8O A;  3OWU A;  4WFO A;  3FGY A;  1D6Z A;  5CLK A;  3EC9 A;  1BSA A;  2Z7A A;  1R4Y A;  4NRE A;  1RCL A;  1HKX A;  5HGR A;  1JKG B;  1X1Y A;  1UDI I;  2R41 A;  3X40 A;  1Q82 4;  3DGO A;  3SVA A;  1TU5 A;  3CCL 3;  2GBW B;  1JRQ A;  4WYK B;  1W6Y A;  4FMA A;  1NO3 A;  1DMN A;  2W56 B;  1HZ1 A;  1RGF A;  1FW7 A;  2BT3 A;  3OWS A;  1DET A;  1BNG A;  4KFE A;  1FGR A;  1D6U A;  2LQV A;  4MMZ B;  3EB8 A;  1HU9 A;  1IQY A;  4EBG A;  1VQ9 3;  1YJW 3;  2MF7 A;  3IPT A;  1SII A;  1TIJ A;  3G16 A;  6STD A;  2HMM B;  2CG1 A;  4EW5 A;  1UGI A;  1ISK A;  1I3F A;  1FGM A;  3NQZ A;  1G96 A;  1IYY A;  2RBI A;  3SOA A;  3IMA B;  3FSD A;  3K7C A;  3JUO A;  3G4S 3;  2P0X A;  1RGC A;  3G0K A;  2W6J H;  3MG2 A;  3TDG A;  2CFW A;  2K54 A;  3CNM A;  1GMP A;  3HI7 A;  3N8B A;  3G71 3;  2P09 A;  1KQS 2;  1ZO2 A;  4MJD A;  2BMQ B;  2ZL8 A;  4GL6 A;  1VQM 3;  5M19 A;  3BLZ A;  2C11 A;  1IU7 A;  3B8L A;  2IUK A;  3DGN A;  3KKG A;  3HK4 A;  2ML6 A;  1F8N A;  1OF5 A;  3AGN A;  4HM7 B;  2F56 A;  5IG4 A;  2OQE A;  2JQ5 A;  4ZM8 A;  4EC6 A;  2L4V A;  2W9P A;  4HKV B;  5D81 A;  2UGI A;  2W56 A;  2WOF A;  2CFK A;  2Y74 A;  3WA3 A;  4HYZ A;  3X41 A;  3BU4 A;  5CF1 A;  4N6L A;  5AIF A;  3SX1 A;  3OW2 2;  1C54 A;  3GRD A;  2FXT A;  4L8P A;  1NU3 A;  1VQ4 3;  1IDP A;  1MGR A;  5AIG A;  1WQL B;  4EYC A;  1VQ7 3;  4BIR A;  1RGG A;  5IF6 A;  3WOD G;  2KXG A;  2PNC A;  1CQS A;  4NPB A;  1W01 A;  4WP5 A;  1L5G B;  3AMO B;  1RCK A;  4O3V A;  2XF3 A;  3N9H A;  6RNT A;  1A90 A;  4FMC A;  3WHO A;  4EV5 A;  3GZX B;  3FF2 A;  1UI7 A;  7RNT A;  2C10 A;  3K0Z A;  1TFK A;  1FUT A;  1WNH A;  1AR0 A;  1IV7 A;  1TUH A;  2IA7 A;  3I0Y A;  3KZT A;  3EHC A;  1I0X A;  1W2B 2;  1RGA A;  3X42 A;  2OTL 3;  3GAX A;  2BNG A;  2K0M A;  2CIU A;  1W02 A;  4HM0 B;  3CD6 3;  3CPO A;  3FG3 A;  4K61 A;  3T8N A;  1I0V A;  1LOX A;  2XGL A;  1B2M A;  1O7M B;  1A2K A;  1EEJ A;  2XFT A;  3BNE A;  1JJ2 2;  2ZDJ A;  1QAK A;  3DMC A;  2Y73 A;  3EF8 A;  3CCQ 3;  1G02 A;  4HM5 B;  3LYG A;  2OCT A;  3Q90 A;  3LT9 A;  1IK3 A;  3EE1 A;  4OK0 A;  1VQ5 3;  3G6E 3;  1M9G A;  4RNZ A;  1BRG A;  3UJM A;  1N5H A;  1NB3 I;  2BHM A;  3SOY A;  3X3Z A;  2QA4 3;  1Q42 A;  2E2T A;  3JUN A;  3L0R A;  2P38 A;  1EKM A;  2YFI B;  3Q3F A;  1W6G A;  4ILF A;  4HBR A;  1GD3 A;  1OGX A;  1LXE A;  3O8Y A;  1ULI B;  3S67 A;  1BGS A;  1DE3 A;  1BSC A;  4HM1 B;  1JNQ A;  4R1K A;  2H0H A;  1O7H B;  1MWU A;  1VQ6 3;  3JUP A;  5RNT A;  1RDS A;  3FG4 A;  1I3I A;  2BMR B;  3AHS A;  5M18 A;  3JUM A;  1IV9 A;  1OHO A;  2P05 A;  1YIT 3;  5LC7 A;  5BXQ A;  2R4I A;  2CX1 A;  3KFQ C;  3FH1 A;  4K1V A;  1WMN A;  1VQK 3;  1QMA A;  1BRJ A;  3BB9 A;  1BAO A;  3SXX A;  3CMA 3;  1MGW A;  1FGO A;  2W03 A;  4ORL A;  1N8R 4;  3RGR A;  2CG0 A;  1EA2 A;  1GY7 A;  5CK6 A;  1KSI A;  1MWS A;  2KF3 A;  2OQE C;  3PXM A;  4N6N B;  4G1M B;  3NV0 B;  3ZG5 A;  4O8S A;  2HMK B;  5IER A;  2KCD A;  1JZO A;  1RSN A;  2F5M A;  1RLS A;  1K41 A;  4XM4 A;  4LSO A;  2GSP A;  1RJO A;  2I9W A;  5AEU B;  3IJE B;  1AY7 A;  1X1U A;  1LOV A;  3OWY A;  2IY2 A;  3CCJ 3;  1AQZ A;  1E97 A;  3JUQ A;  3CXC 2;  1V74 A;  1TRP A;  1RTU A;  4DKI A;  4XBT A;  2GEX A;  2F4Y A;  3V99 A;  1LQM B;  5AI1 A;  2Z6B A;  2GU3 A;  3NX0 A;  2BO9 B;  1W00 A;  1YJ9 3;  4N3V A;  3NM7 A;  2BMO B;  2RSX A;  3DZL A;  4HM4 B;  3WMD A;  2OWP A;  1YVS A;  3PCR A;  1AVK A;  2W2C A;  1IQ8 A;  1QAF A;  3LXU X;  4IIA A;  5LC6 A;  4HM3 B;  5FGO A;  5CF2 A;  5M1A A;  5DRE A;  7GSP A;  1Q81 4;  4BL3 A;  4Q53 A;  4X2O A;  3ZFZ A;  3FLJ A;  4STD A;  2KF5 A;  1VQL 3;  4MMY B;  4O2H A;  1BVI A;  2Z76 A;  1NB5 I;  1YVB I;  5A0O B;  1US1 A;  2KRT A;  3MKI A;  1CYV A;  2XFS A;  3K63 A;  3F40 A;  3H3H A;  1RNB A;  2Q07 A;  1JB4 A;  3E99 A;  1BAN A;  2CKF B;  2YFJ B;  3KSP A;  1UCI A;  2LYX A;  1OGZ A;  4I5Q A;  3RNT A;  2BIR A;  2CFG A;  1BNR A;  1V58 A;  2D42 A;  3D9R A;  2KF4 A;  4FCJ A;  3S5C A;  1Q40 A;  4BTY A;  4FMB A;  6GSP A;  3CCM 3;  4BU4 A;  2GEY A;  1FA3 A;  5GSP A;  1UI8 A;  1FUW A;  3S29 A;  4H3U A;  9RNT A;  1BSE A;  2XRX B;  1GOY A;  3MHE A;  4I4K A;  1TP6 A;  1B2U A;  3K5T A;  1BU4 A;  5AYR B;  1JKG A;  1K28 A;  4FCZ A;  1TRQ A;  4L7K A;  3F7S A;  4HM2 B;  4AEQ A;  1NJI 4;  4AKZ A;  1RNT A;  1SPU A;  1VQ8 3;  1OUN A;  2B24 B;  3MPH A;  4WYK A;  1V57 A;  1JBT A;  3CC7 3;  1A67 A;  1U8C B;  1NDO B;  3NBJ A;  1GMR A;  3VF1 A;  3U97 A;  1STF I;  4BL2 A;  1BUJ A;  3U1W A;  1N9J A;  1OCV A;  1CH0 A;  5EEO A;  3VSY A;  1O7N B;  1SIH A;  1BRK A;  2QIY A;  3G8Z A;  4FR9 A;  3SED A;  1MNL A;  1DVC A;  3MG3 A;  3CCS 3;  1VQO 3;  1MWT A;  2BU4 A;  2H0I A;  3FG1 A;  1WMP A;  3LTC A;  1GD4 A;  1BRI A;  1B2S A;  4K90 B;  3EN8 A;  1UW1 A;  1T3B A;  4TX4 A;  3KN4 A;  5IG0 A;  1PYL A;  5KP4 A;  1EUI C;  1N9E A;  4JF8 A;  4LEH A;  3ECF A;  1RKY A;  3BND A;  2E2V A;  1Y4K A;  1K8A 4;  3J7Y d;  5ELU A;  2F5W A;  1N5P A;  1BIR A;  2UX0 A;  3SLU A;  3CC4 3;  2F98 A;  3M8C A;  1RGH A;  1AV4 A;  2ZHX B;  5EQL A;  3UB1 A;  1SQW A;  2B1X B;  1OAC A;  1BNS A;  3B4P A;  3DGM A;  1UGH I;  1T2I A;  5BIR A;  1IQX A;  3GSP A;  1I2E A;  4WWU C;  3D5I A;  3ROB A;  1K9M 4;  3HIG A;  3NBR A;  1KWI A;  4CJN A;  3GZR A;  1YIJ 3;  1VQQ A;  1FUS A;  2AAE A;  1KD1 4;  3AMO A;  4RZM A;  1D6Y A;  3HZP A;  2YX9 A;  2SBL A;  3S27 A;  3NQY A;  1BRS A;  2UUG C;  3H51 A;  3HOH A;  4FCM A;  5IG3 A;  4RNT A;  1S5A A;  1PU4 A;  1DMQ A;  1RRH A;  3V92 A;  1YNV X;  1BRH A;  3EBY A;  1JBR A;  1ASK A;  3CU3 A;  3MYT A;  1BSB A;  2WGO A;  7STD A;  1B21 A;  4XB5 A;  1LNI A;  8RNT A;  2OTJ 3;  3CNX A;  3DGY A;  4KFF A;  2XR8 B;  2HML B;  2RGQ A;  1UUV B;  5AII A;  2A15 A;  3K9M C;  3DH2 A;  4OUQ A;  1Q86 4;  2CX0 A;  5TGN A;  1JN5 B;  1GMQ A;  2CWV A;  3N54 B;  3SYU A;  1IT7 A;  1JB2 A;  2IMJ A;  3T0U A;  1C7H A;  2W04 A;  4HOH A;  4HZB B;  3WDG B;  1W6C A;  5BVB A;  3I56 3;  3KCH A;  3CCE 3;  4J9A A;  3A76 A;  3QRD A;  4KT3 B;  3RDE A;  3RGA A;  3LOY A;  3HX8 A;  4N6M A;  3UL5 A;  4CCV A;  1S72 3;  2V1L A;  5JBS A;  1BSD A;  1GY5 A;  5IEN A;  4HM6 B;  1OHS A;  1RN7 A;  2RCD A;  3FKA A;  2O9U X;  2INX A;  3LT8 A;  3STD A;  3UNL A;  3KII A;  4K1U A;  4GHO A;  5EVH A;  2IUJ A;  1I8V A;  3CME 3;  2FGT A;  1YI2 3;  1B20 A;  1O7P B;  4RNY A;  3PCS A;  1RN1 A;  2H0G A;  5HOH A;  1X1W A;  1JZD A;  4LYL B;  2OOV A;  3D3L A;  3WA2 X;  1YGE A;  5IG5 A;  4R9K A;  1FYS A;  4HZ9 B;  1M1X B;  3NBB A;  1Q7H A;  5AIH A;  4IT7 A;  5STD A;  1JBS A;  1JN5 A;  2YFL B;  1GY6 A;  3AGO A;  1EG9 B;  3X3Y A;  1RMS A;  1ROA A;  2STD A;  1UCK A;  4NHF A;  3NV0 A;  1TTO A;  1GOV A;  1STD A;  3LH4 A;  3S28 A;  4N6U A;  1K73 4;  1GOU A;  1NWW A;  3F14 A;  1ZX2 A;  1B2Z A;  2HMJ B;  3EBT A;  3BNB A;  1FZU A;  1A2V A;  2L1S A;  1OF5 B;  3MWZ A;  3Q1C A;  3PYJ A;  4MMX B;  4WHA A;  2Z77 A;  1GYB A;  2C4B A;  3CPW 2;  3EX9 A;  3CCR 3;  1WTH A;  2RNT A;  3CCU 3;  1UUG B;  1UUW B;  3I55 3;  3B4O A;  4KZ1 A;  3MSO A;  1PY3 A;  5IEO A;  1ULJ B;  2XH9 A;  1T2H A;  2CFL A;  1A2P A;  3JVC A;  2CH9 A;  3UL6 A;  3VGN A;  1GS3 A;  5KP1 A;  4HM8 B;  2KF6 A;  3WOF B;  2CHC A;  2CWT A;  4QWT A;  4U13 A;  1T5Y A;  1BUQ A;  2SAR A;  1GSP A;  1I2G A;  3F8H A;  3NUV A;  4BTX A;  1M1K 4;  1R4C A;  3BNC A;  3FZW A;  1DYU A;  1VQN 3;  4GSP A;  5ELJ A;  3CCV 3;  2XEP A;  4R4K A;  3Q2P A;  1Z1S A;  1KC8 4;  1I2F A;  1CYU A;  2IYJ A;  3D79 A;  4XBY A;  1RGL A;  1RRL A;  3PZW A;  3AHW A;  1IVU A;  3NM2 A;  1X1X A;  2CW9 A;  4J8T A;  4PEJ A;  1TJD A;  4EV2 A;  2ZA4 A;  1RHL A;  3PGB A;  1BNF A;  5G2G A;  4MEI A;  4OVM A;  3DY5 A;  4IPB A;  1IT8 A;  1SJW A;  1OHP A;  3LML A;  3EJV A;  4EXR A;  1B3S A;  2M7O A;  5I97 A;  2HOH A; 
#chains in the Genus database with same CATH homology
 4RNT A;  1I3F A;  1AQZ A;  3URP A;  1TRP A;  1RTU A;  2RBI A;  1IYY A;  1YNV X;  1BRH A;  1ZGX A;  2F4Y A;  1JBR A;  1RGC A;  1BSB A;  1B21 A;  1LNI A;  8RNT A;  1GMP A;  3DGY A;  1YVS A;  3DH2 A;  5BU4 A;  1GMQ A;  3SYU A;  7GSP A;  2AAD A;  1BNE A;  3AGN A;  4HOH A;  2KF5 A;  2F56 A;  3KCH A;  1BVI A;  1LOY A;  1UCJ A;  1HYF A;  3BU4 A;  1RNB A;  1B27 A;  1C54 A;  1UCL A;  3WR2 A;  1BAN A;  1UCI A;  1MGR A;  3RNT A;  1BSD A;  4HAA A;  3D4A A;  1B3S A;  2BIR A;  1BNR A;  1LOW A;  4BIR A;  1RGG A;  2KF4 A;  4GHO A;  1I8V A;  6GSP A;  4BU4 A;  1B20 A;  5GSP A;  1RCK A;  1RN1 A;  6RNT A;  5HOH A;  9RNT A;  3WHO A;  1BSE A;  3BIR A;  1GOY A;  1X1W A;  1YGW A;  1BRN L;  1BNJ A;  7RNT A;  1B2U A;  1FYS A;  1FUT A;  1BU4 A;  1TRQ A;  1BNI A;  1I0X A;  1RGA A;  1RNT A;  1JBS A;  1LRA A;  3AGO A;  1RMS A;  1BOX A;  1UCK A;  1I0V A;  1GMR A;  1SAR A;  1TTO A;  1B2M A;  1RGE A;  1GOV A;  1BUJ A;  4J5G A;  1GOU A;  1CH0 A;  3D5G A;  1B2Z A;  1G02 A;  1BRK A;  1FZU A;  1JBT A;  1Q9E A;  1B2X A;  2C4B A;  2BU4 A;  4J5K A;  2RNT A;  1I70 A;  1BRG A;  3A5E A;  1BRI A;  1B2S A;  1PY3 A;  1T2H A;  3Q3F A;  1A2P A;  1PYL A;  1RN4 A;  2KF6 A;  1BGS A;  1DE3 A;  1BSC A;  2SAR A;  1GSP A;  2F5W A;  1I2G A;  1BIR A;  2KAA A;  1RDS A;  5RNT A;  1I3I A;  3AHS A;  1RGK A;  1RGH A;  4GSP A;  1BSA A;  1R4Y A;  1BRJ A;  1I2F A;  1BNS A;  1RCL A;  1BAO A;  1RGL A;  1X1Y A;  1T2I A;  5BIR A;  3GSP A;  1I2E A;  1MGW A;  3AHW A;  3D5I A;  1X1X A;  2KF3 A;  2ZA4 A;  1HZ1 A;  1RGF A;  1FW7 A;  1RHL A;  1BNF A;  1DET A;  1FUS A;  1BNG A;  2AAE A;  1RSN A;  2F5M A;  1RLS A;  2GSP A;  1BRS A;  1AY7 A;  1X1U A;  1LOV A;  3HOH A;  2HOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...