1B2XA

Barnase wildtype structure at ph 7.5 from a cryo_cooled crystal at 100k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2xA00
1CH0A 1FYSA 1BNFA 1DE3A 1BUJA 1AQZA 1BNEA 1SARA 2KF5A 1BRKA 4BIRA 1BGSA 2AAEA 1RGEA 1BOXA 3BIRA 1BU4A 2KAAA 3D4AA 1I0XA 1Q9EA 1GOYA 1I3IA 3Q3FA 3HOHA 1T2HA 1A2PA 2AADA 1TRPA 5RNTA 1GMQA 1LRAA 2RNTA 4RNTA 9RNTA 1BIRA 1ZGXA 1BNRA 1BSAA 1JBTA 1GOUA 1RGAA 1DETA 3AGNA 1IYYA 1R4YA 1I2EA 1RHLA 7GSPA 1LNIA 1UCLA 1BSDA 6GSPA 1BSCA 1BNJA 1BAOA 1LOWA 1B20A 1UCIA 1B2UA 1RTUA 1RGCA 5GSPA 1I3FA 2RBIA 1BNSA 1RGGA 1YVSA 1I2FA 1PYLA 1RGLA 1X1XA 5BIRA 1BSBA 4J5GA 1BRJA 1FUSA 3WHOA 1RSNA 1I2GA 1JBRA 1B2ZA 2BU4A 5HOHA 3WR2A 1FW7A 1BANA 1B2XA 2KF6A 1BNIA 1RN4A 1BRGA 1MGWA 1YNVX 1B2SA 3D5GA 3KCHA 1GMPA 2BIRA 1G02A 4HOHA 4HAAA 3URPA 1FUTA 5BU4A 1B3SA 1TTOA 1TRQA 1UCJA 1B27A 1RCKA 1RDSA 3BU4A 4J5KA 1RCLA 1RNBA 1I8VA 1GMRA 1BRIA 1MGRA 6RNTA 1RNTA 3D5IA 2GSPA 2KF3A 2F56A 1I70A 1RN1A 1X1YA 1FZUA 1HYFA 2KF4A 1BRNL 1YGWA 1X1WA 1HZ1A 1T2IA 2SARA 2HOHA 1AY7A 1BNGA 1BVIA 1RGKA 3A5EA 1B2MA 3GSPA 4GHOA 4GSPA 1B21A 1C54A 1RLSA 3SYUA 2F5MA 3AHSA 1LOVA 1GOVA 1RGHA 8RNTA 1BRSA 3RNTA 1BRHA 3DGYA 3AGOA 1BSEA 7RNTA 2C4BA 1GSPA 2F4YA 3AHWA 2F5WA 1RGFA 1RMSA 1UCKA 2ZA4A 1X1UA 4BU4A 1JBSA 1PY3A 1I0VA 1LOYA 3DH2A
chains in the Genus database with same CATH superfamily
1FYSA 4X2HA 1AQZA 1BNEA 2OOVA 3JUMA 1SARA 4RNYA 3PZWA 3S28A 1FGMA 2IUJA 1Y4KA 1E3VA 2P09A 3LTBA 4EV5A 5IERA 1OGZA 2OOVC 1Q824 4O8SA 4BTYA 3CCL3 4I4KA 4FMAA 1I0XA 5IEOA 4CCVA 3Q3FA 2WOHA 4BTWA 2GU3A 3WMDA 3Q90A 3OWSA 1OPYA 2XSHB 1RRHA 3F8XA 3NQYA 3WOEB 4AKZA 2RNTA 2CWVA 4CPKA 4L8OA 5IF6A 1JBTA 1MOLA 3E99A 1RGAA 1W00A 1DETA 3CME3 1R4YA 4HM5B 1I2EA 1UI7A 3EF8A 3F9SA 1RN7A 1UCLA 5D83A 5CF2A 1BSDA 1DYUA 6GSPA 1BNJA 4OVMA 1UUWB 2KXGA 2B24B 2CIUA 1B20A 1IT7A 4MEIA 2GEYA 3MG3A 1RGCA 1N9JA 3F8HA 2RBIA 3HI7A 4FR9A 1JV2B 1UGHI 5AI1A 1SJWA 3LOYA 4G1MB 2RSXA 4N6V0 3BNBA 1PFPA 4WYKB 3WHOA 1JKGB 3FF2A 3JVCA 1US1A 3NBJA 3B8LA 3OX9A 4H61A 4MMXB 3D3LA 4QWTA 3FCSB 4WHAA 3ROBA 1VQO3 1BANA 1QVG2 1M1XB 4FCJA 1DMNA 5IG0A 3WDGB 3CCV3 1GY6A 4HM4B 1IVWA 3NHXA 1N8QA 3EBYA 2L4VA 3LXUX 2YFJB 3BLZA 3KZTA 3MHEA 4FMDA 2K0MA 2YFLB 1K41A 4AKYA 2LQVA 4HAAA 3UL5A 1W2ZA 1U8CB 3O8YA 2CX1A 4R80A 1RCLA 2P0MA 1IVUA 1RRLA 3NM7A 1OUNA 1STDA 1C7HA 2KF3A 3JUNA 5EQLA 5FGOA 2R41A 3CCM3 2QEX3 1CEWI 2CG1A 2F56A 7STDA 2XFSA 3FG4A 1TJDA 3K9MC 1FZUA 3M8CA 3T0UA 1KSIA 3DGMA 2W56A 3EN8A 5A0OB 5IEPA 4LMIA 2SARA 2HOHA 4IIAA 2BT3A 3BNDA 3EN1B 1MWSA 3FG3A 1BNGA 2K3DA 3A5EA 5EEOA 3G713 1IVXA 1W6CA 4GHOA 1VQ83 2XR8B 2QIYA 3NQZA 4GSPA 1B21A 4HJLB 4XB5A 2QGUA 2ML6A 3SVAA 3IJEB 4PEJA 1MWTA 5G1LA 4K1UA 4LEHA 1RGHA 1IQXA 3U1WA 8RNTA 1NNVA 1CYVA 2M7OA 4XDWA 2F5WA 1NDOB 3QRDA 2D1WA 1WMPA 1KC84 1N9EA 5IG4A 3AMOB 3SX1A 1JBSA 2OWPA 1UGIA 3DXOA 2PNCA 2Z7AA 3DMCA 4HYZA 3LZAA 3IPTA 4WP5A 5IENA 2P38A 2CH9A 1A67A 4BIRA 3DGNA 1UI8A 1ZO2A 3PCRA 3ZG0A 1BU4A 1WQLB 3S29A 1Q864 4R9KA 2KAAA 2Z6BA 1HKXA 3OXAA 1Q9EA 1GOYA 3RGAA 1ULIB 3LTCA 2GBXB 5RNTA 3JUOA 5M19A 1GMQA 1LRAA 3HX8A 4RNTA 3GAXA 1K8A4 1BNRA 3EB8A 1BSAA 1FUWA 1GOUA 3LTDA 3CCU3 1YGEA 3CU3A 7GSPA 1LNIA 1FGRA 2BO9B 3LT8A 4IT7A 4OK0A 3GZYB 3SXXA 1O7GB 3BNEA 3K5TA 1LOWA 1SQWA 3TDGA 4XBYA 2XH9A 1B2UA 3FLJA 4BL2A 4RZMA 1I3FA 1V74A 1Z1SA 4LSOA 1ZS7A 4WWUC 1PYLA 1X1XA 3Q1CA 3F40A 3VF1A 1BRJA 1LVNA 1OHOA 3H51A 1OF5B 4CJNA 2OTL3 3NV0A 1I2GA 2ZHXB 1JBRA 2WOFA 5CLKA 1JRQA 2HMOB 4N6MA 1W01A 3GRDA 2IA7A 4N6UA 3CNXA 1OACA 3DGLA 5CF1A 1YVBI 1VQN3 4J9AA 2RGQA 2KF6A 3Q2PA 4O2HA 3J7Yd 1BNIA 1GY7A 1BRGA 2P0XA 2STDA 3LH4A 1IVVA 3KCHA 4HM2B 2GEXA 2CFKA 3ALAA 1AVKA 1W02A 1GMPA 4K61A 1J2BA 2CFDA 4HOHA 1STFI 4EYCA 2CFLA 3URPA 1TP6A 1UDII 2KCDA 3PXMA 4MJDA 1UCJA 3I563 4J5KA 2INXA 3BU4A 1RNBA 1LNHA 2OTJ3 1GMRA 3DM8A 1BRIA 3NBBA 6RNTA 1RNTA 4ORLA 3D5IA 3FKAA 2GSPA 4HM0B 3X41A 3CC23 4XBXA 2F99A 2D42A 1RN1A 3V99A 2E2UA 1MNLA 1VQ93 3DZLA 2W56B 2CK3H 2IYJA 3PYJA 1YGWA 1GY5A 2GXFA 2Q07A 3NUVA 4XBTA 3NX0A 5ELUA 1YJN3 3EE1A 3N54B 2HMMB 3X3ZA 4GL6A 1S723 4JF8A 3X40A 1ULJB 5M18A 1AV4A 5DRVA 2IUKA 3BNCA 1RLSA 2PZVA 2XEPA 4FCZA 3HK4A 2W9QA 4N3VA 4EV2A 1BRSA 1GD4A 3FZWA 3MSOA 3DGYA 4J8TA 2Z76A 4TX4A 4RBNA 5BXQA 1QVF2 3AGOA 2OCTA 4U13A 2FGTA 3S27A 3CPW2 2C4BA 1O7WB 2F4YA 3V98A 3GZXB 4WFOA 1RGFA 2ZA4A 4BU4A 2XSOB 3D79A 5G1KA 4HKVB 1Q40A 4H3UA 3CCE3 3I0YA 3DH2A 1L5GB 1VQK3 3X42A 3CCJ3 3CCS3 2O3OA 2BHMA 3CD63 4IPBA 2BMRB 1IU7A 1EKMA 5TGNA 3B4PA 1KQS2 4HM6B 1V57A 1BRKA 3CNMA 1BGSA 2AAEA 1RGEA 3BIRA 2XFTA 1VQ43 2HMLB 3OV4A 1N5HA 1N8R4 1T3BA 1A2KA 1I3IA 2KRTA 1OCVA 1DMMA 1LQMB 1QAFA 2AADA 2A15A 2CX0A 2SBLA 3RGRA 3OW22 4DKIA 1BUQA 2E2TA 1K9M4 3K0ZA 2RFRA 1IT8A 3CC43 1SPUA 1O7NB 3G8ZA 4EW5A 3NXJA 1JB2A 1RHLA 2Z77A 1A2VA 3QK9A 4I5QA 4N6LA 4BTXA 1ISKA 1BSCA 1JB5A 4HBRA 4OUQA 1BAOA 1GYBA 2UGIA 1Q7Y4 2WGQA 2CG0A 1UCIA 3T8UA 4N6NB 1RTUA 1RKYA 1FGQA 4HM1B 4N6TA 4LYLB 3S67A 3K63A 3NV0B 1VQP3 2GU1A 4J5GA 2H0GA 1RSNA 3I553 5I97A 3JUPA 2BU4A 3X3YA 1F8NA 5HOHA 2L1SA 1VQM3 2O9UX 3WR2A 3F7SA 4EBGA 1TUHA 2C11A 1B2XA 2BMOB 1VQL3 1Q7HA 1EUIC 3B7CA 2J8XB 2XGNA 5IW9A 3ZG5A 2OQEA 3IMAB 2CHCA 1E97A 2QA43 1SIHA 1M1K4 2CC3A 1B2SA 1EG9B 1W7CA 1DVCA 3D5GA 5STDA 2GBWB 2W9PA 3SOAA 2BNGA 1D6YA 1JB4A 2OQEC 4L8PA 4N6OB 3STDA 5KP1A 1G02A 4O3VA 3SOYA 5CXOA 3F14A 3EX9A 1TTOA 1TRQA 1RCKA 2YFIB 5HGRA 1S5AA 1Q42A 3U97A 3UJMA 3EJVA 1OGXA 5IG5A 3CCQ3 4K90B 1Q814 2BMQB 1NWWA 4XM4A 5IG3A 1U5OA 3N8BA 2CKFB 1I70A 1NO3A 3CMA3 2XF3A 1X1YA 1ASKA 1HYFA 2H0IA 3KE7A 1BRNL 3UNLA 2I9WA 1X1WA 1HZ1A 4K1VA 4O02B 3AMOA 1T2IA 2P05A 3G0KA 4LGQA 3V92A 4ZM8A 1EA2A 1VQQA 2WGOA 1B2MA 1TU5A 2XGLA 2W03A 3KKGA 3NBRA 1YI23 3MWZA 2V1LA 1C54A 4Q53A 3UB1A 1WMOA 3SYUA 1JN5A 1M904 3H3HA 2F5MA 1OHPA 6STDA 5LC6A 1IQYA 1M9GA 1GOVA 3GZRA 5AIFA 1FGTA 1QAKA 4HZBB 1CQSA 3RNTA 1LQGC 1RJOA 4NPBA 4R9LA 3B4OA 1GSPA 1K734 3VSYA 5AYSC 3AHWA 1QJGA 4HM8B 2W04A 3G4S3 1VQ73 2ZDJA 1ZX2A 1NB5I 1Q40B 4FCMA 2XRXB 1W5ZA 5G2GA 5JBSA 1UUGB 5AIIA 2R4IA 2WO0A 1I0VA 1SIIA 2K54A 1BIRA 2Y74A 1NJI4 3KN4A 1CH0A 3OWUA 4L7KA 1QALA 1BNFA 1DE3A 1BUJA 2CFWA 4CDLA 4XDVA 2KF5A 4JRFA 4KFFA 1BOXA 3ER7A 2F86B 3MYTA 1IV7A 2HMJB 3PS8A 1N5PA 4GB5A 3D4AA 1KWIA 3RDEA 1A90A 4KT3B 3MG2A 3EHCA 2ZL8A 3HOHA 1T2HA 1A2PA 1QMAA 4EXRA 1W4NA 1OF5A 1YIT3 1MWUA 1TRPA 1YHQ3 5KP4A 5AYRB 3GZBA 4HZ9B 1GD3A 3SEDA 9RNTA 1ZGXA 2MF7A 3FH1A 1LXEA 2B1XB 4EC6A 3PGBA 3AGNA 5BVBA 3FF0A 1EEJA 1IYYA 1T5YA 3DGOA 1UUVB 3DY5A 4STDA 1FGOA 3DUKA 1CYUA 1K28A 3WOFB 3FGYA 1D6UA 2Y73A 4ILFA 2MC8A 3CXC2 5DREA 5D81A 3LYGA 3G6E3 1JZDA 5AIHA 1LOXA 4BL3A 4AEQA 2UX0A 2CWTA 4MMYB 5GSPA 2CFGA 1AVLA 5FW5A 3HZPA 3MPHA 1BNSA 1RGGA 1YVSA 3CC73 1I2FA 1RGLA 3LTAA 1G96A 1TFOA 3EQQB 5BIRA 1BSBA 3CPOA 1AR0A 2ML5A 3LT9A 1FUSA 4HM7B 3MG1A 4LZIA 1B2ZA 3HIIA 4WYKA 1O7PB 1JKGA 2FNQA 3MKIA 3N9HA 4FMBA 1VQ53 3X3XA 1ROAA 2W6JH 1FW7A 4X2OA 3CCR3 1FA3A 8CHOA 2HMNB 2W2CA 3KSED 2H0HA 1KD14 3EC9A 3FG1A 5D82A 1RN4A 4KFDA 1MGWA 1YNVX 3KFQC 3UL6A 1VQ63 5EVHA 3WODG 2BIRA 3SLUA 3EBTA 2FXTA 4MMZB 3OWYA 2CWUA 1IDPA 4R4KA 1DVDA 2YX9A 1DMQA 1FUTA 3KIIA 5BU4A 5CK6A 1B3SA 3GWRA 3L0RA 3K7CA 1B27A 4NREA 1RDSA 3VGNA 1TIJA 1WMNA 1I8VA 5LC7A 5AEWB 5JPUA 1JJ22 4KZ1A 2JDIH 3HIGA 1MGRA 1PU4A 1YJW3 1MWRA 3S5CA 5JPPA 1ROVA 3WA2X 4R1KA 5AEUB 2C10A 3FSDA 1G0TA 1YJ93 1NU3A 2KF4A 3T8NA 3WA3A 1IV9A 2JQ5A 1O7MB 3ECFA 2CW9A 1IQ8A 1R4CA 1AY7A 1BVIA 1RGKA 4HVNA 4RNZA 3GSPA 2F98A 2RCDA 3ZFZA 1W6GA 1WTHA 1JN5B 1GS3A 1VZZA 1E3RA 1TFKA 3JUQA 3D9RA 4KFEA 4FMCA 1OH0A 2E2VA 3KSPA 3AHSA 1HU9A 1D6ZA 1V58A 1WNHA 3F7XA 1W2B2 1LOVA 5KP3A 3G16A 5AIGA 3A76A 5ELJA 2UUGC 2W0QA 3NM2A 1BRHA 4KVHA 4NHFA 1EQKA 1UW1A 1BSEA 7RNTA 1OHSA 1NB3I 1O7HB 1JNQA 2LYXA 3BB9A 1YIJ3 1W6YA 4HM3B 1RMSA 1UCKA 2IY2A 1X1UA 3LMLA 1PY3A 2HMKB 1JZOA 1IK3A 3PCSA 2IMJA 1LOYA 5M1AA
chains in the Genus database with same CATH topology
1CH0A 1FYSA 1BNFA 1DE3A 1BUJA 1AQZA 1BNEA 1SARA 2KF5A 1BRKA 4BIRA 1BGSA 2AAEA 1RGEA 1BOXA 3BIRA 1BU4A 2KAAA 3D4AA 1I0XA 1Q9EA 1GOYA 1I3IA 3Q3FA 3HOHA 1T2HA 1A2PA 2AADA 1TRPA 5RNTA 1GMQA 1LRAA 2RNTA 4RNTA 9RNTA 1BIRA 1ZGXA 1BNRA 1BSAA 1JBTA 1GOUA 1RGAA 1DETA 3AGNA 1IYYA 1R4YA 1I2EA 1RHLA 7GSPA 1LNIA 1UCLA 1BSDA 6GSPA 1BSCA 1BNJA 1BAOA 1LOWA 1B20A 1UCIA 1B2UA 1RTUA 1RGCA 5GSPA 1I3FA 2RBIA 1BNSA 1RGGA 1YVSA 1I2FA 1PYLA 1RGLA 1X1XA 5BIRA 1BSBA 4J5GA 1BRJA 1FUSA 3WHOA 1RSNA 1I2GA 1JBRA 1B2ZA 2BU4A 5HOHA 3WR2A 1FW7A 1BANA 1B2XA 2KF6A 1BNIA 1RN4A 1BRGA 1MGWA 1YNVX 1B2SA 3D5GA 3KCHA 1GMPA 2BIRA 1G02A 4HOHA 4HAAA 3URPA 1FUTA 5BU4A 1B3SA 1TTOA 1TRQA 1UCJA 1B27A 1RCKA 1RDSA 3BU4A 4J5KA 1RCLA 1RNBA 1I8VA 1GMRA 1BRIA 1MGRA 6RNTA 1RNTA 3D5IA 2GSPA 2KF3A 2F56A 1I70A 1RN1A 1X1YA 1FZUA 1HYFA 2KF4A 1BRNL 1YGWA 1X1WA 1HZ1A 1T2IA 2SARA 2HOHA 1AY7A 1BNGA 1BVIA 1RGKA 3A5EA 1B2MA 3GSPA 4GHOA 4GSPA 1B21A 1C54A 1RLSA 3SYUA 2F5MA 3AHSA 1LOVA 1GOVA 1RGHA 8RNTA 1BRSA 3RNTA 1BRHA 3DGYA 3AGOA 1BSEA 7RNTA 2C4BA 1GSPA 2F4YA 3AHWA 2F5WA 1RGFA 1RMSA 1UCKA 2ZA4A 1X1UA 4BU4A 1JBSA 1PY3A 1I0VA 1LOYA 3DH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CH0 A;  1FYS A;  1BNF A;  1DE3 A;  1BUJ A;  1AQZ A;  1BNE A;  1SAR A;  2KF5 A;  1BRK A;  4BIR A;  1BGS A;  2AAE A;  1RGE A;  1BOX A;  3BIR A;  1BU4 A;  2KAA A;  3D4A A;  1I0X A;  1Q9E A;  1GOY A;  1I3I A;  3Q3F A;  3HOH A;  1T2H A;  1A2P A;  2AAD A;  1TRP A;  5RNT A;  1GMQ A;  1LRA A;  2RNT A;  4RNT A;  9RNT A;  1BIR A;  1ZGX A;  1BNR A;  1BSA A;  1JBT A;  1GOU A;  1RGA A;  1DET A;  3AGN A;  1IYY A;  1R4Y A;  1I2E A;  1RHL A;  7GSP A;  1LNI A;  1UCL A;  1BSD A;  6GSP A;  1BSC A;  1BNJ A;  1BAO A;  1LOW A;  1B20 A;  1UCI A;  1B2U A;  1RTU A;  1RGC A;  5GSP A;  1I3F A;  2RBI A;  1BNS A;  1RGG A;  1YVS A;  1I2F A;  1PYL A;  1RGL A;  1X1X A;  5BIR A;  1BSB A;  4J5G A;  1BRJ A;  1FUS A;  3WHO A;  1RSN A;  1I2G A;  1JBR A;  1B2Z A;  2BU4 A;  5HOH A;  3WR2 A;  1FW7 A;  1BAN A;  1B2X A;  2KF6 A;  1BNI A;  1RN4 A;  1BRG A;  1MGW A;  1YNV X;  1B2S A;  3D5G A;  3KCH A;  1GMP A;  2BIR A;  1G02 A;  4HOH A;  4HAA A;  3URP A;  1FUT A;  5BU4 A;  1B3S A;  1TTO A;  1TRQ A;  1UCJ A;  1B27 A;  1RCK A;  1RDS A;  3BU4 A;  4J5K A;  1RCL A;  1RNB A;  1I8V A;  1GMR A;  1BRI A;  1MGR A;  6RNT A;  1RNT A;  3D5I A;  2GSP A;  2KF3 A;  2F56 A;  1I70 A;  1RN1 A;  1X1Y A;  1FZU A;  1HYF A;  2KF4 A;  1BRN L;  1YGW A;  1X1W A;  1HZ1 A;  1T2I A;  2SAR A;  2HOH A;  1AY7 A;  1BNG A;  1BVI A;  1RGK A;  3A5E A;  1B2M A;  3GSP A;  4GHO A;  4GSP A;  1B21 A;  1C54 A;  1RLS A;  3SYU A;  2F5M A;  3AHS A;  1LOV A;  1GOV A;  1RGH A;  8RNT A;  1BRS A;  3RNT A;  1BRH A;  3DGY A;  3AGO A;  1BSE A;  7RNT A;  2C4B A;  1GSP A;  2F4Y A;  3AHW A;  2F5W A;  1RGF A;  1RMS A;  1UCK A;  2ZA4 A;  1X1U A;  4BU4 A;  1JBS A;  1PY3 A;  1I0V A;  1LOY A;  3DH2 A; 
#chains in the Genus database with same CATH topology
 1FYS A;  4X2H A;  1AQZ A;  1BNE A;  2OOV A;  3JUM A;  1SAR A;  4RNY A;  3PZW A;  3S28 A;  1FGM A;  2IUJ A;  1Y4K A;  1E3V A;  2P09 A;  3LTB A;  4EV5 A;  5IER A;  1OGZ A;  2OOV C;  1Q82 4;  4O8S A;  4BTY A;  3CCL 3;  4I4K A;  4FMA A;  1I0X A;  5IEO A;  4CCV A;  3Q3F A;  2WOH A;  4BTW A;  2GU3 A;  3WMD A;  3Q90 A;  3OWS A;  1OPY A;  2XSH B;  1RRH A;  3F8X A;  3NQY A;  3WOE B;  4AKZ A;  2RNT A;  2CWV A;  4CPK A;  4L8O A;  5IF6 A;  1JBT A;  1MOL A;  3E99 A;  1RGA A;  1W00 A;  1DET A;  3CME 3;  1R4Y A;  4HM5 B;  1I2E A;  1UI7 A;  3EF8 A;  3F9S A;  1RN7 A;  1UCL A;  5D83 A;  5CF2 A;  1BSD A;  1DYU A;  6GSP A;  1BNJ A;  4OVM A;  1UUW B;  2KXG A;  2B24 B;  2CIU A;  1B20 A;  1IT7 A;  4MEI A;  2GEY A;  3MG3 A;  1RGC A;  1N9J A;  3F8H A;  2RBI A;  3HI7 A;  4FR9 A;  1JV2 B;  1UGH I;  5AI1 A;  1SJW A;  3LOY A;  4G1M B;  2RSX A;  4N6V 0;  3BNB A;  1PFP A;  4WYK B;  3WHO A;  1JKG B;  3FF2 A;  3JVC A;  1US1 A;  3NBJ A;  3B8L A;  3OX9 A;  4H61 A;  4MMX B;  3D3L A;  4QWT A;  3FCS B;  4WHA A;  3ROB A;  1VQO 3;  1BAN A;  1QVG 2;  1M1X B;  4FCJ A;  1DMN A;  5IG0 A;  3WDG B;  3CCV 3;  1GY6 A;  4HM4 B;  1IVW A;  3NHX A;  1N8Q A;  3EBY A;  2L4V A;  3LXU X;  2YFJ B;  3BLZ A;  3KZT A;  3MHE A;  4FMD A;  2K0M A;  2YFL B;  1K41 A;  4AKY A;  2LQV A;  4HAA A;  3UL5 A;  1W2Z A;  1U8C B;  3O8Y A;  2CX1 A;  4R80 A;  1RCL A;  2P0M A;  1IVU A;  1RRL A;  3NM7 A;  1OUN A;  1STD A;  1C7H A;  2KF3 A;  3JUN A;  5EQL A;  5FGO A;  2R41 A;  3CCM 3;  2QEX 3;  1CEW I;  2CG1 A;  2F56 A;  7STD A;  2XFS A;  3FG4 A;  1TJD A;  3K9M C;  1FZU A;  3M8C A;  3T0U A;  1KSI A;  3DGM A;  2W56 A;  3EN8 A;  5A0O B;  5IEP A;  4LMI A;  2SAR A;  2HOH A;  4IIA A;  2BT3 A;  3BND A;  3EN1 B;  1MWS A;  3FG3 A;  1BNG A;  2K3D A;  3A5E A;  5EEO A;  3G71 3;  1IVX A;  1W6C A;  4GHO A;  1VQ8 3;  2XR8 B;  2QIY A;  3NQZ A;  4GSP A;  1B21 A;  4HJL B;  4XB5 A;  2QGU A;  2ML6 A;  3SVA A;  3IJE B;  4PEJ A;  1MWT A;  5G1L A;  4K1U A;  4LEH A;  1RGH A;  1IQX A;  3U1W A;  8RNT A;  1NNV A;  1CYV A;  2M7O A;  4XDW A;  2F5W A;  1NDO B;  3QRD A;  2D1W A;  1WMP A;  1KC8 4;  1N9E A;  5IG4 A;  3AMO B;  3SX1 A;  1JBS A;  2OWP A;  1UGI A;  3DXO A;  2PNC A;  2Z7A A;  3DMC A;  4HYZ A;  3LZA A;  3IPT A;  4WP5 A;  5IEN A;  2P38 A;  2CH9 A;  1A67 A;  4BIR A;  3DGN A;  1UI8 A;  1ZO2 A;  3PCR A;  3ZG0 A;  1BU4 A;  1WQL B;  3S29 A;  1Q86 4;  4R9K A;  2KAA A;  2Z6B A;  1HKX A;  3OXA A;  1Q9E A;  1GOY A;  3RGA A;  1ULI B;  3LTC A;  2GBX B;  5RNT A;  3JUO A;  5M19 A;  1GMQ A;  1LRA A;  3HX8 A;  4RNT A;  3GAX A;  1K8A 4;  1BNR A;  3EB8 A;  1BSA A;  1FUW A;  1GOU A;  3LTD A;  3CCU 3;  1YGE A;  3CU3 A;  7GSP A;  1LNI A;  1FGR A;  2BO9 B;  3LT8 A;  4IT7 A;  4OK0 A;  3GZY B;  3SXX A;  1O7G B;  3BNE A;  3K5T A;  1LOW A;  1SQW A;  3TDG A;  4XBY A;  2XH9 A;  1B2U A;  3FLJ A;  4BL2 A;  4RZM A;  1I3F A;  1V74 A;  1Z1S A;  4LSO A;  1ZS7 A;  4WWU C;  1PYL A;  1X1X A;  3Q1C A;  3F40 A;  3VF1 A;  1BRJ A;  1LVN A;  1OHO A;  3H51 A;  1OF5 B;  4CJN A;  2OTL 3;  3NV0 A;  1I2G A;  2ZHX B;  1JBR A;  2WOF A;  5CLK A;  1JRQ A;  2HMO B;  4N6M A;  1W01 A;  3GRD A;  2IA7 A;  4N6U A;  3CNX A;  1OAC A;  3DGL A;  5CF1 A;  1YVB I;  1VQN 3;  4J9A A;  2RGQ A;  2KF6 A;  3Q2P A;  4O2H A;  3J7Y d;  1BNI A;  1GY7 A;  1BRG A;  2P0X A;  2STD A;  3LH4 A;  1IVV A;  3KCH A;  4HM2 B;  2GEX A;  2CFK A;  3ALA A;  1AVK A;  1W02 A;  1GMP A;  4K61 A;  1J2B A;  2CFD A;  4HOH A;  1STF I;  4EYC A;  2CFL A;  3URP A;  1TP6 A;  1UDI I;  2KCD A;  3PXM A;  4MJD A;  1UCJ A;  3I56 3;  4J5K A;  2INX A;  3BU4 A;  1RNB A;  1LNH A;  2OTJ 3;  1GMR A;  3DM8 A;  1BRI A;  3NBB A;  6RNT A;  1RNT A;  4ORL A;  3D5I A;  3FKA A;  2GSP A;  4HM0 B;  3X41 A;  3CC2 3;  4XBX A;  2F99 A;  2D42 A;  1RN1 A;  3V99 A;  2E2U A;  1MNL A;  1VQ9 3;  3DZL A;  2W56 B;  2CK3 H;  2IYJ A;  3PYJ A;  1YGW A;  1GY5 A;  2GXF A;  2Q07 A;  3NUV A;  4XBT A;  3NX0 A;  5ELU A;  1YJN 3;  3EE1 A;  3N54 B;  2HMM B;  3X3Z A;  4GL6 A;  1S72 3;  4JF8 A;  3X40 A;  1ULJ B;  5M18 A;  1AV4 A;  5DRV A;  2IUK A;  3BNC A;  1RLS A;  2PZV A;  2XEP A;  4FCZ A;  3HK4 A;  2W9Q A;  4N3V A;  4EV2 A;  1BRS A;  1GD4 A;  3FZW A;  3MSO A;  3DGY A;  4J8T A;  2Z76 A;  4TX4 A;  4RBN A;  5BXQ A;  1QVF 2;  3AGO A;  2OCT A;  4U13 A;  2FGT A;  3S27 A;  3CPW 2;  2C4B A;  1O7W B;  2F4Y A;  3V98 A;  3GZX B;  4WFO A;  1RGF A;  2ZA4 A;  4BU4 A;  2XSO B;  3D79 A;  5G1K A;  4HKV B;  1Q40 A;  4H3U A;  3CCE 3;  3I0Y A;  3DH2 A;  1L5G B;  1VQK 3;  3X42 A;  3CCJ 3;  3CCS 3;  2O3O A;  2BHM A;  3CD6 3;  4IPB A;  2BMR B;  1IU7 A;  1EKM A;  5TGN A;  3B4P A;  1KQS 2;  4HM6 B;  1V57 A;  1BRK A;  3CNM A;  1BGS A;  2AAE A;  1RGE A;  3BIR A;  2XFT A;  1VQ4 3;  2HML B;  3OV4 A;  1N5H A;  1N8R 4;  1T3B A;  1A2K A;  1I3I A;  2KRT A;  1OCV A;  1DMM A;  1LQM B;  1QAF A;  2AAD A;  2A15 A;  2CX0 A;  2SBL A;  3RGR A;  3OW2 2;  4DKI A;  1BUQ A;  2E2T A;  1K9M 4;  3K0Z A;  2RFR A;  1IT8 A;  3CC4 3;  1SPU A;  1O7N B;  3G8Z A;  4EW5 A;  3NXJ A;  1JB2 A;  1RHL A;  2Z77 A;  1A2V A;  3QK9 A;  4I5Q A;  4N6L A;  4BTX A;  1ISK A;  1BSC A;  1JB5 A;  4HBR A;  4OUQ A;  1BAO A;  1GYB A;  2UGI A;  1Q7Y 4;  2WGQ A;  2CG0 A;  1UCI A;  3T8U A;  4N6N B;  1RTU A;  1RKY A;  1FGQ A;  4HM1 B;  4N6T A;  4LYL B;  3S67 A;  3K63 A;  3NV0 B;  1VQP 3;  2GU1 A;  4J5G A;  2H0G A;  1RSN A;  3I55 3;  5I97 A;  3JUP A;  2BU4 A;  3X3Y A;  1F8N A;  5HOH A;  2L1S A;  1VQM 3;  2O9U X;  3WR2 A;  3F7S A;  4EBG A;  1TUH A;  2C11 A;  1B2X A;  2BMO B;  1VQL 3;  1Q7H A;  1EUI C;  3B7C A;  2J8X B;  2XGN A;  5IW9 A;  3ZG5 A;  2OQE A;  3IMA B;  2CHC A;  1E97 A;  2QA4 3;  1SIH A;  1M1K 4;  2CC3 A;  1B2S A;  1EG9 B;  1W7C A;  1DVC A;  3D5G A;  5STD A;  2GBW B;  2W9P A;  3SOA A;  2BNG A;  1D6Y A;  1JB4 A;  2OQE C;  4L8P A;  4N6O B;  3STD A;  5KP1 A;  1G02 A;  4O3V A;  3SOY A;  5CXO A;  3F14 A;  3EX9 A;  1TTO A;  1TRQ A;  1RCK A;  2YFI B;  5HGR A;  1S5A A;  1Q42 A;  3U97 A;  3UJM A;  3EJV A;  1OGX A;  5IG5 A;  3CCQ 3;  4K90 B;  1Q81 4;  2BMQ B;  1NWW A;  4XM4 A;  5IG3 A;  1U5O A;  3N8B A;  2CKF B;  1I70 A;  1NO3 A;  3CMA 3;  2XF3 A;  1X1Y A;  1ASK A;  1HYF A;  2H0I A;  3KE7 A;  1BRN L;  3UNL A;  2I9W A;  1X1W A;  1HZ1 A;  4K1V A;  4O02 B;  3AMO A;  1T2I A;  2P05 A;  3G0K A;  4LGQ A;  3V92 A;  4ZM8 A;  1EA2 A;  1VQQ A;  2WGO A;  1B2M A;  1TU5 A;  2XGL A;  2W03 A;  3KKG A;  3NBR A;  1YI2 3;  3MWZ A;  2V1L A;  1C54 A;  4Q53 A;  3UB1 A;  1WMO A;  3SYU A;  1JN5 A;  1M90 4;  3H3H A;  2F5M A;  1OHP A;  6STD A;  5LC6 A;  1IQY A;  1M9G A;  1GOV A;  3GZR A;  5AIF A;  1FGT A;  1QAK A;  4HZB B;  1CQS A;  3RNT A;  1LQG C;  1RJO A;  4NPB A;  4R9L A;  3B4O A;  1GSP A;  1K73 4;  3VSY A;  5AYS C;  3AHW A;  1QJG A;  4HM8 B;  2W04 A;  3G4S 3;  1VQ7 3;  2ZDJ A;  1ZX2 A;  1NB5 I;  1Q40 B;  4FCM A;  2XRX B;  1W5Z A;  5G2G A;  5JBS A;  1UUG B;  5AII A;  2R4I A;  2WO0 A;  1I0V A;  1SII A;  2K54 A;  1BIR A;  2Y74 A;  1NJI 4;  3KN4 A;  1CH0 A;  3OWU A;  4L7K A;  1QAL A;  1BNF A;  1DE3 A;  1BUJ A;  2CFW A;  4CDL A;  4XDV A;  2KF5 A;  4JRF A;  4KFF A;  1BOX A;  3ER7 A;  2F86 B;  3MYT A;  1IV7 A;  2HMJ B;  3PS8 A;  1N5P A;  4GB5 A;  3D4A A;  1KWI A;  3RDE A;  1A90 A;  4KT3 B;  3MG2 A;  3EHC A;  2ZL8 A;  3HOH A;  1T2H A;  1A2P A;  1QMA A;  4EXR A;  1W4N A;  1OF5 A;  1YIT 3;  1MWU A;  1TRP A;  1YHQ 3;  5KP4 A;  5AYR B;  3GZB A;  4HZ9 B;  1GD3 A;  3SED A;  9RNT A;  1ZGX A;  2MF7 A;  3FH1 A;  1LXE A;  2B1X B;  4EC6 A;  3PGB A;  3AGN A;  5BVB A;  3FF0 A;  1EEJ A;  1IYY A;  1T5Y A;  3DGO A;  1UUV B;  3DY5 A;  4STD A;  1FGO A;  3DUK A;  1CYU A;  1K28 A;  3WOF B;  3FGY A;  1D6U A;  2Y73 A;  4ILF A;  2MC8 A;  3CXC 2;  5DRE A;  5D81 A;  3LYG A;  3G6E 3;  1JZD A;  5AIH A;  1LOX A;  4BL3 A;  4AEQ A;  2UX0 A;  2CWT A;  4MMY B;  5GSP A;  2CFG A;  1AVL A;  5FW5 A;  3HZP A;  3MPH A;  1BNS A;  1RGG A;  1YVS A;  3CC7 3;  1I2F A;  1RGL A;  3LTA A;  1G96 A;  1TFO A;  3EQQ B;  5BIR A;  1BSB A;  3CPO A;  1AR0 A;  2ML5 A;  3LT9 A;  1FUS A;  4HM7 B;  3MG1 A;  4LZI A;  1B2Z A;  3HII A;  4WYK A;  1O7P B;  1JKG A;  2FNQ A;  3MKI A;  3N9H A;  4FMB A;  1VQ5 3;  3X3X A;  1ROA A;  2W6J H;  1FW7 A;  4X2O A;  3CCR 3;  1FA3 A;  8CHO A;  2HMN B;  2W2C A;  3KSE D;  2H0H A;  1KD1 4;  3EC9 A;  3FG1 A;  5D82 A;  1RN4 A;  4KFD A;  1MGW A;  1YNV X;  3KFQ C;  3UL6 A;  1VQ6 3;  5EVH A;  3WOD G;  2BIR A;  3SLU A;  3EBT A;  2FXT A;  4MMZ B;  3OWY A;  2CWU A;  1IDP A;  4R4K A;  1DVD A;  2YX9 A;  1DMQ A;  1FUT A;  3KII A;  5BU4 A;  5CK6 A;  1B3S A;  3GWR A;  3L0R A;  3K7C A;  1B27 A;  4NRE A;  1RDS A;  3VGN A;  1TIJ A;  1WMN A;  1I8V A;  5LC7 A;  5AEW B;  5JPU A;  1JJ2 2;  4KZ1 A;  2JDI H;  3HIG A;  1MGR A;  1PU4 A;  1YJW 3;  1MWR A;  3S5C A;  5JPP A;  1ROV A;  3WA2 X;  4R1K A;  5AEU B;  2C10 A;  3FSD A;  1G0T A;  1YJ9 3;  1NU3 A;  2KF4 A;  3T8N A;  3WA3 A;  1IV9 A;  2JQ5 A;  1O7M B;  3ECF A;  2CW9 A;  1IQ8 A;  1R4C A;  1AY7 A;  1BVI A;  1RGK A;  4HVN A;  4RNZ A;  3GSP A;  2F98 A;  2RCD A;  3ZFZ A;  1W6G A;  1WTH A;  1JN5 B;  1GS3 A;  1VZZ A;  1E3R A;  1TFK A;  3JUQ A;  3D9R A;  4KFE A;  4FMC A;  1OH0 A;  2E2V A;  3KSP A;  3AHS A;  1HU9 A;  1D6Z A;  1V58 A;  1WNH A;  3F7X A;  1W2B 2;  1LOV A;  5KP3 A;  3G16 A;  5AIG A;  3A76 A;  5ELJ A;  2UUG C;  2W0Q A;  3NM2 A;  1BRH A;  4KVH A;  4NHF A;  1EQK A;  1UW1 A;  1BSE A;  7RNT A;  1OHS A;  1NB3 I;  1O7H B;  1JNQ A;  2LYX A;  3BB9 A;  1YIJ 3;  1W6Y A;  4HM3 B;  1RMS A;  1UCK A;  2IY2 A;  1X1U A;  3LML A;  1PY3 A;  2HMK B;  1JZO A;  1IK3 A;  3PCS A;  2IMJ A;  1LOY A;  5M1A A; 
#chains in the Genus database with same CATH homology
 1CH0 A;  1FYS A;  1BNF A;  1DE3 A;  1BUJ A;  1AQZ A;  1BNE A;  1SAR A;  2KF5 A;  1BRK A;  4BIR A;  1BGS A;  2AAE A;  1RGE A;  1BOX A;  3BIR A;  1BU4 A;  2KAA A;  3D4A A;  1I0X A;  1Q9E A;  1GOY A;  1I3I A;  3Q3F A;  3HOH A;  1T2H A;  1A2P A;  2AAD A;  1TRP A;  5RNT A;  1GMQ A;  1LRA A;  2RNT A;  4RNT A;  9RNT A;  1BIR A;  1ZGX A;  1BNR A;  1BSA A;  1JBT A;  1GOU A;  1RGA A;  1DET A;  3AGN A;  1IYY A;  1R4Y A;  1I2E A;  1RHL A;  7GSP A;  1LNI A;  1UCL A;  1BSD A;  6GSP A;  1BSC A;  1BNJ A;  1BAO A;  1LOW A;  1B20 A;  1UCI A;  1B2U A;  1RTU A;  1RGC A;  5GSP A;  1I3F A;  2RBI A;  1BNS A;  1RGG A;  1YVS A;  1I2F A;  1PYL A;  1RGL A;  1X1X A;  5BIR A;  1BSB A;  4J5G A;  1BRJ A;  1FUS A;  3WHO A;  1RSN A;  1I2G A;  1JBR A;  1B2Z A;  2BU4 A;  5HOH A;  3WR2 A;  1FW7 A;  1BAN A;  1B2X A;  2KF6 A;  1BNI A;  1RN4 A;  1BRG A;  1MGW A;  1YNV X;  1B2S A;  3D5G A;  3KCH A;  1GMP A;  2BIR A;  1G02 A;  4HOH A;  4HAA A;  3URP A;  1FUT A;  5BU4 A;  1B3S A;  1TTO A;  1TRQ A;  1UCJ A;  1B27 A;  1RCK A;  1RDS A;  3BU4 A;  4J5K A;  1RCL A;  1RNB A;  1I8V A;  1GMR A;  1BRI A;  1MGR A;  6RNT A;  1RNT A;  3D5I A;  2GSP A;  2KF3 A;  2F56 A;  1I70 A;  1RN1 A;  1X1Y A;  1FZU A;  1HYF A;  2KF4 A;  1BRN L;  1YGW A;  1X1W A;  1HZ1 A;  1T2I A;  2SAR A;  2HOH A;  1AY7 A;  1BNG A;  1BVI A;  1RGK A;  3A5E A;  1B2M A;  3GSP A;  4GHO A;  4GSP A;  1B21 A;  1C54 A;  1RLS A;  3SYU A;  2F5M A;  3AHS A;  1LOV A;  1GOV A;  1RGH A;  8RNT A;  1BRS A;  3RNT A;  1BRH A;  3DGY A;  3AGO A;  1BSE A;  7RNT A;  2C4B A;  1GSP A;  2F4Y A;  3AHW A;  2F5W A;  1RGF A;  1RMS A;  1UCK A;  2ZA4 A;  1X1U A;  4BU4 A;  1JBS A;  1PY3 A;  1I0V A;  1LOY A;  3DH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...