3BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3bu4A00
2KF4A 1BSBA 2HOHA 1B2MA 1MGRA 1MGWA 1FUSA 3HOHA 1AY7A 1BUJA 1RGAA 1GMPA 1BRKA 1X1YA 1BNFA 5BIRA 1T2HA 2BU4A 1B27A 1JBTA 1YVSA 3AHSA 4BU4A 1BNGA 3D4AA 1BNIA 1BSCA 1PY3A 3DH2A 1FUTA 1RGLA 1TRPA 1JBSA 1BOXA 1R4YA 6RNTA 1LOYA 1RCLA 1FW7A 1BRJA 3AGOA 3KCHA 2GSPA 1I70A 1RGHA 1BSDA 5BU4A 1BNJA 4HAAA 2RNTA 3BIRA 6GSPA 1DE3A 1I2FA 1LOWA 1RSNA 1BNSA 1LOVA 2KF6A 1FYSA 1GOVA 5HOHA 1RGEA 1BAOA 1RMSA 1I3FA 3SYUA 1I2EA 1JBRA 1YNVX 1BRNL 1BRGA 4GHOA 4J5KA 8RNTA 1BRHA 1I0VA 1RDSA 1B3SA 2KAAA 3DGYA 1BU4A 1DETA 3AHWA 1X1UA 1RCKA 1RHLA 9RNTA 2F5MA 3AGNA 5GSPA 2BIRA 1RLSA 2F4YA 1BVIA 1HYFA 1Q9EA 1FZUA 3WR2A 1CH0A 1BSAA 1RGGA 1UCLA 1I2GA 1BRIA 1BIRA 1G02A 1BNEA 3D5IA 1RTUA 2KF3A 1RNTA 1TTOA 1X1XA 7GSPA 1A2PA 1B2ZA 2C4BA 1GOUA 1BGSA 1GMRA 1I0XA 1UCJA 1ZGXA 1B20A 3A5EA 1RGFA 1LRAA 1RGCA 1TRQA 2F56A 4HOHA 3GSPA 3D5GA 1LNIA 1BSEA 1BANA 1RNBA 1I8VA 1RGKA 1YGWA 2AADA 3Q3FA 1X1WA 1IYYA 2F5WA 3BU4A 1BRSA 2RBIA 1UCKA 3RNTA 1UCIA 4GSPA 3WHOA 1GOYA 4J5GA 7RNTA 1B2XA 2ZA4A 1RN1A 1B2SA 1GMQA 1HZ1A 3URPA 4RNTA 1AQZA 1T2IA 1BNRA 1C54A 1RN4A 1B21A 1B2UA 2SARA 2KF5A 1PYLA 5RNTA 2AAEA 1GSPA 1I3IA 1SARA 4BIRA
chains in the Genus database with same CATH superfamily
1BSBA 2KCDA 4KFEA 1W5ZA 2ZL8A 3T8UA 2MC8A 1WQLB 1LQMB 2BO9B 3X3YA 1Q7HA 4O8SA 2XF3A 1GMPA 1MOLA 2XEPA 2E2UA 2CWTA 3V92A 1QVG2 2K0MA 2R41A 1O7MB 4MMXB 2P05A 1UW1A 3FG1A 4X2OA 5BVBA 3X41A 2OWPA 3G8ZA 3I553 4N6LA 1GS3A 5AIHA 5M19A 1MWRA 1TUHA 1BSCA 3G4S3 5IG5A 1JZOA 1STDA 3JVCA 2OCTA 5STDA 4N6TA 3RGRA 2E2VA 2XGLA 3FH1A 1DVCA 3LTCA 1IVXA 3SXXA 4FR9A 1FGMA 3WA3A 1BOXA 2UUGC 3K5TA 2CG1A 4HM6B 1JBSA 4KVHA 1LOYA 1RRLA 2CG0A 4HM4B 1YHQ3 3EX9A 1UI7A 4FMBA 5CXOA 1YJW3 2KRTA 1ULJB 1I70A 3FG3A 2Y74A 1OUNA 2CWVA 5LC6A 3WOEB 3F8HA 2RNTA 3BIRA 3GZRA 1C7HA 1KWIA 1KSIA 2P0MA 3M8CA 3J7Yd 3Q1CA 5HOHA 1GOVA 4MEIA 4HBRA 2YFJB 1IK3A 1RMSA 1I3FA 5JPUA 1I2EA 1JBRA 4WWUC 4BL3A 4L7KA 1T3BA 5JBSA 4GL6A 1IQXA 5KP4A 3U1WA 1O7PB 1ISKA 4I4KA 4J5KA 2XGNA 3KE7A 5FW5A 1I0VA 1VQ53 3V99A 1BU4A 1DETA 1SJWA 5G2GA 1UUGB 4CJNA 3TDGA 1Q7Y4 2XSOB 1UUWB 3AGNA 2XRXB 5G1KA 3SVAA 1RLSA 2W0QA 3CCJ3 1BVIA 1HYFA 1EG9B 1K28A 1V57A 1Q9EA 1FZUA 4X2HA 3WR2A 1TU5A 3UNLA 2UX0A 3LXUX 5IEOA 3CD63 3LH4A 3NQYA 4XBTA 2J8XB 1O7WB 1JV2B 4OK0A 1BNEA 4LSOA 2H0HA 3H3HA 3HIIA 1TTOA 2JDIH 3DUKA 1WTHA 1B2ZA 1VQP3 4ZM8A 2CK3H 1I0XA 2D42A 1GMRA 3FGYA 2CFKA 1PU4A 4N6UA 5IG3A 2IUKA 1A2KA 1BSEA 3QRDA 2Q07A 4RNYA 4LMIA 1BANA 3ZFZA 4XM4A 4HM0B 1N8QA 1EKMA 2BT3A 3F7XA 1IDPA 2CFLA 3SX1A 4CPKA 1W00A 1YGWA 3Q3FA 3JUNA 3Q90A 1KC84 3LOYA 4BTYA 4HM1B 4HM8B 3NXJA 4NHFA 4HJLB 4N6V0 3ZG5A 1RRHA 4HM7B 3WHOA 3S27A 3AMOB 1GOYA 1RJOA 2STDA 1B2XA 1RN1A 4L8PA 1US1A 2FGTA 1AQZA 3EBYA 1V74A 1IU7A 3MG1A 4H61A 4EXRA 1RN4A 1UI8A 5FGOA 3B7CA 2SARA 3LZAA 1W2B2 1VQ43 2AAEA 2GBWB 4TX4A 2K54A 1NNVA 1ROAA 3F40A 3HIGA 2W03A 3HI7A 1WMNA 1N9EA 1MGRA 1N5HA 5IF6A 1MGWA 1VZZA 1FUSA 3HOHA 1AY7A 2YFIB 3WOFB 1DYUA 3OWSA 3U97A 2B24B 1BNFA 3RDEA 1N9JA 1OH0A 1JB4A 1GD3A 3O8YA 4XDVA 1QMAA 4EBGA 2RFRA 1MWSA 3CCU3 1N8R4 1NO3A 2HMKB 4WYKB 3AHSA 2P09A 1CEWI 1BNGA 1O7HB 1BNIA 3MPHA 3NBRA 1E3VA 4N6MA 1GY5A 4EV5A 4GB5A 2WOFA 2ZDJA 1TRPA 1LXEA 3VF1A 1VQ63 4J8TA 1E3RA 2JQ5A 3I0YA 2OOVA 2C11A 1BRJA 5M1AA 1SIIA 1D6UA 4MMYB 2BHMA 1DMNA 1W6GA 4K90B 3HZPA 1ZX2A 5D83A 1NB3I 2QA43 1Y4KA 5DREA 1W6YA 1GD4A 1LOWA 1W2ZA 3FF2A 4R4KA 3G6E3 3BLZA 5JPPA 2BMQB 2HMLB 2KF6A 2LQVA 3GRDA 4LZIA 2HMNB 1BUQA 4RBNA 3SYUA 1QAFA 2OQEC 3MKIA 4ORLA 3N8BA 4XBXA 3B4PA 4HZBB 1IT7A 1JN5B 4O02B 5IW9A 3H51A 2XH9A 3EQQB 1OCVA 1B3SA 4K61A 3G0KA 3VGNA 3X3XA 3CC23 4LEHA 1ZO2A 3SOAA 4CCVA 3BNEA 4HZ9B 3FCSB 3LTBA 3CNMA 3OWUA 1AVKA 9RNTA 3L0RA 1Z1SA 1YIJ3 1T5YA 2IMJA 5ELJA 3D3LA 3DGNA 4KFFA 3KIIA 1YGEA 1KQS2 3NBJA 1CYUA 4MMZB 3CNXA 1RGGA 2H0IA 3D5IA 1JZDA 3DY5A 4XBYA 3IPTA 2FNQA 1WMOA 1SQWA 1W02A 3DGLA 1OHPA 1SPUA 3LMLA 7GSPA 1VQM3 1BGSA 1VQ83 2BMRB 1RGFA 4HYZA 3GSPA 4OUQA 5ELUA 3D5GA 4WP5A 1E97A 2HMOB 2H0GA 3AMOA 1IVVA 2MF7A 5D82A 8CHOA 1K734 1RNBA 1I8VA 2B1XB 1RGKA 3JUOA 1QJGA 2IA7A 2AADA 3KSED 3PZWA 1X1WA 1IYYA 2XSHB 2BNGA 3BU4A 1R4CA 3EJVA 2CWUA 2M7OA 3EE1A 1FGTA 2E2TA 1VQN3 2ML5A 1OHOA 7RNTA 1NB5I 3PXMA 1HZ1A 4RNTA 3JUPA 4EC6A 1RN7A 1F8NA 1M9GA 2BMOB 2QGUA 2RSXA 4IPBA 7STDA 1BNRA 1GY7A 3SLUA 5BXQA 5CF1A 1C54A 3MG2A 1CYVA 1N5PA 1JRQA 2W04A 3DMCA 1B2UA 1IV7A 3EN1B 1V58A 2CFGA 3BNBA 4FCMA 4R9LA 1TFKA 2ML6A 5RNTA 2CKFB 3GZBA 3PYJA 1OPYA 4JF8A 3CC43 1ASKA 2CH9A 1B2MA 1W4NA 1K9M4 2KF4A 2PNCA 2HOHA 4BTXA 4EYCA 4WYKA 1M1XB 3CCQ3 3T0UA 2P0XA 4FMDA 1JKGA 1O7GB 2GU1A 3NQZA 4LGQA 2IUJA 1A90A 1BRKA 1GY6A 1CQSA 3ER7A 5BIRA 2CHCA 3DXOA 1LQGC 3CCE3 1FA3A 3DGOA 4OVMA 1Q864 1B27A 3FLJA 5AYRB 1YVSA 2XFTA 3I563 5AIFA 4BU4A 3OWYA 1DMQA 1MNLA 3D4AA 3MG3A 2CC3A 3UL5A 3DH2A 1LVNA 2GEXA 1FUTA 2LYXA 3BB9A 1RGLA 4IIAA 3ALAA 1EQKA 4CDLA 2L1SA 3EN8A 3OW22 1R4YA 1QALA 6RNTA 3NBBA 1RCLA 3NX0A 1FW7A 1W7CA 3AGOA 3FF0A 3FKAA 3FG4A 4AKZA 2GSPA 5CK6A 3QK9A 1BSDA 1JN5A 2CFWA 3K63A 1BNJA 2W2CA 1VQ93 4AEQA 3GAXA 1K41A 5IG0A 1I2FA 1DE3A 2V1LA 6STDA 2WGQA 3K0ZA 1D6YA 3DZLA 1L5GB 1LOVA 2FXTA 2W56B 3NM2A 1BAOA 4EW5A 3WDGB 3MHEA 2GEYA 2GU3A 1YNVX 3IMAB 2CW9A 2YX9A 4MJDA 4QWTA 3UL6A 5EEOA 3BNDA 1D6ZA 2HMJB 1JKGB 1EUIC 4GHOA 1BRHA 3GZXB 8RNTA 1BRNL 1K8A4 3CU3A 2KXGA 3AHWA 1X1UA 3MYTA 5IEPA 3Q2PA 1RCKA 1RHLA 5D81A 3SEDA 3KSPA 3PGBA 1S5AA 3GWRA 1ZS7A 2F5MA 1S723 4IT7A 2F4YA 1RKYA 1O7NB 4BTWA 1KD14 1SIHA 1BSAA 2F98A 2RGQA 1UCLA 5LC7A 1BRIA 1G02A 3EBTA 3B8LA 3CPW2 3X42A 2OTJ3 1RTUA 2XFSA 2KF3A 5G1LA 3CCR3 4RNZA 1RNTA 3WMDA 3LYGA 1IV9A 1Q40B 2C4BA 4N6NB 1GOUA 1FGQA 3A5EA 4JRFA 1RGCA 1TRQA 2A15A 2F56A 5EQLA 1A2VA 4Q53A 1LNIA 1FGRA 4HM3B 5HGRA 4U13A 3NUVA 4FCJA 1NDOB 4N3VA 5A0OB 1NJI4 1G96A 3LTAA 3ROBA 3OX9A 4FMAA 1HKXA 3HX8A 2F5WA 3K9MC 1UGHI 1W6CA 3NV0B 3CME3 3D79A 4HVNA 1BRSA 2RBIA 1OACA 5IERA 1WMPA 1UCIA 3DGMA 3MSOA 3NM7A 2I9WA 3DM8A 3ZG0A 4NREA 1TFOA 1IVUA 1NWWA 4KT3B 4NPBA 2W6JH 1UDII 1LOXA 1OF5B 3MWZA 3N9HA 2ZA4A 1GMQA 1JB2A 3SOYA 4O2HA 2GBXB 1OGXA 1NU3A 1A67A 5IG4A 4H3UA 1PYLA 2YFLB 1UGIA 3HK4A 3KFQC 4KFDA 3CCL3 3JUQA 1GSPA 4N6OB 3PS8A 1TP6A 1I3IA 2WGOA 1Q42A 1OHSA 5M18A 1JB5A 1VQO3 3B4OA 5TGNA 2P38A 4KZ1A 3D9RA 4G1MB 5AI1A 2IYJA 1UUVB 4K1VA 1JNQA 2WO0A 3EF8A 1BUJA 1G0TA 1RGAA 2R4IA 1X1YA 2WOHA 1T2HA 2D1WA 2INXA 4AKYA 4ILFA 1AVLA 2RCDA 1QAKA 2BU4A 4FMCA 4BL2A 1JBTA 3UJMA 3X3ZA 2OQEA 1YI23 4RZMA 1AV4A 2PZVA 2Z6BA 1PY3A 3S29A 2L4VA 4FCZA 1Q824 3CCM3 3WA2X 4XB5A 1TJDA 2C10A 2ZHXB 3PCSA 3F9SA 3F8XA 1Q814 1YJ93 3EHCA 1MWTA 2W56A 3N54B 2SBLA 3KN4A 3S67A 2CIUA 1JJ22 3F14A 3KCHA 4HM2B 4O3VA 2W9QA 1FUWA 1RGHA 5BU4A 3LT8A 4HAAA 6GSPA 3CPOA 1RSNA 2IY2A 3T8NA 4HKVB 1BNSA 3V98A 5AIIA 1FYSA 4WHAA 3CC73 1RGEA 1YJN3 1M904 1AR0A 1J2BA 1VQK3 1WNHA 1VQQA 2K3DA 2QIYA 1U8CB 3RGAA 4L8OA 4HM5B 2OTL3 5AIGA 1BRGA 3OV4A 5EVHA 2CX1A 3FZWA 3G16A 1RDSA 2KAAA 3DGYA 5AYSC 1ROVA 2UGIA 5KP3A 2Z77A 2HMMB 2Z7AA 2F86B 3KZTA 4EV2A 1TIJA 1VQ73 1Q40A 1EEJA 1ULIB 2OOVC 5GSPA 2BIRA 5AEWB 5AEUB 2O9UX 2Y73A 4LYLB 1DVDA 1CH0A 3GZYB 3ECFA 3FSDA 1I2GA 5DRVA 1BIRA 1IQ8A 1DMMA 3CCS3 1X1XA 3G713 3CCV3 1LNHA 1A2PA 2QEX3 3NV0A 5CLKA 3K7CA 1EA2A 1HU9A 1ZGXA 1UCJA 4XDWA 1B20A 1U5OA 4I5QA 1LRAA 3OXAA 4HOHA 4K1UA 4R80A 2O3OA 1QVF2 1FGOA 1OF5A 3PCRA 4J9AA 2CX0A 4WFOA 1IVWA 1MWUA 3CMA3 3KKGA 3NHXA 4STDA 3CXC2 1W01A 2CFDA 3BNCA 1UCKA 3IJEB 4R9KA 3RNTA 3STDA 1PFPA 3F7SA 3LT9A 4GSPA 3JUMA 1OGZA 4J5GA 1GYBA 3EB8A 3URPA 1B2SA 4R1KA 3X40A 2GXFA 2XR8B 3E99A 3EC9A 1VQL3 2W9PA 5IENA 1IQYA 1M1K4 1T2IA 4DKIA 1STFI 5I97A 5CF2A 3LTDA 1B21A 3S28A 3VSYA 2Z76A 3A76A 4PEJA 2KF5A 2F99A 3WODG 1IT8A 5KP1A 1YIT3 3S5CA 1YVBI 1SARA 3UB1A 4BIRA
chains in the Genus database with same CATH topology
2KF4A 1BSBA 2HOHA 1B2MA 1MGRA 1MGWA 1FUSA 3HOHA 1AY7A 1BUJA 1RGAA 1GMPA 1BRKA 1X1YA 1BNFA 5BIRA 1T2HA 2BU4A 1B27A 1JBTA 1YVSA 3AHSA 4BU4A 1BNGA 3D4AA 1BNIA 1BSCA 1PY3A 3DH2A 1FUTA 1RGLA 1TRPA 1JBSA 1BOXA 1R4YA 6RNTA 1LOYA 1RCLA 1FW7A 1BRJA 3AGOA 3KCHA 2GSPA 1I70A 1RGHA 1BSDA 5BU4A 1BNJA 4HAAA 2RNTA 3BIRA 6GSPA 1DE3A 1I2FA 1LOWA 1RSNA 1BNSA 1LOVA 2KF6A 1FYSA 1GOVA 5HOHA 1RGEA 1BAOA 1RMSA 1I3FA 3SYUA 1I2EA 1JBRA 1YNVX 1BRNL 1BRGA 4GHOA 4J5KA 8RNTA 1BRHA 1I0VA 1RDSA 1B3SA 2KAAA 3DGYA 1BU4A 1DETA 3AHWA 1X1UA 1RCKA 1RHLA 9RNTA 2F5MA 3AGNA 5GSPA 2BIRA 1RLSA 2F4YA 1BVIA 1HYFA 1Q9EA 1FZUA 3WR2A 1CH0A 1BSAA 1RGGA 1UCLA 1I2GA 1BRIA 1BIRA 1G02A 1BNEA 3D5IA 1RTUA 2KF3A 1RNTA 1TTOA 1X1XA 7GSPA 1A2PA 1B2ZA 2C4BA 1GOUA 1BGSA 1GMRA 1I0XA 1UCJA 1ZGXA 1B20A 3A5EA 1RGFA 1LRAA 1RGCA 1TRQA 2F56A 4HOHA 3GSPA 3D5GA 1LNIA 1BSEA 1BANA 1RNBA 1I8VA 1RGKA 1YGWA 2AADA 3Q3FA 1X1WA 1IYYA 2F5WA 3BU4A 1BRSA 2RBIA 1UCKA 3RNTA 1UCIA 4GSPA 3WHOA 1GOYA 4J5GA 7RNTA 1B2XA 2ZA4A 1RN1A 1B2SA 1GMQA 1HZ1A 3URPA 4RNTA 1AQZA 1T2IA 1BNRA 1C54A 1RN4A 1B21A 1B2UA 2SARA 2KF5A 1PYLA 5RNTA 2AAEA 1GSPA 1I3IA 1SARA 4BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KF4 A;  1BSB A;  2HOH A;  1B2M A;  1MGR A;  1MGW A;  1FUS A;  3HOH A;  1AY7 A;  1BUJ A;  1RGA A;  1GMP A;  1BRK A;  1X1Y A;  1BNF A;  5BIR A;  1T2H A;  2BU4 A;  1B27 A;  1JBT A;  1YVS A;  3AHS A;  4BU4 A;  1BNG A;  3D4A A;  1BNI A;  1BSC A;  1PY3 A;  3DH2 A;  1FUT A;  1RGL A;  1TRP A;  1JBS A;  1BOX A;  1R4Y A;  6RNT A;  1LOY A;  1RCL A;  1FW7 A;  1BRJ A;  3AGO A;  3KCH A;  2GSP A;  1I70 A;  1RGH A;  1BSD A;  5BU4 A;  1BNJ A;  4HAA A;  2RNT A;  3BIR A;  6GSP A;  1DE3 A;  1I2F A;  1LOW A;  1RSN A;  1BNS A;  1LOV A;  2KF6 A;  1FYS A;  1GOV A;  5HOH A;  1RGE A;  1BAO A;  1RMS A;  1I3F A;  3SYU A;  1I2E A;  1JBR A;  1YNV X;  1BRN L;  1BRG A;  4GHO A;  4J5K A;  8RNT A;  1BRH A;  1I0V A;  1RDS A;  1B3S A;  2KAA A;  3DGY A;  1BU4 A;  1DET A;  3AHW A;  1X1U A;  1RCK A;  1RHL A;  9RNT A;  2F5M A;  3AGN A;  5GSP A;  2BIR A;  1RLS A;  2F4Y A;  1BVI A;  1HYF A;  1Q9E A;  1FZU A;  3WR2 A;  1CH0 A;  1BSA A;  1RGG A;  1UCL A;  1I2G A;  1BRI A;  1BIR A;  1G02 A;  1BNE A;  3D5I A;  1RTU A;  2KF3 A;  1RNT A;  1TTO A;  1X1X A;  7GSP A;  1A2P A;  1B2Z A;  2C4B A;  1GOU A;  1BGS A;  1GMR A;  1I0X A;  1UCJ A;  1ZGX A;  1B20 A;  3A5E A;  1RGF A;  1LRA A;  1RGC A;  1TRQ A;  2F56 A;  4HOH A;  3GSP A;  3D5G A;  1LNI A;  1BSE A;  1BAN A;  1RNB A;  1I8V A;  1RGK A;  1YGW A;  2AAD A;  3Q3F A;  1X1W A;  1IYY A;  2F5W A;  3BU4 A;  1BRS A;  2RBI A;  1UCK A;  3RNT A;  1UCI A;  4GSP A;  3WHO A;  1GOY A;  4J5G A;  7RNT A;  1B2X A;  2ZA4 A;  1RN1 A;  1B2S A;  1GMQ A;  1HZ1 A;  3URP A;  4RNT A;  1AQZ A;  1T2I A;  1BNR A;  1C54 A;  1RN4 A;  1B21 A;  1B2U A;  2SAR A;  2KF5 A;  1PYL A;  5RNT A;  2AAE A;  1GSP A;  1I3I A;  1SAR A;  4BIR A; 
#chains in the Genus database with same CATH topology
 1BSB A;  2KCD A;  4KFE A;  1W5Z A;  2ZL8 A;  3T8U A;  2MC8 A;  1WQL B;  1LQM B;  2BO9 B;  3X3Y A;  1Q7H A;  4O8S A;  2XF3 A;  1GMP A;  1MOL A;  2XEP A;  2E2U A;  2CWT A;  3V92 A;  1QVG 2;  2K0M A;  2R41 A;  1O7M B;  4MMX B;  2P05 A;  1UW1 A;  3FG1 A;  4X2O A;  5BVB A;  3X41 A;  2OWP A;  3G8Z A;  3I55 3;  4N6L A;  1GS3 A;  5AIH A;  5M19 A;  1MWR A;  1TUH A;  1BSC A;  3G4S 3;  5IG5 A;  1JZO A;  1STD A;  3JVC A;  2OCT A;  5STD A;  4N6T A;  3RGR A;  2E2V A;  2XGL A;  3FH1 A;  1DVC A;  3LTC A;  1IVX A;  3SXX A;  4FR9 A;  1FGM A;  3WA3 A;  1BOX A;  2UUG C;  3K5T A;  2CG1 A;  4HM6 B;  1JBS A;  4KVH A;  1LOY A;  1RRL A;  2CG0 A;  4HM4 B;  1YHQ 3;  3EX9 A;  1UI7 A;  4FMB A;  5CXO A;  1YJW 3;  2KRT A;  1ULJ B;  1I70 A;  3FG3 A;  2Y74 A;  1OUN A;  2CWV A;  5LC6 A;  3WOE B;  3F8H A;  2RNT A;  3BIR A;  3GZR A;  1C7H A;  1KWI A;  1KSI A;  2P0M A;  3M8C A;  3J7Y d;  3Q1C A;  5HOH A;  1GOV A;  4MEI A;  4HBR A;  2YFJ B;  1IK3 A;  1RMS A;  1I3F A;  5JPU A;  1I2E A;  1JBR A;  4WWU C;  4BL3 A;  4L7K A;  1T3B A;  5JBS A;  4GL6 A;  1IQX A;  5KP4 A;  3U1W A;  1O7P B;  1ISK A;  4I4K A;  4J5K A;  2XGN A;  3KE7 A;  5FW5 A;  1I0V A;  1VQ5 3;  3V99 A;  1BU4 A;  1DET A;  1SJW A;  5G2G A;  1UUG B;  4CJN A;  3TDG A;  1Q7Y 4;  2XSO B;  1UUW B;  3AGN A;  2XRX B;  5G1K A;  3SVA A;  1RLS A;  2W0Q A;  3CCJ 3;  1BVI A;  1HYF A;  1EG9 B;  1K28 A;  1V57 A;  1Q9E A;  1FZU A;  4X2H A;  3WR2 A;  1TU5 A;  3UNL A;  2UX0 A;  3LXU X;  5IEO A;  3CD6 3;  3LH4 A;  3NQY A;  4XBT A;  2J8X B;  1O7W B;  1JV2 B;  4OK0 A;  1BNE A;  4LSO A;  2H0H A;  3H3H A;  3HII A;  1TTO A;  2JDI H;  3DUK A;  1WTH A;  1B2Z A;  1VQP 3;  4ZM8 A;  2CK3 H;  1I0X A;  2D42 A;  1GMR A;  3FGY A;  2CFK A;  1PU4 A;  4N6U A;  5IG3 A;  2IUK A;  1A2K A;  1BSE A;  3QRD A;  2Q07 A;  4RNY A;  4LMI A;  1BAN A;  3ZFZ A;  4XM4 A;  4HM0 B;  1N8Q A;  1EKM A;  2BT3 A;  3F7X A;  1IDP A;  2CFL A;  3SX1 A;  4CPK A;  1W00 A;  1YGW A;  3Q3F A;  3JUN A;  3Q90 A;  1KC8 4;  3LOY A;  4BTY A;  4HM1 B;  4HM8 B;  3NXJ A;  4NHF A;  4HJL B;  4N6V 0;  3ZG5 A;  1RRH A;  4HM7 B;  3WHO A;  3S27 A;  3AMO B;  1GOY A;  1RJO A;  2STD A;  1B2X A;  1RN1 A;  4L8P A;  1US1 A;  2FGT A;  1AQZ A;  3EBY A;  1V74 A;  1IU7 A;  3MG1 A;  4H61 A;  4EXR A;  1RN4 A;  1UI8 A;  5FGO A;  3B7C A;  2SAR A;  3LZA A;  1W2B 2;  1VQ4 3;  2AAE A;  2GBW B;  4TX4 A;  2K54 A;  1NNV A;  1ROA A;  3F40 A;  3HIG A;  2W03 A;  3HI7 A;  1WMN A;  1N9E A;  1MGR A;  1N5H A;  5IF6 A;  1MGW A;  1VZZ A;  1FUS A;  3HOH A;  1AY7 A;  2YFI B;  3WOF B;  1DYU A;  3OWS A;  3U97 A;  2B24 B;  1BNF A;  3RDE A;  1N9J A;  1OH0 A;  1JB4 A;  1GD3 A;  3O8Y A;  4XDV A;  1QMA A;  4EBG A;  2RFR A;  1MWS A;  3CCU 3;  1N8R 4;  1NO3 A;  2HMK B;  4WYK B;  3AHS A;  2P09 A;  1CEW I;  1BNG A;  1O7H B;  1BNI A;  3MPH A;  3NBR A;  1E3V A;  4N6M A;  1GY5 A;  4EV5 A;  4GB5 A;  2WOF A;  2ZDJ A;  1TRP A;  1LXE A;  3VF1 A;  1VQ6 3;  4J8T A;  1E3R A;  2JQ5 A;  3I0Y A;  2OOV A;  2C11 A;  1BRJ A;  5M1A A;  1SII A;  1D6U A;  4MMY B;  2BHM A;  1DMN A;  1W6G A;  4K90 B;  3HZP A;  1ZX2 A;  5D83 A;  1NB3 I;  2QA4 3;  1Y4K A;  5DRE A;  1W6Y A;  1GD4 A;  1LOW A;  1W2Z A;  3FF2 A;  4R4K A;  3G6E 3;  3BLZ A;  5JPP A;  2BMQ B;  2HML B;  2KF6 A;  2LQV A;  3GRD A;  4LZI A;  2HMN B;  1BUQ A;  4RBN A;  3SYU A;  1QAF A;  2OQE C;  3MKI A;  4ORL A;  3N8B A;  4XBX A;  3B4P A;  4HZB B;  1IT7 A;  1JN5 B;  4O02 B;  5IW9 A;  3H51 A;  2XH9 A;  3EQQ B;  1OCV A;  1B3S A;  4K61 A;  3G0K A;  3VGN A;  3X3X A;  3CC2 3;  4LEH A;  1ZO2 A;  3SOA A;  4CCV A;  3BNE A;  4HZ9 B;  3FCS B;  3LTB A;  3CNM A;  3OWU A;  1AVK A;  9RNT A;  3L0R A;  1Z1S A;  1YIJ 3;  1T5Y A;  2IMJ A;  5ELJ A;  3D3L A;  3DGN A;  4KFF A;  3KII A;  1YGE A;  1KQS 2;  3NBJ A;  1CYU A;  4MMZ B;  3CNX A;  1RGG A;  2H0I A;  3D5I A;  1JZD A;  3DY5 A;  4XBY A;  3IPT A;  2FNQ A;  1WMO A;  1SQW A;  1W02 A;  3DGL A;  1OHP A;  1SPU A;  3LML A;  7GSP A;  1VQM 3;  1BGS A;  1VQ8 3;  2BMR B;  1RGF A;  4HYZ A;  3GSP A;  4OUQ A;  5ELU A;  3D5G A;  4WP5 A;  1E97 A;  2HMO B;  2H0G A;  3AMO A;  1IVV A;  2MF7 A;  5D82 A;  8CHO A;  1K73 4;  1RNB A;  1I8V A;  2B1X B;  1RGK A;  3JUO A;  1QJG A;  2IA7 A;  2AAD A;  3KSE D;  3PZW A;  1X1W A;  1IYY A;  2XSH B;  2BNG A;  3BU4 A;  1R4C A;  3EJV A;  2CWU A;  2M7O A;  3EE1 A;  1FGT A;  2E2T A;  1VQN 3;  2ML5 A;  1OHO A;  7RNT A;  1NB5 I;  3PXM A;  1HZ1 A;  4RNT A;  3JUP A;  4EC6 A;  1RN7 A;  1F8N A;  1M9G A;  2BMO B;  2QGU A;  2RSX A;  4IPB A;  7STD A;  1BNR A;  1GY7 A;  3SLU A;  5BXQ A;  5CF1 A;  1C54 A;  3MG2 A;  1CYV A;  1N5P A;  1JRQ A;  2W04 A;  3DMC A;  1B2U A;  1IV7 A;  3EN1 B;  1V58 A;  2CFG A;  3BNB A;  4FCM A;  4R9L A;  1TFK A;  2ML6 A;  5RNT A;  2CKF B;  3GZB A;  3PYJ A;  1OPY A;  4JF8 A;  3CC4 3;  1ASK A;  2CH9 A;  1B2M A;  1W4N A;  1K9M 4;  2KF4 A;  2PNC A;  2HOH A;  4BTX A;  4EYC A;  4WYK A;  1M1X B;  3CCQ 3;  3T0U A;  2P0X A;  4FMD A;  1JKG A;  1O7G B;  2GU1 A;  3NQZ A;  4LGQ A;  2IUJ A;  1A90 A;  1BRK A;  1GY6 A;  1CQS A;  3ER7 A;  5BIR A;  2CHC A;  3DXO A;  1LQG C;  3CCE 3;  1FA3 A;  3DGO A;  4OVM A;  1Q86 4;  1B27 A;  3FLJ A;  5AYR B;  1YVS A;  2XFT A;  3I56 3;  5AIF A;  4BU4 A;  3OWY A;  1DMQ A;  1MNL A;  3D4A A;  3MG3 A;  2CC3 A;  3UL5 A;  3DH2 A;  1LVN A;  2GEX A;  1FUT A;  2LYX A;  3BB9 A;  1RGL A;  4IIA A;  3ALA A;  1EQK A;  4CDL A;  2L1S A;  3EN8 A;  3OW2 2;  1R4Y A;  1QAL A;  6RNT A;  3NBB A;  1RCL A;  3NX0 A;  1FW7 A;  1W7C A;  3AGO A;  3FF0 A;  3FKA A;  3FG4 A;  4AKZ A;  2GSP A;  5CK6 A;  3QK9 A;  1BSD A;  1JN5 A;  2CFW A;  3K63 A;  1BNJ A;  2W2C A;  1VQ9 3;  4AEQ A;  3GAX A;  1K41 A;  5IG0 A;  1I2F A;  1DE3 A;  2V1L A;  6STD A;  2WGQ A;  3K0Z A;  1D6Y A;  3DZL A;  1L5G B;  1LOV A;  2FXT A;  2W56 B;  3NM2 A;  1BAO A;  4EW5 A;  3WDG B;  3MHE A;  2GEY A;  2GU3 A;  1YNV X;  3IMA B;  2CW9 A;  2YX9 A;  4MJD A;  4QWT A;  3UL6 A;  5EEO A;  3BND A;  1D6Z A;  2HMJ B;  1JKG B;  1EUI C;  4GHO A;  1BRH A;  3GZX B;  8RNT A;  1BRN L;  1K8A 4;  3CU3 A;  2KXG A;  3AHW A;  1X1U A;  3MYT A;  5IEP A;  3Q2P A;  1RCK A;  1RHL A;  5D81 A;  3SED A;  3KSP A;  3PGB A;  1S5A A;  3GWR A;  1ZS7 A;  2F5M A;  1S72 3;  4IT7 A;  2F4Y A;  1RKY A;  1O7N B;  4BTW A;  1KD1 4;  1SIH A;  1BSA A;  2F98 A;  2RGQ A;  1UCL A;  5LC7 A;  1BRI A;  1G02 A;  3EBT A;  3B8L A;  3CPW 2;  3X42 A;  2OTJ 3;  1RTU A;  2XFS A;  2KF3 A;  5G1L A;  3CCR 3;  4RNZ A;  1RNT A;  3WMD A;  3LYG A;  1IV9 A;  1Q40 B;  2C4B A;  4N6N B;  1GOU A;  1FGQ A;  3A5E A;  4JRF A;  1RGC A;  1TRQ A;  2A15 A;  2F56 A;  5EQL A;  1A2V A;  4Q53 A;  1LNI A;  1FGR A;  4HM3 B;  5HGR A;  4U13 A;  3NUV A;  4FCJ A;  1NDO B;  4N3V A;  5A0O B;  1NJI 4;  1G96 A;  3LTA A;  3ROB A;  3OX9 A;  4FMA A;  1HKX A;  3HX8 A;  2F5W A;  3K9M C;  1UGH I;  1W6C A;  3NV0 B;  3CME 3;  3D79 A;  4HVN A;  1BRS A;  2RBI A;  1OAC A;  5IER A;  1WMP A;  1UCI A;  3DGM A;  3MSO A;  3NM7 A;  2I9W A;  3DM8 A;  3ZG0 A;  4NRE A;  1TFO A;  1IVU A;  1NWW A;  4KT3 B;  4NPB A;  2W6J H;  1UDI I;  1LOX A;  1OF5 B;  3MWZ A;  3N9H A;  2ZA4 A;  1GMQ A;  1JB2 A;  3SOY A;  4O2H A;  2GBX B;  1OGX A;  1NU3 A;  1A67 A;  5IG4 A;  4H3U A;  1PYL A;  2YFL B;  1UGI A;  3HK4 A;  3KFQ C;  4KFD A;  3CCL 3;  3JUQ A;  1GSP A;  4N6O B;  3PS8 A;  1TP6 A;  1I3I A;  2WGO A;  1Q42 A;  1OHS A;  5M18 A;  1JB5 A;  1VQO 3;  3B4O A;  5TGN A;  2P38 A;  4KZ1 A;  3D9R A;  4G1M B;  5AI1 A;  2IYJ A;  1UUV B;  4K1V A;  1JNQ A;  2WO0 A;  3EF8 A;  1BUJ A;  1G0T A;  1RGA A;  2R4I A;  1X1Y A;  2WOH A;  1T2H A;  2D1W A;  2INX A;  4AKY A;  4ILF A;  1AVL A;  2RCD A;  1QAK A;  2BU4 A;  4FMC A;  4BL2 A;  1JBT A;  3UJM A;  3X3Z A;  2OQE A;  1YI2 3;  4RZM A;  1AV4 A;  2PZV A;  2Z6B A;  1PY3 A;  3S29 A;  2L4V A;  4FCZ A;  1Q82 4;  3CCM 3;  3WA2 X;  4XB5 A;  1TJD A;  2C10 A;  2ZHX B;  3PCS A;  3F9S A;  3F8X A;  1Q81 4;  1YJ9 3;  3EHC A;  1MWT A;  2W56 A;  3N54 B;  2SBL A;  3KN4 A;  3S67 A;  2CIU A;  1JJ2 2;  3F14 A;  3KCH A;  4HM2 B;  4O3V A;  2W9Q A;  1FUW A;  1RGH A;  5BU4 A;  3LT8 A;  4HAA A;  6GSP A;  3CPO A;  1RSN A;  2IY2 A;  3T8N A;  4HKV B;  1BNS A;  3V98 A;  5AII A;  1FYS A;  4WHA A;  3CC7 3;  1RGE A;  1YJN 3;  1M90 4;  1AR0 A;  1J2B A;  1VQK 3;  1WNH A;  1VQQ A;  2K3D A;  2QIY A;  1U8C B;  3RGA A;  4L8O A;  4HM5 B;  2OTL 3;  5AIG A;  1BRG A;  3OV4 A;  5EVH A;  2CX1 A;  3FZW A;  3G16 A;  1RDS A;  2KAA A;  3DGY A;  5AYS C;  1ROV A;  2UGI A;  5KP3 A;  2Z77 A;  2HMM B;  2Z7A A;  2F86 B;  3KZT A;  4EV2 A;  1TIJ A;  1VQ7 3;  1Q40 A;  1EEJ A;  1ULI B;  2OOV C;  5GSP A;  2BIR A;  5AEW B;  5AEU B;  2O9U X;  2Y73 A;  4LYL B;  1DVD A;  1CH0 A;  3GZY B;  3ECF A;  3FSD A;  1I2G A;  5DRV A;  1BIR A;  1IQ8 A;  1DMM A;  3CCS 3;  1X1X A;  3G71 3;  3CCV 3;  1LNH A;  1A2P A;  2QEX 3;  3NV0 A;  5CLK A;  3K7C A;  1EA2 A;  1HU9 A;  1ZGX A;  1UCJ A;  4XDW A;  1B20 A;  1U5O A;  4I5Q A;  1LRA A;  3OXA A;  4HOH A;  4K1U A;  4R80 A;  2O3O A;  1QVF 2;  1FGO A;  1OF5 A;  3PCR A;  4J9A A;  2CX0 A;  4WFO A;  1IVW A;  1MWU A;  3CMA 3;  3KKG A;  3NHX A;  4STD A;  3CXC 2;  1W01 A;  2CFD A;  3BNC A;  1UCK A;  3IJE B;  4R9K A;  3RNT A;  3STD A;  1PFP A;  3F7S A;  3LT9 A;  4GSP A;  3JUM A;  1OGZ A;  4J5G A;  1GYB A;  3EB8 A;  3URP A;  1B2S A;  4R1K A;  3X40 A;  2GXF A;  2XR8 B;  3E99 A;  3EC9 A;  1VQL 3;  2W9P A;  5IEN A;  1IQY A;  1M1K 4;  1T2I A;  4DKI A;  1STF I;  5I97 A;  5CF2 A;  3LTD A;  1B21 A;  3S28 A;  3VSY A;  2Z76 A;  3A76 A;  4PEJ A;  2KF5 A;  2F99 A;  3WOD G;  1IT8 A;  5KP1 A;  1YIT 3;  3S5C A;  1YVB I;  1SAR A;  3UB1 A;  4BIR A; 
#chains in the Genus database with same CATH homology
 2KF4 A;  1BSB A;  2HOH A;  1B2M A;  1MGR A;  1MGW A;  1FUS A;  3HOH A;  1AY7 A;  1BUJ A;  1RGA A;  1GMP A;  1BRK A;  1X1Y A;  1BNF A;  5BIR A;  1T2H A;  2BU4 A;  1B27 A;  1JBT A;  1YVS A;  3AHS A;  4BU4 A;  1BNG A;  3D4A A;  1BNI A;  1BSC A;  1PY3 A;  3DH2 A;  1FUT A;  1RGL A;  1TRP A;  1JBS A;  1BOX A;  1R4Y A;  6RNT A;  1LOY A;  1RCL A;  1FW7 A;  1BRJ A;  3AGO A;  3KCH A;  2GSP A;  1I70 A;  1RGH A;  1BSD A;  5BU4 A;  1BNJ A;  4HAA A;  2RNT A;  3BIR A;  6GSP A;  1DE3 A;  1I2F A;  1LOW A;  1RSN A;  1BNS A;  1LOV A;  2KF6 A;  1FYS A;  1GOV A;  5HOH A;  1RGE A;  1BAO A;  1RMS A;  1I3F A;  3SYU A;  1I2E A;  1JBR A;  1YNV X;  1BRN L;  1BRG A;  4GHO A;  4J5K A;  8RNT A;  1BRH A;  1I0V A;  1RDS A;  1B3S A;  2KAA A;  3DGY A;  1BU4 A;  1DET A;  3AHW A;  1X1U A;  1RCK A;  1RHL A;  9RNT A;  2F5M A;  3AGN A;  5GSP A;  2BIR A;  1RLS A;  2F4Y A;  1BVI A;  1HYF A;  1Q9E A;  1FZU A;  3WR2 A;  1CH0 A;  1BSA A;  1RGG A;  1UCL A;  1I2G A;  1BRI A;  1BIR A;  1G02 A;  1BNE A;  3D5I A;  1RTU A;  2KF3 A;  1RNT A;  1TTO A;  1X1X A;  7GSP A;  1A2P A;  1B2Z A;  2C4B A;  1GOU A;  1BGS A;  1GMR A;  1I0X A;  1UCJ A;  1ZGX A;  1B20 A;  3A5E A;  1RGF A;  1LRA A;  1RGC A;  1TRQ A;  2F56 A;  4HOH A;  3GSP A;  3D5G A;  1LNI A;  1BSE A;  1BAN A;  1RNB A;  1I8V A;  1RGK A;  1YGW A;  2AAD A;  3Q3F A;  1X1W A;  1IYY A;  2F5W A;  3BU4 A;  1BRS A;  2RBI A;  1UCK A;  3RNT A;  1UCI A;  4GSP A;  3WHO A;  1GOY A;  4J5G A;  7RNT A;  1B2X A;  2ZA4 A;  1RN1 A;  1B2S A;  1GMQ A;  1HZ1 A;  3URP A;  4RNT A;  1AQZ A;  1T2I A;  1BNR A;  1C54 A;  1RN4 A;  1B21 A;  1B2U A;  2SAR A;  2KF5 A;  1PYL A;  5RNT A;  2AAE A;  1GSP A;  1I3I A;  1SAR A;  4BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...