1B2XA

Barnase wildtype structure at ph 7.5 from a cryo_cooled crystal at 100k
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARNASE)
publication title A structural double-mutant cycle: estimating the strength of a buried salt bridge in barnase.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1b2xA00
1YVSA 1B2MA 1CH0A 1GMQA 1DETA 1X1WA 1BRIA 1Q9EA 1RLSA 1BSBA 1B2XA 1BRNL 1T2HA 3AHSA 2GSPA 3GSPA 2C4BA 1RN1A 1JBTA 3AHWA 3BIRA 1BOXA 1BRHA 1RHLA 1X1XA 3WR2A 1GOYA 2F5MA 3D4AA 1I2EA 1IYYA 2AADA 9RNTA 1BNJA 4HOHA 1RTUA 2BU4A 1FUTA 1B3SA 1I2GA 1B2UA 4RNTA 1YNVX 1LRAA 7RNTA 1BNRA 7GSPA 1B2SA 1BRGA 1BRKA 1ZGXA 1RMSA 3KCHA 5RNTA 1BNIA 2ZA4A 2F5WA 1RGEA 1MGWA 3URPA 1AY7A 1GSPA 1I2FA 2KF4A 2KF3A 2F4YA 4HAAA 1PYLA 3D5IA 1RGAA 1RNTA 1X1UA 1FW7A 1BSAA 1FZUA 1UCJA 1BNEA 1BIRA 1FUSA 1PY3A 1B2ZA 1RN4A 1BRJA 2SARA 3DH2A 1B21A 3BU4A 3AGNA 1RGHA 1TRQA 1TRPA 1GMRA 1RNBA 1BNFA 3HOHA 2F56A 5BU4A 1BSCA 2KF5A 1C54A 4GSPA 3RNTA 1B20A 1RCLA 3Q3FA 1TTOA 1RDSA 1UCKA 8RNTA 5BIRA 1X1YA 1RGFA 1AQZA 2KAAA 4J5KA 4BIRA 1A2PA 1RGGA 3D5GA 1LNIA 2KF6A 1RGCA 1I70A 1BNGA 1I8VA 1BGSA 1UCLA 1I0VA 5HOHA 3A5EA 4BU4A 1I3IA 1YGWA 1T2IA 2AAEA 1BRSA 1I3FA 1BSDA 1BVIA 6RNTA 1RGLA 1G02A 1BNSA 5GSPA 1B27A 6GSPA 1FYSA 2RNTA 1BUJA 4J5GA 1BSEA 1RCKA 1RSNA 1MGRA 3WHOA 1BAOA 3SYUA 1UCIA 1GMPA 4GHOA 2RBIA 1JBRA 1BU4A 1RGKA 1HYFA 3AGOA 1LOYA 3DGYA 1LOVA 1R4YA 1LOWA 1GOVA 1GOUA 1HZ1A 1DE3A 2BIRA 1BANA 1JBSA 1I0XA 2HOHA 1SARA
chains in the Genus database with same CATH superfamily
3JUMA 1O7NB 1IT7A 1VQQA 3RGAA 1DETA 3CCS3 1BRIA 1NWWA 2Y74A 3ZFZA 1EUIC 3FG3A 4EC6A 3EB8A 1FGMA 4FMCA 5STDA 1T2HA 3FF2A 2KRTA 2GU3A 3AHSA 3GSPA 4LMIA 2SBLA 2IUJA 3CCE3 3EHCA 2HMLB 1Q7Y4 1BRHA 3JUQA 1AVKA 1M9GA 4FR9A 1X1XA 4MMZB 1GOYA 3LTCA 4OVMA 1EQKA 1S5AA 4HM2B 5LC7A 3BLZA 1QMAA 4ILFA 2QGUA 1US1A 3FZWA 1W6YA 3FGYA 5BVBA 3CCL3 1B3SA 2P38A 1GD4A 1MWTA 7RNTA 2YX9A 3WDGB 1UI7A 1B2SA 1TUHA 1TJDA 1A2VA 4I5QA 4U13A 4EV5A 2OWPA 2OQEA 1W02A 2STDA 1A90A 1ROAA 4KZ1A 3CCJ3 2ZA4A 3KZTA 1V74A 2W56A 1IK3A 3KSPA 1IQXA 4RNYA 4HYZA 1GSPA 1K9M4 1FGQA 1RRHA 2XGLA 2CX0A 2F4YA 2INXA 4AEQA 2RSXA 1ULJB 3NV0B 1YGEA 1PYLA 1W4NA 3DUKA 3SVAA 2IYJA 3JUNA 1FW7A 2CWTA 7STDA 4O3VA 2CWUA 1BIRA 1PY3A 2SARA 1BRJA 3LZAA 1W2B2 2WO0A 2K54A 3DXOA 3F14A 2R4IA 1RNBA 3HOHA 3AMOA 3GZYB 1C54A 2K0MA 1JV2B 5LC6A 3RNTA 1Q40A 1ISKA 5G2GA 5D83A 4K61A 1RDSA 3SOYA 3UJMA 4O8SA 1OHOA 3F40A 2Z6BA 3ZG5A 1YJW3 3PGBA 1YJN3 3CD63 5IF6A 1JKGA 4N6NB 1PFPA 1FA3A 1NB3I 1YJ93 3G0KA 2KF6A 2P0XA 3BNDA 2W0QA 3EBYA 3N9HA 2IA7A 1I0VA 3FSDA 2WGOA 5AYRB 3JUOA 2OTJ3 3OX9A 3OWYA 4MMXB 4N6UA 1QVF2 2AAEA 3Q90A 4TX4A 3FF0A 1BSDA 2GEXA 1ZS7A 3NQZA 4R1KA 2BHMA 1GY6A 2Z76A 3HX8A 2OOVC 4KFEA 1TP6A 5GSPA 3CNMA 3X40A 6GSPA 1JN5B 1FYSA 1Q42A 2L4VA 3UB1A 4J5GA 1MGRA 1LQGC 3MG2A 3WHOA 2I9WA 3CMA3 4HVNA 1SQWA 1UCIA 4GHOA 1LOXA 4EW5A 3OWSA 2R41A 4WHAA 4XDVA 5HGRA 1V57A 2CG0A 3J7Yd 5M19A 3LOYA 4HM0B 1K41A 2CK3H 1OHPA 1R4YA 2E2UA 1LOWA 4K1VA 1GOVA 1JBSA 1BANA 4X2OA 4H3UA 1I0XA 2O9UX 1IQYA 1SARA 3N54B 3MWZA 1CH0A 3SLUA 2XFSA 2W6JH 1RLSA 4EV2A 1NU3A 1BSBA 1YIJ3 1Q7HA 2XSHB 2XF3A 1GYBA 1N5PA 1VQ63 4HM6B 2CG1A 3MSOA 1M1XB 1W6GA 1VQ93 1RN1A 4EXRA 4R9KA 5TGNA 2ZDJA 3MYTA 3WR2A 2XGNA 3BNEA 2AADA 2WGQA 1N9JA 4XB5A 9RNTA 1M1K4 2Z7AA 4HOHA 4WP5A 3GZXB 1WNHA 2BU4A 1STDA 2Q07A 3A76A 4O02B 3ER7A 3S29A 3VSYA 1CQSA 1UUWB 1RRLA 1UUVB 3EX9A 3K5TA 5CLKA 5JBSA 4AKYA 2QA43 1YNVX 1LRAA 3QK9A 1BNRA 5IERA 2OCTA 4WFOA 1BRGA 4GB5A 1G0TA 1W01A 3DMCA 3KCHA 3WA2X 3CCV3 3X3YA 2Z77A 2BMQB 2F5WA 1MGWA 1QAKA 3URPA 3CCQ3 3Q2PA 3GAXA 3EN1B 3HK4A 2BO9B 1W2ZA 1D6UA 3DGMA 4HBRA 3G713 3B7CA 5FW5A 1JJ22 4L8OA 3I553 4XDWA 5BXQA 4CDLA 2GU1A 4HAAA 4K1UA 1ASKA 2BMRB 3S27A 3S28A 3MG3A 1OH0A 4HM8B 1UCJA 4OK0A 4XM4A 1FGOA 1FUSA 5IG3A 1UW1A 1AR0A 1B2ZA 1QJGA 2XRXB 3D9RA 2CIUA 3BU4A 3AGNA 4R80A 1RGHA 1TRQA 4CCVA 1GMRA 3MG1A 1ROVA 5BU4A 1TFOA 1BSCA 1GY5A 2XFTA 1ZX2A 4GSPA 3OXAA 4HM1B 1OUNA 3HIIA 1RCLA 3Q3FA 3EE1A 3IMAB 3S67A 3HI7A 2QEX3 1OPYA 3B8LA 3EN8A 1X1YA 3IPTA 3EJVA 3N8BA 2RCDA 1SIHA 5ELUA 3WMDA 1AQZA 3RGRA 3H3HA 3UNLA 3LT9A 3PYJA 1A2PA 1RGGA 2LQVA 1WTHA 3F8HA 1O7MB 1RGCA 3MKIA 2CC3A 1I70A 1J2BA 1BNGA 1LQMB 4HM4B 5AEUB 1UCLA 2QIYA 3ROBA 2W9QA 3JVCA 2WOFA 5IW9A 1E97A 3QRDA 3X3XA 3F8XA 3SEDA 3FCSB 4AKZA 2ML5A 3WOEB 1BRSA 2IMJA 1CEWI 4K90B 1RGLA 6RNTA 1BNSA 3X42A 2E2TA 1B27A 2MF7A 2WOHA 4EBGA 5AIIA 5KP4A 2RNTA 1RJOA 3FG1A 4IPBA 5I97A 1Q864 2B1XB 2L1SA 1TU5A 1W5ZA 3SYUA 4L7KA 3JUPA 3G8ZA 1DVDA 4HM7B 4KFFA 2O3OA 1IVUA 2UGIA 3X3ZA 2FNQA 1RGKA 3LMLA 1HYFA 3DY5A 5CF2A 1LOVA 1WMNA 4FCZA 3STDA 1NNVA 3CC43 2W03A 1Y4KA 3KIIA 1JN5A 3X41A 4HZ9B 2HOHA 2KF3A 3DGOA 2UX0A 1B2MA 4J8TA 5AIGA 2BT3A 4WYKB 3LH4A 5DRVA 1Q9EA 1UGHI 5IENA 5CF1A 4N6LA 2OTL3 3PCSA 1BRNL 1TFKA 1GD3A 1NDOB 4BL3A 4RZMA 1JB5A 1OCVA 2C4BA 3I0YA 4JRFA 5EEOA 1HKXA 4N6TA 3NUVA 1NJI4 3BIRA 5AYSC 1VQK3 1BOXA 1YHQ3 1MNLA 1Q40B 1D6ZA 2PNCA 2XSOB 1O7GB 3D4AA 1L5GB 3U1WA 1FUWA 3CCR3 4Q53A 1Z1SA 2IUKA 4MEIA 1VQ53 1BNJA 5IG5A 4XBTA 4EYCA 1VQM3 1M904 3ALAA 4FMBA 3V99A 1VQ43 4LZIA 3CC73 4I4KA 1JKGB 2H0IA 1QALA 3PS8A 1S723 2BMOB 1Q814 1B2UA 1JRQA 2XH9A 2F99A 3BNBA 3KSED 2C11A 3LTAA 3OV4A 4J9AA 1BUQA 6STDA 1CYVA 1K734 2FXTA 3NXJA 1N5HA 1ZGXA 1BRKA 1RMSA 3NQYA 3CPW2 4DKIA 1VQ83 1TIJA 1DMNA 3EF8A 4IT7A 3LXUX 2MC8A 3KN4A 4BTWA 2GBXB 4OUQA 5EVHA 1AY7A 5DREA 3NM2A 3F7SA 1RN7A 3U97A 3FLJA 2GXFA 1MWSA 1FGRA 1YVBI 1EKMA 3FG4A 2ZHXB 3NX0A 2JDIH 2FGTA 3FKAA 3D3LA 1X1UA 1DMMA 1FZUA 1G96A 3NHXA 1BNEA 2UUGC 1QVG2 1JZDA 1OF5B 1RN4A 1W00A 1FGTA 1B21A 4GL6A 2CHCA 1K28A 3VGNA 1ZO2A 1IVWA 3HIGA 2F56A 3GZRA 5CXOA 2OOVA 3G4S3 1IVXA 1B20A 1IT8A 1KWIA 1TTOA 3EBTA 1DVCA 2W9PA 4JF8A 8RNTA 1OGXA 5BIRA 5CK6A 3MHEA 1IV7A 3UL6A 4HM3B 1UUGB 4FCMA 2PZVA 1O7PB 2YFIB 2KAAA 5IEOA 2CH9A 3NM7A 1JZOA 5AIHA 2K3DA 3WODG 5D82A 2BNGA 1IQ8A 3K9MC 4CJNA 3T0UA 1I8VA 1BGSA 3KE7A 2CFLA 5M1AA 1ULIB 5ELJA 1I3IA 2HMOB 3BNCA 4KT3B 1KD14 3DGNA 1YGWA 5AIFA 2HMJB 4BL2A 1T2IA 4ZM8A 3LT8A 3G6E3 1SJWA 1BVIA 2CX1A 1O7HB 4X2HA 1G02A 2JQ5A 5EQLA 3GZBA 1SIIA 4KFDA 2GEYA 3KKGA 3NV0A 1BUJA 1BSEA 1MWRA 2B24B 1RCKA 2KXGA 1BAOA 2D1WA 4NREA 3WA3A 1UGIA 4XBYA 5IG0A 1W7CA 2RBIA 2H0HA 3PCRA 3SXXA 5KP3A 2H0GA 2YFJB 1V58A 3T8NA 2CFGA 3SX1A 1BU4A 3CPOA 1Q824 2F86B 2CKFB 3NBBA 3V92A 3OW22 1DYUA 1U5OA 2RFRA 1IDPA 1JB2A 1DE3A 3T8UA 2HMKB 3LTDA 3CME3 1VQ73 1JBRA 3V98A 3PZWA 3I563 1YVSA 3EQQB 1GY7A 4BTYA 1KQS2 4FCJA 1GMQA 1X1WA 3MPHA 2CFDA 1B2XA 3ZG0A 4NHFA 3S5CA 2GBWB 1OHSA 3M8CA 1WMPA 2GSPA 2W04A 4R9LA 1MOLA 3VF1A 1JBTA 3AHWA 2CWVA 1RHLA 1KC84 1VQO3 1JB4A 2F5MA 3DZLA 3CCU3 1VQL3 1I2EA 1IYYA 3Q1CA 2CFKA 2P0MA 3DGLA 4QWTA 1HU9A 1F8NA 4WYKA 1OGZA 1RTUA 1OACA 3CU3A 3H51A 2W56B 3ECFA 1FUTA 3GRDA 4MMYB 5G1KA 1AVLA 4LGQA 1C7HA 1IU7A 3OWUA 2P09A 1I2GA 2CFWA 4HM5B 1RKYA 4RNTA 1KSIA 3KFQC 2J8XB 3L0RA 4R4KA 7GSPA 1T5YA 4FMDA 4L8PA 4MJDA 1A2KA 3CCM3 1LVNA 4N6OB 5RNTA 3WOFB 1IVVA 2F98A 2KCDA 2HMMB 3LTBA 1BNIA 1W6CA 1RGEA 4LSOA 3FH1A 2RGQA 1GS3A 3E99A 3UL5A 8CHOA 3BB9A 1I2FA 2ZL8A 3AMOB 2KF4A 3HZPA 3RDEA 1DMQA 3G16A 1CYUA 2W2CA 2IY2A 3D5IA 1RGAA 3K7CA 4N3VA 1RNTA 4STDA 5G1LA 1BSAA 2YFLB 3EC9A 3SOAA 1YI23 3DH2A 1UI8A 2HMNB 3NBJA 5JPPA 1TRPA 4HJLB 3IJEB 3GWRA 1BNFA 1VZZA 2E2VA 2KF5A 1AV4A 4KVHA 3TDGA 3CXC2 1EG9B 1UCKA 3CC23 1O7WB 4CPKA 1WMOA 5KP1A 4O2HA 5AEWB 1QAFA 2LYXA 1RGFA 1EA2A 1LXEA 1IV9A 1OF5A 1STFI 1WQLB 4WWUC 4J5KA 4BTXA 4BIRA 3DM8A 3D5GA 1LNIA 2P05A 4IIAA 1LNHA 1NB5I 5M18A 3PXMA 1YIT3 1EEJA 2Y73A 2C10A 4XBXA 2XEPA 4G1MB 5HOHA 2ML6A 5IG4A 1T3BA 3A5EA 1R4CA 1E3VA 1E3RA 1U8CB 4BU4A 4NPBA 1UDII 1MWUA 5JPUA 1N8R4 3K0ZA 2XR8B 2M7OA 1D6YA 4N6V0 5A0OB 1N8QA 5FGOA 5IEPA 1I3FA 4H61A 2CW9A 4HZBB 2V1LA 4N6MA 2A15A 1N9EA 1A67A 3NBRA 2OQEC 3K63A 3B4OA 4RNZA 1RSNA 4FMAA 3CNXA 1GMPA 1NO3A 1SPUA 3F9SA 5D81A 2D42A 1VQN3 1VQP3 4HKVB 3D79A 3F7XA 3AGOA 3DGYA 1LOYA 1K8A4 4PEJA 1PU4A 3LYGA 3O8YA 4LEHA 3B4PA 5AI1A 1HZ1A 1GOUA 1JNQA 4LYLB 2BIRA 4ORLA 4RBNA
chains in the Genus database with same CATH topology
1YVSA 1B2MA 1CH0A 1GMQA 1DETA 1X1WA 1BRIA 1Q9EA 1RLSA 1BSBA 1B2XA 1BRNL 1T2HA 3AHSA 2GSPA 3GSPA 2C4BA 1RN1A 1JBTA 3AHWA 3BIRA 1BOXA 1BRHA 1RHLA 1X1XA 3WR2A 1GOYA 2F5MA 3D4AA 1I2EA 1IYYA 2AADA 9RNTA 1BNJA 4HOHA 1RTUA 2BU4A 1FUTA 1B3SA 1I2GA 1B2UA 4RNTA 1YNVX 1LRAA 7RNTA 1BNRA 7GSPA 1B2SA 1BRGA 1BRKA 1ZGXA 1RMSA 3KCHA 5RNTA 1BNIA 2ZA4A 2F5WA 1RGEA 1MGWA 3URPA 1AY7A 1GSPA 1I2FA 2KF4A 2KF3A 2F4YA 4HAAA 1PYLA 3D5IA 1RGAA 1RNTA 1X1UA 1FW7A 1BSAA 1FZUA 1UCJA 1BNEA 1BIRA 1FUSA 1PY3A 1B2ZA 1RN4A 1BRJA 2SARA 3DH2A 1B21A 3BU4A 3AGNA 1RGHA 1TRQA 1TRPA 1GMRA 1RNBA 1BNFA 3HOHA 2F56A 5BU4A 1BSCA 2KF5A 1C54A 4GSPA 3RNTA 1B20A 1RCLA 3Q3FA 1TTOA 1RDSA 1UCKA 8RNTA 5BIRA 1X1YA 1RGFA 1AQZA 2KAAA 4J5KA 4BIRA 1A2PA 1RGGA 3D5GA 1LNIA 2KF6A 1RGCA 1I70A 1BNGA 1I8VA 1BGSA 1UCLA 1I0VA 5HOHA 3A5EA 4BU4A 1I3IA 1YGWA 1T2IA 2AAEA 1BRSA 1I3FA 1BSDA 1BVIA 6RNTA 1RGLA 1G02A 1BNSA 5GSPA 1B27A 6GSPA 1FYSA 2RNTA 1BUJA 4J5GA 1BSEA 1RCKA 1RSNA 1MGRA 3WHOA 1BAOA 3SYUA 1UCIA 1GMPA 4GHOA 2RBIA 1JBRA 1BU4A 1RGKA 1HYFA 3AGOA 1LOYA 3DGYA 1LOVA 1R4YA 1LOWA 1GOVA 1GOUA 1HZ1A 1DE3A 2BIRA 1BANA 1JBSA 1I0XA 2HOHA 1SARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVS A;  1B2M A;  1CH0 A;  1GMQ A;  1DET A;  1X1W A;  1BRI A;  1Q9E A;  1RLS A;  1BSB A;  1B2X A;  1BRN L;  1T2H A;  3AHS A;  2GSP A;  3GSP A;  2C4B A;  1RN1 A;  1JBT A;  3AHW A;  3BIR A;  1BOX A;  1BRH A;  1RHL A;  1X1X A;  3WR2 A;  1GOY A;  2F5M A;  3D4A A;  1I2E A;  1IYY A;  2AAD A;  9RNT A;  1BNJ A;  4HOH A;  1RTU A;  2BU4 A;  1FUT A;  1B3S A;  1I2G A;  1B2U A;  4RNT A;  1YNV X;  1LRA A;  7RNT A;  1BNR A;  7GSP A;  1B2S A;  1BRG A;  1BRK A;  1ZGX A;  1RMS A;  3KCH A;  5RNT A;  1BNI A;  2ZA4 A;  2F5W A;  1RGE A;  1MGW A;  3URP A;  1AY7 A;  1GSP A;  1I2F A;  2KF4 A;  2KF3 A;  2F4Y A;  4HAA A;  1PYL A;  3D5I A;  1RGA A;  1RNT A;  1X1U A;  1FW7 A;  1BSA A;  1FZU A;  1UCJ A;  1BNE A;  1BIR A;  1FUS A;  1PY3 A;  1B2Z A;  1RN4 A;  1BRJ A;  2SAR A;  3DH2 A;  1B21 A;  3BU4 A;  3AGN A;  1RGH A;  1TRQ A;  1TRP A;  1GMR A;  1RNB A;  1BNF A;  3HOH A;  2F56 A;  5BU4 A;  1BSC A;  2KF5 A;  1C54 A;  4GSP A;  3RNT A;  1B20 A;  1RCL A;  3Q3F A;  1TTO A;  1RDS A;  1UCK A;  8RNT A;  5BIR A;  1X1Y A;  1RGF A;  1AQZ A;  2KAA A;  4J5K A;  4BIR A;  1A2P A;  1RGG A;  3D5G A;  1LNI A;  2KF6 A;  1RGC A;  1I70 A;  1BNG A;  1I8V A;  1BGS A;  1UCL A;  1I0V A;  5HOH A;  3A5E A;  4BU4 A;  1I3I A;  1YGW A;  1T2I A;  2AAE A;  1BRS A;  1I3F A;  1BSD A;  1BVI A;  6RNT A;  1RGL A;  1G02 A;  1BNS A;  5GSP A;  1B27 A;  6GSP A;  1FYS A;  2RNT A;  1BUJ A;  4J5G A;  1BSE A;  1RCK A;  1RSN A;  1MGR A;  3WHO A;  1BAO A;  3SYU A;  1UCI A;  1GMP A;  4GHO A;  2RBI A;  1JBR A;  1BU4 A;  1RGK A;  1HYF A;  3AGO A;  1LOY A;  3DGY A;  1LOV A;  1R4Y A;  1LOW A;  1GOV A;  1GOU A;  1HZ1 A;  1DE3 A;  2BIR A;  1BAN A;  1JBS A;  1I0X A;  2HOH A;  1SAR A; 
#chains in the Genus database with same CATH topology
 3JUM A;  1O7N B;  1IT7 A;  1VQQ A;  3RGA A;  1DET A;  3CCS 3;  1BRI A;  1NWW A;  2Y74 A;  3ZFZ A;  1EUI C;  3FG3 A;  4EC6 A;  3EB8 A;  1FGM A;  4FMC A;  5STD A;  1T2H A;  3FF2 A;  2KRT A;  2GU3 A;  3AHS A;  3GSP A;  4LMI A;  2SBL A;  2IUJ A;  3CCE 3;  3EHC A;  2HML B;  1Q7Y 4;  1BRH A;  3JUQ A;  1AVK A;  1M9G A;  4FR9 A;  1X1X A;  4MMZ B;  1GOY A;  3LTC A;  4OVM A;  1EQK A;  1S5A A;  4HM2 B;  5LC7 A;  3BLZ A;  1QMA A;  4ILF A;  2QGU A;  1US1 A;  3FZW A;  1W6Y A;  3FGY A;  5BVB A;  3CCL 3;  1B3S A;  2P38 A;  1GD4 A;  1MWT A;  7RNT A;  2YX9 A;  3WDG B;  1UI7 A;  1B2S A;  1TUH A;  1TJD A;  1A2V A;  4I5Q A;  4U13 A;  4EV5 A;  2OWP A;  2OQE A;  1W02 A;  2STD A;  1A90 A;  1ROA A;  4KZ1 A;  3CCJ 3;  2ZA4 A;  3KZT A;  1V74 A;  2W56 A;  1IK3 A;  3KSP A;  1IQX A;  4RNY A;  4HYZ A;  1GSP A;  1K9M 4;  1FGQ A;  1RRH A;  2XGL A;  2CX0 A;  2F4Y A;  2INX A;  4AEQ A;  2RSX A;  1ULJ B;  3NV0 B;  1YGE A;  1PYL A;  1W4N A;  3DUK A;  3SVA A;  2IYJ A;  3JUN A;  1FW7 A;  2CWT A;  7STD A;  4O3V A;  2CWU A;  1BIR A;  1PY3 A;  2SAR A;  1BRJ A;  3LZA A;  1W2B 2;  2WO0 A;  2K54 A;  3DXO A;  3F14 A;  2R4I A;  1RNB A;  3HOH A;  3AMO A;  3GZY B;  1C54 A;  2K0M A;  1JV2 B;  5LC6 A;  3RNT A;  1Q40 A;  1ISK A;  5G2G A;  5D83 A;  4K61 A;  1RDS A;  3SOY A;  3UJM A;  4O8S A;  1OHO A;  3F40 A;  2Z6B A;  3ZG5 A;  1YJW 3;  3PGB A;  1YJN 3;  3CD6 3;  5IF6 A;  1JKG A;  4N6N B;  1PFP A;  1FA3 A;  1NB3 I;  1YJ9 3;  3G0K A;  2KF6 A;  2P0X A;  3BND A;  2W0Q A;  3EBY A;  3N9H A;  2IA7 A;  1I0V A;  3FSD A;  2WGO A;  5AYR B;  3JUO A;  2OTJ 3;  3OX9 A;  3OWY A;  4MMX B;  4N6U A;  1QVF 2;  2AAE A;  3Q90 A;  4TX4 A;  3FF0 A;  1BSD A;  2GEX A;  1ZS7 A;  3NQZ A;  4R1K A;  2BHM A;  1GY6 A;  2Z76 A;  3HX8 A;  2OOV C;  4KFE A;  1TP6 A;  5GSP A;  3CNM A;  3X40 A;  6GSP A;  1JN5 B;  1FYS A;  1Q42 A;  2L4V A;  3UB1 A;  4J5G A;  1MGR A;  1LQG C;  3MG2 A;  3WHO A;  2I9W A;  3CMA 3;  4HVN A;  1SQW A;  1UCI A;  4GHO A;  1LOX A;  4EW5 A;  3OWS A;  2R41 A;  4WHA A;  4XDV A;  5HGR A;  1V57 A;  2CG0 A;  3J7Y d;  5M19 A;  3LOY A;  4HM0 B;  1K41 A;  2CK3 H;  1OHP A;  1R4Y A;  2E2U A;  1LOW A;  4K1V A;  1GOV A;  1JBS A;  1BAN A;  4X2O A;  4H3U A;  1I0X A;  2O9U X;  1IQY A;  1SAR A;  3N54 B;  3MWZ A;  1CH0 A;  3SLU A;  2XFS A;  2W6J H;  1RLS A;  4EV2 A;  1NU3 A;  1BSB A;  1YIJ 3;  1Q7H A;  2XSH B;  2XF3 A;  1GYB A;  1N5P A;  1VQ6 3;  4HM6 B;  2CG1 A;  3MSO A;  1M1X B;  1W6G A;  1VQ9 3;  1RN1 A;  4EXR A;  4R9K A;  5TGN A;  2ZDJ A;  3MYT A;  3WR2 A;  2XGN A;  3BNE A;  2AAD A;  2WGQ A;  1N9J A;  4XB5 A;  9RNT A;  1M1K 4;  2Z7A A;  4HOH A;  4WP5 A;  3GZX B;  1WNH A;  2BU4 A;  1STD A;  2Q07 A;  3A76 A;  4O02 B;  3ER7 A;  3S29 A;  3VSY A;  1CQS A;  1UUW B;  1RRL A;  1UUV B;  3EX9 A;  3K5T A;  5CLK A;  5JBS A;  4AKY A;  2QA4 3;  1YNV X;  1LRA A;  3QK9 A;  1BNR A;  5IER A;  2OCT A;  4WFO A;  1BRG A;  4GB5 A;  1G0T A;  1W01 A;  3DMC A;  3KCH A;  3WA2 X;  3CCV 3;  3X3Y A;  2Z77 A;  2BMQ B;  2F5W A;  1MGW A;  1QAK A;  3URP A;  3CCQ 3;  3Q2P A;  3GAX A;  3EN1 B;  3HK4 A;  2BO9 B;  1W2Z A;  1D6U A;  3DGM A;  4HBR A;  3G71 3;  3B7C A;  5FW5 A;  1JJ2 2;  4L8O A;  3I55 3;  4XDW A;  5BXQ A;  4CDL A;  2GU1 A;  4HAA A;  4K1U A;  1ASK A;  2BMR B;  3S27 A;  3S28 A;  3MG3 A;  1OH0 A;  4HM8 B;  1UCJ A;  4OK0 A;  4XM4 A;  1FGO A;  1FUS A;  5IG3 A;  1UW1 A;  1AR0 A;  1B2Z A;  1QJG A;  2XRX B;  3D9R A;  2CIU A;  3BU4 A;  3AGN A;  4R80 A;  1RGH A;  1TRQ A;  4CCV A;  1GMR A;  3MG1 A;  1ROV A;  5BU4 A;  1TFO A;  1BSC A;  1GY5 A;  2XFT A;  1ZX2 A;  4GSP A;  3OXA A;  4HM1 B;  1OUN A;  3HII A;  1RCL A;  3Q3F A;  3EE1 A;  3IMA B;  3S67 A;  3HI7 A;  2QEX 3;  1OPY A;  3B8L A;  3EN8 A;  1X1Y A;  3IPT A;  3EJV A;  3N8B A;  2RCD A;  1SIH A;  5ELU A;  3WMD A;  1AQZ A;  3RGR A;  3H3H A;  3UNL A;  3LT9 A;  3PYJ A;  1A2P A;  1RGG A;  2LQV A;  1WTH A;  3F8H A;  1O7M B;  1RGC A;  3MKI A;  2CC3 A;  1I70 A;  1J2B A;  1BNG A;  1LQM B;  4HM4 B;  5AEU B;  1UCL A;  2QIY A;  3ROB A;  2W9Q A;  3JVC A;  2WOF A;  5IW9 A;  1E97 A;  3QRD A;  3X3X A;  3F8X A;  3SED A;  3FCS B;  4AKZ A;  2ML5 A;  3WOE B;  1BRS A;  2IMJ A;  1CEW I;  4K90 B;  1RGL A;  6RNT A;  1BNS A;  3X42 A;  2E2T A;  1B27 A;  2MF7 A;  2WOH A;  4EBG A;  5AII A;  5KP4 A;  2RNT A;  1RJO A;  3FG1 A;  4IPB A;  5I97 A;  1Q86 4;  2B1X B;  2L1S A;  1TU5 A;  1W5Z A;  3SYU A;  4L7K A;  3JUP A;  3G8Z A;  1DVD A;  4HM7 B;  4KFF A;  2O3O A;  1IVU A;  2UGI A;  3X3Z A;  2FNQ A;  1RGK A;  3LML A;  1HYF A;  3DY5 A;  5CF2 A;  1LOV A;  1WMN A;  4FCZ A;  3STD A;  1NNV A;  3CC4 3;  2W03 A;  1Y4K A;  3KII A;  1JN5 A;  3X41 A;  4HZ9 B;  2HOH A;  2KF3 A;  3DGO A;  2UX0 A;  1B2M A;  4J8T A;  5AIG A;  2BT3 A;  4WYK B;  3LH4 A;  5DRV A;  1Q9E A;  1UGH I;  5IEN A;  5CF1 A;  4N6L A;  2OTL 3;  3PCS A;  1BRN L;  1TFK A;  1GD3 A;  1NDO B;  4BL3 A;  4RZM A;  1JB5 A;  1OCV A;  2C4B A;  3I0Y A;  4JRF A;  5EEO A;  1HKX A;  4N6T A;  3NUV A;  1NJI 4;  3BIR A;  5AYS C;  1VQK 3;  1BOX A;  1YHQ 3;  1MNL A;  1Q40 B;  1D6Z A;  2PNC A;  2XSO B;  1O7G B;  3D4A A;  1L5G B;  3U1W A;  1FUW A;  3CCR 3;  4Q53 A;  1Z1S A;  2IUK A;  4MEI A;  1VQ5 3;  1BNJ A;  5IG5 A;  4XBT A;  4EYC A;  1VQM 3;  1M90 4;  3ALA A;  4FMB A;  3V99 A;  1VQ4 3;  4LZI A;  3CC7 3;  4I4K A;  1JKG B;  2H0I A;  1QAL A;  3PS8 A;  1S72 3;  2BMO B;  1Q81 4;  1B2U A;  1JRQ A;  2XH9 A;  2F99 A;  3BNB A;  3KSE D;  2C11 A;  3LTA A;  3OV4 A;  4J9A A;  1BUQ A;  6STD A;  1CYV A;  1K73 4;  2FXT A;  3NXJ A;  1N5H A;  1ZGX A;  1BRK A;  1RMS A;  3NQY A;  3CPW 2;  4DKI A;  1VQ8 3;  1TIJ A;  1DMN A;  3EF8 A;  4IT7 A;  3LXU X;  2MC8 A;  3KN4 A;  4BTW A;  2GBX B;  4OUQ A;  5EVH A;  1AY7 A;  5DRE A;  3NM2 A;  3F7S A;  1RN7 A;  3U97 A;  3FLJ A;  2GXF A;  1MWS A;  1FGR A;  1YVB I;  1EKM A;  3FG4 A;  2ZHX B;  3NX0 A;  2JDI H;  2FGT A;  3FKA A;  3D3L A;  1X1U A;  1DMM A;  1FZU A;  1G96 A;  3NHX A;  1BNE A;  2UUG C;  1QVG 2;  1JZD A;  1OF5 B;  1RN4 A;  1W00 A;  1FGT A;  1B21 A;  4GL6 A;  2CHC A;  1K28 A;  3VGN A;  1ZO2 A;  1IVW A;  3HIG A;  2F56 A;  3GZR A;  5CXO A;  2OOV A;  3G4S 3;  1IVX A;  1B20 A;  1IT8 A;  1KWI A;  1TTO A;  3EBT A;  1DVC A;  2W9P A;  4JF8 A;  8RNT A;  1OGX A;  5BIR A;  5CK6 A;  3MHE A;  1IV7 A;  3UL6 A;  4HM3 B;  1UUG B;  4FCM A;  2PZV A;  1O7P B;  2YFI B;  2KAA A;  5IEO A;  2CH9 A;  3NM7 A;  1JZO A;  5AIH A;  2K3D A;  3WOD G;  5D82 A;  2BNG A;  1IQ8 A;  3K9M C;  4CJN A;  3T0U A;  1I8V A;  1BGS A;  3KE7 A;  2CFL A;  5M1A A;  1ULI B;  5ELJ A;  1I3I A;  2HMO B;  3BNC A;  4KT3 B;  1KD1 4;  3DGN A;  1YGW A;  5AIF A;  2HMJ B;  4BL2 A;  1T2I A;  4ZM8 A;  3LT8 A;  3G6E 3;  1SJW A;  1BVI A;  2CX1 A;  1O7H B;  4X2H A;  1G02 A;  2JQ5 A;  5EQL A;  3GZB A;  1SII A;  4KFD A;  2GEY A;  3KKG A;  3NV0 A;  1BUJ A;  1BSE A;  1MWR A;  2B24 B;  1RCK A;  2KXG A;  1BAO A;  2D1W A;  4NRE A;  3WA3 A;  1UGI A;  4XBY A;  5IG0 A;  1W7C A;  2RBI A;  2H0H A;  3PCR A;  3SXX A;  5KP3 A;  2H0G A;  2YFJ B;  1V58 A;  3T8N A;  2CFG A;  3SX1 A;  1BU4 A;  3CPO A;  1Q82 4;  2F86 B;  2CKF B;  3NBB A;  3V92 A;  3OW2 2;  1DYU A;  1U5O A;  2RFR A;  1IDP A;  1JB2 A;  1DE3 A;  3T8U A;  2HMK B;  3LTD A;  3CME 3;  1VQ7 3;  1JBR A;  3V98 A;  3PZW A;  3I56 3;  1YVS A;  3EQQ B;  1GY7 A;  4BTY A;  1KQS 2;  4FCJ A;  1GMQ A;  1X1W A;  3MPH A;  2CFD A;  1B2X A;  3ZG0 A;  4NHF A;  3S5C A;  2GBW B;  1OHS A;  3M8C A;  1WMP A;  2GSP A;  2W04 A;  4R9L A;  1MOL A;  3VF1 A;  1JBT A;  3AHW A;  2CWV A;  1RHL A;  1KC8 4;  1VQO 3;  1JB4 A;  2F5M A;  3DZL A;  3CCU 3;  1VQL 3;  1I2E A;  1IYY A;  3Q1C A;  2CFK A;  2P0M A;  3DGL A;  4QWT A;  1HU9 A;  1F8N A;  4WYK A;  1OGZ A;  1RTU A;  1OAC A;  3CU3 A;  3H51 A;  2W56 B;  3ECF A;  1FUT A;  3GRD A;  4MMY B;  5G1K A;  1AVL A;  4LGQ A;  1C7H A;  1IU7 A;  3OWU A;  2P09 A;  1I2G A;  2CFW A;  4HM5 B;  1RKY A;  4RNT A;  1KSI A;  3KFQ C;  2J8X B;  3L0R A;  4R4K A;  7GSP A;  1T5Y A;  4FMD A;  4L8P A;  4MJD A;  1A2K A;  3CCM 3;  1LVN A;  4N6O B;  5RNT A;  3WOF B;  1IVV A;  2F98 A;  2KCD A;  2HMM B;  3LTB A;  1BNI A;  1W6C A;  1RGE A;  4LSO A;  3FH1 A;  2RGQ A;  1GS3 A;  3E99 A;  3UL5 A;  8CHO A;  3BB9 A;  1I2F A;  2ZL8 A;  3AMO B;  2KF4 A;  3HZP A;  3RDE A;  1DMQ A;  3G16 A;  1CYU A;  2W2C A;  2IY2 A;  3D5I A;  1RGA A;  3K7C A;  4N3V A;  1RNT A;  4STD A;  5G1L A;  1BSA A;  2YFL B;  3EC9 A;  3SOA A;  1YI2 3;  3DH2 A;  1UI8 A;  2HMN B;  3NBJ A;  5JPP A;  1TRP A;  4HJL B;  3IJE B;  3GWR A;  1BNF A;  1VZZ A;  2E2V A;  2KF5 A;  1AV4 A;  4KVH A;  3TDG A;  3CXC 2;  1EG9 B;  1UCK A;  3CC2 3;  1O7W B;  4CPK A;  1WMO A;  5KP1 A;  4O2H A;  5AEW B;  1QAF A;  2LYX A;  1RGF A;  1EA2 A;  1LXE A;  1IV9 A;  1OF5 A;  1STF I;  1WQL B;  4WWU C;  4J5K A;  4BTX A;  4BIR A;  3DM8 A;  3D5G A;  1LNI A;  2P05 A;  4IIA A;  1LNH A;  1NB5 I;  5M18 A;  3PXM A;  1YIT 3;  1EEJ A;  2Y73 A;  2C10 A;  4XBX A;  2XEP A;  4G1M B;  5HOH A;  2ML6 A;  5IG4 A;  1T3B A;  3A5E A;  1R4C A;  1E3V A;  1E3R A;  1U8C B;  4BU4 A;  4NPB A;  1UDI I;  1MWU A;  5JPU A;  1N8R 4;  3K0Z A;  2XR8 B;  2M7O A;  1D6Y A;  4N6V 0;  5A0O B;  1N8Q A;  5FGO A;  5IEP A;  1I3F A;  4H61 A;  2CW9 A;  4HZB B;  2V1L A;  4N6M A;  2A15 A;  1N9E A;  1A67 A;  3NBR A;  2OQE C;  3K63 A;  3B4O A;  4RNZ A;  1RSN A;  4FMA A;  3CNX A;  1GMP A;  1NO3 A;  1SPU A;  3F9S A;  5D81 A;  2D42 A;  1VQN 3;  1VQP 3;  4HKV B;  3D79 A;  3F7X A;  3AGO A;  3DGY A;  1LOY A;  1K8A 4;  4PEJ A;  1PU4 A;  3LYG A;  3O8Y A;  4LEH A;  3B4P A;  5AI1 A;  1HZ1 A;  1GOU A;  1JNQ A;  4LYL B;  2BIR A;  4ORL A;  4RBN A; 
#chains in the Genus database with same CATH homology
 1YVS A;  1B2M A;  1CH0 A;  1GMQ A;  1DET A;  1X1W A;  1BRI A;  1Q9E A;  1RLS A;  1BSB A;  1B2X A;  1BRN L;  1T2H A;  3AHS A;  2GSP A;  3GSP A;  2C4B A;  1RN1 A;  1JBT A;  3AHW A;  3BIR A;  1BOX A;  1BRH A;  1RHL A;  1X1X A;  3WR2 A;  1GOY A;  2F5M A;  3D4A A;  1I2E A;  1IYY A;  2AAD A;  9RNT A;  1BNJ A;  4HOH A;  1RTU A;  2BU4 A;  1FUT A;  1B3S A;  1I2G A;  1B2U A;  4RNT A;  1YNV X;  1LRA A;  7RNT A;  1BNR A;  7GSP A;  1B2S A;  1BRG A;  1BRK A;  1ZGX A;  1RMS A;  3KCH A;  5RNT A;  1BNI A;  2ZA4 A;  2F5W A;  1RGE A;  1MGW A;  3URP A;  1AY7 A;  1GSP A;  1I2F A;  2KF4 A;  2KF3 A;  2F4Y A;  4HAA A;  1PYL A;  3D5I A;  1RGA A;  1RNT A;  1X1U A;  1FW7 A;  1BSA A;  1FZU A;  1UCJ A;  1BNE A;  1BIR A;  1FUS A;  1PY3 A;  1B2Z A;  1RN4 A;  1BRJ A;  2SAR A;  3DH2 A;  1B21 A;  3BU4 A;  3AGN A;  1RGH A;  1TRQ A;  1TRP A;  1GMR A;  1RNB A;  1BNF A;  3HOH A;  2F56 A;  5BU4 A;  1BSC A;  2KF5 A;  1C54 A;  4GSP A;  3RNT A;  1B20 A;  1RCL A;  3Q3F A;  1TTO A;  1RDS A;  1UCK A;  8RNT A;  5BIR A;  1X1Y A;  1RGF A;  1AQZ A;  2KAA A;  4J5K A;  4BIR A;  1A2P A;  1RGG A;  3D5G A;  1LNI A;  2KF6 A;  1RGC A;  1I70 A;  1BNG A;  1I8V A;  1BGS A;  1UCL A;  1I0V A;  5HOH A;  3A5E A;  4BU4 A;  1I3I A;  1YGW A;  1T2I A;  2AAE A;  1BRS A;  1I3F A;  1BSD A;  1BVI A;  6RNT A;  1RGL A;  1G02 A;  1BNS A;  5GSP A;  1B27 A;  6GSP A;  1FYS A;  2RNT A;  1BUJ A;  4J5G A;  1BSE A;  1RCK A;  1RSN A;  1MGR A;  3WHO A;  1BAO A;  3SYU A;  1UCI A;  1GMP A;  4GHO A;  2RBI A;  1JBR A;  1BU4 A;  1RGK A;  1HYF A;  3AGO A;  1LOY A;  3DGY A;  1LOV A;  1R4Y A;  1LOW A;  1GOV A;  1GOU A;  1HZ1 A;  1DE3 A;  2BIR A;  1BAN A;  1JBS A;  1I0X A;  2HOH A;  1SAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...