1B2XA

Barnase wildtype structure at ph 7.5 from a cryo_cooled crystal at 100k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2xA00
1B2MA 1BUJA 2SARA 1T2HA 2KF6A 1BNRA 1BNEA 1R4YA 8RNTA 2C4BA 2AADA 1RDSA 1B2XA 1FYSA 1JBTA 2RBIA 3DGYA 1DETA 2BIRA 4RNTA 3AGNA 1FW7A 1BNIA 1RTUA 4BU4A 1BRSA 4HOHA 1AY7A 1FZUA 1PY3A 2BU4A 1I0VA 3AHWA 1RGFA 1LOWA 3AHSA 1B21A 1YNVX 1RN4A 1X1UA 2AAEA 5HOHA 2F5WA 1YGWA 1DE3A 2GSPA 1BANA 3WHOA 1ZGXA 1X1WA 1BRHA 1RCLA 1I0XA 3URPA 1X1YA 1BGSA 1B2SA 1I2GA 1B3SA 1T2IA 1BRKA 1BRGA 1LOVA 1RGCA 1TRQA 3RNTA 1RN1A 1BSAA 1BRNL 1BSBA 1I8VA 2F56A 1B2UA 1GMQA 1LRAA 1CH0A 4BIRA 1TRPA 1HZ1A 3A5EA 1JBRA 3DH2A 1I3FA 2ZA4A 1BRJA 3D5IA 2RNTA 3SYUA 1RCKA 1B20A 3Q3FA 3WR2A 1BRIA 1UCKA 1I3IA 2KF5A 1BNJA 1BOXA 1B2ZA 1BVIA 1BAOA 1RGLA 6RNTA 1UCIA 5BU4A 4J5GA 1LNIA 1HYFA 1IYYA 2F5MA 1BSEA 1RGHA 1A2PA 1BSCA 1PYLA 1SARA 2F4YA 7GSPA 1TTOA 1RGKA 2KAAA 7RNTA 3HOHA 1I2EA 1B27A 2KF4A 1MGWA 1RHLA 9RNTA 1BNFA 1G02A 1RNTA 1UCJA 3BIRA 1RLSA 1GOVA 1LOYA 1GMRA 1RGAA 4GSPA 2KF3A 2HOHA 1RGGA 1RSNA 4GHOA 3D5GA 3AGOA 4J5KA 1BIRA 3D4AA 3GSPA 1GSPA 1BSDA 5BIRA 1GOUA 1MGRA 5RNTA 1RGEA 1YVSA 6GSPA 1FUTA 1I2FA 1C54A 1Q9EA 1GMPA 1JBSA 1BU4A 1X1XA 1AQZA 4HAAA 1I70A 1UCLA 1RNBA 1BNGA 1BNSA 5GSPA 1RMSA 1GOYA 3KCHA 1FUSA 3BU4A
chains in the Genus database with same CATH superfamily
2W04A 3GZXB 3X41A 4HM4B 1BNEA 1Q864 5KP1A 4XBYA 1RDSA 1NB5I 5EVHA 4O2HA 1V74A 4HM5B 1AVLA 2RFRA 3LTDA 3NBJA 3JUOA 5JPUA 1QAKA 5IW9A 5JPPA 1AV4A 1LVNA 2BT3A 1RTUA 3CCR3 1A90A 4HOHA 3B8LA 1FZUA 1GY5A 2CFKA 3WOEB 1RGFA 1JN5B 3AHSA 3EBYA 1EQKA 3S5CA 3VF1A 4EV5A 4CJNA 2CW9A 1X1UA 2P0XA 2OQEA 1Q7Y4 4JRFA 1K28A 3CC23 3ALAA 1IK3A 3B4OA 4NHFA 1ZGXA 3BNDA 3WOFB 1BRHA 1OHPA 2BO9B 3JUMA 3OWUA 1OHSA 3DGLA 4FCMA 3LH4A 1BRKA 4HZ9B 5FGOA 4OUQA 3VSYA 3M8CA 1Q40B 2HMMB 5AYSC 3SOAA 4R4KA 1B2UA 2A15A 1LRAA 1M1XB 1QAFA 4R80A 5DREA 5M18A 1A2VA 1IVUA 1JN5A 1HZ1A 3HIGA 3I563 4N6OB 2L1SA 1MWTA 3CCS3 5JBSA 4NPBA 1YGEA 2STDA 2B1XB 3X40A 3OWYA 3KKGA 3AMOA 2GEXA 7STDA 3FF2A 3EF8A 3NQZA 1K734 1RCKA 1LXEA 5D83A 2OWPA 5G2GA 1I3IA 4EBGA 1B2ZA 2XSOB 4WFOA 1NWWA 1GY6A 5KP4A 4GSPA 3DGOA 4MMZB 3KSPA 3SXXA 4LZIA 3V98A 1VQ93 3EJVA 3F14A 2CWUA 2YFLB 3EN1B 3IPTA 1PYLA 3K9MC 5D81A 1YVBI 2D1WA 1RRLA 4AEQA 3OW22 1TP6A 2IMJA 4K1VA 3CCE3 1HU9A 1UGIA 2CWVA 1YJ93 1W00A 3F8XA 3NX0A 2KF4A 1MGWA 1RHLA 3S67A 5AEWB 9RNTA 2P38A 2MC8A 4N3VA 1CQSA 1RNTA 4XM4A 1VQK3 3ER7A 3KIIA 3CPOA 5EQLA 1O7NB 5IEPA 2CFDA 3A76A 3HZPA 2KF3A 4HZBB 5DRVA 3DGMA 1RJOA 4WWUC 3D4AA 3FG1A 2QGUA 3NBBA 1GSPA 3FF0A 4HVNA 1OCVA 1RGEA 1TU5A 3CCL3 4BTWA 1FUTA 1I2FA 3EE1A 3WA2X 1QVF2 2RSXA 1Q9EA 3F7SA 1JB5A 1AQZA 2OOVC 2R41A 4MMXB 2WGOA 3F40A 3SOYA 3QRDA 1RNBA 2OTJ3 1N8QA 1V58A 1SIIA 1GOYA 3JUNA 1OUNA 4O8SA 3KN4A 4FR9A 4J9AA 2O9UX 2W03A 3BNCA 3E99A 3MHEA 1T2HA 1BNRA 1W2ZA 5LC7A 1BUQA 1R4YA 4GB5A 1UI8A 1GD3A 1VQM3 2XEPA 2CC3A 3FKAA 1JBTA 4HM3B 2CFGA 1MWUA 2RBIA 2H0IA 5IG3A 1AY7A 1EA2A 1FGOA 2BU4A 2IYJA 3AHWA 1WNHA 1O7GB 3JUQA 3MG2A 3UB1A 1LOWA 1Q7HA 2OCTA 3CD63 1YNVX 2I9WA 2BMRB 1W01A 1N5HA 3BNEA 5HOHA 2F5WA 1RRHA 1YGWA 1SIHA 1RN7A 4I5QA 2GSPA 3SEDA 3HX8A 1DE3A 1HKXA 3PZWA 4CDLA 3WHOA 5IF6A 2BMQB 3FLJA 4HBRA 4XDVA 2ML5A 1ULJB 1GY7A 1NU3A 1W02A 2XF3A 1TIJA 2SBLA 1ZX2A 1BGSA 1W6CA 1EUIC 3DMCA 5AIGA 3FCSB 5D82A 3BLZA 2OOVA 3RNTA 4HYZA 1YJN3 1BSAA 4BTYA 4STDA 2LYXA 4KFFA 2XGNA 4LSOA 2J8XB 2F99A 3N54B 1FA3A 3FG3A 1GMQA 4RBNA 4WP5A 1JJ22 1LNHA 3OV4A 4KZ1A 3A5EA 1VQO3 1Q824 3STDA 1DMMA 1E3VA 2YFIB 4X2HA 3DH2A 4DKIA 2ZA4A 1IV9A 4HM1B 2XFTA 1BRJA 4XBTA 1VQ63 3U1WA 3D5IA 2OTL3 4KVHA 3S28A 3CCU3 1IVVA 1LQMB 1M904 1B20A 2P09A 3Q3FA 4GL6A 2XFSA 1Q42A 2WGQA 1J2BA 3HIIA 1BVIA 1BAOA 4N6LA 3X3XA 4QWTA 1UCIA 3NV0B 3ROBA 3CNXA 1LNIA 2P0MA 4J8TA 1WMOA 1FGQA 3K5TA 3CXC2 1BSEA 1S723 2GU1A 2W2CA 3K63A 4EC6A 3LXUX 3U97A 3PCRA 2F4YA 7GSPA 2K3DA 1FGMA 3T8UA 2C11A 2INXA 1RGKA 7RNTA 1OGZA 3B7CA 3N8BA 2W56B 1RKYA 5EEOA 4R9KA 1YJW3 3OWSA 1UCJA 1Q814 3B4PA 1KWIA 1MNLA 3FH1A 4MEIA 1GOVA 1NO3A 4ILFA 3RGAA 3UJMA 1RGAA 3Q2PA 1QALA 1STFI 2CX0A 2HOHA 1RGGA 1NB3I 1RSNA 2W6JH 3D5GA 4GHOA 1M9GA 4L7KA 1W5ZA 3AGOA 4MMYB 3CCV3 1VQ43 4J5KA 1VQ53 1T3BA 1KSIA 2XH9A 4AKZA 3D3LA 1MGRA 3WA3A 1YVSA 2B24B 1FGTA 1UUWB 2C10A 3NV0A 4K90B 6GSPA 3KZTA 4HM2B 3CME3 1C54A 3MPHA 1UUVB 1MOLA 1VQ73 3PXMA 1Q40A 2CG0A 4TX4A 2D42A 1BU4A 3LMLA 4HKVB 1Z1SA 2XR8B 3D9RA 5AIIA 1O7WB 1W7CA 1BNGA 1RMSA 2LQVA 3SLUA 3F7XA 1R4CA 4ORLA 4KT3B 1B2MA 2SARA 2W56A 3LT8A 5IEOA 1LQGC 1WMNA 2KF6A 1YI23 8RNTA 1VQP3 2AADA 3LT9A 2CH9A 4HM6B 2QIYA 2WOFA 4IT7A 4L8PA 4RZMA 1B2XA 1FYSA 1UW1A 2Z6BA 5I97A 1IQYA 2WOHA 3DGYA 3IJEB 4WHAA 2QEX3 1FW7A 2CG1A 1C7HA 1OF5B 4BU4A 4N6UA 1DVDA 1OGXA 3UL6A 1OHOA 3S29A 2YFJB 1DMNA 4LEHA 5CF2A 1B21A 1JNQA 1U8CB 2WO0A 3QK9A 2F98A 1RN4A 4RNYA 4KFDA 5STDA 1JZDA 2MF7A 4X2OA 4ZM8A 1PFPA 4IPBA 1NDOB 2E2VA 1D6UA 4HM8B 1BANA 1UUGB 1US1A 2GU3A 5IG0A 5CF1A 1QVG2 1SJWA 1KD14 1X1WA 2O3OA 1RCLA 1IT8A 1IVWA 3DUKA 1I0XA 4LMIA 1X1YA 1B2SA 1T2IA 1UGHI 2KXGA 4CCVA 3JUPA 2KCDA 1LOVA 2W9QA 1TRQA 3BB9A 1RN1A 2BHMA 5IERA 1ROVA 1BSBA 2CX1A 5AEUB 2IUKA 1PU4A 1Y4KA 3EHCA 1CH0A 3RDEA 2BMOB 1CYVA 1TRPA 3H3HA 1D6YA 3X3ZA 2Y73A 3DY5A 5G1LA 1JBRA 3WDGB 1E3RA 1QJGA 1ZS7A 3PCSA 2HMLB 3PS8A 3OXAA 3FG4A 4FCZA 1SQWA 3DM8A 4EXRA 3X42A 5A0OB 3LTCA 1G0TA 3MYTA 4XDWA 5LC6A 2PNCA 3SYUA 3V92A 2FXTA 3WR2A 5IG5A 3CPW2 1O7PB 4N6V0 1AR0A 1BNJA 1BOXA 1W6YA 3UL5A 1K8A4 6RNTA 1RGLA 2CK3H 2L4VA 5HGRA 5BU4A 1V57A 1KC84 1VQN3 1SPUA 1IYYA 2CIUA 2F5MA 4FMDA 6STDA 1A2PA 1FGRA 1IU7A 1SARA 2K54A 3Q90A 4N6NB 1ISKA 1TTOA 2E2TA 3GZBA 3EQQB 3FSDA 3I553 1O7HB 3MG1A 2GXFA 3HOHA 1B27A 3K0ZA 3UNLA 3KFQC 2IA7A 4K1UA 5ELJA 5IENA 3NM7A 1IT7A 4EW5A 2XRXB 1OPYA 2HMJB 3CC73 1IDPA 3BNBA 1TFOA 1WQLB 1LOYA 1GMRA 2JDIH 3DGNA 2ZDJA 2CFLA 3F8HA 4KFEA 4NREA 3FGYA 2GBXB 1BIRA 3GSPA 4BL3A 3X3YA 2PZVA 3NM2A 5BIRA 1GOUA 2YX9A 2RCDA 3G16A 8CHOA 2Z7AA 5BXQA 4HM0B 5CK6A 2F86B 3MSOA 4N6MA 1JB2A 3SVAA 3NQYA 3G4S3 1X1XA 3AMOB 4HAAA 1T5YA 3LZAA 4EV2A 1KQS2 1BNSA 2UX0A 2HMNB 2ZL8A 3H51A 1NNVA 2HMKB 4G1MB 5IG4A 3G6E3 3CC43 3KE7A 5KP3A 1BUJA 2CHCA 3DZLA 4FMBA 4U13A 3LYGA 3HI7A 1IVXA 1W6GA 2C4BA 2GEYA 1N5PA 3O8YA 2KRTA 3VGNA 3PGBA 2BNGA 2CKFB 4FMAA 3G8ZA 1DETA 2ZHXB 3WMDA 2BIRA 2P05A 1WTHA 4RNTA 1YHQ3 3AGNA 2FGTA 1BNIA 4HJLB 3S27A 1BRSA 3CU3A 1PY3A 1IQ8A 1I0VA 3Q1CA 1E97A 3L0RA 4MJDA 4OK0A 3I0YA 1YIT3 1M1K4 3NUVA 3TDGA 3GRDA 2UGIA 3LOYA 2AAEA 1IV7A 2XSHB 1A2KA 3T8NA 3FZWA 1ZO2A 1GD4A 1TUHA 3ECFA 1YIJ3 3GWRA 2K0MA 3MKIA 2JQ5A 1DVCA 1NJI4 3G0KA 1GYBA 3LTBA 3EB8A 3JVCA 1JV2B 4PEJA 1L5GB 2Z77A 3URPA 3OX9A 1K41A 1I2GA 1B3SA 4FMCA 3DXOA 4IIAA 1VZZA 1O7MB 1EKMA 1RGCA 1BRGA 2Q07A 3PYJA 1CYUA 5CLKA 3CNMA 1U5OA 3K7CA 3N9HA 1BRNL 1ASKA 1I8VA 3EN8A 3MG3A 1G96A 2V1LA 1STDA 2F56A 2E2UA 5AIHA 2H0GA 1GS3A 5AYRB 4XBXA 2CFWA 4BIRA 3G713 1VQL3 1WMPA 2UUGC 1EEJA 4Q53A 1F8NA 2R4IA 5CXOA 1JKGB 4R9LA 1DYUA 1I3FA 1UI7A 3NHXA 4R1KA 1N8R4 1VQQA 4CPKA 2RNTA 3KSED 2IUJA 4H61A 4WYKB 2H0HA 1BRIA 1UCKA 2KF5A 1A67A 3GAXA 3LTAA 5G1KA 2FNQA 3GZRA 4LGQA 5FW5A 1W2B2 5TGNA 3SX1A 1LOXA 4LYLB 4FCJA 1N9EA 2ML6A 4J5GA 1MWRA 4I4KA 1HYFA 4K61A 4XB5A 1K9M4 1JRQA 3RGRA 1UDII 4OVMA 3CCJ3 1RGHA 3EX9A 4AKYA 1BSCA 2Y74A 1D6ZA 4BL2A 1IQXA 1OF5A 3F9SA 1CEWI 3IMAB 4O02B 1OACA 3MWZA 1AVKA 2KAAA 1I2EA 1MWSA 3T0UA 2RGQA 1FUWA 2IY2A 1W4NA 3V99A 1BNFA 1G02A 1JKGA 1TJDA 3EC9A 2XGLA 3BIRA 1RLSA 1ULIB 2Z76A 3GZYB 4BTXA 5AI1A 3CMA3 5M1AA 3ZG5A 5ELUA 3NXJA 2HMOB 5M19A 3CCQ3 2OQEC 1JB4A 4WYKA 1N9JA 4HM7B 1JZOA 3HK4A 1DMQA 1QMAA 1ROAA 4N6TA 4O3VA 2QA43 1BSDA 2GBWB 3NBRA 5RNTA 4EYCA 1S5AA 5BVBA 3CCM3 2CWTA 1VQ83 2W0QA 2M7OA 1GMPA 2W9PA 1JBSA 4RNZA 5AIFA 1OH0A 3WODG 1TFKA 3ZFZA 3J7Yd 1I70A 1UCLA 4L8OA 3ZG0A 3D79A 5GSPA 4JF8A 1EG9B 3KCHA 4H3UA 1FUSA 3EBTA 3BU4A
chains in the Genus database with same CATH topology
1B2MA 1BUJA 2SARA 1T2HA 2KF6A 1BNRA 1BNEA 1R4YA 8RNTA 2C4BA 2AADA 1RDSA 1B2XA 1FYSA 1JBTA 2RBIA 3DGYA 1DETA 2BIRA 4RNTA 3AGNA 1FW7A 1BNIA 1RTUA 4BU4A 1BRSA 4HOHA 1AY7A 1FZUA 1PY3A 2BU4A 1I0VA 3AHWA 1RGFA 1LOWA 3AHSA 1B21A 1YNVX 1RN4A 1X1UA 2AAEA 5HOHA 2F5WA 1YGWA 1DE3A 2GSPA 1BANA 3WHOA 1ZGXA 1X1WA 1BRHA 1RCLA 1I0XA 3URPA 1X1YA 1BGSA 1B2SA 1I2GA 1B3SA 1T2IA 1BRKA 1BRGA 1LOVA 1RGCA 1TRQA 3RNTA 1RN1A 1BSAA 1BRNL 1BSBA 1I8VA 2F56A 1B2UA 1GMQA 1LRAA 1CH0A 4BIRA 1TRPA 1HZ1A 3A5EA 1JBRA 3DH2A 1I3FA 2ZA4A 1BRJA 3D5IA 2RNTA 3SYUA 1RCKA 1B20A 3Q3FA 3WR2A 1BRIA 1UCKA 1I3IA 2KF5A 1BNJA 1BOXA 1B2ZA 1BVIA 1BAOA 1RGLA 6RNTA 1UCIA 5BU4A 4J5GA 1LNIA 1HYFA 1IYYA 2F5MA 1BSEA 1RGHA 1A2PA 1BSCA 1PYLA 1SARA 2F4YA 7GSPA 1TTOA 1RGKA 2KAAA 7RNTA 3HOHA 1I2EA 1B27A 2KF4A 1MGWA 1RHLA 9RNTA 1BNFA 1G02A 1RNTA 1UCJA 3BIRA 1RLSA 1GOVA 1LOYA 1GMRA 1RGAA 4GSPA 2KF3A 2HOHA 1RGGA 1RSNA 4GHOA 3D5GA 3AGOA 4J5KA 1BIRA 3D4AA 3GSPA 1GSPA 1BSDA 5BIRA 1GOUA 1MGRA 5RNTA 1RGEA 1YVSA 6GSPA 1FUTA 1I2FA 1C54A 1Q9EA 1GMPA 1JBSA 1BU4A 1X1XA 1AQZA 4HAAA 1I70A 1UCLA 1RNBA 1BNGA 1BNSA 5GSPA 1RMSA 1GOYA 3KCHA 1FUSA 3BU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2M A;  1BUJ A;  2SAR A;  1T2H A;  2KF6 A;  1BNR A;  1BNE A;  1R4Y A;  8RNT A;  2C4B A;  2AAD A;  1RDS A;  1B2X A;  1FYS A;  1JBT A;  2RBI A;  3DGY A;  1DET A;  2BIR A;  4RNT A;  3AGN A;  1FW7 A;  1BNI A;  1RTU A;  4BU4 A;  1BRS A;  4HOH A;  1AY7 A;  1FZU A;  1PY3 A;  2BU4 A;  1I0V A;  3AHW A;  1RGF A;  1LOW A;  3AHS A;  1B21 A;  1YNV X;  1RN4 A;  1X1U A;  2AAE A;  5HOH A;  2F5W A;  1YGW A;  1DE3 A;  2GSP A;  1BAN A;  3WHO A;  1ZGX A;  1X1W A;  1BRH A;  1RCL A;  1I0X A;  3URP A;  1X1Y A;  1BGS A;  1B2S A;  1I2G A;  1B3S A;  1T2I A;  1BRK A;  1BRG A;  1LOV A;  1RGC A;  1TRQ A;  3RNT A;  1RN1 A;  1BSA A;  1BRN L;  1BSB A;  1I8V A;  2F56 A;  1B2U A;  1GMQ A;  1LRA A;  1CH0 A;  4BIR A;  1TRP A;  1HZ1 A;  3A5E A;  1JBR A;  3DH2 A;  1I3F A;  2ZA4 A;  1BRJ A;  3D5I A;  2RNT A;  3SYU A;  1RCK A;  1B20 A;  3Q3F A;  3WR2 A;  1BRI A;  1UCK A;  1I3I A;  2KF5 A;  1BNJ A;  1BOX A;  1B2Z A;  1BVI A;  1BAO A;  1RGL A;  6RNT A;  1UCI A;  5BU4 A;  4J5G A;  1LNI A;  1HYF A;  1IYY A;  2F5M A;  1BSE A;  1RGH A;  1A2P A;  1BSC A;  1PYL A;  1SAR A;  2F4Y A;  7GSP A;  1TTO A;  1RGK A;  2KAA A;  7RNT A;  3HOH A;  1I2E A;  1B27 A;  2KF4 A;  1MGW A;  1RHL A;  9RNT A;  1BNF A;  1G02 A;  1RNT A;  1UCJ A;  3BIR A;  1RLS A;  1GOV A;  1LOY A;  1GMR A;  1RGA A;  4GSP A;  2KF3 A;  2HOH A;  1RGG A;  1RSN A;  4GHO A;  3D5G A;  3AGO A;  4J5K A;  1BIR A;  3D4A A;  3GSP A;  1GSP A;  1BSD A;  5BIR A;  1GOU A;  1MGR A;  5RNT A;  1RGE A;  1YVS A;  6GSP A;  1FUT A;  1I2F A;  1C54 A;  1Q9E A;  1GMP A;  1JBS A;  1BU4 A;  1X1X A;  1AQZ A;  4HAA A;  1I70 A;  1UCL A;  1RNB A;  1BNG A;  1BNS A;  5GSP A;  1RMS A;  1GOY A;  3KCH A;  1FUS A;  3BU4 A; 
#chains in the Genus database with same CATH topology
 2W04 A;  3GZX B;  3X41 A;  4HM4 B;  1BNE A;  1Q86 4;  5KP1 A;  4XBY A;  1RDS A;  1NB5 I;  5EVH A;  4O2H A;  1V74 A;  4HM5 B;  1AVL A;  2RFR A;  3LTD A;  3NBJ A;  3JUO A;  5JPU A;  1QAK A;  5IW9 A;  5JPP A;  1AV4 A;  1LVN A;  2BT3 A;  1RTU A;  3CCR 3;  1A90 A;  4HOH A;  3B8L A;  1FZU A;  1GY5 A;  2CFK A;  3WOE B;  1RGF A;  1JN5 B;  3AHS A;  3EBY A;  1EQK A;  3S5C A;  3VF1 A;  4EV5 A;  4CJN A;  2CW9 A;  1X1U A;  2P0X A;  2OQE A;  1Q7Y 4;  4JRF A;  1K28 A;  3CC2 3;  3ALA A;  1IK3 A;  3B4O A;  4NHF A;  1ZGX A;  3BND A;  3WOF B;  1BRH A;  1OHP A;  2BO9 B;  3JUM A;  3OWU A;  1OHS A;  3DGL A;  4FCM A;  3LH4 A;  1BRK A;  4HZ9 B;  5FGO A;  4OUQ A;  3VSY A;  3M8C A;  1Q40 B;  2HMM B;  5AYS C;  3SOA A;  4R4K A;  1B2U A;  2A15 A;  1LRA A;  1M1X B;  1QAF A;  4R80 A;  5DRE A;  5M18 A;  1A2V A;  1IVU A;  1JN5 A;  1HZ1 A;  3HIG A;  3I56 3;  4N6O B;  2L1S A;  1MWT A;  3CCS 3;  5JBS A;  4NPB A;  1YGE A;  2STD A;  2B1X B;  3X40 A;  3OWY A;  3KKG A;  3AMO A;  2GEX A;  7STD A;  3FF2 A;  3EF8 A;  3NQZ A;  1K73 4;  1RCK A;  1LXE A;  5D83 A;  2OWP A;  5G2G A;  1I3I A;  4EBG A;  1B2Z A;  2XSO B;  4WFO A;  1NWW A;  1GY6 A;  5KP4 A;  4GSP A;  3DGO A;  4MMZ B;  3KSP A;  3SXX A;  4LZI A;  3V98 A;  1VQ9 3;  3EJV A;  3F14 A;  2CWU A;  2YFL B;  3EN1 B;  3IPT A;  1PYL A;  3K9M C;  5D81 A;  1YVB I;  2D1W A;  1RRL A;  4AEQ A;  3OW2 2;  1TP6 A;  2IMJ A;  4K1V A;  3CCE 3;  1HU9 A;  1UGI A;  2CWV A;  1YJ9 3;  1W00 A;  3F8X A;  3NX0 A;  2KF4 A;  1MGW A;  1RHL A;  3S67 A;  5AEW B;  9RNT A;  2P38 A;  2MC8 A;  4N3V A;  1CQS A;  1RNT A;  4XM4 A;  1VQK 3;  3ER7 A;  3KII A;  3CPO A;  5EQL A;  1O7N B;  5IEP A;  2CFD A;  3A76 A;  3HZP A;  2KF3 A;  4HZB B;  5DRV A;  3DGM A;  1RJO A;  4WWU C;  3D4A A;  3FG1 A;  2QGU A;  3NBB A;  1GSP A;  3FF0 A;  4HVN A;  1OCV A;  1RGE A;  1TU5 A;  3CCL 3;  4BTW A;  1FUT A;  1I2F A;  3EE1 A;  3WA2 X;  1QVF 2;  2RSX A;  1Q9E A;  3F7S A;  1JB5 A;  1AQZ A;  2OOV C;  2R41 A;  4MMX B;  2WGO A;  3F40 A;  3SOY A;  3QRD A;  1RNB A;  2OTJ 3;  1N8Q A;  1V58 A;  1SII A;  1GOY A;  3JUN A;  1OUN A;  4O8S A;  3KN4 A;  4FR9 A;  4J9A A;  2O9U X;  2W03 A;  3BNC A;  3E99 A;  3MHE A;  1T2H A;  1BNR A;  1W2Z A;  5LC7 A;  1BUQ A;  1R4Y A;  4GB5 A;  1UI8 A;  1GD3 A;  1VQM 3;  2XEP A;  2CC3 A;  3FKA A;  1JBT A;  4HM3 B;  2CFG A;  1MWU A;  2RBI A;  2H0I A;  5IG3 A;  1AY7 A;  1EA2 A;  1FGO A;  2BU4 A;  2IYJ A;  3AHW A;  1WNH A;  1O7G B;  3JUQ A;  3MG2 A;  3UB1 A;  1LOW A;  1Q7H A;  2OCT A;  3CD6 3;  1YNV X;  2I9W A;  2BMR B;  1W01 A;  1N5H A;  3BNE A;  5HOH A;  2F5W A;  1RRH A;  1YGW A;  1SIH A;  1RN7 A;  4I5Q A;  2GSP A;  3SED A;  3HX8 A;  1DE3 A;  1HKX A;  3PZW A;  4CDL A;  3WHO A;  5IF6 A;  2BMQ B;  3FLJ A;  4HBR A;  4XDV A;  2ML5 A;  1ULJ B;  1GY7 A;  1NU3 A;  1W02 A;  2XF3 A;  1TIJ A;  2SBL A;  1ZX2 A;  1BGS A;  1W6C A;  1EUI C;  3DMC A;  5AIG A;  3FCS B;  5D82 A;  3BLZ A;  2OOV A;  3RNT A;  4HYZ A;  1YJN 3;  1BSA A;  4BTY A;  4STD A;  2LYX A;  4KFF A;  2XGN A;  4LSO A;  2J8X B;  2F99 A;  3N54 B;  1FA3 A;  3FG3 A;  1GMQ A;  4RBN A;  4WP5 A;  1JJ2 2;  1LNH A;  3OV4 A;  4KZ1 A;  3A5E A;  1VQO 3;  1Q82 4;  3STD A;  1DMM A;  1E3V A;  2YFI B;  4X2H A;  3DH2 A;  4DKI A;  2ZA4 A;  1IV9 A;  4HM1 B;  2XFT A;  1BRJ A;  4XBT A;  1VQ6 3;  3U1W A;  3D5I A;  2OTL 3;  4KVH A;  3S28 A;  3CCU 3;  1IVV A;  1LQM B;  1M90 4;  1B20 A;  2P09 A;  3Q3F A;  4GL6 A;  2XFS A;  1Q42 A;  2WGQ A;  1J2B A;  3HII A;  1BVI A;  1BAO A;  4N6L A;  3X3X A;  4QWT A;  1UCI A;  3NV0 B;  3ROB A;  3CNX A;  1LNI A;  2P0M A;  4J8T A;  1WMO A;  1FGQ A;  3K5T A;  3CXC 2;  1BSE A;  1S72 3;  2GU1 A;  2W2C A;  3K63 A;  4EC6 A;  3LXU X;  3U97 A;  3PCR A;  2F4Y A;  7GSP A;  2K3D A;  1FGM A;  3T8U A;  2C11 A;  2INX A;  1RGK A;  7RNT A;  1OGZ A;  3B7C A;  3N8B A;  2W56 B;  1RKY A;  5EEO A;  4R9K A;  1YJW 3;  3OWS A;  1UCJ A;  1Q81 4;  3B4P A;  1KWI A;  1MNL A;  3FH1 A;  4MEI A;  1GOV A;  1NO3 A;  4ILF A;  3RGA A;  3UJM A;  1RGA A;  3Q2P A;  1QAL A;  1STF I;  2CX0 A;  2HOH A;  1RGG A;  1NB3 I;  1RSN A;  2W6J H;  3D5G A;  4GHO A;  1M9G A;  4L7K A;  1W5Z A;  3AGO A;  4MMY B;  3CCV 3;  1VQ4 3;  4J5K A;  1VQ5 3;  1T3B A;  1KSI A;  2XH9 A;  4AKZ A;  3D3L A;  1MGR A;  3WA3 A;  1YVS A;  2B24 B;  1FGT A;  1UUW B;  2C10 A;  3NV0 A;  4K90 B;  6GSP A;  3KZT A;  4HM2 B;  3CME 3;  1C54 A;  3MPH A;  1UUV B;  1MOL A;  1VQ7 3;  3PXM A;  1Q40 A;  2CG0 A;  4TX4 A;  2D42 A;  1BU4 A;  3LML A;  4HKV B;  1Z1S A;  2XR8 B;  3D9R A;  5AII A;  1O7W B;  1W7C A;  1BNG A;  1RMS A;  2LQV A;  3SLU A;  3F7X A;  1R4C A;  4ORL A;  4KT3 B;  1B2M A;  2SAR A;  2W56 A;  3LT8 A;  5IEO A;  1LQG C;  1WMN A;  2KF6 A;  1YI2 3;  8RNT A;  1VQP 3;  2AAD A;  3LT9 A;  2CH9 A;  4HM6 B;  2QIY A;  2WOF A;  4IT7 A;  4L8P A;  4RZM A;  1B2X A;  1FYS A;  1UW1 A;  2Z6B A;  5I97 A;  1IQY A;  2WOH A;  3DGY A;  3IJE B;  4WHA A;  2QEX 3;  1FW7 A;  2CG1 A;  1C7H A;  1OF5 B;  4BU4 A;  4N6U A;  1DVD A;  1OGX A;  3UL6 A;  1OHO A;  3S29 A;  2YFJ B;  1DMN A;  4LEH A;  5CF2 A;  1B21 A;  1JNQ A;  1U8C B;  2WO0 A;  3QK9 A;  2F98 A;  1RN4 A;  4RNY A;  4KFD A;  5STD A;  1JZD A;  2MF7 A;  4X2O A;  4ZM8 A;  1PFP A;  4IPB A;  1NDO B;  2E2V A;  1D6U A;  4HM8 B;  1BAN A;  1UUG B;  1US1 A;  2GU3 A;  5IG0 A;  5CF1 A;  1QVG 2;  1SJW A;  1KD1 4;  1X1W A;  2O3O A;  1RCL A;  1IT8 A;  1IVW A;  3DUK A;  1I0X A;  4LMI A;  1X1Y A;  1B2S A;  1T2I A;  1UGH I;  2KXG A;  4CCV A;  3JUP A;  2KCD A;  1LOV A;  2W9Q A;  1TRQ A;  3BB9 A;  1RN1 A;  2BHM A;  5IER A;  1ROV A;  1BSB A;  2CX1 A;  5AEU B;  2IUK A;  1PU4 A;  1Y4K A;  3EHC A;  1CH0 A;  3RDE A;  2BMO B;  1CYV A;  1TRP A;  3H3H A;  1D6Y A;  3X3Z A;  2Y73 A;  3DY5 A;  5G1L A;  1JBR A;  3WDG B;  1E3R A;  1QJG A;  1ZS7 A;  3PCS A;  2HML B;  3PS8 A;  3OXA A;  3FG4 A;  4FCZ A;  1SQW A;  3DM8 A;  4EXR A;  3X42 A;  5A0O B;  3LTC A;  1G0T A;  3MYT A;  4XDW A;  5LC6 A;  2PNC A;  3SYU A;  3V92 A;  2FXT A;  3WR2 A;  5IG5 A;  3CPW 2;  1O7P B;  4N6V 0;  1AR0 A;  1BNJ A;  1BOX A;  1W6Y A;  3UL5 A;  1K8A 4;  6RNT A;  1RGL A;  2CK3 H;  2L4V A;  5HGR A;  5BU4 A;  1V57 A;  1KC8 4;  1VQN 3;  1SPU A;  1IYY A;  2CIU A;  2F5M A;  4FMD A;  6STD A;  1A2P A;  1FGR A;  1IU7 A;  1SAR A;  2K54 A;  3Q90 A;  4N6N B;  1ISK A;  1TTO A;  2E2T A;  3GZB A;  3EQQ B;  3FSD A;  3I55 3;  1O7H B;  3MG1 A;  2GXF A;  3HOH A;  1B27 A;  3K0Z A;  3UNL A;  3KFQ C;  2IA7 A;  4K1U A;  5ELJ A;  5IEN A;  3NM7 A;  1IT7 A;  4EW5 A;  2XRX B;  1OPY A;  2HMJ B;  3CC7 3;  1IDP A;  3BNB A;  1TFO A;  1WQL B;  1LOY A;  1GMR A;  2JDI H;  3DGN A;  2ZDJ A;  2CFL A;  3F8H A;  4KFE A;  4NRE A;  3FGY A;  2GBX B;  1BIR A;  3GSP A;  4BL3 A;  3X3Y A;  2PZV A;  3NM2 A;  5BIR A;  1GOU A;  2YX9 A;  2RCD A;  3G16 A;  8CHO A;  2Z7A A;  5BXQ A;  4HM0 B;  5CK6 A;  2F86 B;  3MSO A;  4N6M A;  1JB2 A;  3SVA A;  3NQY A;  3G4S 3;  1X1X A;  3AMO B;  4HAA A;  1T5Y A;  3LZA A;  4EV2 A;  1KQS 2;  1BNS A;  2UX0 A;  2HMN B;  2ZL8 A;  3H51 A;  1NNV A;  2HMK B;  4G1M B;  5IG4 A;  3G6E 3;  3CC4 3;  3KE7 A;  5KP3 A;  1BUJ A;  2CHC A;  3DZL A;  4FMB A;  4U13 A;  3LYG A;  3HI7 A;  1IVX A;  1W6G A;  2C4B A;  2GEY A;  1N5P A;  3O8Y A;  2KRT A;  3VGN A;  3PGB A;  2BNG A;  2CKF B;  4FMA A;  3G8Z A;  1DET A;  2ZHX B;  3WMD A;  2BIR A;  2P05 A;  1WTH A;  4RNT A;  1YHQ 3;  3AGN A;  2FGT A;  1BNI A;  4HJL B;  3S27 A;  1BRS A;  3CU3 A;  1PY3 A;  1IQ8 A;  1I0V A;  3Q1C A;  1E97 A;  3L0R A;  4MJD A;  4OK0 A;  3I0Y A;  1YIT 3;  1M1K 4;  3NUV A;  3TDG A;  3GRD A;  2UGI A;  3LOY A;  2AAE A;  1IV7 A;  2XSH B;  1A2K A;  3T8N A;  3FZW A;  1ZO2 A;  1GD4 A;  1TUH A;  3ECF A;  1YIJ 3;  3GWR A;  2K0M A;  3MKI A;  2JQ5 A;  1DVC A;  1NJI 4;  3G0K A;  1GYB A;  3LTB A;  3EB8 A;  3JVC A;  1JV2 B;  4PEJ A;  1L5G B;  2Z77 A;  3URP A;  3OX9 A;  1K41 A;  1I2G A;  1B3S A;  4FMC A;  3DXO A;  4IIA A;  1VZZ A;  1O7M B;  1EKM A;  1RGC A;  1BRG A;  2Q07 A;  3PYJ A;  1CYU A;  5CLK A;  3CNM A;  1U5O A;  3K7C A;  3N9H A;  1BRN L;  1ASK A;  1I8V A;  3EN8 A;  3MG3 A;  1G96 A;  2V1L A;  1STD A;  2F56 A;  2E2U A;  5AIH A;  2H0G A;  1GS3 A;  5AYR B;  4XBX A;  2CFW A;  4BIR A;  3G71 3;  1VQL 3;  1WMP A;  2UUG C;  1EEJ A;  4Q53 A;  1F8N A;  2R4I A;  5CXO A;  1JKG B;  4R9L A;  1DYU A;  1I3F A;  1UI7 A;  3NHX A;  4R1K A;  1N8R 4;  1VQQ A;  4CPK A;  2RNT A;  3KSE D;  2IUJ A;  4H61 A;  4WYK B;  2H0H A;  1BRI A;  1UCK A;  2KF5 A;  1A67 A;  3GAX A;  3LTA A;  5G1K A;  2FNQ A;  3GZR A;  4LGQ A;  5FW5 A;  1W2B 2;  5TGN A;  3SX1 A;  1LOX A;  4LYL B;  4FCJ A;  1N9E A;  2ML6 A;  4J5G A;  1MWR A;  4I4K A;  1HYF A;  4K61 A;  4XB5 A;  1K9M 4;  1JRQ A;  3RGR A;  1UDI I;  4OVM A;  3CCJ 3;  1RGH A;  3EX9 A;  4AKY A;  1BSC A;  2Y74 A;  1D6Z A;  4BL2 A;  1IQX A;  1OF5 A;  3F9S A;  1CEW I;  3IMA B;  4O02 B;  1OAC A;  3MWZ A;  1AVK A;  2KAA A;  1I2E A;  1MWS A;  3T0U A;  2RGQ A;  1FUW A;  2IY2 A;  1W4N A;  3V99 A;  1BNF A;  1G02 A;  1JKG A;  1TJD A;  3EC9 A;  2XGL A;  3BIR A;  1RLS A;  1ULI B;  2Z76 A;  3GZY B;  4BTX A;  5AI1 A;  3CMA 3;  5M1A A;  3ZG5 A;  5ELU A;  3NXJ A;  2HMO B;  5M19 A;  3CCQ 3;  2OQE C;  1JB4 A;  4WYK A;  1N9J A;  4HM7 B;  1JZO A;  3HK4 A;  1DMQ A;  1QMA A;  1ROA A;  4N6T A;  4O3V A;  2QA4 3;  1BSD A;  2GBW B;  3NBR A;  5RNT A;  4EYC A;  1S5A A;  5BVB A;  3CCM 3;  2CWT A;  1VQ8 3;  2W0Q A;  2M7O A;  1GMP A;  2W9P A;  1JBS A;  4RNZ A;  5AIF A;  1OH0 A;  3WOD G;  1TFK A;  3ZFZ A;  3J7Y d;  1I70 A;  1UCL A;  4L8O A;  3ZG0 A;  3D79 A;  5GSP A;  4JF8 A;  1EG9 B;  3KCH A;  4H3U A;  1FUS A;  3EBT A;  3BU4 A; 
#chains in the Genus database with same CATH homology
 1B2M A;  1BUJ A;  2SAR A;  1T2H A;  2KF6 A;  1BNR A;  1BNE A;  1R4Y A;  8RNT A;  2C4B A;  2AAD A;  1RDS A;  1B2X A;  1FYS A;  1JBT A;  2RBI A;  3DGY A;  1DET A;  2BIR A;  4RNT A;  3AGN A;  1FW7 A;  1BNI A;  1RTU A;  4BU4 A;  1BRS A;  4HOH A;  1AY7 A;  1FZU A;  1PY3 A;  2BU4 A;  1I0V A;  3AHW A;  1RGF A;  1LOW A;  3AHS A;  1B21 A;  1YNV X;  1RN4 A;  1X1U A;  2AAE A;  5HOH A;  2F5W A;  1YGW A;  1DE3 A;  2GSP A;  1BAN A;  3WHO A;  1ZGX A;  1X1W A;  1BRH A;  1RCL A;  1I0X A;  3URP A;  1X1Y A;  1BGS A;  1B2S A;  1I2G A;  1B3S A;  1T2I A;  1BRK A;  1BRG A;  1LOV A;  1RGC A;  1TRQ A;  3RNT A;  1RN1 A;  1BSA A;  1BRN L;  1BSB A;  1I8V A;  2F56 A;  1B2U A;  1GMQ A;  1LRA A;  1CH0 A;  4BIR A;  1TRP A;  1HZ1 A;  3A5E A;  1JBR A;  3DH2 A;  1I3F A;  2ZA4 A;  1BRJ A;  3D5I A;  2RNT A;  3SYU A;  1RCK A;  1B20 A;  3Q3F A;  3WR2 A;  1BRI A;  1UCK A;  1I3I A;  2KF5 A;  1BNJ A;  1BOX A;  1B2Z A;  1BVI A;  1BAO A;  1RGL A;  6RNT A;  1UCI A;  5BU4 A;  4J5G A;  1LNI A;  1HYF A;  1IYY A;  2F5M A;  1BSE A;  1RGH A;  1A2P A;  1BSC A;  1PYL A;  1SAR A;  2F4Y A;  7GSP A;  1TTO A;  1RGK A;  2KAA A;  7RNT A;  3HOH A;  1I2E A;  1B27 A;  2KF4 A;  1MGW A;  1RHL A;  9RNT A;  1BNF A;  1G02 A;  1RNT A;  1UCJ A;  3BIR A;  1RLS A;  1GOV A;  1LOY A;  1GMR A;  1RGA A;  4GSP A;  2KF3 A;  2HOH A;  1RGG A;  1RSN A;  4GHO A;  3D5G A;  3AGO A;  4J5K A;  1BIR A;  3D4A A;  3GSP A;  1GSP A;  1BSD A;  5BIR A;  1GOU A;  1MGR A;  5RNT A;  1RGE A;  1YVS A;  6GSP A;  1FUT A;  1I2F A;  1C54 A;  1Q9E A;  1GMP A;  1JBS A;  1BU4 A;  1X1X A;  1AQZ A;  4HAA A;  1I70 A;  1UCL A;  1RNB A;  1BNG A;  1BNS A;  5GSP A;  1RMS A;  1GOY A;  3KCH A;  1FUS A;  3BU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...