3BU4A

Ribonuclease t1 complex with 2'gmp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (RIBONUCLEASE T1)
publication title Conserved water molecules in a large family of microbial ribonucleases.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1998-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3bu4A00
1B3SA 1PY3A 7RNTA 1GOUA 1TRQA 5GSPA 3D4AA 3AHWA 3BU4A 4GHOA 1BSEA 1RGLA 1X1WA 3A5EA 2GSPA 1Q9EA 1MGWA 1G02A 1AY7A 2F4YA 3AGNA 1RMSA 1BRJA 1TRPA 1BNSA 3KCHA 1X1XA 1LNIA 2RBIA 1IYYA 1BNRA 5BU4A 1RGHA 1BNFA 7GSPA 1HYFA 1X1UA 1RGKA 1FZUA 2SARA 3Q3FA 1BRHA 1AQZA 1BAOA 1UCLA 8RNTA 2KF6A 1RDSA 1BUJA 1RLSA 1TTOA 5HOHA 1RGFA 1B2XA 4HOHA 1DETA 1RTUA 2KF5A 2F5MA 3WHOA 5RNTA 2KF3A 3SYUA 9RNTA 1RN4A 3HOHA 1RCKA 1R4YA 6GSPA 1JBSA 1DE3A 1RHLA 1LRAA 1CH0A 1I3IA 1X1YA 4HAAA 1GOYA 1BSBA 2F5WA 2KF4A 1B27A 1RGEA 1BANA 1JBTA 1GSPA 1I0XA 1BSAA 1T2IA 3AHSA 2RNTA 3AGOA 1YNVX 1GMPA 1B2MA 1FYSA 4BU4A 1ZGXA 4GSPA 1UCJA 1BSDA 3D5IA 3DH2A 4RNTA 1B2ZA 5BIRA 1BIRA 1I0VA 1UCKA 1RN1A 1I8VA 1YVSA 1BRGA 1I2GA 1LOWA 1GOVA 1MGRA 1BSCA 1PYLA 1JBRA 2BIRA 1BNJA 3BIRA 1RGGA 1BVIA 1BRNL 1BGSA 1SARA 1B21A 2F56A 1RNBA 1BRSA 1BRIA 1RSNA 1I2EA 2BU4A 1LOYA 1RGCA 1C54A 1I2FA 1B2UA 1LOVA 1A2PA 1T2HA 4J5GA 1HZ1A 1B20A 1RCLA 3WR2A 3URPA 3RNTA 1FUSA 1FUTA 3D5GA 3DGYA 2C4BA 1BNIA 1BNGA 1BNEA 2AADA 1B2SA 2ZA4A 4BIRA 3GSPA 1FW7A 1UCIA 2KAAA 1RNTA 1GMRA 1I3FA 1BRKA 1GMQA 4J5KA 1BOXA 1I70A 1YGWA 2AAEA 6RNTA 1BU4A 1RGAA 2HOHA
chains in the Genus database with same CATH superfamily
1PY3A 3VGNA 1JZOA 2XFTA 3BNEA 2W04A 3GRDA 3MWZA 3OWYA 1LQGC 3EE1A 3GAXA 4MEIA 4LGQA 2QGUA 2M7OA 4WYKA 1JB2A 1TFOA 3M8CA 4OK0A 3F40A 5AIFA 2WOHA 3V92A 3H51A 2WGQA 1DVDA 3OV4A 3T0UA 1MGWA 1G02A 1AY7A 1IQXA 1Q7HA 2GU3A 3U97A 4EC6A 3CCU3 5LC6A 3X41A 1VQ83 1ZO2A 3CU3A 3WA3A 2QA43 5D82A 4L8OA 3PGBA 4EV5A 3QK9A 2CG0A 3MSOA 2CFDA 4O8SA 3DM8A 1LNIA 4WFOA 5KP1A 3CC73 1GS3A 7GSPA 1BNFA 1EKMA 1WMNA 1GY7A 4G1MB 8RNTA 5AIIA 1BAOA 1RDSA 4IIAA 2R41A 1YHQ3 2BMOB 1RLSA 1NDOB 1TTOA 1YGEA 3EBYA 1RGFA 4HM8B 4HOHA 1DETA 1OCVA 1DMMA 1OHPA 1RTUA 4KFEA 3WOFB 2CWTA 2J8XB 1T5YA 3GZXB 2FGTA 3GZBA 1OUNA 3NUVA 1OGXA 4MMZB 3FF2A 4OVMA 2LQVA 3GWRA 3HOHA 4BTYA 1SJWA 1TU5A 4Q53A 4XBTA 1RCKA 3IJEB 1LQMB 2KCDA 3HZPA 1VZZA 3LTBA 3FG3A 1NU3A 1Q40B 1FGQA 1CH0A 1V57A 2HMKB 1YIT3 1SQWA 2W03A 3HIIA 2BT3A 3UB1A 1CQSA 4IT7A 2F5WA 4LMIA 3V98A 2KF4A 1B27A 1W4NA 3KSED 3KSPA 3U1WA 3KFQC 1RRLA 2CX0A 3QRDA 1YNVX 1B2MA 3LTCA 1UCJA 1QALA 2W6JH 4MMYB 1B2ZA 5AYSC 2P0MA 1BIRA 1DYUA 1F8NA 3MPHA 4HJLB 3SVAA 5KP4A 2D1WA 2CW9A 3DGOA 1EG9B 3JUPA 1I8VA 3NBBA 1OH0A 1VQQA 2GBXB 1TJDA 1GY6A 3G6E3 1JBRA 1IQ8A 4WYKB 1BNJA 4EV2A 2XR8B 2XH9A 4O2HA 1SARA 4KFDA 1RNBA 1VQ93 3LMLA 2CWVA 1JNQA 1K28A 1TIJA 3D3LA 1MOLA 3FF0A 1I2FA 5CXOA 1RN7A 3JVCA 1PU4A 1A2KA 5IENA 4HM5B 3BNDA 2IUKA 4R1KA 1FGTA 1RCLA 1V74A 2UX0A 4HM3B 1AVKA 3WR2A 1QVF2 3G0KA 3JUOA 1FUSA 1FUTA 1O7MB 1D6YA 1JV2B 1JB5A 1NB3I 1STDA 2XSOB 3DGYA 3EF8A 3ER7A 4HKVB 2F98A 1NWWA 1RRHA 1W5ZA 3CCL3 4KT3B 4BL3A 5EQLA 3NM2A 1J2BA 4CJNA 1I3FA 2E2UA 1DMQA 1GMQA 1KQS2 3L0RA 3CPOA 3NX0A 3ROBA 1WNHA 1LVNA 2HOHA 2C10A 1B3SA 3OWUA 3RGRA 1TRQA 4LEHA 4HM0B 3WDGB 2CWUA 3BB9A 3AHWA 1MWTA 2E2VA 2Q07A 3BU4A 3PS8A 4ILFA 3HIGA 4MJDA 4RNYA 5CF2A 1BSEA 3UL5A 2IA7A 2A15A 1VQ73 3NHXA 4CCVA 3PCRA 5JBSA 3CD63 2XGLA 2QEX3 4FCJA 3DGNA 1YI23 4HZBB 3CCS3 2Y73A 2CFGA 1RMSA 2RFRA 4XBYA 1BRJA 1US1A 2FNQA 3G8ZA 4EBGA 1VQ63 2Z76A 2HMJB 1X1XA 1CYVA 1A67A 4EXRA 1RKYA 4LSOA 1RGHA 1HYFA 2RGQA 2Z77A 5AEWB 1FGOA 3LOYA 4QWTA 3UJMA 4RBNA 2SARA 1U8CB 3Q3FA 5G1LA 2UUGC 1BUJA 5IG5A 3FKAA 2K54A 5HOHA 1UI8A 5IF6A 1ZS7A 4HYZA 2UGIA 5FGOA 2L4VA 2XFSA 3WMDA 2CKFB 3F7XA 2CC3A 3WOEB 4AKYA 1VQL3 5IG4A 2OTJ3 3DXOA 4J8TA 3VF1A 1QVG2 2ML6A 3S27A 3PZWA 3CCM3 3KIIA 2WO0A 2OWPA 3CNMA 1Q864 4HBRA 1R4YA 1U5OA 2OQEA 1JBSA 3LZAA 4HVNA 3CCV3 1DE3A 3B7CA 2CFLA 2OQEC 4HAAA 2OOVA 1ASKA 4I5QA 1W2ZA 4N6UA 2OOVC 3UL6A 4GB5A 4X2OA 3ZFZA 3X3YA 2RNTA 4AKZA 1LNHA 1GMPA 3T8NA 1FYSA 4GSPA 3SX1A 2QIYA 5BIRA 2SBLA 3OW22 2Z7AA 4MMXB 1YVSA 3N9HA 1VQM3 3ECFA 3NV0A 3TDGA 1I2GA 5IW9A 1HU9A 3KE7A 1IT8A 1O7WB 3MG2A 1RJOA 5JPPA 1BRNL 1BGSA 4FMDA 1STFI 2YFIB 2BO9B 1B21A 2F56A 1GYBA 1OHSA 1BRSA 4KFFA 1I2EA 6STDA 3SEDA 1MWUA 3FCSB 4JRFA 1K8A4 1B2UA 1JN5A 1LOVA 1A2PA 3EN8A 3NXJA 4BTXA 1OGZA 1T2HA 5TGNA 3ZG5A 1HZ1A 1S723 3SLUA 3K63A 3URPA 3RNTA 4TX4A 2XF3A 3EN1B 4K90B 1GY5A 3DMCA 2BNGA 1SPUA 1G96A 1BNIA 1BNGA 4HZ9B 5G1KA 5A0OB 3PCSA 2AADA 4R4KA 4KZ1A 3IMAB 2JQ5A 1W2B2 1VQ53 1TUHA 2ZDJA 1FA3A 1BRKA 2YX9A 4L8PA 4HM2B 1A90A 2B1XB 1G0TA 2W9QA 3NM7A 4K1UA 1M9GA 2AAEA 4PEJA 4R80A 6RNTA 1W6GA 3X42A 2Y74A 4RZMA 3CC43 2WGOA 5GSPA 5ELUA 3D4AA 3SOAA 1UDII 4N6V0 2BMQB 4GHOA 4N6OB 4AEQA 3RDEA 2XRXB 2CFWA 1X1WA 1RGLA 2H0GA 3EQQB 4JF8A 5HGRA 1N8QA 2HMLB 1R4CA 5BXQA 3DUKA 4GL6A 3DGLA 2MF7A 2IUJA 2F4YA 3AGNA 1IV9A 5DREA 3AMOA 4HM1B 1ROAA 3DZLA 3FGYA 2XSHB 3O8YA 2FXTA 5AIGA 3VSYA 3V99A 1MNLA 1W00A 3N54B 3HK4A 1FGRA 3KCHA 1UUWB 1SIHA 1IVVA 3NBRA 1AVLA 1ULIB 3X3XA 1W02A 2CG1A 1RGKA 4DKIA 1FZUA 4EYCA 1UCLA 3F9SA 4IPBA 2KF6A 1T3BA 1IU7A 1DVCA 1QJGA 1KD14 2RSXA 1B2XA 4KVHA 2B24B 3X40A 4XDWA 2W9PA 1HKXA 3K5TA 2P0XA 5D81A 3T8UA 1N5HA 1ULJB 3EC9A 1FGMA 3LXUX 1Z1SA 1JN5B 4J9AA 4FMAA 5LC7A 2HMMB 3NQZA 4ORLA 1V58A 4K1VA 3DY5A 2ZL8A 1EQKA 4I4KA 1N5PA 1RHLA 3LYGA 2P09A 3JUNA 1I3IA 5STDA 1MWSA 1IVXA 1X1YA 1E97A 4XB5A 3LTDA 2D42A 3CCJ3 1BSBA 3BNCA 3EX9A 1RGEA 1BANA 1SIIA 1A2VA 1BSAA 3KZTA 3AGOA 1W01A 1AR0A 4NPBA 3CCE3 4BU4A 2STDA 1QMAA 3STDA 3B4PA 3D5IA 3EHCA 3LT8A 1WMPA 4RNTA 1UGHI 3E99A 1I0VA 3SOYA 5EVHA 4FMCA 3CCR3 3CMA3 1UCKA 2I9WA 3MG1A 4NHFA 8CHOA 5CF1A 3FG4A 4U13A 1Q824 2F99A 3F14A 2CH9A 1MGRA 2GU1A 5DRVA 3S28A 1PYLA 3LT9A 1YJ93 1O7GB 2BIRA 1VQN3 3BIRA 1QAKA 1RGGA 5M1AA 1BVIA 3D79A 4H61A 5FW5A 1L5GB 1ROVA 1IT7A 2L1SA 4N6NB 3ZG0A 3FH1A 1OHOA 1LOYA 3AMOB 3N8BA 1RGCA 5AYRB 1C54A 3WA2X 2K3DA 4HM7B 1GD3A 2WOFA 5AEUB 5IERA 3LH4A 3FG1A 1YVBI 1YJN3 5BVBA 3MHEA 5IG0A 3WODG 1KSIA 2OTL3 3Q2PA 1N8R4 3OWSA 3Q1CA 1JJ22 1KC84 1S5AA 2H0IA 1Y4KA 1BNEA 1D6UA 1B2SA 4L7KA 3GSPA 4CDLA 3FSDA 3B8LA 1UCIA 2IYJA 2KAAA 2W0QA 3CCQ3 3ALAA 1UUGB 1GMRA 4N6MA 2BHMA 5ELJA 4STDA 1M1XB 1IV7A 3MKIA 1BOXA 1I70A 1YGWA 3BLZA 2INXA 2KRTA 1OACA 1NB5I 1UI7A 3D9RA 5G2GA 3G713 2CIUA 7RNTA 1GOUA 1QAFA 3S67A 3G16A 1Q814 2IY2A 2Z6BA 4NREA 3FZWA 2GEYA 4H3UA 4XDVA 3A5EA 2V1LA 1DMNA 1M904 2GSPA 1Q9EA 4HM6B 2E2TA 1WMOA 3H3HA 2H0HA 3IPTA 1VQO3 1K734 3S5CA 2JDIH 4K61A 4CPKA 1OF5A 2C11A 1NNVA 3CXC2 5IEPA 1TRPA 1BNSA 1OPYA 4OUQA 3UNLA 3I553 1IQYA 5CK6A 1VQK3 2RBIA 3K9MC 2W2CA 1K9M4 1IYYA 3F8HA 4R9KA 5BU4A 1BNRA 1GD4A 1Q42A 5IEOA 7STDA 3I0YA 4WWUC 3BNBA 1X1UA 4LZIA 5JPUA 1PFPA 3EJVA 2GXFA 2HMNB 3PXMA 1BRHA 1AQZA 1D6ZA 1KWIA 1JKGA 1O7NB 2GEXA 2K0MA 3A76A 3KKGA 4FCZA 4HM4B 2GBWB 2KXGA 2YFJB 1N9EA 4ZM8A 3CC23 2KF5A 2F5MA 3GZYB 2O9UX 5D83A 3WHOA 3KN4A 3OX9A 2W56A 1ZX2A 3Q90A 5EEOA 1IK3A 1EEJA 2O3OA 5RNTA 2KF3A 4BTWA 2MC8A 1W6CA 2LYXA 4FMBA 3SYUA 9RNTA 1ISKA 1RN4A 1TFKA 4FR9A 2IMJA 4LYLB 2F86B 6GSPA 5CLKA 3RGAA 3B4OA 1LRAA 2CK3H 1YJW3 2YFLB 1LOXA 3X3ZA 1YIJ3 1GOYA 2P05A 2XGNA 4X2HA 3I563 1E3VA 3NQYA 1JBTA 3S29A 4N6TA 1GSPA 2PNCA 1I0XA 1T2IA 3AHSA 3NBJA 2CX1A 3NV0B 1N9JA 4O3VA 1FUWA 1WQLB 3CME3 3K7CA 1ZGXA 3CNXA 1CEWI 1W7CA 1BSDA 2XEPA 4RNZA 3DH2A 3G4S3 1M1K4 1VQ43 2BMRB 3JUMA 5KP3A 4FCMA 1RN1A 1JZDA 1UW1A 3GZRA 1BRGA 3CPW2 2ZHXB 1LOWA 1GOVA 1BSCA 3SXXA 3EB8A 3F7SA 3LTAA 4O02B 4WP5A 5IG3A 3K0ZA 1JB4A 1MWRA 5M19A 1AV4A 1BRIA 1RSNA 2BU4A 1CYUA 1Q7Y4 1O7PB 1UGIA 4XBXA 1NJI4 3MG3A 5I97A 1UUVB 2CHCA 2HMOB 1K41A 1OF5B 2P38A 4BL2A 1EUIC 4N6LA 1BUQA 4J5GA 1O7HB 1TP6A 1B20A 1E3RA 4EW5A 1VQP3 4XM4A 1Q40A 2R4IA 1IDPA 1IVUA 3DGMA 1JRQA 3D5GA 2OCTA 3MYTA 1W6YA 2C4BA 3OXAA 3J7Yd 4WHAA 5AIHA 3EBTA 1JKGB 1WTHA 3JUQA 1EA2A 2ML5A 3PYJA 3HX8A 2ZA4A 4BIRA 1FW7A 2RCDA 4R9LA 2CFKA 2PZVA 5M18A 1RNTA 2W56B 3HI7A 1C7HA 1IVWA 1LXEA 4J5KA 5AI1A 1NO3A 3FLJA 1BU4A 1RGAA 3F8XA 4N3VA
chains in the Genus database with same CATH topology
1B3SA 1PY3A 7RNTA 1GOUA 1TRQA 5GSPA 3D4AA 3AHWA 3BU4A 4GHOA 1BSEA 1RGLA 1X1WA 3A5EA 2GSPA 1Q9EA 1MGWA 1G02A 1AY7A 2F4YA 3AGNA 1RMSA 1BRJA 1TRPA 1BNSA 3KCHA 1X1XA 1LNIA 2RBIA 1IYYA 1BNRA 5BU4A 1RGHA 1BNFA 7GSPA 1HYFA 1X1UA 1RGKA 1FZUA 2SARA 3Q3FA 1BRHA 1AQZA 1BAOA 1UCLA 8RNTA 2KF6A 1RDSA 1BUJA 1RLSA 1TTOA 5HOHA 1RGFA 1B2XA 4HOHA 1DETA 1RTUA 2KF5A 2F5MA 3WHOA 5RNTA 2KF3A 3SYUA 9RNTA 1RN4A 3HOHA 1RCKA 1R4YA 6GSPA 1JBSA 1DE3A 1RHLA 1LRAA 1CH0A 1I3IA 1X1YA 4HAAA 1GOYA 1BSBA 2F5WA 2KF4A 1B27A 1RGEA 1BANA 1JBTA 1GSPA 1I0XA 1BSAA 1T2IA 3AHSA 2RNTA 3AGOA 1YNVX 1GMPA 1B2MA 1FYSA 4BU4A 1ZGXA 4GSPA 1UCJA 1BSDA 3D5IA 3DH2A 4RNTA 1B2ZA 5BIRA 1BIRA 1I0VA 1UCKA 1RN1A 1I8VA 1YVSA 1BRGA 1I2GA 1LOWA 1GOVA 1MGRA 1BSCA 1PYLA 1JBRA 2BIRA 1BNJA 3BIRA 1RGGA 1BVIA 1BRNL 1BGSA 1SARA 1B21A 2F56A 1RNBA 1BRSA 1BRIA 1RSNA 1I2EA 2BU4A 1LOYA 1RGCA 1C54A 1I2FA 1B2UA 1LOVA 1A2PA 1T2HA 4J5GA 1HZ1A 1B20A 1RCLA 3WR2A 3URPA 3RNTA 1FUSA 1FUTA 3D5GA 3DGYA 2C4BA 1BNIA 1BNGA 1BNEA 2AADA 1B2SA 2ZA4A 4BIRA 3GSPA 1FW7A 1UCIA 2KAAA 1RNTA 1GMRA 1I3FA 1BRKA 1GMQA 4J5KA 1BOXA 1I70A 1YGWA 2AAEA 6RNTA 1BU4A 1RGAA 2HOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3S A;  1PY3 A;  7RNT A;  1GOU A;  1TRQ A;  5GSP A;  3D4A A;  3AHW A;  3BU4 A;  4GHO A;  1BSE A;  1RGL A;  1X1W A;  3A5E A;  2GSP A;  1Q9E A;  1MGW A;  1G02 A;  1AY7 A;  2F4Y A;  3AGN A;  1RMS A;  1BRJ A;  1TRP A;  1BNS A;  3KCH A;  1X1X A;  1LNI A;  2RBI A;  1IYY A;  1BNR A;  5BU4 A;  1RGH A;  1BNF A;  7GSP A;  1HYF A;  1X1U A;  1RGK A;  1FZU A;  2SAR A;  3Q3F A;  1BRH A;  1AQZ A;  1BAO A;  1UCL A;  8RNT A;  2KF6 A;  1RDS A;  1BUJ A;  1RLS A;  1TTO A;  5HOH A;  1RGF A;  1B2X A;  4HOH A;  1DET A;  1RTU A;  2KF5 A;  2F5M A;  3WHO A;  5RNT A;  2KF3 A;  3SYU A;  9RNT A;  1RN4 A;  3HOH A;  1RCK A;  1R4Y A;  6GSP A;  1JBS A;  1DE3 A;  1RHL A;  1LRA A;  1CH0 A;  1I3I A;  1X1Y A;  4HAA A;  1GOY A;  1BSB A;  2F5W A;  2KF4 A;  1B27 A;  1RGE A;  1BAN A;  1JBT A;  1GSP A;  1I0X A;  1BSA A;  1T2I A;  3AHS A;  2RNT A;  3AGO A;  1YNV X;  1GMP A;  1B2M A;  1FYS A;  4BU4 A;  1ZGX A;  4GSP A;  1UCJ A;  1BSD A;  3D5I A;  3DH2 A;  4RNT A;  1B2Z A;  5BIR A;  1BIR A;  1I0V A;  1UCK A;  1RN1 A;  1I8V A;  1YVS A;  1BRG A;  1I2G A;  1LOW A;  1GOV A;  1MGR A;  1BSC A;  1PYL A;  1JBR A;  2BIR A;  1BNJ A;  3BIR A;  1RGG A;  1BVI A;  1BRN L;  1BGS A;  1SAR A;  1B21 A;  2F56 A;  1RNB A;  1BRS A;  1BRI A;  1RSN A;  1I2E A;  2BU4 A;  1LOY A;  1RGC A;  1C54 A;  1I2F A;  1B2U A;  1LOV A;  1A2P A;  1T2H A;  4J5G A;  1HZ1 A;  1B20 A;  1RCL A;  3WR2 A;  3URP A;  3RNT A;  1FUS A;  1FUT A;  3D5G A;  3DGY A;  2C4B A;  1BNI A;  1BNG A;  1BNE A;  2AAD A;  1B2S A;  2ZA4 A;  4BIR A;  3GSP A;  1FW7 A;  1UCI A;  2KAA A;  1RNT A;  1GMR A;  1I3F A;  1BRK A;  1GMQ A;  4J5K A;  1BOX A;  1I70 A;  1YGW A;  2AAE A;  6RNT A;  1BU4 A;  1RGA A;  2HOH A; 
#chains in the Genus database with same CATH topology
 1PY3 A;  3VGN A;  1JZO A;  2XFT A;  3BNE A;  2W04 A;  3GRD A;  3MWZ A;  3OWY A;  1LQG C;  3EE1 A;  3GAX A;  4MEI A;  4LGQ A;  2QGU A;  2M7O A;  4WYK A;  1JB2 A;  1TFO A;  3M8C A;  4OK0 A;  3F40 A;  5AIF A;  2WOH A;  3V92 A;  3H51 A;  2WGQ A;  1DVD A;  3OV4 A;  3T0U A;  1MGW A;  1G02 A;  1AY7 A;  1IQX A;  1Q7H A;  2GU3 A;  3U97 A;  4EC6 A;  3CCU 3;  5LC6 A;  3X41 A;  1VQ8 3;  1ZO2 A;  3CU3 A;  3WA3 A;  2QA4 3;  5D82 A;  4L8O A;  3PGB A;  4EV5 A;  3QK9 A;  2CG0 A;  3MSO A;  2CFD A;  4O8S A;  3DM8 A;  1LNI A;  4WFO A;  5KP1 A;  3CC7 3;  1GS3 A;  7GSP A;  1BNF A;  1EKM A;  1WMN A;  1GY7 A;  4G1M B;  8RNT A;  5AII A;  1BAO A;  1RDS A;  4IIA A;  2R41 A;  1YHQ 3;  2BMO B;  1RLS A;  1NDO B;  1TTO A;  1YGE A;  3EBY A;  1RGF A;  4HM8 B;  4HOH A;  1DET A;  1OCV A;  1DMM A;  1OHP A;  1RTU A;  4KFE A;  3WOF B;  2CWT A;  2J8X B;  1T5Y A;  3GZX B;  2FGT A;  3GZB A;  1OUN A;  3NUV A;  1OGX A;  4MMZ B;  3FF2 A;  4OVM A;  2LQV A;  3GWR A;  3HOH A;  4BTY A;  1SJW A;  1TU5 A;  4Q53 A;  4XBT A;  1RCK A;  3IJE B;  1LQM B;  2KCD A;  3HZP A;  1VZZ A;  3LTB A;  3FG3 A;  1NU3 A;  1Q40 B;  1FGQ A;  1CH0 A;  1V57 A;  2HMK B;  1YIT 3;  1SQW A;  2W03 A;  3HII A;  2BT3 A;  3UB1 A;  1CQS A;  4IT7 A;  2F5W A;  4LMI A;  3V98 A;  2KF4 A;  1B27 A;  1W4N A;  3KSE D;  3KSP A;  3U1W A;  3KFQ C;  1RRL A;  2CX0 A;  3QRD A;  1YNV X;  1B2M A;  3LTC A;  1UCJ A;  1QAL A;  2W6J H;  4MMY B;  1B2Z A;  5AYS C;  2P0M A;  1BIR A;  1DYU A;  1F8N A;  3MPH A;  4HJL B;  3SVA A;  5KP4 A;  2D1W A;  2CW9 A;  3DGO A;  1EG9 B;  3JUP A;  1I8V A;  3NBB A;  1OH0 A;  1VQQ A;  2GBX B;  1TJD A;  1GY6 A;  3G6E 3;  1JBR A;  1IQ8 A;  4WYK B;  1BNJ A;  4EV2 A;  2XR8 B;  2XH9 A;  4O2H A;  1SAR A;  4KFD A;  1RNB A;  1VQ9 3;  3LML A;  2CWV A;  1JNQ A;  1K28 A;  1TIJ A;  3D3L A;  1MOL A;  3FF0 A;  1I2F A;  5CXO A;  1RN7 A;  3JVC A;  1PU4 A;  1A2K A;  5IEN A;  4HM5 B;  3BND A;  2IUK A;  4R1K A;  1FGT A;  1RCL A;  1V74 A;  2UX0 A;  4HM3 B;  1AVK A;  3WR2 A;  1QVF 2;  3G0K A;  3JUO A;  1FUS A;  1FUT A;  1O7M B;  1D6Y A;  1JV2 B;  1JB5 A;  1NB3 I;  1STD A;  2XSO B;  3DGY A;  3EF8 A;  3ER7 A;  4HKV B;  2F98 A;  1NWW A;  1RRH A;  1W5Z A;  3CCL 3;  4KT3 B;  4BL3 A;  5EQL A;  3NM2 A;  1J2B A;  4CJN A;  1I3F A;  2E2U A;  1DMQ A;  1GMQ A;  1KQS 2;  3L0R A;  3CPO A;  3NX0 A;  3ROB A;  1WNH A;  1LVN A;  2HOH A;  2C10 A;  1B3S A;  3OWU A;  3RGR A;  1TRQ A;  4LEH A;  4HM0 B;  3WDG B;  2CWU A;  3BB9 A;  3AHW A;  1MWT A;  2E2V A;  2Q07 A;  3BU4 A;  3PS8 A;  4ILF A;  3HIG A;  4MJD A;  4RNY A;  5CF2 A;  1BSE A;  3UL5 A;  2IA7 A;  2A15 A;  1VQ7 3;  3NHX A;  4CCV A;  3PCR A;  5JBS A;  3CD6 3;  2XGL A;  2QEX 3;  4FCJ A;  3DGN A;  1YI2 3;  4HZB B;  3CCS 3;  2Y73 A;  2CFG A;  1RMS A;  2RFR A;  4XBY A;  1BRJ A;  1US1 A;  2FNQ A;  3G8Z A;  4EBG A;  1VQ6 3;  2Z76 A;  2HMJ B;  1X1X A;  1CYV A;  1A67 A;  4EXR A;  1RKY A;  4LSO A;  1RGH A;  1HYF A;  2RGQ A;  2Z77 A;  5AEW B;  1FGO A;  3LOY A;  4QWT A;  3UJM A;  4RBN A;  2SAR A;  1U8C B;  3Q3F A;  5G1L A;  2UUG C;  1BUJ A;  5IG5 A;  3FKA A;  2K54 A;  5HOH A;  1UI8 A;  5IF6 A;  1ZS7 A;  4HYZ A;  2UGI A;  5FGO A;  2L4V A;  2XFS A;  3WMD A;  2CKF B;  3F7X A;  2CC3 A;  3WOE B;  4AKY A;  1VQL 3;  5IG4 A;  2OTJ 3;  3DXO A;  4J8T A;  3VF1 A;  1QVG 2;  2ML6 A;  3S27 A;  3PZW A;  3CCM 3;  3KII A;  2WO0 A;  2OWP A;  3CNM A;  1Q86 4;  4HBR A;  1R4Y A;  1U5O A;  2OQE A;  1JBS A;  3LZA A;  4HVN A;  3CCV 3;  1DE3 A;  3B7C A;  2CFL A;  2OQE C;  4HAA A;  2OOV A;  1ASK A;  4I5Q A;  1W2Z A;  4N6U A;  2OOV C;  3UL6 A;  4GB5 A;  4X2O A;  3ZFZ A;  3X3Y A;  2RNT A;  4AKZ A;  1LNH A;  1GMP A;  3T8N A;  1FYS A;  4GSP A;  3SX1 A;  2QIY A;  5BIR A;  2SBL A;  3OW2 2;  2Z7A A;  4MMX B;  1YVS A;  3N9H A;  1VQM 3;  3ECF A;  3NV0 A;  3TDG A;  1I2G A;  5IW9 A;  1HU9 A;  3KE7 A;  1IT8 A;  1O7W B;  3MG2 A;  1RJO A;  5JPP A;  1BRN L;  1BGS A;  4FMD A;  1STF I;  2YFI B;  2BO9 B;  1B21 A;  2F56 A;  1GYB A;  1OHS A;  1BRS A;  4KFF A;  1I2E A;  6STD A;  3SED A;  1MWU A;  3FCS B;  4JRF A;  1K8A 4;  1B2U A;  1JN5 A;  1LOV A;  1A2P A;  3EN8 A;  3NXJ A;  4BTX A;  1OGZ A;  1T2H A;  5TGN A;  3ZG5 A;  1HZ1 A;  1S72 3;  3SLU A;  3K63 A;  3URP A;  3RNT A;  4TX4 A;  2XF3 A;  3EN1 B;  4K90 B;  1GY5 A;  3DMC A;  2BNG A;  1SPU A;  1G96 A;  1BNI A;  1BNG A;  4HZ9 B;  5G1K A;  5A0O B;  3PCS A;  2AAD A;  4R4K A;  4KZ1 A;  3IMA B;  2JQ5 A;  1W2B 2;  1VQ5 3;  1TUH A;  2ZDJ A;  1FA3 A;  1BRK A;  2YX9 A;  4L8P A;  4HM2 B;  1A90 A;  2B1X B;  1G0T A;  2W9Q A;  3NM7 A;  4K1U A;  1M9G A;  2AAE A;  4PEJ A;  4R80 A;  6RNT A;  1W6G A;  3X42 A;  2Y74 A;  4RZM A;  3CC4 3;  2WGO A;  5GSP A;  5ELU A;  3D4A A;  3SOA A;  1UDI I;  4N6V 0;  2BMQ B;  4GHO A;  4N6O B;  4AEQ A;  3RDE A;  2XRX B;  2CFW A;  1X1W A;  1RGL A;  2H0G A;  3EQQ B;  4JF8 A;  5HGR A;  1N8Q A;  2HML B;  1R4C A;  5BXQ A;  3DUK A;  4GL6 A;  3DGL A;  2MF7 A;  2IUJ A;  2F4Y A;  3AGN A;  1IV9 A;  5DRE A;  3AMO A;  4HM1 B;  1ROA A;  3DZL A;  3FGY A;  2XSH B;  3O8Y A;  2FXT A;  5AIG A;  3VSY A;  3V99 A;  1MNL A;  1W00 A;  3N54 B;  3HK4 A;  1FGR A;  3KCH A;  1UUW B;  1SIH A;  1IVV A;  3NBR A;  1AVL A;  1ULI B;  3X3X A;  1W02 A;  2CG1 A;  1RGK A;  4DKI A;  1FZU A;  4EYC A;  1UCL A;  3F9S A;  4IPB A;  2KF6 A;  1T3B A;  1IU7 A;  1DVC A;  1QJG A;  1KD1 4;  2RSX A;  1B2X A;  4KVH A;  2B24 B;  3X40 A;  4XDW A;  2W9P A;  1HKX A;  3K5T A;  2P0X A;  5D81 A;  3T8U A;  1N5H A;  1ULJ B;  3EC9 A;  1FGM A;  3LXU X;  1Z1S A;  1JN5 B;  4J9A A;  4FMA A;  5LC7 A;  2HMM B;  3NQZ A;  4ORL A;  1V58 A;  4K1V A;  3DY5 A;  2ZL8 A;  1EQK A;  4I4K A;  1N5P A;  1RHL A;  3LYG A;  2P09 A;  3JUN A;  1I3I A;  5STD A;  1MWS A;  1IVX A;  1X1Y A;  1E97 A;  4XB5 A;  3LTD A;  2D42 A;  3CCJ 3;  1BSB A;  3BNC A;  3EX9 A;  1RGE A;  1BAN A;  1SII A;  1A2V A;  1BSA A;  3KZT A;  3AGO A;  1W01 A;  1AR0 A;  4NPB A;  3CCE 3;  4BU4 A;  2STD A;  1QMA A;  3STD A;  3B4P A;  3D5I A;  3EHC A;  3LT8 A;  1WMP A;  4RNT A;  1UGH I;  3E99 A;  1I0V A;  3SOY A;  5EVH A;  4FMC A;  3CCR 3;  3CMA 3;  1UCK A;  2I9W A;  3MG1 A;  4NHF A;  8CHO A;  5CF1 A;  3FG4 A;  4U13 A;  1Q82 4;  2F99 A;  3F14 A;  2CH9 A;  1MGR A;  2GU1 A;  5DRV A;  3S28 A;  1PYL A;  3LT9 A;  1YJ9 3;  1O7G B;  2BIR A;  1VQN 3;  3BIR A;  1QAK A;  1RGG A;  5M1A A;  1BVI A;  3D79 A;  4H61 A;  5FW5 A;  1L5G B;  1ROV A;  1IT7 A;  2L1S A;  4N6N B;  3ZG0 A;  3FH1 A;  1OHO A;  1LOY A;  3AMO B;  3N8B A;  1RGC A;  5AYR B;  1C54 A;  3WA2 X;  2K3D A;  4HM7 B;  1GD3 A;  2WOF A;  5AEU B;  5IER A;  3LH4 A;  3FG1 A;  1YVB I;  1YJN 3;  5BVB A;  3MHE A;  5IG0 A;  3WOD G;  1KSI A;  2OTL 3;  3Q2P A;  1N8R 4;  3OWS A;  3Q1C A;  1JJ2 2;  1KC8 4;  1S5A A;  2H0I A;  1Y4K A;  1BNE A;  1D6U A;  1B2S A;  4L7K A;  3GSP A;  4CDL A;  3FSD A;  3B8L A;  1UCI A;  2IYJ A;  2KAA A;  2W0Q A;  3CCQ 3;  3ALA A;  1UUG B;  1GMR A;  4N6M A;  2BHM A;  5ELJ A;  4STD A;  1M1X B;  1IV7 A;  3MKI A;  1BOX A;  1I70 A;  1YGW A;  3BLZ A;  2INX A;  2KRT A;  1OAC A;  1NB5 I;  1UI7 A;  3D9R A;  5G2G A;  3G71 3;  2CIU A;  7RNT A;  1GOU A;  1QAF A;  3S67 A;  3G16 A;  1Q81 4;  2IY2 A;  2Z6B A;  4NRE A;  3FZW A;  2GEY A;  4H3U A;  4XDV A;  3A5E A;  2V1L A;  1DMN A;  1M90 4;  2GSP A;  1Q9E A;  4HM6 B;  2E2T A;  1WMO A;  3H3H A;  2H0H A;  3IPT A;  1VQO 3;  1K73 4;  3S5C A;  2JDI H;  4K61 A;  4CPK A;  1OF5 A;  2C11 A;  1NNV A;  3CXC 2;  5IEP A;  1TRP A;  1BNS A;  1OPY A;  4OUQ A;  3UNL A;  3I55 3;  1IQY A;  5CK6 A;  1VQK 3;  2RBI A;  3K9M C;  2W2C A;  1K9M 4;  1IYY A;  3F8H A;  4R9K A;  5BU4 A;  1BNR A;  1GD4 A;  1Q42 A;  5IEO A;  7STD A;  3I0Y A;  4WWU C;  3BNB A;  1X1U A;  4LZI A;  5JPU A;  1PFP A;  3EJV A;  2GXF A;  2HMN B;  3PXM A;  1BRH A;  1AQZ A;  1D6Z A;  1KWI A;  1JKG A;  1O7N B;  2GEX A;  2K0M A;  3A76 A;  3KKG A;  4FCZ A;  4HM4 B;  2GBW B;  2KXG A;  2YFJ B;  1N9E A;  4ZM8 A;  3CC2 3;  2KF5 A;  2F5M A;  3GZY B;  2O9U X;  5D83 A;  3WHO A;  3KN4 A;  3OX9 A;  2W56 A;  1ZX2 A;  3Q90 A;  5EEO A;  1IK3 A;  1EEJ A;  2O3O A;  5RNT A;  2KF3 A;  4BTW A;  2MC8 A;  1W6C A;  2LYX A;  4FMB A;  3SYU A;  9RNT A;  1ISK A;  1RN4 A;  1TFK A;  4FR9 A;  2IMJ A;  4LYL B;  2F86 B;  6GSP A;  5CLK A;  3RGA A;  3B4O A;  1LRA A;  2CK3 H;  1YJW 3;  2YFL B;  1LOX A;  3X3Z A;  1YIJ 3;  1GOY A;  2P05 A;  2XGN A;  4X2H A;  3I56 3;  1E3V A;  3NQY A;  1JBT A;  3S29 A;  4N6T A;  1GSP A;  2PNC A;  1I0X A;  1T2I A;  3AHS A;  3NBJ A;  2CX1 A;  3NV0 B;  1N9J A;  4O3V A;  1FUW A;  1WQL B;  3CME 3;  3K7C A;  1ZGX A;  3CNX A;  1CEW I;  1W7C A;  1BSD A;  2XEP A;  4RNZ A;  3DH2 A;  3G4S 3;  1M1K 4;  1VQ4 3;  2BMR B;  3JUM A;  5KP3 A;  4FCM A;  1RN1 A;  1JZD A;  1UW1 A;  3GZR A;  1BRG A;  3CPW 2;  2ZHX B;  1LOW A;  1GOV A;  1BSC A;  3SXX A;  3EB8 A;  3F7S A;  3LTA A;  4O02 B;  4WP5 A;  5IG3 A;  3K0Z A;  1JB4 A;  1MWR A;  5M19 A;  1AV4 A;  1BRI A;  1RSN A;  2BU4 A;  1CYU A;  1Q7Y 4;  1O7P B;  1UGI A;  4XBX A;  1NJI 4;  3MG3 A;  5I97 A;  1UUV B;  2CHC A;  2HMO B;  1K41 A;  1OF5 B;  2P38 A;  4BL2 A;  1EUI C;  4N6L A;  1BUQ A;  4J5G A;  1O7H B;  1TP6 A;  1B20 A;  1E3R A;  4EW5 A;  1VQP 3;  4XM4 A;  1Q40 A;  2R4I A;  1IDP A;  1IVU A;  3DGM A;  1JRQ A;  3D5G A;  2OCT A;  3MYT A;  1W6Y A;  2C4B A;  3OXA A;  3J7Y d;  4WHA A;  5AIH A;  3EBT A;  1JKG B;  1WTH A;  3JUQ A;  1EA2 A;  2ML5 A;  3PYJ A;  3HX8 A;  2ZA4 A;  4BIR A;  1FW7 A;  2RCD A;  4R9L A;  2CFK A;  2PZV A;  5M18 A;  1RNT A;  2W56 B;  3HI7 A;  1C7H A;  1IVW A;  1LXE A;  4J5K A;  5AI1 A;  1NO3 A;  3FLJ A;  1BU4 A;  1RGA A;  3F8X A;  4N3V A; 
#chains in the Genus database with same CATH homology
 1B3S A;  1PY3 A;  7RNT A;  1GOU A;  1TRQ A;  5GSP A;  3D4A A;  3AHW A;  3BU4 A;  4GHO A;  1BSE A;  1RGL A;  1X1W A;  3A5E A;  2GSP A;  1Q9E A;  1MGW A;  1G02 A;  1AY7 A;  2F4Y A;  3AGN A;  1RMS A;  1BRJ A;  1TRP A;  1BNS A;  3KCH A;  1X1X A;  1LNI A;  2RBI A;  1IYY A;  1BNR A;  5BU4 A;  1RGH A;  1BNF A;  7GSP A;  1HYF A;  1X1U A;  1RGK A;  1FZU A;  2SAR A;  3Q3F A;  1BRH A;  1AQZ A;  1BAO A;  1UCL A;  8RNT A;  2KF6 A;  1RDS A;  1BUJ A;  1RLS A;  1TTO A;  5HOH A;  1RGF A;  1B2X A;  4HOH A;  1DET A;  1RTU A;  2KF5 A;  2F5M A;  3WHO A;  5RNT A;  2KF3 A;  3SYU A;  9RNT A;  1RN4 A;  3HOH A;  1RCK A;  1R4Y A;  6GSP A;  1JBS A;  1DE3 A;  1RHL A;  1LRA A;  1CH0 A;  1I3I A;  1X1Y A;  4HAA A;  1GOY A;  1BSB A;  2F5W A;  2KF4 A;  1B27 A;  1RGE A;  1BAN A;  1JBT A;  1GSP A;  1I0X A;  1BSA A;  1T2I A;  3AHS A;  2RNT A;  3AGO A;  1YNV X;  1GMP A;  1B2M A;  1FYS A;  4BU4 A;  1ZGX A;  4GSP A;  1UCJ A;  1BSD A;  3D5I A;  3DH2 A;  4RNT A;  1B2Z A;  5BIR A;  1BIR A;  1I0V A;  1UCK A;  1RN1 A;  1I8V A;  1YVS A;  1BRG A;  1I2G A;  1LOW A;  1GOV A;  1MGR A;  1BSC A;  1PYL A;  1JBR A;  2BIR A;  1BNJ A;  3BIR A;  1RGG A;  1BVI A;  1BRN L;  1BGS A;  1SAR A;  1B21 A;  2F56 A;  1RNB A;  1BRS A;  1BRI A;  1RSN A;  1I2E A;  2BU4 A;  1LOY A;  1RGC A;  1C54 A;  1I2F A;  1B2U A;  1LOV A;  1A2P A;  1T2H A;  4J5G A;  1HZ1 A;  1B20 A;  1RCL A;  3WR2 A;  3URP A;  3RNT A;  1FUS A;  1FUT A;  3D5G A;  3DGY A;  2C4B A;  1BNI A;  1BNG A;  1BNE A;  2AAD A;  1B2S A;  2ZA4 A;  4BIR A;  3GSP A;  1FW7 A;  1UCI A;  2KAA A;  1RNT A;  1GMR A;  1I3F A;  1BRK A;  1GMQ A;  4J5K A;  1BOX A;  1I70 A;  1YGW A;  2AAE A;  6RNT A;  1BU4 A;  1RGA A;  2HOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...